F295885

General Info

Members Datasets Scaffolds Average Seq Length
192 155 188 139

Family's Representative Sequence

Representative Sequence 3300031901|Ga0307406_10273294|Ga0307406_102732942
Length 152
Sequence MLGGMSRAAAGLHRTIPALPVRDVRSAVAFYAERFGFGAPHVTDDFAVVVRDEAVLHLWGAVDEGWRERDQPDRRPVRSGAESFLAGTASCRIEVVDVDALFAELRAAGVLHHVSRGGVTETGFGTREFATLDQDGNLISFFRWNEAEQRAR

Samples

Sample ID Description Type Environment
1 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
2 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
3 2913844669 Nostocales cyanobacterium LEGE 12452 Isolate Unclassified
4 2958512119 Flavobacterium sp. Sd200 Isolate Rhizosphere
5 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
21 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
22 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
23 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
24 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
25 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
26 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
27 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
28 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
29 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
30 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
31 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
32 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
33 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
34 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
35 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
36 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
37 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
38 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
40 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
41 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
42 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
43 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
44 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
45 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
46 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
47 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
48 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
49 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
50 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
51 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
52 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
53 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
54 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
55 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
56 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
78 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
79 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
80 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
81 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
82 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
83 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
84 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
85 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
86 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
87 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
88 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
89 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
90 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
91 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
92 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
93 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
94 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
95 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
96 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
97 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
98 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
99 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
100 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
101 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
102 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
103 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
104 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
105 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
106 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
107 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
108 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
109 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
110 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
111 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
112 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
113 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
114 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
115 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
116 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
117 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
118 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
119 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
120 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
121 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
122 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
123 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
124 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
125 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
126 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
127 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
128 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
129 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
130 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
131 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
132 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
133 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
134 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
135 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
136 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
137 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
138 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
139 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
140 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
141 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
142 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
143 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
144 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
145 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
146 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
147 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
148 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
149 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
150 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
151 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
152 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
153 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
154 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
155 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.92
Metatranscriptomes 0
Isolates 2.08

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.69
Nodule 0
Rhizoplane 1.56
Rhizosphere 90.1
Stem 0
Stem Tuber 0
Unclassified 3.65

