F301476

General Info

Members Datasets Scaffolds Average Seq Length
196 116 186 109

Family's Representative Sequence

Representative Sequence 3300009094|Ga0111539_10631088|Ga0111539_106310882
Length 120
Sequence MSNRFKPKFNIKKGDQVIVISGEAKPRKDDNGKTVFKPKKVLKVLPEDERIIIEGVNMVTKHTKPSARNTKGGIIKKEAPIHISNVMLWDAKVSAPTKIKRTREDGKLVRIAKKSGEVIK

Samples

Sample ID Description Type Environment
1 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2738541283 Pedobacter sp. OK701 Isolate Unclassified
4 2738541284 Pedobacter sp. YR016 Isolate Unclassified
5 2738543023 Pedobacter sp. OK628 Isolate Unclassified
6 2739367663 Pedobacter sp. YR510 Isolate Unclassified
7 2775506987 Pedobacter ginsengisoli T01R-27 Isolate Unclassified
8 2852627209 Pedobacter sp. AK017 Isolate Rhizosphere
9 2857627736 Pedobacter sp. R-74587 Isolate Unclassified
10 2902048731 Pedobacter ureilyticus THG-T11 Isolate Rhizosphere
11 2919186247 Pedobacter africanus 2697 Isolate Rhizosphere
12 2939664404 Pedobacter africanus 2990 Isolate Rhizosphere
13 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
14 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
15 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
16 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
17 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
18 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
19 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
20 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
21 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
24 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
25 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
26 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
27 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
28 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
29 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
30 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
31 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
32 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
33 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
34 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
35 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
36 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
37 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
38 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
39 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
40 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
41 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
42 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
43 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
44 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
45 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
50 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
51 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
52 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
53 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
54 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
55 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
56 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
57 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
58 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
59 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
60 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
61 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
62 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
63 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
64 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
65 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
66 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
67 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
68 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
69 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
70 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
71 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
72 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
73 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
74 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
75 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
76 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
77 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
78 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
79 3300041444 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaT Metatranscriptome Rhizoplane
80 3300041445 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaT Metatranscriptome Rhizoplane
81 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
82 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
83 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
84 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
85 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
86 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
87 3300041506 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaT Metatranscriptome Unclassified
88 3300041508 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaT Metatranscriptome Unclassified
89 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
90 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
91 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
92 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
93 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
94 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
95 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
96 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
97 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
98 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
99 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
100 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
101 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
102 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
103 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
104 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
105 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
106 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
107 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
108 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
109 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
110 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
111 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
112 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
113 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
114 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
115 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
116 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 82.65
Metatranscriptomes 12.24
Isolates 5.1

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.12
Nodule 0
Rhizoplane 7.14
Rhizosphere 72.45
Stem 0
Stem Tuber 0
Unclassified 14.29

