F301114

General Info

Members Datasets Scaffolds Average Seq Length
196 123 392 347

Family's Representative Sequence

Representative Sequence 3300005355|Ga0070671_100007257|Ga0070671_1000072578
Length 358
Sequence MGFKVAVVGATGNVGREILTTLAERNFPADDVIALASSRSIGSQVSFGEDDVLDIQGLDSFDFRGVDIVLSSPGSKVSAVFAPKAAKAGAVVIDNTSQFRMDPDVPLVVPEVNPQAIAGYTKRGIIANPNCSTIQMVVALKPLHDIGGIKRVVVATYQSVSGAGRAVMDELFSQTRSIYVNDAIKPELLTKQIAFNVIPHIDVFMEDGATKEEWKMAVETRKILDPDIAVTATCVRVPVFIGHAEAVNVEFHKPVNEERARAALRDAPGVVVVDHRADEGYVTPAEAAGEDAVYVSRLRRDPTVPHGLSFWCVADNLRKGAALNAVQIAEIVAGQYLSNKRPATRSNVERLRPRTAAE

Samples

Sample ID Description Type Environment
1 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
6 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
7 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
8 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
9 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
10 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
11 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
12 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
13 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
14 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
15 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
16 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
17 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
18 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
19 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
20 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
21 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
22 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
23 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
24 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
25 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
26 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
27 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
28 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
29 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
30 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
31 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
49 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
50 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
51 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
52 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
53 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
54 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
55 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
56 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
57 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
58 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
59 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
60 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
61 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
62 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
63 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
64 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
65 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
66 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
67 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
68 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
69 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
70 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
71 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
72 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
73 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
74 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
75 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
76 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
77 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
78 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
79 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
80 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
81 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
82 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
83 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
84 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
85 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
86 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
87 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
88 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
89 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
90 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
91 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
92 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
93 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
94 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
95 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
96 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
97 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
98 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
99 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
100 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
101 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
102 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
103 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
104 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
105 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
106 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
107 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
108 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
109 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
110 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
111 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
112 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
113 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
114 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
115 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
116 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
117 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
118 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
119 2842775625 Roseomonas sp. R-71825 Isolate Unclassified
120 2883577096 Roseococcus sp. SYP-B2431 Isolate Rhizosphere
121 2894772417 Roseomonas oryzicola KCTC 22478 Isolate Rhizosphere
122 2929199973 Roseomonas sp. R-73070 Hybrid assembly Isolate Unclassified
123 8055909800 Plastoroseomonas hellenica LMG 31523 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.43
Metatranscriptomes 1.02
Isolates 2.55