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10015865 3300003316 Bacteria 13791
2 rootH1_10076725 3300003316 Bacteria 3015
3 rootL2_10022832 3300003322 Bacteria 9571
4 JGI25407J50210_10002399 3300003373 Bacteria 4407
5 Ga0070658_10497022 3300005327 Bacteria 1053
6 Ga0068869_100049439 3300005334 Bacteria 3044
7 Ga0068869_100063475 3300005334 Bacteria 2714
8 Ga0070680_101525713 3300005336 Bacteria 579
9 Ga0068868_100108493 3300005338 Bacteria 2253
10 Ga0070692_10013243 3300005345 Bacteria 3841
11 Ga0070668_100211360 3300005347 Bacteria 1596
12 Ga0070669_101533631 3300005353 Bacteria 579
13 Ga0070675_101281690 3300005354 Unclassified 675
14 Ga0070673_101418377 3300005364 Bacteria 654
15 Ga0070659_100100082 3300005366 Bacteria 2332
16 Ga0070667_100149142 3300005367 Bacteria 2053
17 Ga0070700_100443254 3300005441 Bacteria 986
18 Ga0070663_100275242 3300005455 Bacteria 1340
19 Ga0068853_100976570 3300005539 Unclassified 815
20 Ga0068852_100276431 3300005616 Bacteria 1617
21 Ga0068859_100165947 3300005617 Bacteria 2288
22 Ga0068864_100748295 3300005618 Bacteria 958
23 Ga0068866_10049151 3300005718 Unclassified 2135
24 Ga0068861_100109588 3300005719 Bacteria 2210
25 Ga0068863_100030436 3300005841 Bacteria 5154
26 Ga0068863_100701184 3300005841 Bacteria 1006
27 Ga0068860_100043194 3300005843 Bacteria 4301
28 Ga0068860_100468986 3300005843 Bacteria 1254
29 Ga0068862_100009757 3300005844 Bacteria 7938
30 Ga0081455_10003746 3300005937 Bacteria 17377
31 Ga0081538_10000504 3300005981 Bacteria 43759
32 Ga0075365_10001174 3300006038 Bacteria 11504
33 Ga0075365_11005224 3300006038 Bacteria 588
34 Ga0075428_100006326 3300006844 Bacteria 13171
35 Ga0075430_101181963 3300006846 Bacteria 630
36 Ga0075433_10453950 3300006852 Bacteria 1130
37 Ga0075434_101850598 3300006871 Bacteria 610
38 Ga0068865_101852545 3300006881 Bacteria 546
39 Ga0097620_100165934 3300006931 Bacteria 2288
40 Ga0105240_10088160 3300009093 Bacteria 3798
41 Ga0105245_10099708 3300009098 Bacteria 2686
42 Ga0105243_10032583 3300009148 Bacteria 4028
43 Ga0105242_10349140 3300009176 Bacteria 1366
44 Ga0105242_11814884 3300009176 Unclassified 648
45 Ga0105237_10444648 3300009545 Bacteria 1302
46 Ga0105249_10103386 3300009553 Bacteria 2683
47 Ga0105249_10692969 3300009553 Bacteria 1078
48 Ga0105239_10136488 3300010375 Bacteria 2731
49 Ga0157371_10032620 3300013102 Bacteria 3747
50 Ga0157369_10258635 3300013105 Bacteria 1816
51 Ga0157369_11548340 3300013105 Unclassified 674
52 Ga0157374_10246210 3300013296 Bacteria 1758
53 Ga0163162_10124816 3300013306 Bacteria 2680
54 Ga0157372_10244296 3300013307 Bacteria 2083
55 Ga0157375_10393539 3300013308 Bacteria 1552
56 Ga0163163_10444099 3300014325 Bacteria 1357
57 Ga0157380_10471727 3300014326 Unclassified 1211
58 Ga0157377_10148665 3300014745 Bacteria 1446
59 Ga0157379_10002240 3300014968 Bacteria 16092
60 Ga0157379_10181207 3300014968 Bacteria 1903
61 Ga0207642_10447513 3300025899 Bacteria 782
62 Ga0207688_10034804 3300025901 Bacteria 2789
63 Ga0207695_10088617 3300025913 Bacteria 3114
