F289459

General Info

Members Datasets Scaffolds Average Seq Length
188 133 179 140

Family's Representative Sequence

Representative Sequence 3300021441|Ga0213871_10001689|Ga0213871_100016892
Length 182
Sequence MHAFLSNTSVRFLSTRSECRHSEHQSFMPRHWLFKTEPDAYSIDDLERDGRTEWSGVRNFQARNNMREMKPGDLGFFYHSSTKPPGIVGICEVLVEAHPDSTQFNKSSDYYDGSSGHTNPKWWCVDVGFVRRLPRMVTLEELRAIPALAYMPLLRRGQRLSVQPVSTQEWELIEKLAADGEP

Samples

Sample ID Description Type Environment
1 2585427687 Pedobacter borealis DSM 19626 Isolate Rhizosphere
2 2684623219 Planctomyces sp. SH-PL14 Isolate Unclassified
3 2738541284 Pedobacter sp. YR016 Isolate Unclassified
4 2739367651 Pedobacter sp. OK291 Isolate Unclassified
5 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
6 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
7 2857627736 Pedobacter sp. R-74587 Isolate Unclassified
8 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere
9 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified
10 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
11 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
12 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
13 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
14 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
15 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
16 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
17 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
18 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
19 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
20 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
21 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
22 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
23 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
24 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
25 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
28 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
29 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
30 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
31 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
32 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
33 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
34 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
35 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
36 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
37 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
38 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
40 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
41 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
42 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
43 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
44 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
45 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
46 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
47 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
48 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
49 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
50 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
51 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
52 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
53 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
54 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
55 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
56 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
57 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
58 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
59 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
60 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
67 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
68 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
69 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
70 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
71 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
72 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
73 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
74 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
75 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
76 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
77 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
78 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
79 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
80 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
81 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
82 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
83 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
84 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
85 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
86 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
87 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
88 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
89 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
90 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
91 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
92 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
93 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
94 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
95 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
96 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
97 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
98 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
99 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
100 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
101 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
102 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
103 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
104 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
105 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
106 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
107 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
108 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
109 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
110 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
111 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
112 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
113 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
114 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
115 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
116 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
117 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
118 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
119 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
120 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
121 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
122 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
123 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
124 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
125 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
126 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
127 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
128 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
129 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
130 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
131 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
132 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
133 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.21
Metatranscriptomes 0
Isolates 4.79

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.11
Nodule 0
Rhizoplane 0
Rhizosphere 73.94
Stem 0
Stem Tuber 0
Unclassified 15.96