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS2a_Contig_9474 2124908027 Bacteria 2174
2 SwRhRL2b_contig_444786 2162886007 Bacteria 976
3 ARcpr5oldR_c006109 3300000041 Bacteria 1031
4 JGI25152J39213_1000006 3300002773 Bacteria 158516
5 JGI25153J46596_10026579 3300003215 Bacteria 2045
6 Ga0032354_1073026 3300003693 Bacteria 1910
7 Ga0065714_10004649 3300005288 Bacteria 5772
8 Ga0065714_10016516 3300005288 Bacteria 2777
9 Ga0065714_10177349 3300005288 Bacteria 960
10 Ga0065714_10314439 3300005288 Bacteria 677
11 Ga0065704_10003329 3300005289 Bacteria 4146
12 Ga0065704_10043001 3300005289 Bacteria 737
13 Ga0065704_10103418 3300005289 Bacteria 2157
14 Ga0065704_10319373 3300005289 Bacteria 855
15 Ga0065712_10491295 3300005290 Bacteria 656
16 Ga0065712_10510247 3300005290 Bacteria 643
17 Ga0065707_10153294 3300005295 Bacteria 1635
18 Ga0070682_100833171 3300005337 Bacteria 752
19 Ga0070667_100285431 3300005367 Bacteria 1483
20 Ga0070667_101009587 3300005367 Unclassified 776
21 Ga0070698_100036969 3300005471 Bacteria 5037
22 Ga0070693_100584102 3300005547 Bacteria 804
23 Ga0068863_100828641 3300005841 Bacteria 923
24 Ga0081539_10102399 3300005985 Bacteria 1457
25 Ga0070716_101561708 3300006173 Bacteria 541
26 Ga0075370_10124587 3300006353 Bacteria 1501
27 Ga0111539_10631088 3300009094 Bacteria 1248
28 Ga0105242_11697553 3300009176 Bacteria 668
29 Ga0105237_10002553 3300009545 Bacteria 22488
30 Ga0105239_12894207 3300010375 Bacteria 560
31 Ga0157373_10021916 3300013100 Bacteria 4636
32 Ga0157373_10040447 3300013100 Bacteria 3336
33 Ga0157373_10350352 3300013100 Bacteria 1053
34 Ga0157373_11200604 3300013100 Bacteria 572
35 Ga0157371_10024491 3300013102 Bacteria 4407
36 Ga0157371_10055390 3300013102 Bacteria 2814
37 Ga0157371_10114758 3300013102 Bacteria 1913
38 Ga0157370_10072569 3300013104 Bacteria 3247
39 Ga0157370_10631967 3300013104 Bacteria 979
40 Ga0157370_10644655 3300013104 Bacteria 968
41 Ga0157369_10060060 3300013105 Bacteria 4100
42 Ga0157378_12055162 3300013297 Bacteria 622
43 Ga0157375_10037032 3300013308 Bacteria 4671
44 Ga0157375_10066260 3300013308 Bacteria 3604
45 Ga0163163_10396542 3300014325 Bacteria 1438
46 Ga0157380_11072390 3300014326 Bacteria 843
47 Ga0182008_10000034 3300014497 Bacteria 138235
48 Ga0182008_10003643 3300014497 Bacteria 9192
49 Ga0182006_1000103 3300015261 Bacteria 93638
50 Ga0182006_1032965 3300015261 Bacteria 2079
51 Ga0182006_1038079 3300015261 Bacteria 1903
52 Ga0163161_10273279 3300017792 Bacteria 1323
53 Ga0163161_10456940 3300017792 Bacteria 1033
54 Ga0163161_10490516 3300017792 Bacteria 999
55 Ga0213872_10002389 3300021361 Bacteria 11095
56 Ga0207671_10005849 3300025914 Bacteria 11173
57 Ga0207650_10428052 3300025925 Bacteria 1099
58 Ga0207691_11763096 3300025940 Bacteria 500
59 Ga0207658_10948402 3300025986 Unclassified 784
60 Ga0307515_10007084 3300028794 Bacteria 22272
61 Ga0316181_1287987 3300030744 Bacteria 3662
