F294404

General Info

Members Datasets Scaffolds Average Seq Length
191 155 382 111

Family's Representative Sequence

Representative Sequence 3300041486|Ga0451807_2198962|Ga0451807_2198962_544_933
Length 129
Sequence MGTQQTKSGKKSLILSMDKENLTWDEFMRVEMRVGTVISAEIFEEVRNPAYKITIDFGEFGMRKTSAQVTALYRAEELVGKQVVAVINFPPKQIATMMSECLVLGGIGENKEVTLLQPERKVKNGTRIG

Samples

Sample ID Description Type Environment
1 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
2 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
13 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
14 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
15 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
16 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
17 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
18 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
19 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
20 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
21 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
22 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
23 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
24 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
25 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
26 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
27 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
28 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
29 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
30 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
31 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
32 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
33 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
34 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
35 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
36 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
37 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
39 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
40 3300009986 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_92 metaG Metagenome Rhizosphere
41 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
42 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
43 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
44 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
45 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
46 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
47 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
48 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
49 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
50 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
51 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
52 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
53 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
54 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
55 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
56 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
77 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
78 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
79 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
80 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
81 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
82 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
83 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
84 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
85 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
86 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
87 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
88 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
89 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
90 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
91 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
92 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
93 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
94 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
95 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
96 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
97 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
98 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
99 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
100 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
101 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
102 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
103 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
104 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
105 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
106 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
107 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
108 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
109 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
110 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
111 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
112 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
113 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
114 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
115 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
116 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
117 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
118 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
119 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
120 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
121 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
122 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
123 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
124 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
125 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
126 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
127 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
128 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
129 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
130 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
131 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
132 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
133 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
134 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
135 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
136 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
137 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
138 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
139 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
140 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
141 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
142 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
143 2524023129 Paenibacillus pinihumi DSM 23905 Isolate Rhizosphere
144 2643221543 Paenibacillus sp. Root52 Isolate Unclassified
145 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
146 2888578766 Paenibacillus lycopersici 12200R-189 Isolate Rhizosphere
147 2889276214 Paenibacillus sp. PvR133 Isolate Rhizosphere
148 2890737413 Parapedobacter sp. SGR-10 Isolate Rhizosphere
149 2896344016 Sphingobacterium sp. SGL-16 Isolate Rhizosphere
150 2898713307 Sphingobacterium sp. SGG-5 Isolate Rhizosphere
151 2996706504 Paenibacillus sp. OT2-17 Isolate Rhizosphere
152 648028048 Paenibacillus polymyxa E681 Isolate Rhizosphere
153 8002317523 Cohnella sp. GbtcB17 Isolate Unclassified
154 8022792930 Bacillus sp. Xin Isolate Rhizosphere
155 8057582654 Bacillus arachidis YX15 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.19
Metatranscriptomes 0
Isolates 6.81

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.81
Nodule 0
Rhizoplane 1.57
Rhizosphere 83.77
Stem 0
Stem Tuber 0
Unclassified 8.38