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.53
Nodule 0
Rhizoplane 2.04
Rhizosphere 85.2
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070671_100007257 3300005355 Bacteria 8857
2 rootL2_10044157 3300003322 Bacteria 3897
3 Ga0070666_10115707 3300005335 Bacteria 1857
4 Ga0070680_100033112 3300005336 Bacteria 4163
5 Ga0070675_100102466 3300005354 Bacteria 2412
6 Ga0070710_10031827 3300005437 Bacteria 2851
7 Ga0070711_100034647 3300005439 Bacteria 3369
8 Ga0070711_100043138 3300005439 Bacteria 3053
9 Ga0070711_100168402 3300005439 Bacteria 1668
10 Ga0070681_10008021 3300005458 Bacteria 10338
11 Ga0070681_10031388 3300005458 Bacteria 5334
12 Ga0070706_100073666 3300005467 Bacteria 3161
13 Ga0070707_100009818 3300005468 Bacteria 8903
14 Ga0070707_100243527 3300005468 Bacteria 1750
15 Ga0070698_100007638 3300005471 Bacteria 11701
16 Ga0070699_100015040 3300005518 Bacteria 6650
17 Ga0070679_100015409 3300005530 Bacteria 7347
18 Ga0070697_100040022 3300005536 Bacteria 3791
19 Ga0070697_100102842 3300005536 Bacteria 2374
20 Ga0068856_100329430 3300005614 Bacteria 1544
21 Ga0081540_1002922 3300005983 Bacteria 13759
22 Ga0070717_10000126 3300006028 Bacteria 56422
23 Ga0070717_10062019 3300006028 Bacteria 3100
24 Ga0070712_100005432 3300006175 Bacteria 7889
25 Ga0070712_100022954 3300006175 Bacteria 4114
26 Ga0070712_100139061 3300006175 Bacteria 1850
27 Ga0070712_100156511 3300006175 Bacteria 1755
28 Ga0075436_100098065 3300006914 Bacteria 2039
29 Ga0075435_100206433 3300007076 Bacteria 1665
30 Ga0111539_10353712 3300009094 Bacteria 1710
31 Ga0157369_10200470 3300013105 Bacteria 2095
32 Ga0157375_10360139 3300013308 Bacteria 1621
33 Ga0206356_11817175 3300020070 Bacteria 1154
34 Ga0206352_10351977 3300020078 Bacteria 2562
35 Ga0213873_10010712 3300021358 Bacteria 1940
36 Ga0213872_10000116 3300021361 Bacteria 74192
37 Ga0213872_10000623 3300021361 Bacteria 26829
38 Ga0213872_10007023 3300021361 Bacteria 5580
39 Ga0213872_10013983 3300021361 Bacteria 3752
40 Ga0213872_10085114 3300021361 Bacteria 1417
41 Ga0213875_10002855 3300021388 Bacteria 10121
42 Ga0213875_10004511 3300021388 Bacteria 7624
43 Ga0213875_10041476 3300021388 Bacteria 2166
44 Ga0213875_10080957 3300021388 Bacteria 1515
45 Ga0209148_1000408 3300025254 Bacteria 49722
46 Ga0209455_1000225 3300025272 Bacteria 76514
47 Ga0207680_10045933 3300025903 Bacteria 2579
48 Ga0207699_10124571 3300025906 Bacteria 1671
49 Ga0207684_10037893 3300025910 Bacteria 4091
50 Ga0207707_10035209 3300025912 Bacteria 4378
51 Ga0207707_10255795 3300025912 Bacteria 1520
52 Ga0207693_10004636 3300025915 Bacteria 11599
53 Ga0207693_10023275 3300025915 Bacteria 4919
54 Ga0207693_10104188 3300025915 Bacteria 2225
55 Ga0207693_10128426 3300025915 Bacteria 1993
56 Ga0207663_10003741 3300025916 Bacteria 7499
57 Ga0207663_10164090 3300025916 Bacteria 1572
58 Ga0207660_10220116 3300025917 Bacteria 1490
59 Ga0207652_10013607 3300025921 Bacteria 6579
60 Ga0207646_10197670 3300025922 Bacteria 1816
61 Ga0207659_10086857 3300025926 Bacteria 2327
62 Ga0207700_10076409 3300025928 Bacteria 2599
63 Ga0207644_10061043 3300025931 Bacteria 2729
64 Ga0207665_10104469 3300025939 Bacteria 1983
65 Ga0207661_10254605 3300025944 Bacteria 1562
66 Ga0207651_10225494 3300025960 Bacteria 1518
67 Ga0207702_10012290 3300026078 Bacteria 7127
68 Ga0209179_1012182 3300027512 Bacteria 1540
69 Ga0265338_10080724 3300028800 Bacteria 2732
70 Ga0265327_10119102 3300031251 Bacteria 1253