62 Ga0265328_10068131 3300031239 Bacteria 1307
63 Ga0265331_10002092 3300031250 Bacteria 13775
64 Ga0316575_10126011 3300031665 Bacteria 1049
65 Ga0316579_10153087 3300031691 Bacteria 1113
66 Ga0265342_10082046 3300031712 Bacteria 1861
67 Ga0316576_10001081 3300031727 Bacteria 14158
68 Ga0316576_10001965 3300031727 Bacteria 11485
69 Ga0316576_10269946 3300031727 Bacteria 1275
70 Ga0316578_10009003 3300031728 Bacteria 5110
71 Ga0316578_10172214 3300031728 Bacteria 1305
72 Ga0316578_10191968 3300031728 Bacteria 1230
73 Ga0316578_10520301 3300031728 Bacteria 700
74 Ga0316578_10679633 3300031728 Bacteria 600
75 Ga0307405_11376246 3300031731 Bacteria 616
76 Ga0316577_10008426 3300031733 Bacteria 5526
77 Ga0307413_11539328 3300031824 Bacteria 589
78 Ga0307412_10010373 3300031911 Bacteria 5363
79 Ga0307412_10593078 3300031911 Bacteria 937
80 Ga0307412_12294630 3300031911 Bacteria 503
81 Ga0307414_10009044 3300032004 Bacteria 5699
82 Ga0307414_10025882 3300032004 Bacteria 3766
83 Ga0307414_10056348 3300032004 Bacteria 2756
84 Ga0307414_10183993 3300032004 Bacteria 1683
85 Ga0307411_10536101 3300032005 Bacteria 996
86 Ga0316585_10002058 3300032137 Bacteria 5395
87 Ga0316585_10055577 3300032137 Bacteria 1274
88 Ga0316580_10061015 3300032139 Bacteria 1158
89 Ga0316580_10174313 3300032139 Bacteria 661
90 Ga0316593_10000201 3300032168 Bacteria 9314
91 Ga0316593_10023936 3300032168 Bacteria 1932
92 Ga0316593_10034814 3300032168 Bacteria 1654
93 Ga0316593_10091142 3300032168 Bacteria 1073
94 Ga0316593_10117470 3300032168 Unclassified 953
95 Ga0316593_10186341 3300032168 Bacteria 764
96 Ga0316592_1028925 3300033524 Bacteria 1202
97 Ga0316592_1029156 3300033524 Bacteria 1197
98 Ga0316592_1145515 3300033524 Bacteria 558
99 Ga0316588_1000386 3300033528 Bacteria 5801
100 Ga0316588_1039055 3300033528 Bacteria 1132
101 Ga0316596_1001043 3300033541 Bacteria 5368
102 Ga0316596_1016886 3300033541 Bacteria 1830
103 Ga0316596_1025532 3300033541 Bacteria 1520
104 Ga0316596_1031502 3300033541 Bacteria 1377
105 Ga0316596_1058733 3300033541 Bacteria 1024
106 Ga0316596_1088332 3300033541 Bacteria 835
107 Ga0316596_1124826 3300033541 Bacteria 701
108 Ga0373952_0010894 3300035092 Bacteria 1765
109 Ga0316574_0065061 3300035398 Bacteria 2295
110 Ga0316574_0116099 3300035398 Bacteria 1717
111 Ga0316574_0136060 3300035398 Bacteria 1582
112 Ga0316574_0735619 3300035398 Bacteria 603
113 Ga0316574_0899530 3300035398 Unclassified 536
114 Ga0373931_0420819 3300035691 Bacteria 849
115 Ga0316582_0022702 3300036647 Bacteria 3729
116 Ga0316582_0179690 3300036647 Bacteria 1439
117 Ga0316582_0406085 3300036647 Bacteria 938
118 Ga0316582_0941243 3300036647 Bacteria 590
119 Ga0316584_0015050 3300036712 Bacteria 5526
120 Ga0316584_0020181 3300036712 Bacteria 4827
121 Ga0316584_0037517 3300036712 Bacteria 3601
122 Ga0395901_0018865 3300038443 Bacteria 7051
123 Ga0400489_64897 3300039093 Bacteria 1094
124 Ga0436361_0069195 3300039447 Unclassified 542