64 Ga0207681_10347411 3300025923 Unclassified 1187
65 Ga0207687_10065742 3300025927 Bacteria 2576
66 Ga0207690_10284733 3300025932 Bacteria 1288
67 Ga0207686_10399397 3300025934 Bacteria 1047
68 Ga0207704_10483071 3300025938 Bacteria 995
69 Ga0207689_10097897 3300025942 Bacteria 2410
70 Ga0207689_10569225 3300025942 Bacteria 952
71 Ga0207712_10468854 3300025961 Bacteria 1071
72 Ga0207668_11309532 3300025972 Bacteria 652
73 Ga0207640_10071421 3300025981 Bacteria 2338
74 Ga0207658_10491258 3300025986 Bacteria 1092
75 Ga0207677_10434509 3300026023 Unclassified 1121
76 Ga0207641_10171882 3300026088 Bacteria 1979
77 Ga0207641_11265857 3300026088 Bacteria 738
78 Ga0207648_10229768 3300026089 Bacteria 1650
79 Ga0207676_10094132 3300026095 Bacteria 2468
80 Ga0207675_100051284 3300026118 Bacteria 3849
81 Ga0207698_10019026 3300026142 Bacteria 4691
82 Ga0268265_10018799 3300028380 Bacteria 4794
83 Ga0268265_10163751 3300028380 Bacteria 1893
84 Ga0268264_10235902 3300028381 Unclassified 1692
85 Ga0268264_10257296 3300028381 Bacteria 1624
86 Ga0307509_10325962 3300031507 Unclassified 1270
87 Ga0307405_10027498 3300031731 Unclassified 3299
88 Ga0307413_10737795 3300031824 Bacteria 822
89 Ga0307413_10827229 3300031824 Unclassified 780
90 Ga0307410_10070587 3300031852 Bacteria 2420
91 Ga0307410_10348247 3300031852 Bacteria 1183
92 Ga0326468_10037509 3300031889 Bacteria 676
93 Ga0307406_10120296 3300031901 Unclassified 1824
94 Ga0307406_10273294 3300031901 Bacteria 1285
95 Ga0307406_11476006 3300031901 Unclassified 598
96 Ga0307407_10113304 3300031903 Unclassified 1706
97 Ga0307407_10601834 3300031903 Bacteria 819
98 Ga0307409_100032250 3300031995 Unclassified 3795
99 Ga0307409_100878093 3300031995 Bacteria 909
100 Ga0307416_100121943 3300032002 Unclassified 2325
101 Ga0307414_10177819 3300032004 Bacteria 1708
102 Ga0307411_10109922 3300032005 Unclassified 1970
103 Ga0307415_100070787 3300032126 Unclassified 2450
104 Ga0307415_101077945 3300032126 Bacteria 751
105 Ga0373927_0257659 3300035695 Bacteria 1147
106 Ga0395899_0298317 3300037312 Bacteria 1091
107 Ga0395898_0436842 3300037466 Unclassified 1247
108 Ga0395901_0659706 3300038443 Bacteria 1048
109 Ga0439461_0112478 3300041410 Bacteria 673
110 Ga0451853_0579156 3300041512 Bacteria 1784
111 Ga0439432_231301 3300042006 Bacteria 532
112 Ga0439446_0058843 3300042156 Bacteria 1159
113 Ga0439434_0101680 3300042435 Bacteria 926
114 Ga0466961_0220177 3300044693 Bacteria 1170
115 Ga0466970_0073838 3300044765 Bacteria 1836
116 Ga0466957_1067504 3300044842 Bacteria 582
117 Ga0466959_1205994 3300045049 Bacteria 503
118 Ga0466958_0504874 3300045836 Bacteria 785
119 Ga0466967_1166981 3300045976 Unclassified 767
120 Ga0495643_0096888 3300046522 Bacteria 1516
121 Ga0495611_0093728 3300046648 Bacteria 1389
122 Ga0496102_1211951 3300048905 Unclassified 674
123 Ga0496106_0374378 3300048909 Bacteria 1144
124 Ga0496113_0658564 3300048916 Bacteria 837
125 Ga0496119_0037797 3300048922 Bacteria 3130
126 Ga0501031_0000184 3300049568 Bacteria 35190
