F288449

General Info

Members Datasets Scaffolds Average Seq Length
187 141 374 256

Family's Representative Sequence

Representative Sequence 3300053087|Ga0500643_013407|Ga0500643_013407_1329_2171
Length 280
Sequence MLLAIDAGNTNVVFAVYEADQRRGMWRAATDPRRTGDEYAVWLTQLMGTVGLTPSAITDCIIASVVPTATFNLLKLSREHFRVEPLVVGESAAGGLPVELGIQVRMDRPEEVGADRLVNAVAAAERYGGPLIVVDFGTATTFDVVDAAGDYRGGVIAPGINLSLEALHMAAAKLPKIEVAKPRHGSVIGTNTVAAMQSGVYWGYVGLIEGLLVRLKNEMQAFGSDRVPKVIATGGLAVLFAEATDAIETIDEDLTLRGLVLLQRRNQVASARTPNMKSTS

Samples

Sample ID Description Type Environment
1 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
2 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
3 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
4 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
5 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
6 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
7 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
8 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
9 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
10 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
11 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
12 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
13 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
14 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
15 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
16 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
17 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
18 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
19 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
20 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
21 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
22 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
23 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
24 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
25 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
26 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
27 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
28 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
29 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
30 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
31 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
32 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
33 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
34 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
35 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
36 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
37 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
38 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
53 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
56 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
57 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
58 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
59 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
60 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
61 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
62 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
63 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
64 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
65 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
66 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
67 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
68 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
69 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
70 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
71 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
72 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
73 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
74 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
75 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
76 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
77 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
78 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
79 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
80 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
81 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
82 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
83 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
84 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
85 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
86 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
87 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
88 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
89 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
90 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
91 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
92 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
93 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
94 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
95 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
96 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
97 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
98 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
99 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
100 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
101 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
102 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
103 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
104 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
105 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
106 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
107 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
108 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
109 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
110 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
111 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
112 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
113 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
114 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
115 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
116 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
117 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
118 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
119 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
120 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
121 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
122 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
123 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
124 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
125 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
126 2511231221 Azospirillum lipoferum 4B Isolate Rhizosphere
127 2522572158 Azospirillum halopraeferens DSM 3675 Isolate Unclassified
128 2597490356 Azospirillum brasilense sp7 Isolate Unclassified
129 2713897090 Paracoccus sphaerophysae HAMBI 3106 Isolate Nodule
130 2834578030 Paracoccus thiocyanatus SST Isolate Unclassified
131 2840878972 Albibacillus kandeliae J95 Isolate Rhizosphere
132 2846952575 Azospirillum brasilense sp7 Isolate Unclassified
133 2848858292 Azospirillum brasilense Az39 Isolate Unclassified
134 2883291878 Hypericibacter terrae R5913 Isolate Rhizosphere
135 2883354860 Hypericibacter adhaerens R5959 Isolate Rhizosphere
136 2897803580 Azospirillum doebereinerae GSF71 Isolate Unclassified
137 2899259804 Paracoccus aeridis JC501 Isolate Rhizosphere
138 2919679072 Pseudotabrizicola sp. 4114 Isolate Unclassified
139 2928972540 Brevundimonas sp. 1080 Isolate Rhizosphere
140 2977240413 Brevundimonas vesicularis SORGH_AS 431 Isolate Unclassified
141 8054002106 Azospirillum lipoferum 59b Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 90.91
Metatranscriptomes 0.53
Isolates 8.56

