F301114
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 196 | 123 | 392 | 347 |
Family's Representative Sequence
| Representative Sequence | 3300005355|Ga0070671_100007257|Ga0070671_1000072578 |
| Length | 358 |
| Sequence | MGFKVAVVGATGNVGREILTTLAERNFPADDVIALASSRSIGSQVSFGEDDVLDIQGLDSFDFRGVDIVLSSPGSKVSAVFAPKAAKAGAVVIDNTSQFRMDPDVPLVVPEVNPQAIAGYTKRGIIANPNCSTIQMVVALKPLHDIGGIKRVVVATYQSVSGAGRAVMDELFSQTRSIYVNDAIKPELLTKQIAFNVIPHIDVFMEDGATKEEWKMAVETRKILDPDIAVTATCVRVPVFIGHAEAVNVEFHKPVNEERARAALRDAPGVVVVDHRADEGYVTPAEAAGEDAVYVSRLRRDPTVPHGLSFWCVADNLRKGAALNAVQIAEIVAGQYLSNKRPATRSNVERLRPRTAAE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 2 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 3 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 5 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 7 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 9 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 10 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 11 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 12 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 14 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 15 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 16 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 17 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 20 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 21 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 22 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 23 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 24 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 25 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 26 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 27 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 28 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 29 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 30 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 31 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 32 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 33 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 34 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 35 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 36 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 37 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 38 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 39 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 40 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 41 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 42 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 43 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 44 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 45 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 46 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 47 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 49 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 50 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 51 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 52 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 53 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 54 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 55 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 56 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 57 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 