F288449
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 187 | 141 | 374 | 256 |
Family's Representative Sequence
| Representative Sequence | 3300053087|Ga0500643_013407|Ga0500643_013407_1329_2171 |
| Length | 280 |
| Sequence | MLLAIDAGNTNVVFAVYEADQRRGMWRAATDPRRTGDEYAVWLTQLMGTVGLTPSAITDCIIASVVPTATFNLLKLSREHFRVEPLVVGESAAGGLPVELGIQVRMDRPEEVGADRLVNAVAAAERYGGPLIVVDFGTATTFDVVDAAGDYRGGVIAPGINLSLEALHMAAAKLPKIEVAKPRHGSVIGTNTVAAMQSGVYWGYVGLIEGLLVRLKNEMQAFGSDRVPKVIATGGLAVLFAEATDAIETIDEDLTLRGLVLLQRRNQVASARTPNMKSTS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 2 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 3 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 8 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 10 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 12 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 14 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 17 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 18 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 19 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 20 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 21 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 22 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 23 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 24 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 25 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 26 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 27 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 28 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 29 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 30 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 31 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 32 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 33 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 34 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 35 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 36 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 37 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 38 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 39 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 40 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 41 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 42 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 43 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 44 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 45 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 46 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 47 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 53 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 56 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 57 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 58 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 59 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 60 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 61 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 62 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 63 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 64 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 65 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 66 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 67 