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24737J22298_10068252 3300001990 Bacteria 1063
2 JGI24735J21928_10029094 3300002067 Bacteria 1646
3 JGI25152J39213_1000182 3300002773 Bacteria 42191
4 JGI25150J39212_1000002 3300002774 Bacteria 537631
5 JGI25151J46595_10000003 3300003187 Bacteria 715330
6 JGI25165J46597_1023877 3300003214 Bacteria 794
7 JGI25153J46596_10000003 3300003215 Bacteria 553253
8 rootH2_10066954 3300003320 Bacteria 9222
9 rootH2_10200471 3300003320 Bacteria 4537
10 rootL2_10033375 3300003322 Bacteria 7219
11 Ga0055530_10052139 3300003791 Bacteria 945
12 Ga0065165_1004207 3300005262 Bacteria 9169
13 Ga0065714_10005241 3300005288 Bacteria 4055
14 Ga0065714_10143363 3300005288 Bacteria 1136
15 Ga0070658_11306110 3300005327 Bacteria 630
16 Ga0070683_101228076 3300005329 Unclassified 720
17 Ga0070677_10631650 3300005333 Bacteria 596
18 Ga0070661_101048652 3300005344 Unclassified 678
19 Ga0070659_100006786 3300005366 Bacteria 8285
20 Ga0068855_100000248 3300005563 Bacteria 67971
21 Ga0068855_100001803 3300005563 Bacteria 26743
22 Ga0068855_101910514 3300005563 Bacteria 601
23 Ga0068857_100000525 3300005577 Bacteria 27677
24 Ga0068857_100023332 3300005577 Bacteria 5445
25 Ga0068854_100196491 3300005578 Bacteria 1583
26 Ga0068854_100685118 3300005578 Bacteria 883
27 Ga0068856_102345536 3300005614 Unclassified 541
28 Ga0070717_10175957 3300006028 Bacteria 1863
29 Ga0075366_10677774 3300006195 Bacteria 640
30 Ga0075428_100003647 3300006844 Bacteria 16886
31 Ga0075428_101298671 3300006844 Bacteria 765
32 Ga0075430_100176642 3300006846 Bacteria 1777
33 Ga0075429_100203166 3300006880 Bacteria 1736
34 Ga0099794_10056126 3300007265 Bacteria 1905
35 Ga0105240_10067868 3300009093 Bacteria 4419
36 Ga0111539_10008752 3300009094 Bacteria 12839
37 Ga0111539_10060887 3300009094 Bacteria 4473
38 Ga0105237_10729024 3300009545 Bacteria 998
39 Ga0105239_10000001 3300010375 Bacteria 617353
40 Ga0157373_10000021 3300013100 Bacteria 165522
41 Ga0157373_10001533 3300013100 Bacteria 17628
42 Ga0157371_10000266 3300013102 Bacteria 71146
43 Ga0157370_10007765 3300013104 Bacteria 11628
44 Ga0157370_10044084 3300013104 Bacteria 4290
45 Ga0157370_11079573 3300013104 Bacteria 726
46 Ga0157369_10328137 3300013105 Bacteria 1590
47 Ga0157369_10843100 3300013105 Bacteria 941
48 Ga0157374_10021929 3300013296 Bacteria 5691
49 Ga0157372_10001011 3300013307 Bacteria 30755
50 Ga0157372_10177018 3300013307 Bacteria 2469
51 Ga0157375_10494673 3300013308 Bacteria 1387
52 Ga0157376_10156049 3300014969 Bacteria 2064
53 Ga0182006_1000068 3300015261 Bacteria 144823
54 Ga0163161_10000307 3300017792 Bacteria 42668
55 Ga0163161_10000858 3300017792 Bacteria 23684
56 Ga0163161_10052786 3300017792 Bacteria 2947
57 Ga0163161_10061281 3300017792 Bacteria 2738
58 Ga0213873_10030464 3300021358 Bacteria 1336
59 Ga0213875_10004933 3300021388 Bacteria 7245