125 Ga0436361_0407713 3300039447 Bacteria 104420
126 Ga0451787_079997 3300041441 Bacteria 709
127 Ga0451790_09522 3300041444 Bacteria 747
128 Ga0451792_10578 3300041445 Bacteria 540
129 Ga0451791_0559924 3300041451 Bacteria 645
130 Ga0451793_1119074 3300041452 Bacteria 596
131 Ga0451795_0255989 3300041456 Bacteria 606
132 Ga0451795_0304275 3300041456 Bacteria 1472
133 Ga0451795_0305167 3300041456 Bacteria 1075
134 Ga0451795_0855695 3300041456 Bacteria 909
135 Ga0451795_0941981 3300041456 Bacteria 693
136 Ga0451795_1028677 3300041456 Bacteria 991
137 Ga0451798_0875130 3300041458 Bacteria 604
138 Ga0451837_0039977 3300041494 Bacteria 729
139 Ga0451841_0428835 3300041498 Bacteria 537
140 Ga0451850_00076 3300041506 Bacteria 850
141 Ga0451852_08922 3300041508 Bacteria 571
142 Ga0451843_1251536 3300041509 Bacteria 1321
143 Ga0451855_0334591 3300041511 Bacteria 2044
144 Ga0451855_0470294 3300041511 Bacteria 1024
145 Ga0451855_0968480 3300041511 Bacteria 859
146 Ga0451855_1886358 3300041511 Unclassified 1155
147 Ga0451577_0124402 3300042876 Bacteria 2311
148 Ga0451577_0159725 3300042876 Bacteria 2029
149 Ga0451577_1656704 3300042876 Bacteria 563
150 Ga0451577_2037012 3300042876 Bacteria 501
151 Ga0453683_0293979 3300044673 Bacteria 1038
152 Ga0453684_0012498 3300044712 Bacteria 13983
153 Ga0453684_0014056 3300044712 Bacteria 12880
154 Ga0453684_0032398 3300044712 Bacteria 7316
155 Ga0453684_0048058 3300044712 Bacteria 5649
156 Ga0453684_0055204 3300044712 Bacteria 5166
157 Ga0453684_0980864 3300044712 Bacteria 900
158 Ga0453684_1026756 3300044712 Bacteria 875
159 Ga0451576_0262799 3300045051 Bacteria 1804
160 Ga0451576_2215454 3300045051 Bacteria 564
161 Ga0495607_0215687 3300046501 Bacteria 942
162 Ga0495609_0009823 3300046538 Bacteria 4615
163 Ga0496114_0299048 3300048917 Bacteria 1421
164 Ga0496115_0024014 3300048918 Bacteria 4736
165 Ga0496116_0003301 3300048919 Bacteria 16049
166 Ga0496116_0323491 3300048919 Bacteria 721
167 Ga0496119_0098735 3300048922 Bacteria 1644
168 Ga0496121_0783769 3300048924 Bacteria 562
169 Ga0496122_0000140 3300048925 Bacteria 169037
170 Ga0496122_0000862 3300048925 Bacteria 57049
171 Ga0496123_0007798 3300048926 Bacteria 9971
172 Ga0496123_0029231 3300048926 Bacteria 4064
173 Ga0496125_0179773 3300048928 Bacteria 1411
174 Ga0496125_0244937 3300048928 Bacteria 1135
175 Ga0496126_0002082 3300048929 Bacteria 28029
176 Ga0501241_011069 3300049758 Bacteria 1638
177 nmdc:mga0k408_11918_c1 3300050493 Bacteria 4743
178 nmdc:mga07m45_391769_c1 3300050496 Bacteria 806
179 Ga0500651_0000078 3300053093 Bacteria 62741
180 Ga0500608_000222 3300053122 Bacteria 22331
181 Ga0500652_012079 3300053131 Bacteria 3016
182 Ga0500559_0011392 3300053136 Bacteria 3799
183 Ga0500573_0214726 3300053140 Bacteria 1013
184 Ga0500577_0201459 3300053142 Bacteria 859
185 Ga0500601_016273 3300053737 Bacteria 848
186 Ga0587079_002637 3300059647 Bacteria 2230