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 68 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 69 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 70 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 71 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 72 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 73 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 74 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 75 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 76 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 77 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 78 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 79 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 80 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 81 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 82 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 83 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 84 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 85 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 86 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 87 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 88 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 89 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 90 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 91 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 92 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 93 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 94 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 95 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 96 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 97 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 98 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 99 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 100 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 101 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 102 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 103 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 104 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 105 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 106 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 107 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 108 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 109 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 110 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 111 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 112 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 113 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 114 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 115 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 116 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 117 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 118 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 119 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 120 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 121 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 122 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 123 | 3300059423 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 124 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 125 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 126 | 2511231221 | Azospirillum lipoferum 4B | Isolate | Rhizosphere |
| 127 | 2522572158 | Azospirillum halopraeferens DSM 3675 | Isolate | Unclassified |
| 128 | 2597490356 | Azospirillum brasilense sp7 | Isolate | Unclassified |
| 129 | 2713897090 | Paracoccus sphaerophysae HAMBI 3106 | Isolate | Nodule |
| 130 | 2834578030 | Paracoccus thiocyanatus SST | Isolate | Unclassified |
| 131 | 2840878972 | Albibacillus kandeliae J95 | Isolate | Rhizosphere |
| 132 | 2846952575 | Azospirillum brasilense sp7 | Isolate | Unclassified |
| 133 | 2848858292 | Azospirillum brasilense Az39 | Isolate | Unclassified |
| 134 | 2883291878 | Hypericibacter terrae R5913 | Isolate | Rhizosphere |
| 135 | 2883354860 | Hypericibacter adhaerens R5959 | Isolate | Rhizosphere |
| 136 | 2897803580 | Azospirillum doebereinerae GSF71 | Isolate | Unclassified |
| 137 | 2899259804 | Paracoccus aeridis JC501 | Isolate | Rhizosphere |
| 138 | 2919679072 | Pseudotabrizicola sp. 4114 | Isolate | Unclassified |
| 139 | 2928972540 | Brevundimonas sp. 1080 | Isolate | Rhizosphere |
| 140 | 2977240413 | Brevundimonas vesicularis SORGH_AS 431 | Isolate | Unclassified |
| 141 | 8054002106 | Azospirillum lipoferum 59b | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 90.91 |
| Metatranscriptomes | 0.53 |
| Isolates | 8.56 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 7.49 |
| Nodule | 0.53 |
| Rhizoplane | 2.67 |
| Rhizosphere | 82.35 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0500643_013407 | 3300053087 | Bacteria | 2894 |
| 2 | Ga0068869_100155591 | 3300005334 | Bacteria | 1776 |
| 3 | Ga0070669_100021275 | 3300005353 | Bacteria | 4636 |
| 4 | Ga0070675_100287757 | 3300005354 | Bacteria | 1446 |
| 5 | Ga0070674_100033323 | 3300005356 | Bacteria | 3428 |
| 6 | Ga0070667_100619222 | 3300005367 | Bacteria | 998 |
| 7 | Ga0070713_100339819 | 3300005436 | Bacteria | 1391 |
| 8 | Ga0070705_100075209 | 3300005440 | Bacteria | 2056 |
| 9 | Ga0070705_100166256 | 3300005440 | Bacteria | 1480 |
| 10 | Ga0070700_100395410 | 3300005441 | Bacteria | 1038 |
| 11 | Ga0070662_100186176 | 3300005457 | Bacteria | 1639 |
| 12 | Ga0070681_10337893 | 3300005458 | Bacteria | 1415 |
| 13 | Ga0070699_100672599 | 3300005518 | Bacteria | 945 |
| 14 | Ga0070679_100242240 | 3300005530 | Bacteria | 1761 |
| 15 | Ga0070679_100326108 | 3300005530 | Bacteria | 1484 |
| 16 | Ga0070696_100007228 | 3300005546 | Bacteria | 7412 |
| 17 | Ga0070696_100029456 | 3300005546 | Bacteria | 3753 |
| 18 | Ga0070693_100490783 | 3300005547 | Bacteria | 869 |
| 19 | Ga0070704_100118831 | 3300005549 | Bacteria | 2026 |
| 20 | Ga0068855_100119949 | 3300005563 | Bacteria | 3011 |
| 21 | Ga0068855_100442714 | 3300005563 | Bacteria | 1419 |
| 22 | Ga0068855_100964301 | 3300005563 | Bacteria | 898 |
| 23 | Ga0068862_100106041 | 3300005844 | Bacteria | 2463 |
| 24 | Ga0081538_10002356 | 3300005981 | Bacteria | 18584 |
| 25 | Ga0075428_100117568 | 3300006844 | Bacteria | 2896 |
| 26 | Ga0075430_100041075 | 3300006846 | Bacteria | 3914 |
| 27 | Ga0075431_100587940 | 3300006847 | Bacteria | 1098 |
| 28 | Ga0105240_10019423 | 3300009093 | Bacteria | 9079 |
| 29 | Ga0105240_10052885 | 3300009093 | Bacteria | 5102 |
| 30 | Ga0105240_10131511 | 3300009093 | Bacteria | 3001 |
| 31 | Ga0111539_10000331 | 3300009094 | Bacteria | 57983 |