58 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 59 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 60 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 61 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 62 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 63 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 64 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 65 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 66 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 67 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 68 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 69 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 70 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 71 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 72 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 73 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 74 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 75 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 76 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 77 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 78 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 79 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 80 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 81 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 82 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 83 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 84 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 85 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 86 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 87 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 88 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 89 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 90 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 91 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 92 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 93 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 94 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 95 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 96 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 97 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 98 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 99 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 100 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 101 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 102 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 103 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 104 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 105 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 106 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 107 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 108 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 109 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 110 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 111 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 112 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 113 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 114 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 115 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 117 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 118 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 119 | 2842775625 | Roseomonas sp. R-71825 | Isolate | Unclassified |
| 120 | 2883577096 | Roseococcus sp. SYP-B2431 | Isolate | Rhizosphere |
| 121 | 2894772417 | Roseomonas oryzicola KCTC 22478 | Isolate | Rhizosphere |
| 122 | 2929199973 | Roseomonas sp. R-73070 Hybrid assembly | Isolate | Unclassified |
| 123 | 8055909800 | Plastoroseomonas hellenica LMG 31523 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.43 |
| Metatranscriptomes | 1.02 |
| Isolates | 2.55 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.53 |
| Nodule | 0 |
| Rhizoplane | 2.04 |
| Rhizosphere | 85.2 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070671_100007257 | 3300005355 | Bacteria | 8857 |
| 2 | rootL2_10044157 | 3300003322 | Bacteria | 3897 |
| 3 | Ga0070666_10115707 | 3300005335 | Bacteria | 1857 |
| 4 | Ga0070680_100033112 | 3300005336 | Bacteria | 4163 |
| 5 | Ga0070675_100102466 | 3300005354 | Bacteria | 2412 |
| 6 | Ga0070710_10031827 | 3300005437 | Bacteria | 2851 |
| 7 | Ga0070711_100034647 | 3300005439 | Bacteria | 3369 |
| 8 | Ga0070711_100043138 | 3300005439 | Bacteria | 3053 |
| 9 | Ga0070711_100168402 | 3300005439 | Bacteria | 1668 |
| 10 | Ga0070681_10008021 | 3300005458 | Bacteria | 10338 |
| 11 | Ga0070681_10031388 | 3300005458 | Bacteria | 5334 |
| 12 | Ga0070706_100073666 | 3300005467 | Bacteria | 3161 |
| 13 | Ga0070707_100009818 | 3300005468 | Bacteria | 8903 |
| 14 | Ga0070707_100243527 | 3300005468 | Bacteria | 1750 |
| 15 | Ga0070698_100007638 | 3300005471 | Bacteria | 11701 |
| 16 | Ga0070699_100015040 | 3300005518 | Bacteria | 6650 |
| 17 | Ga0070679_100015409 | 3300005530 | Bacteria | 7347 |
| 18 | Ga0070697_100040022 | 3300005536 | Bacteria | 3791 |
| 19 | Ga0070697_100102842 | 3300005536 | Bacteria | 2374 |
| 20 | Ga0068856_100329430 | 3300005614 | Bacteria | 1544 |
| 21 | Ga0081540_1002922 | 3300005983 | Bacteria | 13759 |
| 22 | Ga0070717_10000126 | 3300006028 | Bacteria | 56422 |
| 23 | Ga0070717_10062019 | 3300006028 | Bacteria | 3100 |
| 24 | Ga0070712_100005432 | 3300006175 | Bacteria | 7889 |
| 25 | Ga0070712_100022954 | 3300006175 | Bacteria | 4114 |
| 26 | Ga0070712_100139061 | 3300006175 | Bacteria | 1850 |
| 27 | Ga0070712_100156511 | 3300006175 | Bacteria | 1755 |
| 28 | Ga0075436_100098065 | 3300006914 | Bacteria | 2039 |
| 29 | Ga0075435_100206433 | 3300007076 | Bacteria | 1665 |
| 30 | Ga0111539_10353712 | 3300009094 | Bacteria | 1710 |
| 31 | Ga0157369_10200470 | 3300013105 | Bacteria | 2095 |
| 32 | Ga0157375_10360139 | 3300013308 | Bacteria | 1621 |
| 33 | Ga0206356_11817175 | 3300020070 | Bacteria | 1154 |
| 34 | Ga0206352_10351977 | 3300020078 | Bacteria | 2562 |
| 35 | Ga0213873_10010712 | 3300021358 | Bacteria | 1940 |
| 36 | Ga0213872_10000116 | 3300021361 | Bacteria | 74192 |
| 37 | Ga0213872_10000623 | 3300021361 | Bacteria | 26829 |
| 38 | Ga0213872_10007023 | 3300021361 | Bacteria | 5580 |
| 39 | Ga0213872_10013983 | 3300021361 | Bacteria | 3752 |
| 40 | Ga0213872_10085114 | 3300021361 | Bacteria | 1417 |
| 41 | Ga0213875_10002855 | 3300021388 | Bacteria | 10121 |
| 42 | Ga0213875_10004511 | 3300021388 | Bacteria | 7624 |
| 43 | Ga0213875_10041476 | 3300021388 | Bacteria | 2166 |
| 44 | Ga0213875_10080957 | 3300021388 | Bacteria | 1515 |
| 45 | Ga0209148_1000408 | 3300025254 | Bacteria | 49722 |
| 46 | Ga0209455_1000225 | 3300025272 | Bacteria | 76514 |
| 47 | Ga0207680_10045933 | 3300025903 | Bacteria | 2579 |