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.49
Nodule 0.53
Rhizoplane 2.67
Rhizosphere 82.35
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0500643_013407 3300053087 Bacteria 2894
2 Ga0068869_100155591 3300005334 Bacteria 1776
3 Ga0070669_100021275 3300005353 Bacteria 4636
4 Ga0070675_100287757 3300005354 Bacteria 1446
5 Ga0070674_100033323 3300005356 Bacteria 3428
6 Ga0070667_100619222 3300005367 Bacteria 998
7 Ga0070713_100339819 3300005436 Bacteria 1391
8 Ga0070705_100075209 3300005440 Bacteria 2056
9 Ga0070705_100166256 3300005440 Bacteria 1480
10 Ga0070700_100395410 3300005441 Bacteria 1038
11 Ga0070662_100186176 3300005457 Bacteria 1639
12 Ga0070681_10337893 3300005458 Bacteria 1415
13 Ga0070699_100672599 3300005518 Bacteria 945
14 Ga0070679_100242240 3300005530 Bacteria 1761
15 Ga0070679_100326108 3300005530 Bacteria 1484
16 Ga0070696_100007228 3300005546 Bacteria 7412
17 Ga0070696_100029456 3300005546 Bacteria 3753
18 Ga0070693_100490783 3300005547 Bacteria 869
19 Ga0070704_100118831 3300005549 Bacteria 2026
20 Ga0068855_100119949 3300005563 Bacteria 3011
21 Ga0068855_100442714 3300005563 Bacteria 1419
22 Ga0068855_100964301 3300005563 Bacteria 898
23 Ga0068862_100106041 3300005844 Bacteria 2463
24 Ga0081538_10002356 3300005981 Bacteria 18584
25 Ga0075428_100117568 3300006844 Bacteria 2896
26 Ga0075430_100041075 3300006846 Bacteria 3914
27 Ga0075431_100587940 3300006847 Bacteria 1098
28 Ga0105240_10019423 3300009093 Bacteria 9079
29 Ga0105240_10052885 3300009093 Bacteria 5102
30 Ga0105240_10131511 3300009093 Bacteria 3001
31 Ga0111539_10000331 3300009094 Bacteria 57983
32 Ga0111539_10808777 3300009094 Bacteria 1091
33 Ga0105241_10481071 3300009174 Bacteria 1104
34 Ga0105238_10426291 3300009551 Bacteria 1322
35 Ga0157373_10065850 3300013100 Bacteria 2564
36 Ga0157371_10116623 3300013102 Bacteria 1898
37 Ga0157371_10242055 3300013102 Bacteria 1298
38 Ga0157370_10014964 3300013104 Bacteria 7910
39 Ga0157370_10028134 3300013104 Bacteria 5534
40 Ga0157370_10063790 3300013104 Bacteria 3489
41 Ga0157369_10049815 3300013105 Bacteria 4538
42 Ga0157372_10231772 3300013307 Bacteria 2141
43 Ga0163163_10346880 3300014325 Bacteria 1540
44 Ga0157380_10043803 3300014326 Bacteria 3505
45 Ga0157380_10524539 3300014326 Bacteria 1156
46 Ga0182008_10075503 3300014497 Bacteria 1658
47 Ga0163161_10359608 3300017792 Bacteria 1159
48 Ga0206356_10431194 3300020070 Bacteria 1583
49 Ga0213872_10000603 3300021361 Bacteria 27341
50 Ga0213872_10022134 3300021361 Bacteria 2927
51 Ga0207707_10043912 3300025912 Bacteria 3897
52 Ga0207707_10297261 3300025912 Bacteria 1397
53 Ga0207695_10038990 3300025913 Bacteria 5109
54 Ga0207695_10040177 3300025913 Bacteria 5020
55 Ga0207660_10023405 3300025917 Bacteria 4171
56 Ga0207652_10010165 3300025921 Bacteria 7579
57 Ga0207681_10074139 3300025923 Bacteria 2383
58 Ga0207694_10008152 3300025924 Bacteria 7917
59 Ga0207664_10001376 3300025929 Bacteria 15967
60 Ga0207706_10271653 3300025933 Bacteria 1479
61 Ga0207669_10003304 3300025937 Bacteria 6977
62 Ga0207689_10036162 3300025942 Bacteria 4100
63 Ga0207667_10204567 3300025949 Bacteria 2025
64 Ga0207712_10501478 3300025961 Bacteria 1038
65 Ga0207702_10385893 3300026078 Bacteria 1348
66 Ga0207675_100055369 3300026118 Bacteria 3700