| 32 | Ga0111539_10808777 | 3300009094 | Bacteria | 1091 |
| 33 | Ga0105241_10481071 | 3300009174 | Bacteria | 1104 |
| 34 | Ga0105238_10426291 | 3300009551 | Bacteria | 1322 |
| 35 | Ga0157373_10065850 | 3300013100 | Bacteria | 2564 |
| 36 | Ga0157371_10116623 | 3300013102 | Bacteria | 1898 |
| 37 | Ga0157371_10242055 | 3300013102 | Bacteria | 1298 |
| 38 | Ga0157370_10014964 | 3300013104 | Bacteria | 7910 |
| 39 | Ga0157370_10028134 | 3300013104 | Bacteria | 5534 |
| 40 | Ga0157370_10063790 | 3300013104 | Bacteria | 3489 |
| 41 | Ga0157369_10049815 | 3300013105 | Bacteria | 4538 |
| 42 | Ga0157372_10231772 | 3300013307 | Bacteria | 2141 |
| 43 | Ga0163163_10346880 | 3300014325 | Bacteria | 1540 |
| 44 | Ga0157380_10043803 | 3300014326 | Bacteria | 3505 |
| 45 | Ga0157380_10524539 | 3300014326 | Bacteria | 1156 |
| 46 | Ga0182008_10075503 | 3300014497 | Bacteria | 1658 |
| 47 | Ga0163161_10359608 | 3300017792 | Bacteria | 1159 |
| 48 | Ga0206356_10431194 | 3300020070 | Bacteria | 1583 |
| 49 | Ga0213872_10000603 | 3300021361 | Bacteria | 27341 |
| 50 | Ga0213872_10022134 | 3300021361 | Bacteria | 2927 |
| 51 | Ga0207707_10043912 | 3300025912 | Bacteria | 3897 |
| 52 | Ga0207707_10297261 | 3300025912 | Bacteria | 1397 |
| 53 | Ga0207695_10038990 | 3300025913 | Bacteria | 5109 |
| 54 | Ga0207695_10040177 | 3300025913 | Bacteria | 5020 |
| 55 | Ga0207660_10023405 | 3300025917 | Bacteria | 4171 |
| 56 | Ga0207652_10010165 | 3300025921 | Bacteria | 7579 |
| 57 | Ga0207681_10074139 | 3300025923 | Bacteria | 2383 |
| 58 | Ga0207694_10008152 | 3300025924 | Bacteria | 7917 |
| 59 | Ga0207664_10001376 | 3300025929 | Bacteria | 15967 |
| 60 | Ga0207706_10271653 | 3300025933 | Bacteria | 1479 |
| 61 | Ga0207669_10003304 | 3300025937 | Bacteria | 6977 |
| 62 | Ga0207689_10036162 | 3300025942 | Bacteria | 4100 |
| 63 | Ga0207667_10204567 | 3300025949 | Bacteria | 2025 |
| 64 | Ga0207712_10501478 | 3300025961 | Bacteria | 1038 |
| 65 | Ga0207702_10385893 | 3300026078 | Bacteria | 1348 |
| 66 | Ga0207675_100055369 | 3300026118 | Bacteria | 3700 |
| 67 | Ga0207428_10000242 | 3300027907 | Bacteria | 74839 |
| 68 | Ga0268266_10027369 | 3300028379 | Bacteria | 4848 |
| 69 | Ga0268265_10188881 | 3300028380 | Bacteria | 1777 |
| 70 | Ga0265337_1015734 | 3300028556 | Bacteria | 2467 |
| 71 | Ga0265334_10037285 | 3300028573 | Bacteria | 1917 |
| 72 | Ga0265338_10008222 | 3300028800 | Bacteria | 12707 |
| 73 | Ga0265338_10026124 | 3300028800 | Bacteria | 5901 |
| 74 | Ga0265338_10119051 | 3300028800 | Bacteria | 2109 |
| 75 | Ga0265338_10241095 | 3300028800 | Bacteria | 1339 |
| 76 | Ga0265338_10491152 | 3300028800 | Bacteria | 865 |
| 77 | Ga0265324_10019860 | 3300029957 | Bacteria | 2418 |
| 78 | Ga0265328_10005613 | 3300031239 | Bacteria | 5362 |
| 79 | Ga0265320_10012914 | 3300031240 | Bacteria | 4827 |
| 80 | Ga0265331_10000066 | 3300031250 | Bacteria | 163571 |
| 81 | Ga0265331_10011563 | 3300031250 | Bacteria | 4828 |
| 82 | Ga0265327_10000428 | 3300031251 | Bacteria | 76098 |
| 83 | Ga0265327_10000602 | 3300031251 | Bacteria | 59632 |
| 84 | Ga0265327_10065717 | 3300031251 | Bacteria | 1833 |
| 85 | Ga0265327_10101779 | 3300031251 | Bacteria | 1385 |
| 86 | Ga0265316_10013535 | 3300031344 | Bacteria | 7241 |
| 87 | Ga0265313_10000788 | 3300031595 | Bacteria | 32028 |
| 88 | Ga0265313_10001237 | 3300031595 | Bacteria | 24347 |