| 48 | Ga0207699_10124571 | 3300025906 | Bacteria | 1671 |
| 49 | Ga0207684_10037893 | 3300025910 | Bacteria | 4091 |
| 50 | Ga0207707_10035209 | 3300025912 | Bacteria | 4378 |
| 51 | Ga0207707_10255795 | 3300025912 | Bacteria | 1520 |
| 52 | Ga0207693_10004636 | 3300025915 | Bacteria | 11599 |
| 53 | Ga0207693_10023275 | 3300025915 | Bacteria | 4919 |
| 54 | Ga0207693_10104188 | 3300025915 | Bacteria | 2225 |
| 55 | Ga0207693_10128426 | 3300025915 | Bacteria | 1993 |
| 56 | Ga0207663_10003741 | 3300025916 | Bacteria | 7499 |
| 57 | Ga0207663_10164090 | 3300025916 | Bacteria | 1572 |
| 58 | Ga0207660_10220116 | 3300025917 | Bacteria | 1490 |
| 59 | Ga0207652_10013607 | 3300025921 | Bacteria | 6579 |
| 60 | Ga0207646_10197670 | 3300025922 | Bacteria | 1816 |
| 61 | Ga0207659_10086857 | 3300025926 | Bacteria | 2327 |
| 62 | Ga0207700_10076409 | 3300025928 | Bacteria | 2599 |
| 63 | Ga0207644_10061043 | 3300025931 | Bacteria | 2729 |
| 64 | Ga0207665_10104469 | 3300025939 | Bacteria | 1983 |
| 65 | Ga0207661_10254605 | 3300025944 | Bacteria | 1562 |
| 66 | Ga0207651_10225494 | 3300025960 | Bacteria | 1518 |
| 67 | Ga0207702_10012290 | 3300026078 | Bacteria | 7127 |
| 68 | Ga0209179_1012182 | 3300027512 | Bacteria | 1540 |
| 69 | Ga0265338_10080724 | 3300028800 | Bacteria | 2732 |
| 70 | Ga0265327_10119102 | 3300031251 | Bacteria | 1253 |
| 71 | Ga0265316_10186654 | 3300031344 | Bacteria | 1542 |
| 72 | Ga0265313_10000004 | 3300031595 | Bacteria | 188027 |
| 73 | Ga0307414_10060562 | 3300032004 | Bacteria | 2678 |
| 74 | Ga0373926_0055813 | 3300035083 | Bacteria | 1432 |
| 75 | Ga0373926_0071170 | 3300035083 | Bacteria | 1278 |
| 76 | Ga0373934_0011578 | 3300035086 | Bacteria | 3317 |
| 77 | Ga0373944_0041222 | 3300035089 | Bacteria | 1428 |
| 78 | Ga0373954_0017689 | 3300035118 | Bacteria | 3203 |
| 79 | Ga0373954_0099592 | 3300035118 | Bacteria | 1401 |
| 80 | Ga0373956_0003392 | 3300035119 | Bacteria | 6418 |
| 81 | Ga0373956_0035808 | 3300035119 | Bacteria | 2190 |
| 82 | Ga0373946_0144353 | 3300035171 | Bacteria | 1106 |
| 83 | Ga0373955_0089927 | 3300035172 | Bacteria | 1748 |
| 84 | Ga0373955_0106073 | 3300035172 | Bacteria | 1619 |
| 85 | Ga0373931_0033350 | 3300035691 | Bacteria | 2668 |
| 86 | Ga0373935_0072933 | 3300035692 | Bacteria | 2217 |
| 87 | Ga0373935_0073835 | 3300035692 | Bacteria | 2204 |
| 88 | Ga0373935_0077102 | 3300035692 | Bacteria | 2160 |
| 89 | Ga0373935_0120277 | 3300035692 | Bacteria | 1754 |
| 90 | Ga0373927_0204554 | 3300035695 | Bacteria | 1296 |
| 91 | Ga0373933_0005495 | 3300035724 | Bacteria | 6905 |
| 92 | Ga0373933_0010051 | 3300035724 | Bacteria | 5180 |
| 93 | Ga0373937_0001240 | 3300036401 | Bacteria | 21456 |
| 94 | Ga0373937_0004440 | 3300036401 | Bacteria | 11923 |
| 95 | Ga0373937_0045286 | 3300036401 | Bacteria | 4020 |
| 96 | Ga0373937_0092382 | 3300036401 | Bacteria | 2805 |
| 97 | Ga0373925_0012610 | 3300037068 | Bacteria | 6123 |
| 98 | Ga0373925_0066703 | 3300037068 | Bacteria | 2713 |
| 99 | Ga0373925_0268786 | 3300037068 | Bacteria | 1371 |
| 100 | Ga0395900_0134849 | 3300037418 | Bacteria | 2529 |
| 101 | Ga0436364_0376522 | 3300037853 | Bacteria | 9802 |
| 102 | Ga0436364_0442853 | 3300037853 | Bacteria | 3891 |
| 103 | Ga0436364_0488318 | 3300037853 | Bacteria | 3578 |
| 104 | Ga0436364_0509304 | 3300037853 | Bacteria | 4813 |
| 105 | Ga0436364_0656092 | 3300037853 | Bacteria | 21926 |