67 Ga0207428_10000242 3300027907 Bacteria 74839
68 Ga0268266_10027369 3300028379 Bacteria 4848
69 Ga0268265_10188881 3300028380 Bacteria 1777
70 Ga0265337_1015734 3300028556 Bacteria 2467
71 Ga0265334_10037285 3300028573 Bacteria 1917
72 Ga0265338_10008222 3300028800 Bacteria 12707
73 Ga0265338_10026124 3300028800 Bacteria 5901
74 Ga0265338_10119051 3300028800 Bacteria 2109
75 Ga0265338_10241095 3300028800 Bacteria 1339
76 Ga0265338_10491152 3300028800 Bacteria 865
77 Ga0265324_10019860 3300029957 Bacteria 2418
78 Ga0265328_10005613 3300031239 Bacteria 5362
79 Ga0265320_10012914 3300031240 Bacteria 4827
80 Ga0265331_10000066 3300031250 Bacteria 163571
81 Ga0265331_10011563 3300031250 Bacteria 4828
82 Ga0265327_10000428 3300031251 Bacteria 76098
83 Ga0265327_10000602 3300031251 Bacteria 59632
84 Ga0265327_10065717 3300031251 Bacteria 1833
85 Ga0265327_10101779 3300031251 Bacteria 1385
86 Ga0265316_10013535 3300031344 Bacteria 7241
87 Ga0265313_10000788 3300031595 Bacteria 32028
88 Ga0265313_10001237 3300031595 Bacteria 24347
89 Ga0265314_10014669 3300031711 Bacteria 6254
90 Ga0265314_10091853 3300031711 Bacteria 1974
91 Ga0265342_10150945 3300031712 Bacteria 1290
92 Ga0307409_100008031 3300031995 Bacteria 6364
93 Ga0307409_100097265 3300031995 Bacteria 2431
94 Ga0307414_10370637 3300032004 Bacteria 1235
95 Ga0307411_10433788 3300032005 Bacteria 1095
96 Ga0373940_0038326 3300035088 Bacteria 1308
97 Ga0373933_0009102 3300035724 Bacteria 5420
98 Ga0373937_0002676 3300036401 Bacteria 14852
99 Ga0395899_0009300 3300037312 Bacteria 7546
100 Ga0395901_0687013 3300038443 Bacteria 1023
101 Ga0400483_108857 3300039062 Bacteria 2127
102 Ga0400483_162194 3300039062 Bacteria 2628
103 Ga0400483_252808 3300039062 Bacteria 1532
104 Ga0436360_1097697 3300039438 Bacteria 2328
105 Ga0436360_1280575 3300039438 Bacteria 1332
106 Ga0436361_0008883 3300039447 Bacteria 2028
107 Ga0451577_0041379 3300042876 Bacteria 4136
108 Ga0453683_0041915 3300044673 Bacteria 2875
109 Ga0453683_0182436 3300044673 Bacteria 1331
110 Ga0466966_0129091 3300044684 Bacteria 1549
111 Ga0453684_0012492 3300044712 Bacteria 13986
112 Ga0453684_0018305 3300044712 Bacteria 10766
113 Ga0453684_0105104 3300044712 Bacteria 3445
114 Ga0453684_0383173 3300044712 Bacteria 1578
115 Ga0466957_0021991 3300044842 Bacteria 3761
116 Ga0451576_0000030 3300045051 Bacteria 403352
117 Ga0451576_0001548 3300045051 Bacteria 38737
118 Ga0451576_0002190 3300045051 Bacteria 30140
119 Ga0451576_0010029 3300045051 Bacteria 10911
120 Ga0451576_0036243 3300045051 Bacteria 5230
121 Ga0451576_0037557 3300045051 Bacteria 5130
122 Ga0451576_0201978 3300045051 Bacteria 2076
123 Ga0466958_0009529 3300045836 Bacteria 5413
124 Ga0495681_0085657 3300047470 Bacteria 1399
125 Ga0496103_0047536 3300048906 Bacteria 2652
126 Ga0496107_0300513 3300048910 Bacteria 1195
127 Ga0496110_0472211 3300048913 Bacteria 1143
128 Ga0496112_0282742 3300048915 Bacteria 1606
129 Ga0496115_0120283 3300048918 Bacteria 2160
130 Ga0496122_0041244 3300048925 Bacteria 3653
131 Ga0501032_0000012 3300049569 Bacteria 193329
132 Ga0501033_0038101 3300049570 Bacteria 3597
133 Ga0501033_0068825 3300049570 Bacteria 2602
134 Ga0501034_0000001 3300049571 Bacteria 2184493
135 Ga0501039_0000020 3300049575 Bacteria 162656