127 Ga0501032_0000609 3300049569 Bacteria 28961
128 Ga0501033_0000196 3300049570 Bacteria 57814
129 Ga0501036_0000907 3300049572 Bacteria 22187
130 Ga0501036_0916194 3300049572 Unclassified 719
131 Ga0501037_0003828 3300049573 Bacteria 10918
132 Ga0501038_0002399 3300049574 Bacteria 17460
133 Ga0501039_0004602 3300049575 Bacteria 10432
134 Ga0501039_0909728 3300049575 Unclassified 685
135 Ga0501040_0000239 3300049576 Bacteria 32294
136 Ga0501041_0000184 3300049577 Bacteria 28387
137 Ga0501041_0054108 3300049577 Bacteria 2449
138 Ga0501042_0000014 3300049578 Bacteria 53046
139 Ga0501042_0305516 3300049578 Bacteria 1149
140 Ga0501043_0000092 3300049579 Bacteria 80825
141 Ga0501046_0004080 3300049580 Bacteria 13316
142 Ga0501046_0183442 3300049580 Bacteria 1564
143 Ga0501047_0006284 3300049581 Bacteria 11170
144 Ga0501048_0001148 3300049582 Bacteria 19885
145 Ga0501067_0017239 3300049583 Bacteria 3992
146 Ga0501068_0000009 3300049584 Bacteria 67122
147 Ga0501069_0039401 3300049585 Bacteria 2610
148 Ga0501069_0209771 3300049585 Bacteria 1130
149 Ga0501070_0194048 3300049586 Bacteria 1668
150 Ga0501071_0000712 3300049587 Bacteria 17456
151 Ga0501071_0082459 3300049587 Bacteria 2355
152 Ga0501072_0000600 3300049588 Bacteria 25969
153 Ga0501072_0124072 3300049588 Bacteria 2058
154 Ga0501072_0969966 3300049588 Unclassified 663
155 Ga0501072_1484710 3300049588 Unclassified 523
156 Ga0501073_0004895 3300049589 Bacteria 10051
157 Ga0501074_0000215 3300049590 Bacteria 31741
158 Ga0501075_0000006 3300049591 Bacteria 111683
159 Ga0501075_0312348 3300049591 Bacteria 1198
160 Ga0501076_0000083 3300049592 Bacteria 49438
161 Ga0501077_0000048 3300049593 Bacteria 61935
162 Ga0501079_0001040 3300049741 Bacteria 19219
163 Ga0501080_0000026 3300049742 Bacteria 89548
164 Ga0501081_0000069 3300049743 Bacteria 39558
165 Ga0501081_1063794 3300049743 Bacteria 612
166 Ga0501083_0000136 3300049744 Bacteria 49859
167 Ga0501241_005841 3300049758 Bacteria 2283
168 Ga0501269_004025 3300049766 Bacteria 1770
169 Ga0501035_0000499 3300049822 Bacteria 44174
170 Ga0501035_1064918 3300049822 Bacteria 633
171 Ga0501044_0019336 3300049823 Bacteria 7288
172 Ga0501045_0000110 3300049824 Bacteria 41325
173 Ga0501045_0127815 3300049824 Bacteria 1888
174 nmdc:mga00v17_746942_c1 3300050491 Bacteria 625
175 nmdc:mga0yw44_1118492_c1 3300050492 Bacteria 532
176 nmdc:mga0yw44_2675_c1 3300050492 Bacteria 7689
177 nmdc:mga09592_1484986_c1 3300050508 Bacteria 552
178 nmdc:mga0qj67_11678_c1 3300050509 Bacteria 6589
179 nmdc:mga0qj67_423686_c1 3300050509 Bacteria 1073
180 Ga0500593_000746 3300053117 Bacteria 12229
181 Ga0500642_0027525 3300053130 Unclassified 2334
182 Ga0500568_0111376 3300053139 Bacteria 1023
183 Ga0500573_0001875 3300053140 Bacteria 10258
184 Ga0501084_0000105 3300054114 Bacteria 62464
185 Ga0501082_0000645 3300060353 Bacteria 30754
186 Ga0466962_0037431 3300061719 Bacteria 2323
187 Ga0530510_0001636 3300061734 Bacteria 15137
188 Ga0530510_0010002 3300061734 Bacteria 6654