| 106 | Ga0436364_1307074 | 3300037853 | Bacteria | 38313 |
| 107 | Ga0395901_0131226 | 3300038443 | Bacteria | 2633 |
| 108 | Ga0436365_0294183 | 3300039437 | Bacteria | 2192 |
| 109 | Ga0436365_0514100 | 3300039437 | Bacteria | 3715 |
| 110 | Ga0436365_0673618 | 3300039437 | Bacteria | 1799 |
| 111 | Ga0436365_1135016 | 3300039437 | Bacteria | 1540 |
| 112 | Ga0436365_1669401 | 3300039437 | Bacteria | 1960 |
| 113 | Ga0436360_0109567 | 3300039438 | Bacteria | 1395 |
| 114 | Ga0436360_0190001 | 3300039438 | Bacteria | 2199 |
| 115 | Ga0436360_0513180 | 3300039438 | Bacteria | 1885 |
| 116 | Ga0436360_0526834 | 3300039438 | Bacteria | 1931 |
| 117 | Ga0436360_0527857 | 3300039438 | Bacteria | 4747 |
| 118 | Ga0436360_1283069 | 3300039438 | Bacteria | 3381 |
| 119 | Ga0436361_0052254 | 3300039447 | Bacteria | 2963 |
| 120 | Ga0436361_0207681 | 3300039447 | Bacteria | 2684 |
| 121 | Ga0436361_0208480 | 3300039447 | Bacteria | 84635 |
| 122 | Ga0436361_0298499 | 3300039447 | Bacteria | 3240 |
| 123 | Ga0436361_0589721 | 3300039447 | Bacteria | 4974 |
| 124 | Ga0436361_0697019 | 3300039447 | Bacteria | 8464 |
| 125 | Ga0436361_0813147 | 3300039447 | Bacteria | 36211 |
| 126 | Ga0436361_0813801 | 3300039447 | Bacteria | 1219 |
| 127 | Ga0436363_0568502 | 3300039450 | Bacteria | 3073 |
| 128 | Ga0436363_0995237 | 3300039450 | Bacteria | 2473 |
| 129 | Ga0436362_0168182 | 3300039453 | Bacteria | 2784 |
| 130 | Ga0436362_0274543 | 3300039453 | Bacteria | 5191 |
| 131 | Ga0436362_0391293 | 3300039453 | Bacteria | 1172 |
| 132 | Ga0436362_0679890 | 3300039453 | Bacteria | 1274 |
| 133 | Ga0436362_0981287 | 3300039453 | Bacteria | 2734 |
| 134 | Ga0436362_1069424 | 3300039453 | Bacteria | 3782 |
| 135 | Ga0436362_1077878 | 3300039453 | Bacteria | 1609 |
| 136 | Ga0436362_1202504 | 3300039453 | Bacteria | 4237 |
| 137 | Ga0466966_0045978 | 3300044684 | Bacteria | 2789 |
| 138 | Ga0453684_0111746 | 3300044712 | Bacteria | 3318 |
| 139 | Ga0453684_0121386 | 3300044712 | Bacteria | 3154 |
| 140 | Ga0451576_0000030 | 3300045051 | Bacteria | 403352 |
| 141 | Ga0495592_0093002 | 3300046454 | Bacteria | 2160 |
| 142 | Ga0495651_0042885 | 3300046462 | Bacteria | 3511 |
| 143 | Ga0495664_0000939 | 3300046477 | Bacteria | 15034 |
| 144 | Ga0495608_0002429 | 3300046511 | Bacteria | 13400 |
| 145 | Ga0495628_0056105 | 3300046516 | Bacteria | 3102 |
| 146 | Ga0495640_0147816 | 3300046533 | Bacteria | 1511 |
| 147 | Ga0495587_0006105 | 3300046536 | Bacteria | 7862 |
| 148 | Ga0495645_0000788 | 3300046543 | Bacteria | 21703 |
| 149 | Ga0495667_0009534 | 3300046559 | Bacteria | 6581 |
| 150 | Ga0495635_0268252 | 3300046663 | Bacteria | 1148 |
| 151 | Ga0495599_0227551 | 3300046678 | Bacteria | 1139 |
| 152 | Ga0495623_0040273 | 3300046679 | Bacteria | 2984 |
| 153 | Ga0495646_0012253 | 3300046680 | Bacteria | 5452 |
| 154 | Ga0495604_0158577 | 3300047317 | Bacteria | 1600 |
| 155 | Ga0495680_0183790 | 3300047322 | Bacteria | 1507 |
| 156 | Ga0495675_0003102 | 3300047444 | Bacteria | 9980 |
| 157 | Ga0495684_0168781 | 3300047471 | Bacteria | 1629 |
| 158 | Ga0495602_0000640 | 3300048088 | Bacteria | 32699 |
| 159 | Ga0496104_0165599 | 3300048907 | Bacteria | 2120 |
| 160 | Ga0496108_0348088 | 3300048911 | Bacteria | 1293 |
| 161 | Ga0496112_0130381 | 3300048915 | Bacteria | 2485 |
| 162 | Ga0496113_0175418 | 3300048916 | Bacteria | 1698 |
| 163 | Ga0496119_0010864 | 3300048922 | Bacteria | 7610 |