136 Ga0501042_0202879 3300049578 Bacteria 1430
137 Ga0501070_0038953 3300049586 Bacteria 3966
138 Ga0501071_0528214 3300049587 Bacteria 906
139 Ga0501073_0128964 3300049589 Bacteria 1753
140 Ga0501073_0174281 3300049589 Bacteria 1489
141 Ga0501075_0168283 3300049591 Bacteria 1672
142 Ga0501081_0200420 3300049743 Bacteria 1447
143 Ga0501083_0006468 3300049744 Bacteria 8311
144 Ga0501083_0022048 3300049744 Bacteria 4421
145 Ga0501035_0376423 3300049822 Bacteria 1185
146 Ga0501045_0289155 3300049824 Bacteria 1220
147 nmdc:mga05p37_614196_c1 3300050507 Bacteria 1225
148 nmdc:mga0qj67_22662_c1 3300050509 Bacteria 4825
149 nmdc:mga06r32_586540_c1 3300050510 Bacteria 1086
150 nmdc:mga06r32_645160_c1 3300050510 Bacteria 1027
151 nmdc:mga08y16_35_c1 3300050511 Bacteria 157578
152 nmdc:mga0a205_53269_c2 3300050515 Bacteria 2732
153 nmdc:mga0a205_679665_c1 3300050515 Bacteria 880
154 Ga0500644_0123124 3300053088 Bacteria 1013
155 Ga0500647_0014877 3300053091 Bacteria 3547
156 Ga0500562_000021 3300053108 Bacteria 112425
157 Ga0500595_021657 3300053119 Bacteria 2291
158 Ga0500642_0017485 3300053130 Bacteria 2750
159 Ga0500642_0113984 3300053130 Bacteria 1263
160 Ga0500652_000040 3300053131 Bacteria 68826
161 Ga0500573_0083539 3300053140 Bacteria 1813
162 Ga0500588_0000255 3300053146 Bacteria 7681
163 Ga0500588_0011386 3300053146 Bacteria 2176
164 Ga0500616_0013636 3300053153 Bacteria 4709
165 Ga0500637_0000190 3300053178 Bacteria 22829
166 Ga0500601_000480 3300053737 Bacteria 6295
167 Ga0501084_0474893 3300054114 Bacteria 1057
168 Ga0590071_046333 3300059421 Bacteria 1050
169 Ga0590074_020878 3300059423 Bacteria 1128
170 Ga0590077_020100 3300059426 Bacteria 1417
171 Ga0466962_0080009 3300061719 Bacteria 1562
172 2512033969 2511231221 Bacteria 6846400
173 2523105266 2522572158 Bacteria 6514390
174 2599101432 2597490356 Bacteria 7030811
175 2715499636 2713897090 Bacteria 3353799
176 2834579936 2834578030 Bacteria 3530182
177 2840883810 2840878972 Bacteria 5483153
178 2846953844 2846952575 Bacteria 6587527
179 2848859972 2848858292 Bacteria 7391279
180 2883294322 2883291878 Bacteria 5894118
181 2883357153 2883354860 Bacteria 5865246
182 2897809958 2897803580 Bacteria 7000062
183 2899261567 2899259804 Bacteria 3320927
184 2919680999 2919679072 Bacteria 4629602
185 2928975119 2928972540 Bacteria 3058286
186 2977241888 2977240413 Bacteria 3191065
187 8054004545 8054002106 Bacteria 7987183
188 Ga0500643_013407
189 Ga0068869_100155591
190 Ga0070669_100021275
191 Ga0070675_100287757
192 Ga0070674_100033323
193 Ga0070667_100619222
194 Ga0070713_100339819
195 Ga0070705_100075209
196 Ga0070705_100166256
197 Ga0070700_100395410
198 Ga0070662_100186176
199 Ga0070681_10337893
200 Ga0070699_100672599
201 Ga0070679_100242240
202 Ga0070679_100326108
203 Ga0070696_100007228
204 Ga0070696_100029456
205 Ga0070693_100490783
206 Ga0070704_100118831
207 Ga0068855_100119949
208 Ga0068855_100442714
209 Ga0068855_100964301
210 Ga0068862_100106041
211 Ga0081538_10002356
212 Ga0075428_100117568
213 Ga0075430_100041075
214 Ga0075431_100587940
215 Ga0105240_10019423
216 Ga0105240_10052885
217 Ga0105240_10131511
218 Ga0111539_10000331
219 Ga0111539_10808777
220 Ga0105241_10481071
221 Ga0105238_10426291
222 Ga0157373_10065850
223 Ga0157371_10116623
224 Ga0157371_10242055