71 Ga0265316_10186654 3300031344 Bacteria 1542
72 Ga0265313_10000004 3300031595 Bacteria 188027
73 Ga0307414_10060562 3300032004 Bacteria 2678
74 Ga0373926_0055813 3300035083 Bacteria 1432
75 Ga0373926_0071170 3300035083 Bacteria 1278
76 Ga0373934_0011578 3300035086 Bacteria 3317
77 Ga0373944_0041222 3300035089 Bacteria 1428
78 Ga0373954_0017689 3300035118 Bacteria 3203
79 Ga0373954_0099592 3300035118 Bacteria 1401
80 Ga0373956_0003392 3300035119 Bacteria 6418
81 Ga0373956_0035808 3300035119 Bacteria 2190
82 Ga0373946_0144353 3300035171 Bacteria 1106
83 Ga0373955_0089927 3300035172 Bacteria 1748
84 Ga0373955_0106073 3300035172 Bacteria 1619
85 Ga0373931_0033350 3300035691 Bacteria 2668
86 Ga0373935_0072933 3300035692 Bacteria 2217
87 Ga0373935_0073835 3300035692 Bacteria 2204
88 Ga0373935_0077102 3300035692 Bacteria 2160
89 Ga0373935_0120277 3300035692 Bacteria 1754
90 Ga0373927_0204554 3300035695 Bacteria 1296
91 Ga0373933_0005495 3300035724 Bacteria 6905
92 Ga0373933_0010051 3300035724 Bacteria 5180
93 Ga0373937_0001240 3300036401 Bacteria 21456
94 Ga0373937_0004440 3300036401 Bacteria 11923
95 Ga0373937_0045286 3300036401 Bacteria 4020
96 Ga0373937_0092382 3300036401 Bacteria 2805
97 Ga0373925_0012610 3300037068 Bacteria 6123
98 Ga0373925_0066703 3300037068 Bacteria 2713
99 Ga0373925_0268786 3300037068 Bacteria 1371
100 Ga0395900_0134849 3300037418 Bacteria 2529
101 Ga0436364_0376522 3300037853 Bacteria 9802
102 Ga0436364_0442853 3300037853 Bacteria 3891
103 Ga0436364_0488318 3300037853 Bacteria 3578
104 Ga0436364_0509304 3300037853 Bacteria 4813
105 Ga0436364_0656092 3300037853 Bacteria 21926
106 Ga0436364_1307074 3300037853 Bacteria 38313
107 Ga0395901_0131226 3300038443 Bacteria 2633
108 Ga0436365_0294183 3300039437 Bacteria 2192
109 Ga0436365_0514100 3300039437 Bacteria 3715
110 Ga0436365_0673618 3300039437 Bacteria 1799
111 Ga0436365_1135016 3300039437 Bacteria 1540
112 Ga0436365_1669401 3300039437 Bacteria 1960
113 Ga0436360_0109567 3300039438 Bacteria 1395
114 Ga0436360_0190001 3300039438 Bacteria 2199
115 Ga0436360_0513180 3300039438 Bacteria 1885
116 Ga0436360_0526834 3300039438 Bacteria 1931
117 Ga0436360_0527857 3300039438 Bacteria 4747
118 Ga0436360_1283069 3300039438 Bacteria 3381
119 Ga0436361_0052254 3300039447 Bacteria 2963
120 Ga0436361_0207681 3300039447 Bacteria 2684
121 Ga0436361_0208480 3300039447 Bacteria 84635
122 Ga0436361_0298499 3300039447 Bacteria 3240
123 Ga0436361_0589721 3300039447 Bacteria 4974
124 Ga0436361_0697019 3300039447 Bacteria 8464
125 Ga0436361_0813147 3300039447 Bacteria 36211
126 Ga0436361_0813801 3300039447 Bacteria 1219
127 Ga0436363_0568502 3300039450 Bacteria 3073
128 Ga0436363_0995237 3300039450 Bacteria 2473
129 Ga0436362_0168182 3300039453 Bacteria 2784
130 Ga0436362_0274543 3300039453 Bacteria 5191
131 Ga0436362_0391293 3300039453 Bacteria 1172
132 Ga0436362_0679890 3300039453 Bacteria 1274
133 Ga0436362_0981287 3300039453 Bacteria 2734
134 Ga0436362_1069424 3300039453 Bacteria 3782
135 Ga0436362_1077878 3300039453 Bacteria 1609
136 Ga0436362_1202504 3300039453 Bacteria 4237
137 Ga0466966_0045978 3300044684 Bacteria 2789
138 Ga0453684_0111746 3300044712 Bacteria 3318
139 Ga0453684_0121386 3300044712 Bacteria 3154
140 Ga0451576_0000030 3300045051 Bacteria 403352
141 Ga0495592_0093002 3300046454 Bacteria 2160
142 Ga0495651_0042885 3300046462 Bacteria 3511
143 Ga0495664_0000939 3300046477 Bacteria 15034