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041508 Ga0451852_08922 Ga0451852_08922_226_543 84
2 3300045051 Ga0451576_2215454 Ga0451576_2215454_41_319 91
3 3300041456 Ga0451795_1028677 Ga0451795_1028677_56_379 92
4 3300031728 Ga0316578_10679633 Ga0316578_106796332 95
5 3300032139 Ga0316580_10061015 Ga0316580_100610153 95
6 3300033541 Ga0316596_1124826 Ga0316596_11248262 95
7 3300035398 Ga0316574_0899530 Ga0316574_0899530_237_524 95
8 3300048919 Ga0496116_0323491 Ga0496116_0323491_181_492 100
9 3300048922 Ga0496119_0098735 Ga0496119_0098735_1066_1377 100
10 2162886007 SwRhRL2b_contig_444786 SwRhRL2b_0456.00005650 101
11 3300005289 Ga0065704_10103418 Ga0065704_101034185 101
12 3300041456 Ga0451795_0304275 Ga0451795_0304275_740_1045 101
13 3300041456 Ga0451795_0305167 Ga0451795_0305167_189_494 101
14 3300048919 Ga0496116_0003301 Ga0496116_0003301_14922_15239 101
15 3300048925 Ga0496122_0000140 Ga0496122_0000140_95542_95859 101
16 3300048926 Ga0496123_0007798 Ga0496123_0007798_2086_2403 101
17 3300048928 Ga0496125_0244937 Ga0496125_0244937_188_505 101
18 3300048929 Ga0496126_0002082 Ga0496126_0002082_10991_11308 101
19 3300039447 Ga0436361_0407713 Ga0436361_0407713_78076_78384 102
20 3300041511 Ga0451855_0334591 Ga0451855_0334591_1217_1528 102
21 3300003215 JGI25153J46596_10026579 JGI25153J46596_100265792 103
22 3300003693 Ga0032354_1073026 Ga0032354_10730261 103
23 3300006353 Ga0075370_10124587 Ga0075370_101245874 103
24 3300035691 Ga0373931_0420819 Ga0373931_0420819_403_717 103
25 3300039447 Ga0436361_0069195 Ga0436361_0069195_91_402 103
26 3300041451 Ga0451791_0559924 Ga0451791_0559924_133_447 103
27 3300041498 Ga0451841_0428835 Ga0451841_0428835_150_464 103
28 3300041511 Ga0451855_0470294 Ga0451855_0470294_376_690 103
29 3300041511 Ga0451855_0968480 Ga0451855_0968480_268_582 103
30 3300048924 Ga0496121_0783769 Ga0496121_0783769_182_496 103
31 3300050493 nmdc:mga0k408_11918_c1 nmdc:mga0k408_11918_c1_1843_2157 103
32 3300050496 nmdc:mga07m45_391769_c1 nmdc:mga07m45_391769_c1_417_731 103
33 3300053122 Ga0500608_000222 Ga0500608_000222_19185_19499 103
34 3300053136 Ga0500559_0011392 Ga0500559_0011392_2417_2731 103
35 3300041441 Ga0451787_079997 Ga0451787_079997_105_422 104
36 3300041511 Ga0451855_1886358 Ga0451855_1886358_402_719 104
37 3300005367 Ga0070667_101009587 Ga0070667_1010095872 105
38 3300021361 Ga0213872_10002389 Ga0213872_1000238910 105
39 3300025986 Ga0207658_10948402 Ga0207658_109484022 105
40 3300031239 Ga0265328_10068131 Ga0265328_100681312 105
41 3300031250 Ga0265331_10002092 Ga0265331_1000209217 105
42 3300032168 Ga0316593_10000201 Ga0316593_100002016 105
43 3300032168 Ga0316593_10091142 Ga0316593_100911422 105
44 3300033524 Ga0316592_1029156 Ga0316592_10291563 105
45 3300053131 Ga0500652_012079 Ga0500652_012079_1630_1950 105
46 3300053737 Ga0500601_016273 Ga0500601_016273_95_415 105
47 3300031712 Ga0265342_10082046 Ga0265342_100820464 106
48 3300031727 Ga0316576_10001081 Ga0316576_1000108114 106
49 3300031727 Ga0316576_10001965 Ga0316576_1000196517 106
50 3300031727 Ga0316576_10269946 Ga0316576_102699464 106
51 3300031728 Ga0316578_10009003 Ga0316578_100090032 106
52 3300031728 Ga0316578_10520301 Ga0316578_105203011 106
53 3300032137 Ga0316585_10055577 Ga0316585_100555774 106
54 3300032168 Ga0316593_10117470 Ga0316593_101174702 106
55 3300033524 Ga0316592_1028925 Ga0316592_10289252 106
56 3300033524 Ga0316592_1145515 Ga0316592_11455152 106
57 3300033528 Ga0316588_1000386 Ga0316588_10003865 106
58 3300033528 Ga0316588_1039055 Ga0316588_10390552 106
59 3300033541 Ga0316596_1001043 Ga0316596_10010436 106
60 3300033541 Ga0316596_1031502 Ga0316596_10315023 106
61 3300033541 Ga0316596_1058733 Ga0316596_10587332 106
62 3300033541 Ga0316596_1088332 Ga0316596_10883322 106
63 3300035398 Ga0316574_0065061 Ga0316574_0065061_1286_1609 106
64 3300036647 Ga0316582_0022702 Ga0316582_0022702_517_840 106