| 164 | Ga0501032_0003311 | 3300049569 | Bacteria | 12389 |
| 165 | Ga0501032_0024833 | 3300049569 | Bacteria | 4134 |
| 166 | Ga0501033_0002436 | 3300049570 | Bacteria | 15810 |
| 167 | Ga0501033_0087326 | 3300049570 | Bacteria | 2283 |
| 168 | Ga0501033_0179535 | 3300049570 | Bacteria | 1518 |
| 169 | Ga0501037_0145825 | 3300049573 | Bacteria | 1693 |
| 170 | Ga0501038_0083147 | 3300049574 | Bacteria | 2695 |
| 171 | Ga0501043_0312528 | 3300049579 | Bacteria | 1199 |
| 172 | Ga0501043_0377092 | 3300049579 | Bacteria | 1074 |
| 173 | Ga0501047_0256855 | 3300049581 | Bacteria | 1595 |
| 174 | Ga0501069_0090335 | 3300049585 | Bacteria | 1732 |
| 175 | Ga0501070_0009973 | 3300049586 | Bacteria | 8032 |
| 176 | Ga0501070_0017995 | 3300049586 | Bacteria | 5929 |
| 177 | Ga0501070_0060623 | 3300049586 | Bacteria | 3136 |
| 178 | Ga0501073_0072413 | 3300049589 | Bacteria | 2400 |
| 179 | Ga0501074_0204188 | 3300049590 | Bacteria | 1408 |
| 180 | Ga0501080_0000117 | 3300049742 | Bacteria | 55452 |
| 181 | Ga0501083_0037544 | 3300049744 | Bacteria | 3299 |
| 182 | Ga0501035_0004289 | 3300049822 | Bacteria | 13541 |
| 183 | Ga0501035_0295488 | 3300049822 | Bacteria | 1366 |
| 184 | Ga0501044_0006875 | 3300049823 | Bacteria | 12528 |
| 185 | Ga0501044_0034214 | 3300049823 | Bacteria | 5331 |
| 186 | Ga0501044_0248564 | 3300049823 | Bacteria | 1720 |
| 187 | nmdc:mga08x19_62488_c1 | 3300050514 | Bacteria | 2415 |
| 188 | Ga0495601_0001965 | 3300053077 | Bacteria | 11496 |
| 189 | Ga0500642_0001113 | 3300053130 | Bacteria | 7699 |
| 190 | Ga0501082_0055652 | 3300060353 | Bacteria | 3407 |
| 191 | Ga0466962_0126498 | 3300061719 | Bacteria | 1234 |
| 192 | 2842776943 | 2842775625 | Bacteria | 5587290 |
| 193 | 2883579642 | 2883577096 | Bacteria | 4709178 |
| 194 | 2894773560 | 2894772417 | Bacteria | 5305674 |
| 195 | 2929205456 | 2929199973 | Bacteria | 7260745 |
| 196 | 8055914451 | 8055909800 | Bacteria | 7278581 |
| 197 | Ga0070671_100007257 | |||
| 198 | rootL2_10044157 | |||
| 199 | Ga0070666_10115707 | |||
| 200 | Ga0070680_100033112 | |||
| 201 | Ga0070675_100102466 | |||
| 202 | Ga0070710_10031827 | |||
| 203 | Ga0070711_100034647 | |||
| 204 | Ga0070711_100043138 | |||
| 205 | Ga0070711_100168402 | |||
| 206 | Ga0070681_10008021 | |||
| 207 | Ga0070681_10031388 | |||
| 208 | Ga0070706_100073666 | |||
| 209 | Ga0070707_100009818 | |||
| 210 | Ga0070707_100243527 | |||
| 211 | Ga0070698_100007638 | |||
| 212 | Ga0070699_100015040 | |||
| 213 | Ga0070679_100015409 | |||
| 214 | Ga0070697_100040022 | |||
| 215 | Ga0070697_100102842 | |||
| 216 | Ga0068856_100329430 | |||
| 217 | Ga0081540_1002922 | |||
| 218 | Ga0070717_10000126 | |||
| 219 | Ga0070717_10062019 | |||
| 220 | Ga0070712_100005432 | |||
| 221 | Ga0070712_100022954 | |||
| 222 | Ga0070712_100139061 | |||
| 223 | Ga0070712_100156511 | |||
| 224 | Ga0075436_100098065 | |||
| 225 | Ga0075435_100206433 | |||
| 226 | Ga0111539_10353712 | |||
| 227 | Ga0157369_10200470 | |||
| 228 | Ga0157375_10360139 | |||
| 229 | Ga0206356_11817175 | |||
| 230 | Ga0206352_10351977 | |||
| 231 | Ga0213873_10010712 | |||
| 232 | Ga0213872_10000116 | |||
| 233 | Ga0213872_10000623 | |||
| 234 | Ga0213872_10007023 | |||
| 235 | Ga0213872_10013983 | |||
| 236 | Ga0213872_10085114 | |||
| 237 | Ga0213875_10002855 | |||
| 238 | Ga0213875_10004511 | |||
| 239 | Ga0213875_10041476 | |||
| 240 | Ga0213875_10080957 | |||