| 89 | Ga0265314_10014669 | 3300031711 | Bacteria | 6254 |
| 90 | Ga0265314_10091853 | 3300031711 | Bacteria | 1974 |
| 91 | Ga0265342_10150945 | 3300031712 | Bacteria | 1290 |
| 92 | Ga0307409_100008031 | 3300031995 | Bacteria | 6364 |
| 93 | Ga0307409_100097265 | 3300031995 | Bacteria | 2431 |
| 94 | Ga0307414_10370637 | 3300032004 | Bacteria | 1235 |
| 95 | Ga0307411_10433788 | 3300032005 | Bacteria | 1095 |
| 96 | Ga0373940_0038326 | 3300035088 | Bacteria | 1308 |
| 97 | Ga0373933_0009102 | 3300035724 | Bacteria | 5420 |
| 98 | Ga0373937_0002676 | 3300036401 | Bacteria | 14852 |
| 99 | Ga0395899_0009300 | 3300037312 | Bacteria | 7546 |
| 100 | Ga0395901_0687013 | 3300038443 | Bacteria | 1023 |
| 101 | Ga0400483_108857 | 3300039062 | Bacteria | 2127 |
| 102 | Ga0400483_162194 | 3300039062 | Bacteria | 2628 |
| 103 | Ga0400483_252808 | 3300039062 | Bacteria | 1532 |
| 104 | Ga0436360_1097697 | 3300039438 | Bacteria | 2328 |
| 105 | Ga0436360_1280575 | 3300039438 | Bacteria | 1332 |
| 106 | Ga0436361_0008883 | 3300039447 | Bacteria | 2028 |
| 107 | Ga0451577_0041379 | 3300042876 | Bacteria | 4136 |
| 108 | Ga0453683_0041915 | 3300044673 | Bacteria | 2875 |
| 109 | Ga0453683_0182436 | 3300044673 | Bacteria | 1331 |
| 110 | Ga0466966_0129091 | 3300044684 | Bacteria | 1549 |
| 111 | Ga0453684_0012492 | 3300044712 | Bacteria | 13986 |
| 112 | Ga0453684_0018305 | 3300044712 | Bacteria | 10766 |
| 113 | Ga0453684_0105104 | 3300044712 | Bacteria | 3445 |
| 114 | Ga0453684_0383173 | 3300044712 | Bacteria | 1578 |
| 115 | Ga0466957_0021991 | 3300044842 | Bacteria | 3761 |
| 116 | Ga0451576_0000030 | 3300045051 | Bacteria | 403352 |
| 117 | Ga0451576_0001548 | 3300045051 | Bacteria | 38737 |
| 118 | Ga0451576_0002190 | 3300045051 | Bacteria | 30140 |
| 119 | Ga0451576_0010029 | 3300045051 | Bacteria | 10911 |
| 120 | Ga0451576_0036243 | 3300045051 | Bacteria | 5230 |
| 121 | Ga0451576_0037557 | 3300045051 | Bacteria | 5130 |
| 122 | Ga0451576_0201978 | 3300045051 | Bacteria | 2076 |
| 123 | Ga0466958_0009529 | 3300045836 | Bacteria | 5413 |
| 124 | Ga0495681_0085657 | 3300047470 | Bacteria | 1399 |
| 125 | Ga0496103_0047536 | 3300048906 | Bacteria | 2652 |
| 126 | Ga0496107_0300513 | 3300048910 | Bacteria | 1195 |
| 127 | Ga0496110_0472211 | 3300048913 | Bacteria | 1143 |
| 128 | Ga0496112_0282742 | 3300048915 | Bacteria | 1606 |
| 129 | Ga0496115_0120283 | 3300048918 | Bacteria | 2160 |
| 130 | Ga0496122_0041244 | 3300048925 | Bacteria | 3653 |
| 131 | Ga0501032_0000012 | 3300049569 | Bacteria | 193329 |
| 132 | Ga0501033_0038101 | 3300049570 | Bacteria | 3597 |
| 133 | Ga0501033_0068825 | 3300049570 | Bacteria | 2602 |
| 134 | Ga0501034_0000001 | 3300049571 | Bacteria | 2184493 |
| 135 | Ga0501039_0000020 | 3300049575 | Bacteria | 162656 |
| 136 | Ga0501042_0202879 | 3300049578 | Bacteria | 1430 |
| 137 | Ga0501070_0038953 | 3300049586 | Bacteria | 3966 |
| 138 | Ga0501071_0528214 | 3300049587 | Bacteria | 906 |
| 139 | Ga0501073_0128964 | 3300049589 | Bacteria | 1753 |
| 140 | Ga0501073_0174281 | 3300049589 | Bacteria | 1489 |
| 141 | Ga0501075_0168283 | 3300049591 | Bacteria | 1672 |
| 142 | Ga0501081_0200420 | 3300049743 | Bacteria | 1447 |
| 143 | Ga0501083_0006468 | 3300049744 | Bacteria | 8311 |
| 144 | Ga0501083_0022048 | 3300049744 | Bacteria | 4421 |
| 145 | Ga0501035_0376423 | 3300049822 | Bacteria | 1185 |