65 3300036647 Ga0316582_0406085 Ga0316582_0406085_27_350 106
66 3300036712 Ga0316584_0020181 Ga0316584_0020181_1799_2122 106
67 3300036712 Ga0316584_0037517 Ga0316584_0037517_1998_2321 106
68 3300041456 Ga0451795_0255989 Ga0451795_0255989_122_445 106
69 3300041456 Ga0451795_0855695 Ga0451795_0855695_220_543 106
70 3300042876 Ga0451577_0124402 Ga0451577_0124402_1012_1335 106
71 3300042876 Ga0451577_0159725 Ga0451577_0159725_411_734 106
72 3300042876 Ga0451577_1656704 Ga0451577_1656704_30_353 106
73 3300042876 Ga0451577_2037012 Ga0451577_2037012_91_414 106
74 3300044673 Ga0453683_0293979 Ga0453683_0293979_698_1021 106
75 3300044712 Ga0453684_0012498 Ga0453684_0012498_7658_7981 106
76 3300044712 Ga0453684_0014056 Ga0453684_0014056_7156_7479 106
77 3300044712 Ga0453684_0032398 Ga0453684_0032398_5372_5695 106
78 3300044712 Ga0453684_0048058 Ga0453684_0048058_4082_4405 106
79 3300044712 Ga0453684_0055204 Ga0453684_0055204_4787_5110 106
80 3300044712 Ga0453684_0980864 Ga0453684_0980864_57_380 106
81 3300044712 Ga0453684_1026756 Ga0453684_1026756_136_459 106
82 3300045051 Ga0451576_0262799 Ga0451576_0262799_269_592 106
83 3300005471 Ga0070698_100036969 Ga0070698_1000369697 108
84 3300013297 Ga0157378_12055162 Ga0157378_120551621 108
85 3300025925 Ga0207650_10428052 Ga0207650_104280522 108
86 iso_pu_bacteria 2738541283 2738755678 108
87 iso_pu_bacteria 2738541284 2738762105 108
88 iso_pu_bacteria 2738543023 2739301915 108
89 iso_pu_bacteria 2739367663 2739646671 108
90 iso_pu_bacteria 2775506987 2776615269 108
91 iso_pu_bacteria 2852627209 2852629112 108
92 iso_pu_bacteria 2857627736 2857631650 108
93 iso_pu_bacteria 2902048731 2902051189 108
94 iso_pu_bacteria 2919186247 2919189070 108
95 iso_pu_bacteria 2939664404 2939666775 108
96 3300005985 Ga0081539_10102399 Ga0081539_101023993 109
97 3300009094 Ga0111539_10631088 Ga0111539_106310882 109
98 3300041509 Ga0451843_1251536 Ga0451843_1251536_445_774 109
99 3300000041 ARcpr5oldR_c006109 ARcpr5oldR_0061092 110
100 3300005289 Ga0065704_10319373 Ga0065704_103193732 110
101 3300005290 Ga0065712_10491295 Ga0065712_104912951 110
102 3300005290 Ga0065712_10510247 Ga0065712_105102472 110
103 3300005295 Ga0065707_10153294 Ga0065707_101532942 110
104 3300005337 Ga0070682_100833171 Ga0070682_1008331712 110
105 3300005367 Ga0070667_100285431 Ga0070667_1002854311 110
106 3300005547 Ga0070693_100584102 Ga0070693_1005841022 110
107 3300005841 Ga0068863_100828641 Ga0068863_1008286412 110
108 3300006173 Ga0070716_101561708 Ga0070716_1015617081 110
109 3300013308 Ga0157375_10037032 Ga0157375_100370329 110
110 3300014325 Ga0163163_10396542 Ga0163163_103965422 110
111 3300014326 Ga0157380_11072390 Ga0157380_110723902 110
112 3300025940 Ga0207691_11763096 Ga0207691_117630961 110
113 3300031665 Ga0316575_10126011 Ga0316575_101260112 110
114 3300031691 Ga0316579_10153087 Ga0316579_101530872 110
115 3300031728 Ga0316578_10172214 Ga0316578_101722142 110
116 3300031728 Ga0316578_10191968 Ga0316578_101919683 110
117 3300031733 Ga0316577_10008426 Ga0316577_100084269 110
118 3300032137 Ga0316585_10002058 Ga0316585_100020589 110
119 3300032139 Ga0316580_10174313 Ga0316580_101743132 110
120 3300032168 Ga0316593_10023936 Ga0316593_100239365 110
121 3300032168 Ga0316593_10034814 Ga0316593_100348144 110
122 3300032168 Ga0316593_10186341 Ga0316593_101863412 110
123 3300033541 Ga0316596_1016886 Ga0316596_10168865 110
124 3300033541 Ga0316596_1025532 Ga0316596_10255324 110
125 3300035092 Ga0373952_0010894 Ga0373952_0010894_562_903 110
126 3300035398 Ga0316574_0116099 Ga0316574_0116099_579_914 110
127 3300035398 Ga0316574_0136060 Ga0316574_0136060_1186_1521 110
128 3300035398 Ga0316574_0735619 Ga0316574_0735619_119_454 110
129 3300036647 Ga0316582_0179690 Ga0316582_0179690_221_556 110
130 3300036647 Ga0316582_0941243 Ga0316582_0941243_234_569 110
131 3300036712 Ga0316584_0015050 Ga0316584_0015050_4131_4466 110