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046522 Ga0495643_0096888 Ga0495643_0096888_158_496 111
2 3300046648 Ga0495611_0093728 Ga0495611_0093728_19_381 118
3 3300006844 Ga0075428_100006326 Ga0075428_1000063266 122
4 3300006846 Ga0075430_101181963 Ga0075430_1011819632 122
5 3300042006 Ga0439432_231301 Ga0439432_231301_141_521 124
6 3300042435 Ga0439434_0101680 Ga0439434_0101680_531_911 124
7 3300050509 nmdc:mga0qj67_423686_c1 nmdc:mga0qj67_423686_c1_445_834 127
8 3300005455 Ga0070663_100275242 Ga0070663_1002752422 128
9 3300025899 Ga0207642_10447513 Ga0207642_104475131 128
10 3300044842 Ga0466957_1067504 Ga0466957_1067504_17_424 128
11 iso_pu_bacteria 2913844669 2913848826 129
12 3300006881 Ga0068865_101852545 Ga0068865_1018525452 131
13 iso_pu_bacteria 2852623160 2852624249 132
14 iso_pu_bacteria 2884933994 2884935293 132
15 3300013102 Ga0157371_10032620 Ga0157371_100326206 133
16 3300013105 Ga0157369_10258635 Ga0157369_102586353 133
17 3300049568 Ga0501031_0000184 Ga0501031_0000184_21358_21765 133
18 3300049569 Ga0501032_0000609 Ga0501032_0000609_27709_28116 133
19 3300049570 Ga0501033_0000196 Ga0501033_0000196_48667_49074 133
20 3300049572 Ga0501036_0000907 Ga0501036_0000907_21484_21891 133
21 3300049573 Ga0501037_0003828 Ga0501037_0003828_2942_3349 133
22 3300049574 Ga0501038_0002399 Ga0501038_0002399_13440_13847 133
23 3300049575 Ga0501039_0004602 Ga0501039_0004602_3934_4341 133
24 3300049576 Ga0501040_0000239 Ga0501040_0000239_29760_30167 133
25 3300049577 Ga0501041_0000184 Ga0501041_0000184_14556_14963 133
26 3300049578 Ga0501042_0000014 Ga0501042_0000014_269_676 133
27 3300049579 Ga0501043_0000092 Ga0501043_0000092_14555_14962 133
28 3300049580 Ga0501046_0004080 Ga0501046_0004080_5544_5951 133
29 3300049581 Ga0501047_0006284 Ga0501047_0006284_434_841 133
30 3300049582 Ga0501048_0001148 Ga0501048_0001148_2918_3325 133
31 3300049584 Ga0501068_0000009 Ga0501068_0000009_48653_49060 133
32 3300049585 Ga0501069_0209771 Ga0501069_0209771_561_968 133
33 3300049586 Ga0501070_0194048 Ga0501070_0194048_1100_1507 133
34 3300049587 Ga0501071_0000712 Ga0501071_0000712_13437_13844 133
35 3300049588 Ga0501072_0000600 Ga0501072_0000600_285_692 133
36 3300049589 Ga0501073_0004895 Ga0501073_0004895_1470_1877 133
37 3300049590 Ga0501074_0000215 Ga0501074_0000215_15825_16232 133
38 3300049591 Ga0501075_0000006 Ga0501075_0000006_21604_22011 133
39 3300049592 Ga0501076_0000083 Ga0501076_0000083_48732_49139 133
40 3300049593 Ga0501077_0000048 Ga0501077_0000048_13440_13847 133
41 3300049741 Ga0501079_0001040 Ga0501079_0001040_15853_16260 133
42 3300049742 Ga0501080_0000026 Ga0501080_0000026_45103_45510 133
43 3300049743 Ga0501081_0000069 Ga0501081_0000069_14556_14963 133
44 3300049744 Ga0501083_0000136 Ga0501083_0000136_48617_49024 133
45 3300049822 Ga0501035_0000499 Ga0501035_0000499_16059_16466 133
46 3300049823 Ga0501044_0019336 Ga0501044_0019336_578_985 133
47 3300049824 Ga0501045_0000110 Ga0501045_0000110_25432_25839 133
48 3300054114 Ga0501084_0000105 Ga0501084_0000105_27595_28002 133
49 3300060353 Ga0501082_0000645 Ga0501082_0000645_8744_9151 133
50 3300061734 Ga0530510_0001636 Ga0530510_0001636_175_582 133
51 iso_pu_bacteria 2958512119 2958513579 133
52 3300003322 rootL2_10022832 rootL2_100228327 134
53 3300005367 Ga0070667_100149142 Ga0070667_1001491422 134
54 3300005617 Ga0068859_100165947 Ga0068859_1001659472 134
55 3300005618 Ga0068864_100748295 Ga0068864_1007482951 134
56 3300005843 Ga0068860_100043194 Ga0068860_1000431943 134
57 3300005844 Ga0068862_100009757 Ga0068862_1000097573 134
58 3300006931 Ga0097620_100165934 Ga0097620_1001659342 134
59 3300025942 Ga0207689_10569225 Ga0207689_105692252 134
60 3300025961 Ga0207712_10468854 Ga0207712_104688541 134
61 3300025986 Ga0207658_10491258 Ga0207658_104912582 134
62 3300026088 Ga0207641_10171882 Ga0207641_101718822 134
63 3300026095 Ga0207676_10094132 Ga0207676_100941321 134