60 Ga0213875_10007851 3300021388 Bacteria 5483
61 Ga0213875_10032876 3300021388 Bacteria 2450
62 Ga0213871_10001689 3300021441 Bacteria 3807
63 Ga0207425_1000004 3300025245 Bacteria 1092421
64 Ga0209129_1000005 3300025258 Bacteria 777812
65 Ga0209233_1009810 3300025261 Bacteria 2898
66 Ga0209233_1019070 3300025261 Bacteria 1831
67 Ga0209025_1000009 3300025294 Bacteria 1092561
68 Ga0209758_1000010 3300025297 Bacteria 1092782
69 Ga0209050_1002187 3300025298 Bacteria 17636
70 Ga0207647_10000211 3300025904 Bacteria 47375
71 Ga0207690_10080456 3300025932 Bacteria 2274
72 Ga0207667_10002945 3300025949 Bacteria 21128
73 Ga0207667_10958670 3300025949 Bacteria 844
74 Ga0207667_11327943 3300025949 Bacteria 695
75 Ga0207640_10655508 3300025981 Bacteria 895
76 Ga0207702_11550005 3300026078 Unclassified 656
77 Ga0207674_10002190 3300026116 Bacteria 24729
78 Ga0207674_11301945 3300026116 Bacteria 696
79 Ga0207428_10093818 3300027907 Bacteria 2327
80 Ga0265323_10162925 3300028653 Unclassified 711
81 Ga0265338_10121798 3300028800 Bacteria 2077
82 Ga0316182_1034707 3300030745 Bacteria 683
83 Ga0307513_10424324 3300031456 Bacteria 1059
84 Ga0307513_10682755 3300031456 Bacteria 733
85 Ga0307408_101138630 3300031548 Bacteria 725
86 Ga0307516_10212890 3300031730 Bacteria 1646
87 Ga0307405_10000043 3300031731 Bacteria 78391
88 Ga0307412_10000004 3300031911 Bacteria 544053
89 Ga0307412_10042386 3300031911 Bacteria 2957
90 Ga0307416_100000029 3300032002 Bacteria 164815
91 Ga0307414_10011255 3300032004 Bacteria 5238
92 Ga0307414_10345699 3300032004 Bacteria 1275
93 Ga0373954_0007238 3300035118 Unclassified 4849
94 Ga0373954_0138971 3300035118 Bacteria 1184
95 Ga0373954_0637218 3300035118 Unclassified 528
96 Ga0373956_0178578 3300035119 Unclassified 1003
97 Ga0373935_0761684 3300035692 Bacteria 714
98 Ga0373947_0250542 3300035725 Bacteria 1171
99 Ga0373937_0510178 3300036401 Bacteria 1142
100 Ga0436364_0543093 3300037853 Bacteria 5363
101 Ga0436364_0582666 3300037853 Bacteria 15527
102 Ga0436364_0738373 3300037853 Bacteria 5385
103 Ga0436364_1368749 3300037853 Bacteria 30962
104 Ga0436364_1369139 3300037853 Bacteria 52035
105 Ga0395901_0145954 3300038443 Bacteria 2487
106 Ga0395901_1405136 3300038443 Unclassified 656
107 Ga0436365_0248159 3300039437 Unclassified 1995
108 Ga0436365_0400007 3300039437 Bacteria 651
109 Ga0436365_1564076 3300039437 Bacteria 663
110 Ga0436360_0509096 3300039438 Bacteria 4319
111 Ga0436360_0750517 3300039438 Bacteria 4650
112 Ga0436360_0851519 3300039438 Bacteria 1103
113 Ga0436360_0904610 3300039438 Bacteria 1127
114 Ga0436360_1328769 3300039438 Bacteria 3304
115 Ga0436361_0116532 3300039447 Unclassified 895
116 Ga0436361_0360555 3300039447 Bacteria 955
117 Ga0436363_0137732 3300039450 Bacteria 1064
118 Ga0436363_0299156 3300039450 Bacteria 1757
119 Ga0436363_0467269 3300039450 Bacteria 4825