132 3300039093 Ga0400489_64897 Ga0400489_64897_121_456 110
133 3300059647 Ga0587079_002637 Ga0587079_002637_1321_1656 110
134 3300013102 Ga0157371_10114758 Ga0157371_101147583 111
135 2124908027 MRS2a_Contig_9474 MRS2a_00359450 112
136 3300002773 JGI25152J39213_1000006 JGI25152J39213_100000634 112
137 3300005288 Ga0065714_10004649 Ga0065714_100046496 112
138 3300005288 Ga0065714_10016516 Ga0065714_100165165 112
139 3300005288 Ga0065714_10177349 Ga0065714_101773492 112
140 3300005288 Ga0065714_10314439 Ga0065714_103144392 112
141 3300005289 Ga0065704_10003329 Ga0065704_100033295 112
142 3300005289 Ga0065704_10043001 Ga0065704_100430012 112
143 3300009176 Ga0105242_11697553 Ga0105242_116975531 112
144 3300009545 Ga0105237_10002553 Ga0105237_1000255322 112
145 3300010375 Ga0105239_12894207 Ga0105239_128942072 112
146 3300013100 Ga0157373_10021916 Ga0157373_100219165 112
147 3300013100 Ga0157373_10040447 Ga0157373_100404475 112
148 3300013100 Ga0157373_10350352 Ga0157373_103503522 112
149 3300013100 Ga0157373_11200604 Ga0157373_112006041 112
150 3300013102 Ga0157371_10024491 Ga0157371_100244919 112
151 3300013102 Ga0157371_10055390 Ga0157371_100553903 112
152 3300013104 Ga0157370_10072569 Ga0157370_100725693 112
153 3300013104 Ga0157370_10631967 Ga0157370_106319673 112
154 3300013104 Ga0157370_10644655 Ga0157370_106446551 112
155 3300013105 Ga0157369_10060060 Ga0157369_100600606 112
156 3300013308 Ga0157375_10066260 Ga0157375_100662606 112
157 3300014497 Ga0182008_10000034 Ga0182008_100000343 112
158 3300014497 Ga0182008_10003643 Ga0182008_100036432 112
159 3300015261 Ga0182006_1000103 Ga0182006_100010386 112
160 3300015261 Ga0182006_1032965 Ga0182006_10329652 112
161 3300015261 Ga0182006_1038079 Ga0182006_10380792 112
162 3300017792 Ga0163161_10273279 Ga0163161_102732793 112
163 3300017792 Ga0163161_10456940 Ga0163161_104569402 112
164 3300017792 Ga0163161_10490516 Ga0163161_104905162 112
165 3300025914 Ga0207671_10005849 Ga0207671_100058496 112
166 3300028794 Ga0307515_10007084 Ga0307515_1000708417 112
167 3300030744 Ga0316181_1287987 Ga0316181_12879877 112
168 3300031731 Ga0307405_11376246 Ga0307405_113762462 112
169 3300031824 Ga0307413_11539328 Ga0307413_115393282 112
170 3300031911 Ga0307412_10010373 Ga0307412_100103736 112
171 3300031911 Ga0307412_10593078 Ga0307412_105930782 112
172 3300031911 Ga0307412_12294630 Ga0307412_122946302 112
173 3300032004 Ga0307414_10009044 Ga0307414_100090447 112
174 3300032004 Ga0307414_10025882 Ga0307414_100258827 112
175 3300032004 Ga0307414_10056348 Ga0307414_100563486 112
176 3300032004 Ga0307414_10183993 Ga0307414_101839932 112
177 3300032005 Ga0307411_10536101 Ga0307411_105361012 112
178 3300038443 Ga0395901_0018865 Ga0395901_0018865_3439_3780 112
179 3300041444 Ga0451790_09522 Ga0451790_09522_397_735 112
180 3300041445 Ga0451792_10578 Ga0451792_10578_112_450 112
181 3300041452 Ga0451793_1119074 Ga0451793_1119074_21_365 112
182 3300041456 Ga0451795_0941981 Ga0451795_0941981_240_584 112
183 3300041458 Ga0451798_0875130 Ga0451798_0875130_100_441 112
184 3300041494 Ga0451837_0039977 Ga0451837_0039977_112_453 112
185 3300041506 Ga0451850_00076 Ga0451850_00076_215_556 112
186 3300046501 Ga0495607_0215687 Ga0495607_0215687_101_442 112
187 3300046538 Ga0495609_0009823 Ga0495609_0009823_3991_4332 112
188 3300048917 Ga0496114_0299048 Ga0496114_0299048_872_1213 112
189 3300048918 Ga0496115_0024014 Ga0496115_0024014_1995_2333 112
190 3300048925 Ga0496122_0000862 Ga0496122_0000862_33000_33341 112
191 3300048926 Ga0496123_0029231 Ga0496123_0029231_595_936 112
192 3300048928 Ga0496125_0179773 Ga0496125_0179773_526_867 112
193 3300049758 Ga0501241_011069 Ga0501241_011069_636_974 112
194 3300053093 Ga0500651_0000078 Ga0500651_0000078_22986_23324 112
195 3300053140 Ga0500573_0214726 Ga0500573_0214726_200_538 112
196 3300053142 Ga0500577_0201459 Ga0500577_0201459_455_796 112