64 3300028380 Ga0268265_10018799 Ga0268265_100187991 134
65 3300031507 Ga0307509_10325962 Ga0307509_103259623 134
66 3300050492 nmdc:mga0yw44_2675_c1 nmdc:mga0yw44_2675_c1_1924_2346 134
67 3300053140 Ga0500573_0001875 Ga0500573_0001875_6854_7276 134
68 3300003316 rootH1_10076725 rootH1_100767254 135
69 3300003373 JGI25407J50210_10002399 JGI25407J50210_100023996 135
70 3300005841 Ga0068863_100030436 Ga0068863_1000304366 135
71 3300005937 Ga0081455_10003746 Ga0081455_1000374610 135
72 3300005981 Ga0081538_10000504 Ga0081538_1000050420 135
73 3300006852 Ga0075433_10453950 Ga0075433_104539502 135
74 3300006871 Ga0075434_101850598 Ga0075434_1018505982 135
75 3300009093 Ga0105240_10088160 Ga0105240_100881603 135
76 3300009545 Ga0105237_10444648 Ga0105237_104446482 135
77 3300025913 Ga0207695_10088617 Ga0207695_100886172 135
78 3300026088 Ga0207641_11265857 Ga0207641_112658571 135
79 3300031824 Ga0307413_10737795 Ga0307413_107377952 135
80 3300035695 Ga0373927_0257659 Ga0373927_0257659_676_1086 135
81 3300037312 Ga0395899_0298317 Ga0395899_0298317_253_669 135
82 3300041410 Ga0439461_0112478 Ga0439461_0112478_92_508 135
83 3300041512 Ga0451853_0579156 Ga0451853_0579156_763_1173 135
84 3300042156 Ga0439446_0058843 Ga0439446_0058843_672_1088 135
85 3300049575 Ga0501039_0909728 Ga0501039_0909728_139_555 135
86 3300049588 Ga0501072_0124072 Ga0501072_0124072_16_432 135
87 3300050491 nmdc:mga00v17_746942_c1 nmdc:mga00v17_746942_c1_176_586 135
88 3300050492 nmdc:mga0yw44_1118492_c1 nmdc:mga0yw44_1118492_c1_44_454 135
89 3300053117 Ga0500593_000746 Ga0500593_000746_3143_3553 135
90 3300053139 Ga0500568_0111376 Ga0500568_0111376_563_973 135
91 3300003316 rootH1_10015865 rootH1_1001586510 136
92 3300005327 Ga0070658_10497022 Ga0070658_104970221 136
93 3300005334 Ga0068869_100049439 Ga0068869_1000494392 136
94 3300005334 Ga0068869_100063475 Ga0068869_1000634752 136
95 3300005336 Ga0070680_101525713 Ga0070680_1015257131 136
96 3300005338 Ga0068868_100108493 Ga0068868_1001084931 136
97 3300005345 Ga0070692_10013243 Ga0070692_100132435 136
98 3300005347 Ga0070668_100211360 Ga0070668_1002113602 136
99 3300005353 Ga0070669_101533631 Ga0070669_1015336311 136
100 3300005354 Ga0070675_101281690 Ga0070675_1012816901 136
101 3300005364 Ga0070673_101418377 Ga0070673_1014183771 136
102 3300005366 Ga0070659_100100082 Ga0070659_1001000822 136
103 3300005441 Ga0070700_100443254 Ga0070700_1004432542 136
104 3300005539 Ga0068853_100976570 Ga0068853_1009765702 136
105 3300005616 Ga0068852_100276431 Ga0068852_1002764312 136
106 3300005718 Ga0068866_10049151 Ga0068866_100491512 136
107 3300005719 Ga0068861_100109588 Ga0068861_1001095881 136
108 3300005841 Ga0068863_100701184 Ga0068863_1007011842 136
109 3300005843 Ga0068860_100468986 Ga0068860_1004689862 136
110 3300006038 Ga0075365_10001174 Ga0075365_100011742 136
111 3300006038 Ga0075365_11005224 Ga0075365_110052242 136
112 3300009098 Ga0105245_10099708 Ga0105245_100997082 136
113 3300009148 Ga0105243_10032583 Ga0105243_100325834 136
114 3300009176 Ga0105242_10349140 Ga0105242_103491402 136
115 3300009176 Ga0105242_11814884 Ga0105242_118148841 136
116 3300009553 Ga0105249_10103386 Ga0105249_101033862 136
117 3300009553 Ga0105249_10692969 Ga0105249_106929691 136
118 3300010375 Ga0105239_10136488 Ga0105239_101364883 136
119 3300013105 Ga0157369_11548340 Ga0157369_115483402 136
120 3300013296 Ga0157374_10246210 Ga0157374_102462103 136
121 3300013306 Ga0163162_10124816 Ga0163162_101248162 136
122 3300013307 Ga0157372_10244296 Ga0157372_102442962 136
123 3300013308 Ga0157375_10393539 Ga0157375_103935393 136
124 3300014325 Ga0163163_10444099 Ga0163163_104440991 136
125 3300014326 Ga0157380_10471727 Ga0157380_104717272 136
126 3300014745 Ga0157377_10148665 Ga0157377_101486652 136
127 3300014968 Ga0157379_10002240 Ga0157379_1000224011 136
128 3300014968 Ga0157379_10181207 Ga0157379_101812073 136