144 Ga0495608_0002429 3300046511 Bacteria 13400
145 Ga0495628_0056105 3300046516 Bacteria 3102
146 Ga0495640_0147816 3300046533 Bacteria 1511
147 Ga0495587_0006105 3300046536 Bacteria 7862
148 Ga0495645_0000788 3300046543 Bacteria 21703
149 Ga0495667_0009534 3300046559 Bacteria 6581
150 Ga0495635_0268252 3300046663 Bacteria 1148
151 Ga0495599_0227551 3300046678 Bacteria 1139
152 Ga0495623_0040273 3300046679 Bacteria 2984
153 Ga0495646_0012253 3300046680 Bacteria 5452
154 Ga0495604_0158577 3300047317 Bacteria 1600
155 Ga0495680_0183790 3300047322 Bacteria 1507
156 Ga0495675_0003102 3300047444 Bacteria 9980
157 Ga0495684_0168781 3300047471 Bacteria 1629
158 Ga0495602_0000640 3300048088 Bacteria 32699
159 Ga0496104_0165599 3300048907 Bacteria 2120
160 Ga0496108_0348088 3300048911 Bacteria 1293
161 Ga0496112_0130381 3300048915 Bacteria 2485
162 Ga0496113_0175418 3300048916 Bacteria 1698
163 Ga0496119_0010864 3300048922 Bacteria 7610
164 Ga0501032_0003311 3300049569 Bacteria 12389
165 Ga0501032_0024833 3300049569 Bacteria 4134
166 Ga0501033_0002436 3300049570 Bacteria 15810
167 Ga0501033_0087326 3300049570 Bacteria 2283
168 Ga0501033_0179535 3300049570 Bacteria 1518
169 Ga0501037_0145825 3300049573 Bacteria 1693
170 Ga0501038_0083147 3300049574 Bacteria 2695
171 Ga0501043_0312528 3300049579 Bacteria 1199
172 Ga0501043_0377092 3300049579 Bacteria 1074
173 Ga0501047_0256855 3300049581 Bacteria 1595
174 Ga0501069_0090335 3300049585 Bacteria 1732
175 Ga0501070_0009973 3300049586 Bacteria 8032
176 Ga0501070_0017995 3300049586 Bacteria 5929
177 Ga0501070_0060623 3300049586 Bacteria 3136
178 Ga0501073_0072413 3300049589 Bacteria 2400
179 Ga0501074_0204188 3300049590 Bacteria 1408
180 Ga0501080_0000117 3300049742 Bacteria 55452
181 Ga0501083_0037544 3300049744 Bacteria 3299
182 Ga0501035_0004289 3300049822 Bacteria 13541
183 Ga0501035_0295488 3300049822 Bacteria 1366
184 Ga0501044_0006875 3300049823 Bacteria 12528
185 Ga0501044_0034214 3300049823 Bacteria 5331
186 Ga0501044_0248564 3300049823 Bacteria 1720
187 nmdc:mga08x19_62488_c1 3300050514 Bacteria 2415
188 Ga0495601_0001965 3300053077 Bacteria 11496
189 Ga0500642_0001113 3300053130 Bacteria 7699
190 Ga0501082_0055652 3300060353 Bacteria 3407
191 Ga0466962_0126498 3300061719 Bacteria 1234
192 2842776943 2842775625 Bacteria 5587290
193 2883579642 2883577096 Bacteria 4709178
194 2894773560 2894772417 Bacteria 5305674
195 2929205456 2929199973 Bacteria 7260745
196 8055914451 8055909800 Bacteria 7278581
197 Ga0070671_100007257
198 rootL2_10044157
199 Ga0070666_10115707
200 Ga0070680_100033112
201 Ga0070675_100102466
202 Ga0070710_10031827
203 Ga0070711_100034647
204 Ga0070711_100043138
205 Ga0070711_100168402
206 Ga0070681_10008021
207 Ga0070681_10031388
208 Ga0070706_100073666
209 Ga0070707_100009818
210 Ga0070707_100243527
211 Ga0070698_100007638
212 Ga0070699_100015040
213 Ga0070679_100015409
214 Ga0070697_100040022
215 Ga0070697_100102842
216 Ga0068856_100329430
217 Ga0081540_1002922
218 Ga0070717_10000126
219 Ga0070717_10062019
220 Ga0070712_100005432
221 Ga0070712_100022954
222 Ga0070712_100139061
223 Ga0070712_100156511
224 Ga0075436_100098065
225 Ga0075435_100206433
226 Ga0111539_10353712
227 Ga0157369_10200470
228 Ga0157375_10360139
229 Ga0206356_11817175
230 Ga0206352_10351977
231 Ga0213873_10010712
232 Ga0213872_10000116
233 Ga0213872_10000623
234 Ga0213872_10007023
235 Ga0213872_10013983
236 Ga0213872_10085114