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451807_2198962 3300041486 Bacteria 982
2 JGI25151J46595_10053975 3300003187 Bacteria 1337
3 rootH2_10230576 3300003320 Bacteria 1694
4 Ga0065714_10104424 3300005288 Bacteria 1581
5 Ga0065704_10084327 3300005289 Bacteria 3348
6 Ga0070658_10381225 3300005327 Bacteria 1210
7 Ga0070658_11779697 3300005327 Bacteria 533
8 Ga0070670_100228264 3300005331 Bacteria 1620
9 Ga0068869_100296698 3300005334 Bacteria 1304
10 Ga0070666_10181625 3300005335 Bacteria 1476
11 Ga0070682_101186965 3300005337 Bacteria 643
12 Ga0070660_100256678 3300005339 Bacteria 1426
13 Ga0070703_10350386 3300005406 Bacteria 630
14 Ga0070694_100539078 3300005444 Bacteria 933
15 Ga0070678_100050618 3300005456 Bacteria 3007
16 Ga0068867_100480773 3300005459 Bacteria 1064
17 Ga0068867_100509339 3300005459 Bacteria 1036
18 Ga0070679_100060032 3300005530 Bacteria 3790
19 Ga0068853_100224579 3300005539 Bacteria 1716
20 Ga0070695_100092569 3300005545 Bacteria 2021
21 Ga0070696_100069737 3300005546 Bacteria 2471
22 Ga0070665_100011324 3300005548 Bacteria 9021
23 Ga0070665_100629490 3300005548 Bacteria 1086
24 Ga0070704_100099509 3300005549 Bacteria 2187
25 Ga0068855_100093687 3300005563 Bacteria 3464
26 Ga0068855_101443978 3300005563 Bacteria 708
27 Ga0068857_102313171 3300005577 Bacteria 528
28 Ga0068852_102854865 3300005616 Bacteria 501
29 Ga0068860_100419055 3300005843 Bacteria 1327
30 Ga0068862_102791523 3300005844 Bacteria 500
31 Ga0070716_100276642 3300006173 Bacteria 1156
32 Ga0075366_10991756 3300006195 Bacteria 524
33 Ga0068871_100286945 3300006358 Bacteria 1441
34 Ga0068871_100832459 3300006358 Bacteria 852
35 Ga0075428_100119599 3300006844 Bacteria 2868
36 Ga0075428_100163392 3300006844 Bacteria 2416
37 Ga0075430_100137198 3300006846 Bacteria 2038
38 Ga0075431_100307104 3300006847 Bacteria 1602
39 Ga0068865_100499360 3300006881 Bacteria 1014
40 Ga0075436_101253852 3300006914 Bacteria 560
41 Ga0099794_10003968 3300007265 Bacteria 5743
42 Ga0105240_10038589 3300009093 Bacteria 6125
43 Ga0105240_10781032 3300009093 Unclassified 1036
44 Ga0114129_10109265 3300009147 Bacteria 3818
45 Ga0114129_12322693 3300009147 Bacteria 643
46 Ga0105241_10000057 3300009174 Bacteria 84081
47 Ga0105241_10831090 3300009174 Bacteria 853
48 Ga0105238_10190847 3300009551 Bacteria 2025
49 Ga0105033_129861 3300009986 Bacteria 502
50 Ga0105239_10213937 3300010375 Bacteria 2161
51 Ga0157371_10458442 3300013102 Bacteria 938
52 Ga0157378_10620320 3300013297 Bacteria 1094
53 Ga0157378_12168013 3300013297 Bacteria 607
54 Ga0157378_12852243 3300013297 Bacteria 536
55 Ga0163162_10361851 3300013306 Bacteria 1584
56 Ga0157372_10010661 3300013307 Bacteria 9776
57 Ga0157380_13452480 3300014326 Unclassified 506
58 Ga0157376_11250381 3300014969 Bacteria 772
59 Ga0157376_11686446 3300014969 Bacteria 669
60 Ga0163161_10787810 3300017792 Bacteria 798
61 Ga0209233_1009068 3300025261 Bacteria 3045
62 Ga0209455_1033527 3300025272 Bacteria 843
63 Ga0209130_1014266 3300025284 Bacteria 2001
64 Ga0209675_1003273 3300025291 Bacteria 7797
65 Ga0209675_1086772 3300025291 Unclassified 571
66 Ga0209025_1001102 3300025294 Bacteria 38868
67 Ga0209025_1020027 3300025294 Bacteria 3683
68 Ga0209564_1069091 3300025295 Bacteria 744
69 Ga0209256_1036188 3300025299 Bacteria 1297
70 Ga0207653_10333721 3300025885 Bacteria 591