120 Ga0436363_0680751 3300039450 Bacteria 2924
121 Ga0436363_1039836 3300039450 Bacteria 844
122 Ga0436363_1552373 3300039450 Unclassified 763
123 Ga0436362_0176214 3300039453 Bacteria 659
124 Ga0436362_0420269 3300039453 Bacteria 734
125 Ga0436362_0916298 3300039453 Bacteria 2532
126 Ga0436362_1015309 3300039453 Bacteria 744
127 Ga0436362_1130861 3300039453 Bacteria 708
128 Ga0451577_0011267 3300042876 Bacteria 8470
129 Ga0466964_0319976 3300044706 Unclassified 788
130 Ga0453684_0004908 3300044712 Bacteria 27376
131 Ga0466968_0627320 3300044735 Bacteria 544
132 Ga0466970_0821310 3300044765 Bacteria 545
133 Ga0466959_0479995 3300045049 Bacteria 841
134 Ga0451576_0015753 3300045051 Bacteria 8368
135 Ga0451576_2438773 3300045051 Bacteria 535
136 Ga0466958_0110816 3300045836 Bacteria 1713
137 Ga0466958_0673895 3300045836 Unclassified 673
138 Ga0495592_0064556 3300046454 Unclassified 2683
139 Ga0495603_0364297 3300046455 Unclassified 829
140 Ga0495638_0000001 3300046460 Bacteria 1114121
141 Ga0495641_0015131 3300046461 Unclassified 4139
142 Ga0495651_0145763 3300046462 Bacteria 1712
143 Ga0495651_0556406 3300046462 Unclassified 728
144 Ga0495651_0597295 3300046462 Bacteria 697
145 Ga0495606_0053659 3300046507 Bacteria 2615
146 Ga0495608_0257204 3300046511 Bacteria 1088
147 Ga0495610_0000026 3300046512 Bacteria 284737
148 Ga0495628_0568957 3300046516 Unclassified 812
149 Ga0495630_0484632 3300046517 Unclassified 948
150 Ga0495586_0002732 3300046535 Bacteria 9546
151 Ga0495587_0066678 3300046536 Unclassified 2099
152 Ga0495667_0335609 3300046559 Unclassified 956
153 Ga0495634_0078064 3300046642 Unclassified 2170
154 Ga0495634_0081201 3300046642 Unclassified 2121
155 Ga0495599_0067037 3300046678 Unclassified 2242
156 Ga0495647_0019730 3300046681 Bacteria 2414
157 Ga0495658_0013468 3300046683 Bacteria 4163
158 Ga0495613_0076345 3300046689 Bacteria 2438
159 Ga0495680_0314033 3300047322 Bacteria 1098
160 Ga0495681_0070342 3300047470 Bacteria 1587
161 Ga0495684_0204642 3300047471 Unclassified 1454
162 Ga0495686_0002147 3300047472 Bacteria 19284
163 Ga0495686_0534150 3300047472 Unclassified 614
164 Ga0501202_023221 3300049652 Bacteria 1250
165 Ga0501206_006512 3300049653 Bacteria 1520
166 Ga0501207_026055 3300049654 Bacteria 961
167 Ga0501222_037752 3300049662 Bacteria 679
168 Ga0501223_003909 3300049663 Bacteria 3216
169 Ga0501242_000341 3300049674 Bacteria 3865
170 Ga0501257_023348 3300049686 Bacteria 1466
171 Ga0501225_0021889 3300049705 Bacteria 1764
172 Ga0501280_004235 3300049776 Bacteria 2123
173 Ga0501204_103929 3300049850 Unclassified 511
174 nmdc:mga0k408_552690_c1 3300050493 Bacteria 680
175 nmdc:mga08y16_12456_c1 3300050511 Bacteria 8946
176 nmdc:mga08y16_39455_c1 3300050511 Bacteria 4954
177 Ga0500635_0001192 3300053080 Bacteria 6227
178 Ga0500568_0034515 3300053139 Bacteria 2069
179 Ga0500577_0168507 3300053142 Bacteria 936