129 3300025901 Ga0207688_10034804 Ga0207688_100348042 136
130 3300025923 Ga0207681_10347411 Ga0207681_103474111 136
131 3300025927 Ga0207687_10065742 Ga0207687_100657422 136
132 3300025932 Ga0207690_10284733 Ga0207690_102847332 136
133 3300025934 Ga0207686_10399397 Ga0207686_103993972 136
134 3300025938 Ga0207704_10483071 Ga0207704_104830712 136
135 3300025942 Ga0207689_10097897 Ga0207689_100978972 136
136 3300025972 Ga0207668_11309532 Ga0207668_113095321 136
137 3300025981 Ga0207640_10071421 Ga0207640_100714212 136
138 3300026023 Ga0207677_10434509 Ga0207677_104345092 136
139 3300026089 Ga0207648_10229768 Ga0207648_102297682 136
140 3300026118 Ga0207675_100051284 Ga0207675_1000512844 136
141 3300026142 Ga0207698_10019026 Ga0207698_100190263 136
142 3300028380 Ga0268265_10163751 Ga0268265_101637512 136
143 3300028381 Ga0268264_10235902 Ga0268264_102359022 136
144 3300028381 Ga0268264_10257296 Ga0268264_102572962 136
145 3300031731 Ga0307405_10027498 Ga0307405_100274982 136
146 3300031824 Ga0307413_10827229 Ga0307413_108272291 136
147 3300031852 Ga0307410_10070587 Ga0307410_100705872 136
148 3300031852 Ga0307410_10348247 Ga0307410_103482472 136
149 3300031889 Ga0326468_10037509 Ga0326468_100375091 136
150 3300031901 Ga0307406_10120296 Ga0307406_101202961 136
151 3300031901 Ga0307406_10273294 Ga0307406_102732942 136
152 3300031901 Ga0307406_11476006 Ga0307406_114760061 136
153 3300031903 Ga0307407_10113304 Ga0307407_101133042 136
154 3300031903 Ga0307407_10601834 Ga0307407_106018342 136
155 3300031995 Ga0307409_100032250 Ga0307409_1000322505 136
156 3300031995 Ga0307409_100878093 Ga0307409_1008780931 136
157 3300032002 Ga0307416_100121943 Ga0307416_1001219431 136
158 3300032004 Ga0307414_10177819 Ga0307414_101778192 136
159 3300032005 Ga0307411_10109922 Ga0307411_101099222 136
160 3300032126 Ga0307415_100070787 Ga0307415_1000707872 136
161 3300032126 Ga0307415_101077945 Ga0307415_1010779452 136
162 3300037466 Ga0395898_0436842 Ga0395898_0436842_759_1178 136
163 3300038443 Ga0395901_0659706 Ga0395901_0659706_126_545 136
164 3300044693 Ga0466961_0220177 Ga0466961_0220177_672_1097 136
165 3300044765 Ga0466970_0073838 Ga0466970_0073838_852_1277 136
166 3300045049 Ga0466959_1205994 Ga0466959_1205994_56_481 136
167 3300045836 Ga0466958_0504874 Ga0466958_0504874_140_565 136
168 3300045976 Ga0466967_1166981 Ga0466967_1166981_340_756 136
169 3300048905 Ga0496102_1211951 Ga0496102_1211951_173_613 136
170 3300048909 Ga0496106_0374378 Ga0496106_0374378_94_534 136
171 3300048916 Ga0496113_0658564 Ga0496113_0658564_102_545 136
172 3300048922 Ga0496119_0037797 Ga0496119_0037797_1773_2192 136
173 3300049572 Ga0501036_0916194 Ga0501036_0916194_228_641 136
174 3300049577 Ga0501041_0054108 Ga0501041_0054108_1255_1668 136
175 3300049578 Ga0501042_0305516 Ga0501042_0305516_386_799 136
176 3300049580 Ga0501046_0183442 Ga0501046_0183442_119_553 136
177 3300049583 Ga0501067_0017239 Ga0501067_0017239_1450_1869 136
178 3300049585 Ga0501069_0039401 Ga0501069_0039401_893_1312 136
179 3300049587 Ga0501071_0082459 Ga0501071_0082459_1378_1812 136
180 3300049588 Ga0501072_0969966 Ga0501072_0969966_120_563 136
181 3300049588 Ga0501072_1484710 Ga0501072_1484710_41_454 136
182 3300049591 Ga0501075_0312348 Ga0501075_0312348_721_1134 136
183 3300049743 Ga0501081_1063794 Ga0501081_1063794_24_437 136
184 3300049758 Ga0501241_005841 Ga0501241_005841_673_1089 136
185 3300049766 Ga0501269_004025 Ga0501269_004025_1005_1421 136
186 3300049822 Ga0501035_1064918 Ga0501035_1064918_199_612 136
187 3300049824 Ga0501045_0127815 Ga0501045_0127815_103_516 136
188 3300050508 nmdc:mga09592_1484986_c1 nmdc:mga09592_1484986_c1_93_536 136
189 3300050509 nmdc:mga0qj67_11678_c1 nmdc:mga0qj67_11678_c1_3171_3614 136
190 3300053130 Ga0500642_0027525 Ga0500642_0027525_483_899 136
191 3300061719 Ga0466962_0037431 Ga0466962_0037431_1014_1439 136
192 3300061734 Ga0530510_0010002 Ga0530510_0010002_5476_5895 136