| 241 | Ga0209148_1000408 | |||
| 242 | Ga0209455_1000225 | |||
| 243 | Ga0207680_10045933 | |||
| 244 | Ga0207699_10124571 | |||
| 245 | Ga0207684_10037893 | |||
| 246 | Ga0207707_10035209 | |||
| 247 | Ga0207707_10255795 | |||
| 248 | Ga0207693_10004636 | |||
| 249 | Ga0207693_10023275 | |||
| 250 | Ga0207693_10104188 | |||
| 251 | Ga0207693_10128426 | |||
| 252 | Ga0207663_10003741 | |||
| 253 | Ga0207663_10164090 | |||
| 254 | Ga0207660_10220116 | |||
| 255 | Ga0207652_10013607 | |||
| 256 | Ga0207646_10197670 | |||
| 257 | Ga0207659_10086857 | |||
| 258 | Ga0207700_10076409 | |||
| 259 | Ga0207644_10061043 | |||
| 260 | Ga0207665_10104469 | |||
| 261 | Ga0207661_10254605 | |||
| 262 | Ga0207651_10225494 | |||
| 263 | Ga0207702_10012290 | |||
| 264 | Ga0209179_1012182 | |||
| 265 | Ga0265338_10080724 | |||
| 266 | Ga0265327_10119102 | |||
| 267 | Ga0265316_10186654 | |||
| 268 | Ga0265313_10000004 | |||
| 269 | Ga0307414_10060562 | |||
| 270 | Ga0373926_0055813 | |||
| 271 | Ga0373926_0071170 | |||
| 272 | Ga0373934_0011578 | |||
| 273 | Ga0373944_0041222 | |||
| 274 | Ga0373954_0017689 | |||
| 275 | Ga0373954_0099592 | |||
| 276 | Ga0373956_0003392 | |||
| 277 | Ga0373956_0035808 | |||
| 278 | Ga0373946_0144353 | |||
| 279 | Ga0373955_0089927 | |||
| 280 | Ga0373955_0106073 | |||
| 281 | Ga0373931_0033350 | |||
| 282 | Ga0373935_0072933 | |||
| 283 | Ga0373935_0073835 | |||
| 284 | Ga0373935_0077102 | |||
| 285 | Ga0373935_0120277 | |||
| 286 | Ga0373927_0204554 | |||
| 287 | Ga0373933_0005495 | |||
| 288 | Ga0373933_0010051 | |||
| 289 | Ga0373937_0001240 | |||
| 290 | Ga0373937_0004440 | |||
| 291 | Ga0373937_0045286 | |||
| 292 | Ga0373937_0092382 | |||
| 293 | Ga0373925_0012610 | |||
| 294 | Ga0373925_0066703 | |||
| 295 | Ga0373925_0268786 | |||
| 296 | Ga0395900_0134849 | |||
| 297 | Ga0436364_0376522 | |||
| 298 | Ga0436364_0442853 | |||
| 299 | Ga0436364_0488318 | |||
| 300 | Ga0436364_0509304 | |||
| 301 | Ga0436364_0656092 | |||
| 302 | Ga0436364_1307074 | |||
| 303 | Ga0395901_0131226 | |||
| 304 | Ga0436365_0294183 | |||
| 305 | Ga0436365_0514100 | |||
| 306 | Ga0436365_0673618 | |||
| 307 | Ga0436365_1135016 | |||
| 308 | Ga0436365_1669401 | |||
| 309 | Ga0436360_0109567 | |||
| 310 | Ga0436360_0190001 | |||
| 311 | Ga0436360_0513180 | |||
| 312 | Ga0436360_0526834 | |||
| 313 | Ga0436360_0527857 | |||
| 314 | Ga0436360_1283069 | |||
| 315 | Ga0436361_0052254 | |||
| 316 | Ga0436361_0207681 | |||
| 317 | Ga0436361_0208480 | |||
| 318 | Ga0436361_0298499 | |||
| 319 | Ga0436361_0589721 | |||
| 320 | Ga0436361_0697019 | |||
| 321 | Ga0436361_0813147 | |||
| 322 | Ga0436361_0813801 | |||
| 323 | Ga0436363_0568502 | |||
| 324 | Ga0436363_0995237 | |||
| 325 | Ga0436362_0168182 | |||
| 326 | Ga0436362_0274543 | |||
| 327 | Ga0436362_0391293 | |||
| 328 | Ga0436362_0679890 | |||
| 329 | Ga0436362_0981287 | |||
| 330 | Ga0436362_1069424 | |||
| 331 | Ga0436362_1077878 | |||
| 332 | Ga0436362_1202504 | |||
| 333 | Ga0466966_0045978 | |||
| 334 | Ga0453684_0111746 | |||
| 335 | Ga0453684_0121386 | |||
| 336 | Ga0451576_0000030 | |||
| 337 | Ga0495592_0093002 | |||
| 338 | Ga0495651_0042885 | |||
| 339 | Ga0495664_0000939 | |||
| 340 | Ga0495608_0002429 | |||
| 341 | Ga0495628_0056105 | |||
| 342 | Ga0495640_0147816 | |||
| 343 | Ga0495587_0006105 | |||
| 344 | Ga0495645_0000788 | |||
| 345 | Ga0495667_0009534 | |||
| 346 | Ga0495635_0268252 | |||