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049652 Ga0501202_023221 Ga0501202_023221_412_816 122
2 3300049653 Ga0501206_006512 Ga0501206_006512_790_1194 122
3 3300049654 Ga0501207_026055 Ga0501207_026055_210_614 122
4 3300049662 Ga0501222_037752 Ga0501222_037752_213_617 122
5 3300049674 Ga0501242_000341 Ga0501242_000341_2973_3377 122
6 3300049686 Ga0501257_023348 Ga0501257_023348_600_1004 122
7 3300049705 Ga0501225_0021889 Ga0501225_0021889_399_803 122
8 3300049663 Ga0501223_003909 Ga0501223_003909_1205_1588 126
9 3300038443 Ga0395901_1405136 Ga0395901_1405136_37_426 127
10 3300044706 Ga0466964_0319976 Ga0466964_0319976_333_722 127
11 3300044735 Ga0466968_0627320 Ga0466968_0627320_48_437 127
12 3300045836 Ga0466958_0673895 Ga0466958_0673895_95_484 127
13 iso_pu_bacteria 2585427687 2586207342 130
14 iso_pu_bacteria 2738541284 2738763664 130
15 iso_pu_bacteria 2739367651 2739589876 130
16 iso_pu_bacteria 2842722452 2842722613 130
17 iso_pu_bacteria 2842909656 2842914491 130
18 iso_pu_bacteria 2857627736 2857630331 130
19 iso_pu_bacteria 2954016120 2954016276 130
20 iso_pu_bacteria 2977232053 2977236264 130
21 3300039450 Ga0436363_0137732 Ga0436363_0137732_509_991 131
22 3300003320 rootH2_10200471 rootH2_102004712 132
23 3300003322 rootL2_10033375 rootL2_100333752 132
24 3300003791 Ga0055530_10052139 Ga0055530_100521392 132
25 3300005262 Ga0065165_1004207 Ga0065165_10042074 132
26 3300005333 Ga0070677_10631650 Ga0070677_106316501 132
27 3300006195 Ga0075366_10677774 Ga0075366_106777741 132
28 3300006844 Ga0075428_100003647 Ga0075428_1000036472 132
29 3300006844 Ga0075428_101298671 Ga0075428_1012986712 132
30 3300006846 Ga0075430_100176642 Ga0075430_1001766423 132
31 3300006880 Ga0075429_100203166 Ga0075429_1002031662 132
32 3300009094 Ga0111539_10008752 Ga0111539_100087527 132
33 3300009094 Ga0111539_10060887 Ga0111539_100608874 132
34 3300009545 Ga0105237_10729024 Ga0105237_107290241 132
35 3300025298 Ga0209050_1002187 Ga0209050_10021872 132
36 3300027907 Ga0207428_10093818 Ga0207428_100938182 132
37 3300031456 Ga0307513_10424324 Ga0307513_104243242 132
38 3300031456 Ga0307513_10682755 Ga0307513_106827552 132
39 3300031548 Ga0307408_101138630 Ga0307408_1011386301 132
40 3300031730 Ga0307516_10212890 Ga0307516_102128901 132
41 3300042876 Ga0451577_0011267 Ga0451577_0011267_1298_1699 132
42 3300044712 Ga0453684_0004908 Ga0453684_0004908_8461_8862 132
43 3300045051 Ga0451576_0015753 Ga0451576_0015753_7646_8047 132
44 3300046460 Ga0495638_0000001 Ga0495638_0000001_497829_498239 132
45 3300050493 nmdc:mga0k408_552690_c1 nmdc:mga0k408_552690_c1_63_473 132
46 3300050511 nmdc:mga08y16_12456_c1 nmdc:mga08y16_12456_c1_6507_6911 132
47 3300050511 nmdc:mga08y16_39455_c1 nmdc:mga08y16_39455_c1_4328_4735 132
48 3300053142 Ga0500577_0168507 Ga0500577_0168507_183_593 132
49 3300001990 JGI24737J22298_10068252 JGI24737J22298_100682521 134
50 3300002067 JGI24735J21928_10029094 JGI24735J21928_100290942 134
51 3300002773 JGI25152J39213_1000182 JGI25152J39213_10001828 134
52 3300002774 JGI25150J39212_1000002 JGI25150J39212_100000277 134
53 3300003187 JGI25151J46595_10000003 JGI25151J46595_10000003578 134
54 3300003214 JGI25165J46597_1023877 JGI25165J46597_10238771 134
55 3300003215 JGI25153J46596_10000003 JGI25153J46596_10000003410 134
56 3300003320 rootH2_10066954 rootH2_100669546 134
57 3300005288 Ga0065714_10005241 Ga0065714_100052411 134
58 3300005288 Ga0065714_10143363 Ga0065714_101433631 134
59 3300005327 Ga0070658_11306110 Ga0070658_113061101 134
60 3300005329 Ga0070683_101228076 Ga0070683_1012280761 134
61 3300005344 Ga0070661_101048652 Ga0070661_1010486521 134
62 3300005366 Ga0070659_100006786 Ga0070659_1000067867 134
63 3300005563 Ga0068855_100000248 Ga0068855_10000024855 134
64 3300005563 Ga0068855_100001803 Ga0068855_1000018039 134