71 Ga0207682_10568131 3300025893 Unclassified 536
72 Ga0207680_10079038 3300025903 Bacteria 2062
73 Ga0207705_10256136 3300025909 Bacteria 1335
74 Ga0207654_10000444 3300025911 Bacteria 23592
75 Ga0207695_10004811 3300025913 Bacteria 18272
76 Ga0207695_10462279 3300025913 Bacteria 1152
77 Ga0207657_10222541 3300025919 Bacteria 1511
78 Ga0207652_10109851 3300025921 Bacteria 2445
79 Ga0207650_10264788 3300025925 Bacteria 1395
80 Ga0207686_10182971 3300025934 Bacteria 1487
81 Ga0207704_10596606 3300025938 Bacteria 904
82 Ga0207665_10708399 3300025939 Unclassified 792
83 Ga0207689_10133481 3300025942 Bacteria 2044
84 Ga0207667_10289403 3300025949 Bacteria 1674
85 Ga0207639_10291813 3300026041 Bacteria 1438
86 Ga0207641_11781380 3300026088 Unclassified 618
87 Ga0207648_10776905 3300026089 Bacteria 891
88 Ga0207648_11432163 3300026089 Bacteria 649
89 Ga0207683_10027483 3300026121 Bacteria 4916
90 Ga0268266_10027570 3300028379 Bacteria 4829
91 Ga0268264_10379090 3300028381 Bacteria 1354
92 Ga0316575_10360247 3300031665 Unclassified 620
93 Ga0316576_10087137 3300031727 Bacteria 2323
94 Ga0316578_10220864 3300031728 Bacteria 1139
95 Ga0307413_10013368 3300031824 Bacteria 4124
96 Ga0307410_10037656 3300031852 Bacteria 3161
97 Ga0307410_10176308 3300031852 Bacteria 1615
98 Ga0307410_10409721 3300031852 Bacteria 1097
99 Ga0307410_11480389 3300031852 Bacteria 598
100 Ga0307406_11220748 3300031901 Bacteria 654
101 Ga0307407_10118149 3300031903 Bacteria 1676
102 Ga0307407_10964526 3300031903 Bacteria 657
103 Ga0307407_11244989 3300031903 Bacteria 582
104 Ga0307412_10999042 3300031911 Bacteria 739
105 Ga0307409_100116199 3300031995 Bacteria 2254
106 Ga0307409_100332041 3300031995 Bacteria 1427
107 Ga0307409_100385839 3300031995 Bacteria 1333
108 Ga0307409_101326328 3300031995 Unclassified 745
109 Ga0307409_102285545 3300031995 Bacteria 570
110 Ga0307416_100069825 3300032002 Bacteria 2909
111 Ga0307416_100131912 3300032002 Bacteria 2251
112 Ga0307416_102466131 3300032002 Bacteria 619
113 Ga0307414_10931559 3300032004 Bacteria 797
114 Ga0307414_11443282 3300032004 Bacteria 640
115 Ga0307411_10027884 3300032005 Bacteria 3425
116 Ga0307411_10048549 3300032005 Bacteria 2752
117 Ga0307411_10100396 3300032005 Bacteria 2045
118 Ga0307415_100149578 3300032126 Bacteria 1795
119 Ga0307415_100535743 3300032126 Bacteria 1030
120 Ga0373942_0264099 3300035207 Unclassified 588
121 Ga0316574_0110747 3300035398 Bacteria 1760
122 Ga0316574_0750826 3300035398 Unclassified 596
123 Ga0316584_0044465 3300036712 Bacteria 3311
124 Ga0395899_0449395 3300037312 Unclassified 844
125 Ga0395900_0129694 3300037418 Unclassified 2585
126 Ga0436364_0174425 3300037853 Bacteria 2064
127 Ga0395901_1041947 3300038443 Bacteria 792
128 Ga0436365_1907282 3300039437 Bacteria 936
129 Ga0451798_0198142 3300041458 Bacteria 1069
130 Ga0451853_1053593 3300041512 Bacteria 522
131 Ga0450923_018198 3300042125 Bacteria 1342
132 Ga0466969_0532309 3300044656 Bacteria 537
133 Ga0453683_0068271 3300044673 Unclassified 2223
134 Ga0466961_0939881 3300044693 Bacteria 514
135 Ga0453684_0081606 3300044712 Archaea 4032
136 Ga0451576_1051766 3300045051 Bacteria 853
137 Ga0496110_0282595 3300048913 Unclassified 1511
138 Ga0496116_0003390 3300048919 Bacteria 15786
139 Ga0496116_0007759 3300048919 Bacteria 9437