237 Ga0213875_10002855
238 Ga0213875_10004511
239 Ga0213875_10041476
240 Ga0213875_10080957
241 Ga0209148_1000408
242 Ga0209455_1000225
243 Ga0207680_10045933
244 Ga0207699_10124571
245 Ga0207684_10037893
246 Ga0207707_10035209
247 Ga0207707_10255795
248 Ga0207693_10004636
249 Ga0207693_10023275
250 Ga0207693_10104188
251 Ga0207693_10128426
252 Ga0207663_10003741
253 Ga0207663_10164090
254 Ga0207660_10220116
255 Ga0207652_10013607
256 Ga0207646_10197670
257 Ga0207659_10086857
258 Ga0207700_10076409
259 Ga0207644_10061043
260 Ga0207665_10104469
261 Ga0207661_10254605
262 Ga0207651_10225494
263 Ga0207702_10012290
264 Ga0209179_1012182
265 Ga0265338_10080724
266 Ga0265327_10119102
267 Ga0265316_10186654
268 Ga0265313_10000004
269 Ga0307414_10060562
270 Ga0373926_0055813
271 Ga0373926_0071170
272 Ga0373934_0011578
273 Ga0373944_0041222
274 Ga0373954_0017689
275 Ga0373954_0099592
276 Ga0373956_0003392
277 Ga0373956_0035808
278 Ga0373946_0144353
279 Ga0373955_0089927
280 Ga0373955_0106073
281 Ga0373931_0033350
282 Ga0373935_0072933
283 Ga0373935_0073835
284 Ga0373935_0077102
285 Ga0373935_0120277
286 Ga0373927_0204554
287 Ga0373933_0005495
288 Ga0373933_0010051
289 Ga0373937_0001240
290 Ga0373937_0004440
291 Ga0373937_0045286
292 Ga0373937_0092382
293 Ga0373925_0012610
294 Ga0373925_0066703
295 Ga0373925_0268786
296 Ga0395900_0134849
297 Ga0436364_0376522
298 Ga0436364_0442853
299 Ga0436364_0488318
300 Ga0436364_0509304
301 Ga0436364_0656092
302 Ga0436364_1307074
303 Ga0395901_0131226
304 Ga0436365_0294183
305 Ga0436365_0514100
306 Ga0436365_0673618
307 Ga0436365_1135016
308 Ga0436365_1669401
309 Ga0436360_0109567
310 Ga0436360_0190001
311 Ga0436360_0513180
312 Ga0436360_0526834
313 Ga0436360_0527857
314 Ga0436360_1283069
315 Ga0436361_0052254
316 Ga0436361_0207681
317 Ga0436361_0208480
318 Ga0436361_0298499
319 Ga0436361_0589721
320 Ga0436361_0697019
321 Ga0436361_0813147
322 Ga0436361_0813801
323 Ga0436363_0568502
324 Ga0436363_0995237
325 Ga0436362_0168182
326 Ga0436362_0274543
327 Ga0436362_0391293
328 Ga0436362_0679890
329 Ga0436362_0981287
330 Ga0436362_1069424
331 Ga0436362_1077878
332 Ga0436362_1202504
333 Ga0466966_0045978
334 Ga0453684_0111746
335 Ga0453684_0121386
336 Ga0451576_0000030
337 Ga0495592_0093002
338 Ga0495651_0042885
339 Ga0495664_0000939
340 Ga0495608_0002429
341 Ga0495628_0056105
342 Ga0495640_0147816
343 Ga0495587_0006105
344 Ga0495645_0000788
345 Ga0495667_0009534
346 Ga0495635_0268252
347 Ga0495599_0227551
348 Ga0495623_0040273
349 Ga0495646_0012253
350 Ga0495604_0158577
351 Ga0495680_0183790
352 Ga0495675_0003102
353 Ga0495684_0168781
354 Ga0495602_0000640
355 Ga0496104_0165599
356 Ga0496108_0348088
357 Ga0496112_0130381
358 Ga0496113_0175418
359 Ga0496119_0010864
360 Ga0501032_0003311
361 Ga0501032_0024833
362 Ga0501033_0002436
363 Ga0501033_0087326
364 Ga0501033_0179535
365 Ga0501037_0145825
366 Ga0501038_0083147
367 Ga0501043_0312528
368 Ga0501043_0377092
369 Ga0501047_0256855
370 Ga0501069_0090335
371 Ga0501070_0009973
372 Ga0501070_0017995
373 Ga0501070_0060623
374 Ga0501073_0072413
375 Ga0501074_0204188
376 Ga0501080_0000117
377 Ga0501083_0037544
378 Ga0501035_0004289
379 Ga0501035_0295488
380 Ga0501044_0006875
381 Ga0501044_0034214
382 Ga0501044_0248564
383 nmdc:mga08x19_62488_c1
384 Ga0495601_0001965
385 Ga0500642_0001113
386 Ga0501082_0055652
387 Ga0466962_0126498
388 2842776943
389 2883579642
390 2894773560
391 2929205456
392 8055914451