65 3300005563 Ga0068855_101910514 Ga0068855_1019105141 134
66 3300005577 Ga0068857_100000525 Ga0068857_10000052510 134
67 3300005577 Ga0068857_100023332 Ga0068857_1000233326 134
68 3300005578 Ga0068854_100196491 Ga0068854_1001964911 134
69 3300005578 Ga0068854_100685118 Ga0068854_1006851181 134
70 3300005614 Ga0068856_102345536 Ga0068856_1023455361 134
71 3300006028 Ga0070717_10175957 Ga0070717_101759572 134
72 3300007265 Ga0099794_10056126 Ga0099794_100561262 134
73 3300009093 Ga0105240_10067868 Ga0105240_100678686 134
74 3300010375 Ga0105239_10000001 Ga0105239_10000001210 134
75 3300013100 Ga0157373_10000021 Ga0157373_1000002171 134
76 3300013100 Ga0157373_10001533 Ga0157373_1000153310 134
77 3300013102 Ga0157371_10000266 Ga0157371_1000026656 134
78 3300013104 Ga0157370_10007765 Ga0157370_100077655 134
79 3300013104 Ga0157370_10044084 Ga0157370_100440842 134
80 3300013104 Ga0157370_11079573 Ga0157370_110795732 134
81 3300013105 Ga0157369_10328137 Ga0157369_103281372 134
82 3300013105 Ga0157369_10843100 Ga0157369_108431001 134
83 3300013296 Ga0157374_10021929 Ga0157374_100219293 134
84 3300013307 Ga0157372_10001011 Ga0157372_1000101124 134
85 3300013307 Ga0157372_10177018 Ga0157372_101770182 134
86 3300013308 Ga0157375_10494673 Ga0157375_104946731 134
87 3300014969 Ga0157376_10156049 Ga0157376_101560492 134
88 3300015261 Ga0182006_1000068 Ga0182006_100006870 134
89 3300017792 Ga0163161_10000307 Ga0163161_1000030720 134
90 3300017792 Ga0163161_10000858 Ga0163161_100008586 134
91 3300017792 Ga0163161_10052786 Ga0163161_100527863 134
92 3300017792 Ga0163161_10061281 Ga0163161_100612812 134
93 3300021358 Ga0213873_10030464 Ga0213873_100304642 134
94 3300021388 Ga0213875_10004933 Ga0213875_100049337 134
95 3300021388 Ga0213875_10007851 Ga0213875_100078512 134
96 3300021388 Ga0213875_10032876 Ga0213875_100328762 134
97 3300021441 Ga0213871_10001689 Ga0213871_100016892 134
98 3300025245 Ga0207425_1000004 Ga0207425_1000004863 134
99 3300025258 Ga0209129_1000005 Ga0209129_100000577 134
100 3300025261 Ga0209233_1009810 Ga0209233_10098104 134
101 3300025261 Ga0209233_1019070 Ga0209233_10190702 134
102 3300025294 Ga0209025_1000009 Ga0209025_1000009863 134
103 3300025297 Ga0209758_1000010 Ga0209758_1000010864 134
104 3300025904 Ga0207647_10000211 Ga0207647_1000021120 134
105 3300025932 Ga0207690_10080456 Ga0207690_100804561 134
106 3300025949 Ga0207667_10002945 Ga0207667_1000294514 134
107 3300025949 Ga0207667_10958670 Ga0207667_109586702 134
108 3300025949 Ga0207667_11327943 Ga0207667_113279431 134
109 3300025981 Ga0207640_10655508 Ga0207640_106555082 134
110 3300026078 Ga0207702_11550005 Ga0207702_115500052 134
111 3300026116 Ga0207674_10002190 Ga0207674_1000219010 134
112 3300026116 Ga0207674_11301945 Ga0207674_113019451 134
113 3300028653 Ga0265323_10162925 Ga0265323_101629251 134
114 3300028800 Ga0265338_10121798 Ga0265338_101217982 134
115 3300030745 Ga0316182_1034707 Ga0316182_10347071 134
116 3300031731 Ga0307405_10000043 Ga0307405_1000004376 134
117 3300031911 Ga0307412_10000004 Ga0307412_1000000450 134
118 3300031911 Ga0307412_10042386 Ga0307412_100423862 134
119 3300032002 Ga0307416_100000029 Ga0307416_1000000292 134
120 3300032004 Ga0307414_10011255 Ga0307414_100112552 134
121 3300032004 Ga0307414_10345699 Ga0307414_103456992 134
122 3300035118 Ga0373954_0007238 Ga0373954_0007238_2354_2761 134
123 3300035118 Ga0373954_0138971 Ga0373954_0138971_42_449 134
124 3300035118 Ga0373954_0637218 Ga0373954_0637218_108_515 134
125 3300035119 Ga0373956_0178578 Ga0373956_0178578_99_506 134
126 3300035692 Ga0373935_0761684 Ga0373935_0761684_262_669 134
127 3300035725 Ga0373947_0250542 Ga0373947_0250542_496_909 134
128 3300036401 Ga0373937_0510178 Ga0373937_0510178_103_510 134