140 Ga0496117_0523465 3300048920 Bacteria 570
141 Ga0496118_0035384 3300048921 Bacteria 4055
142 Ga0496119_0060452 3300048922 Bacteria 2268
143 Ga0496121_0067498 3300048924 Bacteria 2898
144 Ga0496122_0042743 3300048925 Bacteria 3561
145 Ga0496126_0025737 3300048929 Bacteria 5655
146 Ga0501291_124471 3300049514 Bacteria 562
147 Ga0501032_0232507 3300049569 Bacteria 1199
148 Ga0501032_0866383 3300049569 Bacteria 569
149 Ga0501034_0006384 3300049571 Bacteria 12701
150 Ga0501036_1069198 3300049572 Bacteria 660
151 Ga0501038_0039155 3300049574 Bacteria 4148
152 Ga0501043_0181386 3300049579 Bacteria 1640
153 Ga0501047_0106897 3300049581 Bacteria 2679
154 Ga0501047_0706222 3300049581 Unclassified 826
155 Ga0501069_0280121 3300049585 Bacteria 976
156 Ga0501070_1123280 3300049586 Bacteria 605
157 Ga0501071_0432961 3300049587 Bacteria 1006
158 Ga0501072_0063332 3300049588 Bacteria 2917
159 Ga0501198_001723 3300049649 Bacteria 2883
160 Ga0501206_014336 3300049653 Bacteria 1089
161 Ga0501217_045479 3300049661 Bacteria 1131
162 Ga0501223_002936 3300049663 Bacteria 3742
163 Ga0501235_005831 3300049669 Bacteria 2681
164 Ga0501250_042334 3300049680 Bacteria 673
165 Ga0501221_077762 3300049704 Bacteria 793
166 Ga0501080_0632022 3300049742 Bacteria 948
167 Ga0501273_069729 3300049770 Bacteria 568
168 Ga0501035_0016935 3300049822 Bacteria 6718
169 Ga0501044_0018846 3300049823 Bacteria 7390
170 Ga0501044_0389580 3300049823 Unclassified 1307
171 Ga0501045_0796111 3300049824 Bacteria 696
172 nmdc:mga05p37_188403_c1 3300050507 Bacteria 2506
173 nmdc:mga09592_392623_c1 3300050508 Bacteria 1199
174 nmdc:mga0qj67_198248_c1 3300050509 Bacteria 1631
175 nmdc:mga06r32_442587_c1 3300050510 Bacteria 1280
176 Ga0500556_0277787 3300053104 Bacteria 657
177 Ga0500645_018167 3300053730 Bacteria 2198
178 Ga0501082_1690813 3300060353 Bacteria 552
179 2524190726 2524023129 Bacteria 6762600
180 2643737761 2643221543 Bacteria 6628015
181 2884797010 2884791551 Bacteria 8511252
182 2888583285 2888578766 Bacteria 6743310
183 2889280103 2889276214 Bacteria 5979355
184 2890739266 2890737413 Bacteria 4269751
185 2896345574 2896344016 Bacteria 3811746
186 2898716815 2898713307 Bacteria 4110805
187 2996707198 2996706504 Bacteria 5757485
188 648172785 648028048 Bacteria 5394884
189 8002322456 8002317523 Bacteria 8051857
190 8022797779 8022792930 Bacteria 5693794
191 8057584717 8057582654 Bacteria 5218944
192 Ga0451807_2198962
193 JGI25151J46595_10053975
194 rootH2_10230576
195 Ga0065714_10104424
196 Ga0065704_10084327
197 Ga0070658_10381225
198 Ga0070658_11779697
199 Ga0070670_100228264
200 Ga0068869_100296698
201 Ga0070666_10181625
202 Ga0070682_101186965
203 Ga0070660_100256678
204 Ga0070703_10350386
205 Ga0070694_100539078
206 Ga0070678_100050618
207 Ga0068867_100480773
208 Ga0068867_100509339
209 Ga0070679_100060032
210 Ga0068853_100224579
211 Ga0070695_100092569
212 Ga0070696_100069737
213 Ga0070665_100011324
214 Ga0070665_100629490
215 Ga0070704_100099509
216 Ga0068855_100093687
217 Ga0068855_101443978
218 Ga0068857_102313171
219 Ga0068852_102854865
220 Ga0068860_100419055
221 Ga0068862_102791523
222 Ga0070716_100276642
223 Ga0075366_10991756
224 Ga0068871_100286945
225 Ga0068871_100832459
226 Ga0075428_100119599
227 Ga0075428_100163392
228 Ga0075430_100137198
229 Ga0075431_100307104
230 Ga0068865_100499360
231 Ga0075436_101253852