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF17136

ribosomal_L24

Ribosomal proteins 50S L24/mitochondrial 39S L24

56

119

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
6gsk-assembly2.cif.gz_C5 structure of t. thermophilus 70s ribosome complex with mrna, trnafmet and near-cognate trnathr in the a-site 0.9388 8 80
6gsk-assembly2.cif.gz_C5 structure of t. thermophilus 70s ribosome complex with mrna, trnafmet and near-cognate trnathr in the a-site 0.922 8 80
6wru-assembly1.cif.gz_G structure of the 50s subunit of the ribosome from methicillin resistant staphylococcus aureus in complex with an isomer of the tedizolid 0.8997 12 111
7ttu-assembly1.cif.gz_G 50s ribosomal subunit from staphylococcus aureus (strain atcc43300) 0.8853 12 111
6wru-assembly1.cif.gz_G structure of the 50s subunit of the ribosome from methicillin resistant staphylococcus aureus in complex with an isomer of the tedizolid 0.8813 12 111
ID Description Score Start End Superfamily
af_Q2FW17_1_100_2.30.30.30 Mainly Beta;Roll;SH3 type barrels.; 0.928 10 110 2.30.30.30
af_Q2FW17_1_100_2.30.30.30 Mainly Beta;Roll;SH3 type barrels.; 0.9193 10 110 2.30.30.30
af_P9WHB7_1_104_2.30.30.30 Mainly Beta;Roll;SH3 type barrels.; 0.8729 10 110 2.30.30.30
af_Q8I5H8_47_152_2.30.30.30 Mainly Beta;Roll;SH3 type barrels.; 0.8696 12 109 2.30.30.30
af_Q653V9_69_173_2.30.30.30 Mainly Beta;Roll;SH3 type barrels.; 0.8683 6 109 2.30.30.30
ID Description Score Start End GO Terms
AF-A0A6C2UJY2-F1-model_v4 Large ribosomal subunit protein uL24 0.956 12 79 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-Q04G74-F1-model_v4 Large ribosomal subunit protein uL24 (50S ribosomal protein L24) 0.9517 10 89 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A5N4Q8-F1-model_v4 Large ribosomal subunit protein uL24 (50S ribosomal protein L24) 0.9432 9 111 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A7C5K593-F1-model_v4 Large ribosomal subunit protein uL24 0.9391 9 79 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A3M1IRI7-F1-model_v4 Large ribosomal subunit protein uL24 0.933 11 79 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904

Feature Viewer

pLDDT pTM Quality
88.49 0.71 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map