129 3300037853 Ga0436364_0543093 Ga0436364_0543093_3152_3643 134
130 3300037853 Ga0436364_0582666 Ga0436364_0582666_6967_7443 134
131 3300037853 Ga0436364_0738373 Ga0436364_0738373_4881_5339 134
132 3300037853 Ga0436364_1368749 Ga0436364_1368749_1145_1621 134
133 3300037853 Ga0436364_1369139 Ga0436364_1369139_49607_50077 134
134 3300038443 Ga0395901_0145954 Ga0395901_0145954_526_930 134
135 3300039437 Ga0436365_0248159 Ga0436365_0248159_1324_1791 134
136 3300039437 Ga0436365_0400007 Ga0436365_0400007_97_561 134
137 3300039437 Ga0436365_1564076 Ga0436365_1564076_116_628 134
138 3300039438 Ga0436360_0509096 Ga0436360_0509096_3415_3897 134
139 3300039438 Ga0436360_0750517 Ga0436360_0750517_1833_2300 134
140 3300039438 Ga0436360_0851519 Ga0436360_0851519_565_1023 134
141 3300039438 Ga0436360_0904610 Ga0436360_0904610_411_881 134
142 3300039438 Ga0436360_1328769 Ga0436360_1328769_430_897 134
143 3300039447 Ga0436361_0116532 Ga0436361_0116532_26_481 134
144 3300039447 Ga0436361_0360555 Ga0436361_0360555_90_560 134
145 3300039450 Ga0436363_0299156 Ga0436363_0299156_411_878 134
146 3300039450 Ga0436363_0467269 Ga0436363_0467269_4322_4792 134
147 3300039450 Ga0436363_0680751 Ga0436363_0680751_896_1375 134
148 3300039450 Ga0436363_1039836 Ga0436363_1039836_282_776 134
149 3300039450 Ga0436363_1552373 Ga0436363_1552373_169_678 134
150 3300039453 Ga0436362_0176214 Ga0436362_0176214_125_598 134
151 3300039453 Ga0436362_0420269 Ga0436362_0420269_259_717 134
152 3300039453 Ga0436362_0916298 Ga0436362_0916298_1716_2183 134
153 3300039453 Ga0436362_1015309 Ga0436362_1015309_57_545 134
154 3300039453 Ga0436362_1130861 Ga0436362_1130861_98_553 134
155 3300044765 Ga0466970_0821310 Ga0466970_0821310_59_514 134
156 3300045049 Ga0466959_0479995 Ga0466959_0479995_291_758 134
157 3300045051 Ga0451576_2438773 Ga0451576_2438773_80_487 134
158 3300045836 Ga0466958_0110816 Ga0466958_0110816_1180_1647 134
159 3300046454 Ga0495592_0064556 Ga0495592_0064556_946_1353 134
160 3300046455 Ga0495603_0364297 Ga0495603_0364297_231_650 134
161 3300046461 Ga0495641_0015131 Ga0495641_0015131_1381_1800 134
162 3300046462 Ga0495651_0145763 Ga0495651_0145763_586_993 134
163 3300046462 Ga0495651_0556406 Ga0495651_0556406_162_575 134
164 3300046462 Ga0495651_0597295 Ga0495651_0597295_156_680 134
165 3300046507 Ga0495606_0053659 Ga0495606_0053659_187_591 134
166 3300046511 Ga0495608_0257204 Ga0495608_0257204_25_432 134
167 3300046512 Ga0495610_0000026 Ga0495610_0000026_157631_158035 134
168 3300046516 Ga0495628_0568957 Ga0495628_0568957_320_727 134
169 3300046517 Ga0495630_0484632 Ga0495630_0484632_338_745 134
170 3300046535 Ga0495586_0002732 Ga0495586_0002732_6355_6774 134
171 3300046536 Ga0495587_0066678 Ga0495587_0066678_489_896 134
172 3300046559 Ga0495667_0335609 Ga0495667_0335609_196_600 134
173 3300046642 Ga0495634_0078064 Ga0495634_0078064_1258_1665 134
174 3300046642 Ga0495634_0081201 Ga0495634_0081201_1466_1885 134
175 3300046678 Ga0495599_0067037 Ga0495599_0067037_606_1013 134
176 3300046681 Ga0495647_0019730 Ga0495647_0019730_106_525 134
177 3300046683 Ga0495658_0013468 Ga0495658_0013468_1846_2265 134
178 3300046689 Ga0495613_0076345 Ga0495613_0076345_1843_2262 134
179 3300047322 Ga0495680_0314033 Ga0495680_0314033_147_554 134
180 3300047470 Ga0495681_0070342 Ga0495681_0070342_88_501 134
181 3300047471 Ga0495684_0204642 Ga0495684_0204642_560_967 134
182 3300047472 Ga0495686_0002147 Ga0495686_0002147_16423_16830 134
183 3300047472 Ga0495686_0534150 Ga0495686_0534150_62_490 134
184 3300049776 Ga0501280_004235 Ga0501280_004235_390_806 134
185 3300049850 Ga0501204_103929 Ga0501204_103929_13_420 134
186 3300053080 Ga0500635_0001192 Ga0500635_0001192_3296_3700 134
187 3300053139 Ga0500568_0034515 Ga0500568_0034515_11_466 134
188 iso_pu_bacteria 2684623219 2687237402 134