| 146 | Ga0501045_0289155 | 3300049824 | Bacteria | 1220 |
| 147 | nmdc:mga05p37_614196_c1 | 3300050507 | Bacteria | 1225 |
| 148 | nmdc:mga0qj67_22662_c1 | 3300050509 | Bacteria | 4825 |
| 149 | nmdc:mga06r32_586540_c1 | 3300050510 | Bacteria | 1086 |
| 150 | nmdc:mga06r32_645160_c1 | 3300050510 | Bacteria | 1027 |
| 151 | nmdc:mga08y16_35_c1 | 3300050511 | Bacteria | 157578 |
| 152 | nmdc:mga0a205_53269_c2 | 3300050515 | Bacteria | 2732 |
| 153 | nmdc:mga0a205_679665_c1 | 3300050515 | Bacteria | 880 |
| 154 | Ga0500644_0123124 | 3300053088 | Bacteria | 1013 |
| 155 | Ga0500647_0014877 | 3300053091 | Bacteria | 3547 |
| 156 | Ga0500562_000021 | 3300053108 | Bacteria | 112425 |
| 157 | Ga0500595_021657 | 3300053119 | Bacteria | 2291 |
| 158 | Ga0500642_0017485 | 3300053130 | Bacteria | 2750 |
| 159 | Ga0500642_0113984 | 3300053130 | Bacteria | 1263 |
| 160 | Ga0500652_000040 | 3300053131 | Bacteria | 68826 |
| 161 | Ga0500573_0083539 | 3300053140 | Bacteria | 1813 |
| 162 | Ga0500588_0000255 | 3300053146 | Bacteria | 7681 |
| 163 | Ga0500588_0011386 | 3300053146 | Bacteria | 2176 |
| 164 | Ga0500616_0013636 | 3300053153 | Bacteria | 4709 |
| 165 | Ga0500637_0000190 | 3300053178 | Bacteria | 22829 |
| 166 | Ga0500601_000480 | 3300053737 | Bacteria | 6295 |
| 167 | Ga0501084_0474893 | 3300054114 | Bacteria | 1057 |
| 168 | Ga0590071_046333 | 3300059421 | Bacteria | 1050 |
| 169 | Ga0590074_020878 | 3300059423 | Bacteria | 1128 |
| 170 | Ga0590077_020100 | 3300059426 | Bacteria | 1417 |
| 171 | Ga0466962_0080009 | 3300061719 | Bacteria | 1562 |
| 172 | 2512033969 | 2511231221 | Bacteria | 6846400 |
| 173 | 2523105266 | 2522572158 | Bacteria | 6514390 |
| 174 | 2599101432 | 2597490356 | Bacteria | 7030811 |
| 175 | 2715499636 | 2713897090 | Bacteria | 3353799 |
| 176 | 2834579936 | 2834578030 | Bacteria | 3530182 |
| 177 | 2840883810 | 2840878972 | Bacteria | 5483153 |
| 178 | 2846953844 | 2846952575 | Bacteria | 6587527 |
| 179 | 2848859972 | 2848858292 | Bacteria | 7391279 |
| 180 | 2883294322 | 2883291878 | Bacteria | 5894118 |
| 181 | 2883357153 | 2883354860 | Bacteria | 5865246 |
| 182 | 2897809958 | 2897803580 | Bacteria | 7000062 |
| 183 | 2899261567 | 2899259804 | Bacteria | 3320927 |
| 184 | 2919680999 | 2919679072 | Bacteria | 4629602 |
| 185 | 2928975119 | 2928972540 | Bacteria | 3058286 |
| 186 | 2977241888 | 2977240413 | Bacteria | 3191065 |
| 187 | 8054004545 | 8054002106 | Bacteria | 7987183 |
| 188 | Ga0500643_013407 | |||
| 189 | Ga0068869_100155591 | |||
| 190 | Ga0070669_100021275 | |||
| 191 | Ga0070675_100287757 | |||
| 192 | Ga0070674_100033323 | |||
| 193 | Ga0070667_100619222 | |||
| 194 | Ga0070713_100339819 | |||
| 195 | Ga0070705_100075209 | |||
| 196 | Ga0070705_100166256 | |||
| 197 | Ga0070700_100395410 | |||
| 198 | Ga0070662_100186176 | |||
| 199 | Ga0070681_10337893 | |||
| 200 | Ga0070699_100672599 | |||
| 201 | Ga0070679_100242240 | |||
| 202 | Ga0070679_100326108 | |||
| 203 | Ga0070696_100007228 | |||
| 204 | Ga0070696_100029456 | |||
| 205 | Ga0070693_100490783 | |||
| 206 | Ga0070704_100118831 | |||
| 207 | Ga0068855_100119949 | |||
| 208 | Ga0068855_100442714 | |||
| 209 | Ga0068855_100964301 | |||
| 210 | Ga0068862_100106041 | |||
| 211 | Ga0081538_10002356 | |||
| 212 | Ga0075428_100117568 | |||
| 213 | Ga0075430_100041075 | |||