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02774

Semialdhyde_dhC

Semialdehyde dehydrogenase, dimerisation domain

140

319

0.98

PF01118

Semialdhyde_dh

Semialdehyde dehydrogenase, NAD binding domain

4

120

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
6a6s-assembly1.cif.gz_A crystal structure of the modified fructosyl peptide oxidase from aspergillus nidulans in complex with fsa, seleno-methionine derivative 0.9317 5 40
4rsl-assembly1.cif.gz_A structure of fructosyl peptide oxidase from e. terrenum 0.9256 5 40
8blz-assembly1.cif.gz_C engineered fructosyl peptide oxidase - d02 mutant 0.9199 5 40
2qz9-assembly2.cif.gz_B-2 crystal structure of aspartate semialdehyde dehydrogenase ii from vibrio cholerae 0.8829 7 337
2r00-assembly1.cif.gz_A crystal structure of aspartate semialdehyde dehydrogenase ii complexed with asa from vibrio cholerae 0.8829 7 337
ID Description Score Start End Superfamily
af_P08390_5_140_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9124 7 139 3.40.50.720
3vosA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9099 6 130 3.40.50.720
af_P9WNX5_4_132_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9049 7 134 3.40.50.720
2gz3B01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8919 6 130 3.40.50.720
af_P9WNX5_4_132_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8918 7 134 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A4Q3TI48-F1-model_v4 Aspartate-semialdehyde dehydrogenase 0.9641 206 339 GO:0008652
GO:0016620
GO:0046983
AF-A0A352MVB7-F1-model_v4 Semialdehyde dehydrogenase dimerisation domain-containing protein 0.964 219 337 GO:0008652
GO:0016620
GO:0046983
AF-A0A645CPW7-F1-model_v4 Aspartate-semialdehyde dehydrogenase (EC 1.2.1.11) 0.9604 219 339 GO:0004073
GO:0008652
GO:0046983
AF-A0A645FWB2-F1-model_v4 Aspartate-semialdehyde dehydrogenase 2 (EC 1.2.1.11) 0.9564 219 339 GO:0004073
GO:0008652
GO:0046983
AF-A0A3L7WDM9-F1-model_v4 Aspartate-semialdehyde dehydrogenase (EC 1.2.1.11) 0.9561 204 339 GO:0004073
GO:0008652
GO:0046983

Map