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

11

141

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
1xrk-assembly1.cif.gz_A crystal structure of a mutant bleomycin binding protein from streptoalloteichus hindustanus displaying increased thermostability 0.8541 1 133
2zhp-assembly1.cif.gz_B crystal structure of bleomycin-binding protein from streptoalloteichus hindustanus complexed with bleomycin derivative 0.8522 1 133
1byl-assembly1.cif.gz_A bleomycin resistance protein from streptoalloteichus hindustanus 0.8451 1 133
1jif-assembly1.cif.gz_B crystal structure of bleomycin-binding protein from bleomycin-producing streptomyces verticillus complexed with copper(ii)-bleomycin 0.8409 1 131
5cj3-assembly1.cif.gz_B crystal structure of the zorbamycin binding protein (zbma) from streptomyces flavoviridis with zorbamycin 0.8406 1 136
ID Description Score Start End Superfamily
2pjsB01 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8676 83 132 3.10.180.10
3itwA02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8595 79 135 3.30.720.110
1jieA00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8486 1 131 3.10.180.10
3itwB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8434 79 132 3.30.720.110
2kjzB01 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8401 3 54 3.30.720.120
ID Description Score Start End GO Terms
AF-A0A3C1T3H7-F1-model_v4 Glyoxalase/bleomycin resistance/extradiol dioxygenase family protein 0.9821 1 54 GO:0046677
GO:0051213
AF-A0A7X1PDR9-F1-model_v4 Bleomycin resistance protein 0.9395 1 136 GO:0046677
AF-A0A498JDZ1-F1-model_v4 Uncharacterized protein 0.9394 6 51
AF-A0A538AHC2-F1-model_v4 Bleomycin resistance protein 0.9348 1 133 GO:0046677
AF-A0A0P9DB21-F1-model_v4 Bleomycin resistance protein 0.9332 1 136 GO:0046677

Feature Viewer

pLDDT pTM Quality
88.98 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map