| 214 | Ga0075431_100587940 | |||
| 215 | Ga0105240_10019423 | |||
| 216 | Ga0105240_10052885 | |||
| 217 | Ga0105240_10131511 | |||
| 218 | Ga0111539_10000331 | |||
| 219 | Ga0111539_10808777 | |||
| 220 | Ga0105241_10481071 | |||
| 221 | Ga0105238_10426291 | |||
| 222 | Ga0157373_10065850 | |||
| 223 | Ga0157371_10116623 | |||
| 224 | Ga0157371_10242055 | |||
| 225 | Ga0157370_10014964 | |||
| 226 | Ga0157370_10028134 | |||
| 227 | Ga0157370_10063790 | |||
| 228 | Ga0157369_10049815 | |||
| 229 | Ga0157372_10231772 | |||
| 230 | Ga0163163_10346880 | |||
| 231 | Ga0157380_10043803 | |||
| 232 | Ga0157380_10524539 | |||
| 233 | Ga0182008_10075503 | |||
| 234 | Ga0163161_10359608 | |||
| 235 | Ga0206356_10431194 | |||
| 236 | Ga0213872_10000603 | |||
| 237 | Ga0213872_10022134 | |||
| 238 | Ga0207707_10043912 | |||
| 239 | Ga0207707_10297261 | |||
| 240 | Ga0207695_10038990 | |||
| 241 | Ga0207695_10040177 | |||
| 242 | Ga0207660_10023405 | |||
| 243 | Ga0207652_10010165 | |||
| 244 | Ga0207681_10074139 | |||
| 245 | Ga0207694_10008152 | |||
| 246 | Ga0207664_10001376 | |||
| 247 | Ga0207706_10271653 | |||
| 248 | Ga0207669_10003304 | |||
| 249 | Ga0207689_10036162 | |||
| 250 | Ga0207667_10204567 | |||
| 251 | Ga0207712_10501478 | |||
| 252 | Ga0207702_10385893 | |||
| 253 | Ga0207675_100055369 | |||
| 254 | Ga0207428_10000242 | |||
| 255 | Ga0268266_10027369 | |||
| 256 | Ga0268265_10188881 | |||
| 257 | Ga0265337_1015734 | |||
| 258 | Ga0265334_10037285 | |||
| 259 | Ga0265338_10008222 | |||
| 260 | Ga0265338_10026124 | |||
| 261 | Ga0265338_10119051 | |||
| 262 | Ga0265338_10241095 | |||
| 263 | Ga0265338_10491152 | |||
| 264 | Ga0265324_10019860 | |||
| 265 | Ga0265328_10005613 | |||
| 266 | Ga0265320_10012914 | |||
| 267 | Ga0265331_10000066 | |||
| 268 | Ga0265331_10011563 | |||
| 269 | Ga0265327_10000428 | |||
| 270 | Ga0265327_10000602 | |||
| 271 | Ga0265327_10065717 | |||
| 272 | Ga0265327_10101779 | |||
| 273 | Ga0265316_10013535 | |||
| 274 | Ga0265313_10000788 | |||
| 275 | Ga0265313_10001237 | |||
| 276 | Ga0265314_10014669 | |||
| 277 | Ga0265314_10091853 | |||
| 278 | Ga0265342_10150945 | |||
| 279 | Ga0307409_100008031 | |||
| 280 | Ga0307409_100097265 | |||
| 281 | Ga0307414_10370637 | |||
| 282 | Ga0307411_10433788 | |||
| 283 | Ga0373940_0038326 | |||
| 284 | Ga0373933_0009102 | |||
| 285 | Ga0373937_0002676 | |||
| 286 | Ga0395899_0009300 | |||
| 287 | Ga0395901_0687013 | |||
| 288 | Ga0400483_108857 | |||
| 289 | Ga0400483_162194 | |||
| 290 | Ga0400483_252808 | |||
| 291 | Ga0436360_1097697 | |||
| 292 | Ga0436360_1280575 | |||
| 293 | Ga0436361_0008883 | |||
| 294 | Ga0451577_0041379 | |||
| 295 | Ga0453683_0041915 | |||
| 296 | Ga0453683_0182436 | |||
| 297 | Ga0466966_0129091 | |||
| 298 | Ga0453684_0012492 | |||
| 299 | Ga0453684_0018305 | |||
| 300 | Ga0453684_0105104 | |||
| 301 | Ga0453684_0383173 | |||
| 302 | Ga0466957_0021991 | |||
| 303 | Ga0451576_0000030 | |||
| 304 | Ga0451576_0001548 | |||
| 305 | Ga0451576_0002190 | |||
| 306 | Ga0451576_0010029 | |||
| 307 | Ga0451576_0036243 | |||
| 308 | Ga0451576_0037557 | |||
| 309 | Ga0451576_0201978 | |||
| 310 | Ga0466958_0009529 | |||
| 311 | Ga0495681_0085657 | |||
| 312 | Ga0496103_0047536 | |||
| 313 | Ga0496107_0300513 | |||
| 314 | Ga0496110_0472211 | |||
| 315 | Ga0496112_0282742 | |||
| 316 | Ga0496115_0120283 | |||