225 Ga0157370_10014964
226 Ga0157370_10028134
227 Ga0157370_10063790
228 Ga0157369_10049815
229 Ga0157372_10231772
230 Ga0163163_10346880
231 Ga0157380_10043803
232 Ga0157380_10524539
233 Ga0182008_10075503
234 Ga0163161_10359608
235 Ga0206356_10431194
236 Ga0213872_10000603
237 Ga0213872_10022134
238 Ga0207707_10043912
239 Ga0207707_10297261
240 Ga0207695_10038990
241 Ga0207695_10040177
242 Ga0207660_10023405
243 Ga0207652_10010165
244 Ga0207681_10074139
245 Ga0207694_10008152
246 Ga0207664_10001376
247 Ga0207706_10271653
248 Ga0207669_10003304
249 Ga0207689_10036162
250 Ga0207667_10204567
251 Ga0207712_10501478
252 Ga0207702_10385893
253 Ga0207675_100055369
254 Ga0207428_10000242
255 Ga0268266_10027369
256 Ga0268265_10188881
257 Ga0265337_1015734
258 Ga0265334_10037285
259 Ga0265338_10008222
260 Ga0265338_10026124
261 Ga0265338_10119051
262 Ga0265338_10241095
263 Ga0265338_10491152
264 Ga0265324_10019860
265 Ga0265328_10005613
266 Ga0265320_10012914
267 Ga0265331_10000066
268 Ga0265331_10011563
269 Ga0265327_10000428
270 Ga0265327_10000602
271 Ga0265327_10065717
272 Ga0265327_10101779
273 Ga0265316_10013535
274 Ga0265313_10000788
275 Ga0265313_10001237
276 Ga0265314_10014669
277 Ga0265314_10091853
278 Ga0265342_10150945
279 Ga0307409_100008031
280 Ga0307409_100097265
281 Ga0307414_10370637
282 Ga0307411_10433788
283 Ga0373940_0038326
284 Ga0373933_0009102
285 Ga0373937_0002676
286 Ga0395899_0009300
287 Ga0395901_0687013
288 Ga0400483_108857
289 Ga0400483_162194
290 Ga0400483_252808
291 Ga0436360_1097697
292 Ga0436360_1280575
293 Ga0436361_0008883
294 Ga0451577_0041379
295 Ga0453683_0041915
296 Ga0453683_0182436
297 Ga0466966_0129091
298 Ga0453684_0012492
299 Ga0453684_0018305
300 Ga0453684_0105104
301 Ga0453684_0383173
302 Ga0466957_0021991
303 Ga0451576_0000030
304 Ga0451576_0001548
305 Ga0451576_0002190
306 Ga0451576_0010029
307 Ga0451576_0036243
308 Ga0451576_0037557
309 Ga0451576_0201978
310 Ga0466958_0009529
311 Ga0495681_0085657
312 Ga0496103_0047536
313 Ga0496107_0300513
314 Ga0496110_0472211
315 Ga0496112_0282742
316 Ga0496115_0120283
317 Ga0496122_0041244
318 Ga0501032_0000012
319 Ga0501033_0038101
320 Ga0501033_0068825
321 Ga0501034_0000001
322 Ga0501039_0000020
323 Ga0501042_0202879
324 Ga0501070_0038953
325 Ga0501071_0528214
326 Ga0501073_0128964
327 Ga0501073_0174281
328 Ga0501075_0168283
329 Ga0501081_0200420
330 Ga0501083_0006468
331 Ga0501083_0022048
332 Ga0501035_0376423
333 Ga0501045_0289155
334 nmdc:mga05p37_614196_c1
335 nmdc:mga0qj67_22662_c1
336 nmdc:mga06r32_586540_c1
337 nmdc:mga06r32_645160_c1
338 nmdc:mga08y16_35_c1
339 nmdc:mga0a205_53269_c2
340 nmdc:mga0a205_679665_c1
341 Ga0500644_0123124
342 Ga0500647_0014877
343 Ga0500562_000021
344 Ga0500595_021657
345 Ga0500642_0017485
346 Ga0500642_0113984
347 Ga0500652_000040
348 Ga0500573_0083539
349 Ga0500588_0000255
350 Ga0500588_0011386
351 Ga0500616_0013636
352 Ga0500637_0000190
353 Ga0500601_000480
354 Ga0501084_0474893
355 Ga0590071_046333
356 Ga0590074_020878
357 Ga0590077_020100
358 Ga0466962_0080009
359 2512033969
360 2523105266
361 2599101432
362 2715499636
363 2834579936
364 2840883810
365 2846953844
366 2848859972
367 2883294322
368 2883357153
369 2897809958
370 2899261567
371 2919680999
372 2928975119
373 2977241888
374 8054004545