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01878

EVE

EVE domain

30

176

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
1zce-assembly1.cif.gz_A x-ray crystal structure of protein atu2648 from agrobacterium tumefaciens. northeast structural genomics consortium target atr33. 0.9885 1 134
1zce-assembly1.cif.gz_A x-ray crystal structure of protein atu2648 from agrobacterium tumefaciens. northeast structural genomics consortium target atr33. 0.9812 1 134
2gbs-assembly1.cif.gz_A nmr structure of rpa0253 from rhodopseudomonas palustris. northeast structural genomics consortium target rpr3 0.9613 1 133
2gbs-assembly1.cif.gz_A nmr structure of rpa0253 from rhodopseudomonas palustris. northeast structural genomics consortium target rpr3 0.9475 1 133
2ar1-assembly1.cif.gz_A structure of hypothetical protein from leishmania major 0.9459 1 133
ID Description Score Start End Superfamily
af_A4ICC8_1_164_3.10.590.10 Alpha Beta;Roll;ph1033 like fold;ph1033 like domains 0.9526 1 133 3.10.590.10
af_I1JAX2_1_77_3.10.590.10 Alpha Beta;Roll;ph1033 like fold;ph1033 like domains 0.946 1 71 3.10.590.10
af_Q9ZVK5_4_152_3.10.590.10 Alpha Beta;Roll;ph1033 like fold;ph1033 like domains 0.9427 2 133 3.10.590.10
1zceA00 Alpha Beta;Roll;ph1033 like fold;ph1033 like domains 0.9401 1 131 3.10.590.10
af_A4ICC8_1_164_3.10.590.10 Alpha Beta;Roll;ph1033 like fold;ph1033 like domains 0.9387 1 133 3.10.590.10
ID Description Score Start End GO Terms
AF-A0A2V6EM40-F1-model_v4 EVE domain-containing protein 1.006 2 67
AF-A0A3D4TA91-F1-model_v4 EVE domain-containing protein 1.005 1 65
AF-A0A1H0TPL0-F1-model_v4 Predicted RNA-binding protein, contains PUA-like domain 1.004 1 134
AF-A0A1M7P821-F1-model_v4 Predicted RNA-binding protein, contains PUA-like domain 1.004 1 134
AF-A0A1Q5ZU84-F1-model_v4 EVE domain-containing protein 1.003 1 134

Feature Viewer

pLDDT pTM Quality
95.5 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map