232 Ga0099794_10003968
233 Ga0105240_10038589
234 Ga0105240_10781032
235 Ga0114129_10109265
236 Ga0114129_12322693
237 Ga0105241_10000057
238 Ga0105241_10831090
239 Ga0105238_10190847
240 Ga0105033_129861
241 Ga0105239_10213937
242 Ga0157371_10458442
243 Ga0157378_10620320
244 Ga0157378_12168013
245 Ga0157378_12852243
246 Ga0163162_10361851
247 Ga0157372_10010661
248 Ga0157380_13452480
249 Ga0157376_11250381
250 Ga0157376_11686446
251 Ga0163161_10787810
252 Ga0209233_1009068
253 Ga0209455_1033527
254 Ga0209130_1014266
255 Ga0209675_1003273
256 Ga0209675_1086772
257 Ga0209025_1001102
258 Ga0209025_1020027
259 Ga0209564_1069091
260 Ga0209256_1036188
261 Ga0207653_10333721
262 Ga0207682_10568131
263 Ga0207680_10079038
264 Ga0207705_10256136
265 Ga0207654_10000444
266 Ga0207695_10004811
267 Ga0207695_10462279
268 Ga0207657_10222541
269 Ga0207652_10109851
270 Ga0207650_10264788
271 Ga0207686_10182971
272 Ga0207704_10596606
273 Ga0207665_10708399
274 Ga0207689_10133481
275 Ga0207667_10289403
276 Ga0207639_10291813
277 Ga0207641_11781380
278 Ga0207648_10776905
279 Ga0207648_11432163
280 Ga0207683_10027483
281 Ga0268266_10027570
282 Ga0268264_10379090
283 Ga0316575_10360247
284 Ga0316576_10087137
285 Ga0316578_10220864
286 Ga0307413_10013368
287 Ga0307410_10037656
288 Ga0307410_10176308
289 Ga0307410_10409721
290 Ga0307410_11480389
291 Ga0307406_11220748
292 Ga0307407_10118149
293 Ga0307407_10964526
294 Ga0307407_11244989
295 Ga0307412_10999042
296 Ga0307409_100116199
297 Ga0307409_100332041
298 Ga0307409_100385839
299 Ga0307409_101326328
300 Ga0307409_102285545
301 Ga0307416_100069825
302 Ga0307416_100131912
303 Ga0307416_102466131
304 Ga0307414_10931559
305 Ga0307414_11443282
306 Ga0307411_10027884
307 Ga0307411_10048549
308 Ga0307411_10100396
309 Ga0307415_100149578
310 Ga0307415_100535743
311 Ga0373942_0264099
312 Ga0316574_0110747
313 Ga0316574_0750826
314 Ga0316584_0044465
315 Ga0395899_0449395
316 Ga0395900_0129694
317 Ga0436364_0174425
318 Ga0395901_1041947
319 Ga0436365_1907282
320 Ga0451798_0198142
321 Ga0451853_1053593
322 Ga0450923_018198
323 Ga0466969_0532309
324 Ga0453683_0068271
325 Ga0466961_0939881
326 Ga0453684_0081606
327 Ga0451576_1051766
328 Ga0496110_0282595
329 Ga0496116_0003390
330 Ga0496116_0007759
331 Ga0496117_0523465
332 Ga0496118_0035384
333 Ga0496119_0060452
334 Ga0496121_0067498
335 Ga0496122_0042743
336 Ga0496126_0025737
337 Ga0501291_124471
338 Ga0501032_0232507
339 Ga0501032_0866383
340 Ga0501034_0006384
341 Ga0501036_1069198
342 Ga0501038_0039155
343 Ga0501043_0181386
344 Ga0501047_0106897
345 Ga0501047_0706222
346 Ga0501069_0280121
347 Ga0501070_1123280
348 Ga0501071_0432961
349 Ga0501072_0063332
350 Ga0501198_001723
351 Ga0501206_014336
352 Ga0501217_045479
353 Ga0501223_002936
354 Ga0501235_005831
355 Ga0501250_042334
356 Ga0501221_077762
357 Ga0501080_0632022
358 Ga0501273_069729
359 Ga0501035_0016935
360 Ga0501044_0018846
361 Ga0501044_0389580
362 Ga0501045_0796111
363 nmdc:mga05p37_188403_c1
364 nmdc:mga09592_392623_c1
365 nmdc:mga0qj67_198248_c1
366 nmdc:mga06r32_442587_c1
367 Ga0500556_0277787
368 Ga0500645_018167
369 Ga0501082_1690813
370 2524190726
371 2643737761
372 2884797010
373 2888583285
374 2889280103
375 2890739266
376 2896345574
377 2898716815
378 2996707198
379 648172785
380 8002322456
381 8022797779
382 8057584717