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03309

Pan_kinase

Type III pantothenate kinase

2

214

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
2h3g-assembly1.cif.gz_X-2 structure of the type iii pantothenate kinase (coax) from bacillus anthracis 0.967 1 253
2h3g-assembly1.cif.gz_X-2 structure of the type iii pantothenate kinase (coax) from bacillus anthracis 0.9594 1 253
3djc-assembly2.cif.gz_D crystal structure of pantothenate kinase from legionella pneumophila 0.9531 2 253
3djc-assembly2.cif.gz_A crystal structure of pantothenate kinase from legionella pneumophila 0.9528 1 253
3djc-assembly2.cif.gz_E crystal structure of pantothenate kinase from legionella pneumophila 0.9507 1 253
ID Description Score Start End Superfamily
2h3gX01 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.9676 1 88 3.30.420.40
af_P9WPA1_91_271_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.964 91 255 3.30.420.40
2h3gX02 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.96 91 253 3.30.420.40
2h3gX01 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.9571 1 88 3.30.420.40
3djcB01 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.9523 2 88 3.30.420.40
ID Description Score Start End GO Terms
AF-A0A371IMB4-F1-model_v4 pantothenate kinase (EC 2.7.1.33) 0.985 1 72 GO:0004594
GO:0005737
GO:0015937
AF-A0A140L0B0-F1-model_v4 Type III pantothenate kinase (EC 2.7.1.33) (PanK-III) (Pantothenic acid kinase) 0.9844 1 253 GO:0004594
GO:0005524
GO:0005737
GO:0015937
GO:0046872
AF-A0A1E7GWJ0-F1-model_v4 Type III pantothenate kinase (EC 2.7.1.33) (PanK-III) (Pantothenic acid kinase) 0.9838 1 253 GO:0004594
GO:0005524
GO:0005737
GO:0015937
GO:0046872
AF-A0A2D5HHA7-F1-model_v4 Type III pantothenate kinase (EC 2.7.1.33) (PanK-III) (Pantothenic acid kinase) 0.9828 1 251 GO:0004594
GO:0005524
GO:0005737
GO:0015937
GO:0046872
AF-A0A7C2IBU7-F1-model_v4 Type III pantothenate kinase (EC 2.7.1.33) (PanK-III) (Pantothenic acid kinase) 0.9822 1 253 GO:0004594
GO:0005524
GO:0005737
GO:0015937
GO:0046872

Map