| 347 | Ga0495599_0227551 | |||
| 348 | Ga0495623_0040273 | |||
| 349 | Ga0495646_0012253 | |||
| 350 | Ga0495604_0158577 | |||
| 351 | Ga0495680_0183790 | |||
| 352 | Ga0495675_0003102 | |||
| 353 | Ga0495684_0168781 | |||
| 354 | Ga0495602_0000640 | |||
| 355 | Ga0496104_0165599 | |||
| 356 | Ga0496108_0348088 | |||
| 357 | Ga0496112_0130381 | |||
| 358 | Ga0496113_0175418 | |||
| 359 | Ga0496119_0010864 | |||
| 360 | Ga0501032_0003311 | |||
| 361 | Ga0501032_0024833 | |||
| 362 | Ga0501033_0002436 | |||
| 363 | Ga0501033_0087326 | |||
| 364 | Ga0501033_0179535 | |||
| 365 | Ga0501037_0145825 | |||
| 366 | Ga0501038_0083147 | |||
| 367 | Ga0501043_0312528 | |||
| 368 | Ga0501043_0377092 | |||
| 369 | Ga0501047_0256855 | |||
| 370 | Ga0501069_0090335 | |||
| 371 | Ga0501070_0009973 | |||
| 372 | Ga0501070_0017995 | |||
| 373 | Ga0501070_0060623 | |||
| 374 | Ga0501073_0072413 | |||
| 375 | Ga0501074_0204188 | |||
| 376 | Ga0501080_0000117 | |||
| 377 | Ga0501083_0037544 | |||
| 378 | Ga0501035_0004289 | |||
| 379 | Ga0501035_0295488 | |||
| 380 | Ga0501044_0006875 | |||
| 381 | Ga0501044_0034214 | |||
| 382 | Ga0501044_0248564 | |||
| 383 | nmdc:mga08x19_62488_c1 | |||
| 384 | Ga0495601_0001965 | |||
| 385 | Ga0500642_0001113 | |||
| 386 | Ga0501082_0055652 | |||
| 387 | Ga0466962_0126498 | |||
| 388 | 2842776943 | |||
| 389 | 2883579642 | |||
| 390 | 2894773560 | |||
| 391 | 2929205456 | |||
| 392 | 8055914451 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6a6s-assembly1.cif.gz_A | crystal structure of the modified fructosyl peptide oxidase from aspergillus nidulans in complex with fsa, seleno-methionine derivative | 0.9317 | 5 | 40 |
| 4rsl-assembly1.cif.gz_A | structure of fructosyl peptide oxidase from e. terrenum | 0.9256 | 5 | 40 |
| 8blz-assembly1.cif.gz_C | engineered fructosyl peptide oxidase - d02 mutant | 0.9199 | 5 | 40 |
| 2qz9-assembly2.cif.gz_B-2 | crystal structure of aspartate semialdehyde dehydrogenase ii from vibrio cholerae | 0.8829 | 7 | 337 |
| 2r00-assembly1.cif.gz_A | crystal structure of aspartate semialdehyde dehydrogenase ii complexed with asa from vibrio cholerae | 0.8829 | 7 | 337 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P08390_5_140_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9124 | 7 | 139 | 3.40.50.720 |
| 3vosA01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9099 | 6 | 130 | 3.40.50.720 |
| af_P9WNX5_4_132_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9049 | 7 | 134 | 3.40.50.720 |
| 2gz3B01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.8919 | 6 | 130 | 3.40.50.720 |
| af_P9WNX5_4_132_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.8918 | 7 | 134 | 3.40.50.720 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4Q3TI48-F1-model_v4 | Aspartate-semialdehyde dehydrogenase | 0.9641 | 206 | 339 |
GO:0008652
GO:0016620 GO:0046983 |
| AF-A0A352MVB7-F1-model_v4 | Semialdehyde dehydrogenase dimerisation domain-containing protein | 0.964 | 219 | 337 |
GO:0008652
GO:0016620 GO:0046983 |
| AF-A0A645CPW7-F1-model_v4 | Aspartate-semialdehyde dehydrogenase (EC 1.2.1.11) | 0.9604 | 219 | 339 |
GO:0004073
GO:0008652 GO:0046983 |
| AF-A0A645FWB2-F1-model_v4 | Aspartate-semialdehyde dehydrogenase 2 (EC 1.2.1.11) | 0.9564 | 219 | 339 |
GO:0004073
GO:0008652 GO:0046983 |
| AF-A0A3L7WDM9-F1-model_v4 | Aspartate-semialdehyde dehydrogenase (EC 1.2.1.11) | 0.9561 | 204 | 339 |
GO:0004073
GO:0008652 GO:0046983 |