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01588

tRNA_bind

Putative tRNA binding domain

32

127

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2nzo-assembly2.cif.gz_D crystal structure of a secretion chaperone csaa from bacillus subtilis in the space group p 32 2 1 0.997 1 109
2nzo-assembly2.cif.gz_D crystal structure of a secretion chaperone csaa from bacillus subtilis in the space group p 32 2 1 0.9879 1 109
3g48-assembly2.cif.gz_B crystal structure of chaperone csaa form bacillus anthracis str. ames 0.9838 1 109
2nzo-assembly2.cif.gz_C crystal structure of a secretion chaperone csaa from bacillus subtilis in the space group p 32 2 1 0.9815 1 109
3g48-assembly2.cif.gz_A crystal structure of chaperone csaa form bacillus anthracis str. ames 0.9743 1 109
ID Description Score Start End Superfamily
af_Q54B13_2_117_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.975 1 109 2.40.50.140
af_Q54B13_2_117_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9663 1 109 2.40.50.140
1gd7A00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9487 1 109 2.40.50.140
2q2iB00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9452 1 109 2.40.50.140
5h34A00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9371 1 109 2.40.50.140
ID Description Score Start End GO Terms
AF-A0A1S2LUR8-F1-model_v4 tRNA-binding protein 1.002 1 109 GO:0000049
AF-A0A4R5KKU8-F1-model_v4 Chaperone CsaA 1.002 1 109 GO:0000049
AF-A0A5E9IF84-F1-model_v4 deleted 1.001 1 109
AF-A0A4V3WEW8-F1-model_v4 Chaperone CsaA 1 1 109 GO:0000049
AF-W8ZK43-F1-model_v4 tRNA-binding domain-containing protein 1 1 109 GO:0000049

Map