| 317 | Ga0496122_0041244 | |||
| 318 | Ga0501032_0000012 | |||
| 319 | Ga0501033_0038101 | |||
| 320 | Ga0501033_0068825 | |||
| 321 | Ga0501034_0000001 | |||
| 322 | Ga0501039_0000020 | |||
| 323 | Ga0501042_0202879 | |||
| 324 | Ga0501070_0038953 | |||
| 325 | Ga0501071_0528214 | |||
| 326 | Ga0501073_0128964 | |||
| 327 | Ga0501073_0174281 | |||
| 328 | Ga0501075_0168283 | |||
| 329 | Ga0501081_0200420 | |||
| 330 | Ga0501083_0006468 | |||
| 331 | Ga0501083_0022048 | |||
| 332 | Ga0501035_0376423 | |||
| 333 | Ga0501045_0289155 | |||
| 334 | nmdc:mga05p37_614196_c1 | |||
| 335 | nmdc:mga0qj67_22662_c1 | |||
| 336 | nmdc:mga06r32_586540_c1 | |||
| 337 | nmdc:mga06r32_645160_c1 | |||
| 338 | nmdc:mga08y16_35_c1 | |||
| 339 | nmdc:mga0a205_53269_c2 | |||
| 340 | nmdc:mga0a205_679665_c1 | |||
| 341 | Ga0500644_0123124 | |||
| 342 | Ga0500647_0014877 | |||
| 343 | Ga0500562_000021 | |||
| 344 | Ga0500595_021657 | |||
| 345 | Ga0500642_0017485 | |||
| 346 | Ga0500642_0113984 | |||
| 347 | Ga0500652_000040 | |||
| 348 | Ga0500573_0083539 | |||
| 349 | Ga0500588_0000255 | |||
| 350 | Ga0500588_0011386 | |||
| 351 | Ga0500616_0013636 | |||
| 352 | Ga0500637_0000190 | |||
| 353 | Ga0500601_000480 | |||
| 354 | Ga0501084_0474893 | |||
| 355 | Ga0590071_046333 | |||
| 356 | Ga0590074_020878 | |||
| 357 | Ga0590077_020100 | |||
| 358 | Ga0466962_0080009 | |||
| 359 | 2512033969 | |||
| 360 | 2523105266 | |||
| 361 | 2599101432 | |||
| 362 | 2715499636 | |||
| 363 | 2834579936 | |||
| 364 | 2840883810 | |||
| 365 | 2846953844 | |||
| 366 | 2848859972 | |||
| 367 | 2883294322 | |||
| 368 | 2883357153 | |||
| 369 | 2897809958 | |||
| 370 | 2899261567 | |||
| 371 | 2919680999 | |||
| 372 | 2928975119 | |||
| 373 | 2977241888 | |||
| 374 | 8054004545 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2h3g-assembly1.cif.gz_X-2 | structure of the type iii pantothenate kinase (coax) from bacillus anthracis | 0.967 | 1 | 253 |
| 2h3g-assembly1.cif.gz_X-2 | structure of the type iii pantothenate kinase (coax) from bacillus anthracis | 0.9594 | 1 | 253 |
| 3djc-assembly2.cif.gz_D | crystal structure of pantothenate kinase from legionella pneumophila | 0.9531 | 2 | 253 |
| 3djc-assembly2.cif.gz_A | crystal structure of pantothenate kinase from legionella pneumophila | 0.9528 | 1 | 253 |
| 3djc-assembly2.cif.gz_E | crystal structure of pantothenate kinase from legionella pneumophila | 0.9507 | 1 | 253 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2h3gX01 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain | 0.9676 | 1 | 88 | 3.30.420.40 |
| af_P9WPA1_91_271_3.30.420.40 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain | 0.964 | 91 | 255 | 3.30.420.40 |
| 2h3gX02 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain | 0.96 | 91 | 253 | 3.30.420.40 |
| 2h3gX01 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain | 0.9571 | 1 | 88 | 3.30.420.40 |
| 3djcB01 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain | 0.9523 | 2 | 88 | 3.30.420.40 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A371IMB4-F1-model_v4 | pantothenate kinase (EC 2.7.1.33) | 0.985 | 1 | 72 |
GO:0004594
GO:0005737 GO:0015937 |
| AF-A0A140L0B0-F1-model_v4 | Type III pantothenate kinase (EC 2.7.1.33) (PanK-III) (Pantothenic acid kinase) | 0.9844 | 1 | 253 |
GO:0004594
GO:0005524 GO:0005737 GO:0015937 GO:0046872 |
| AF-A0A1E7GWJ0-F1-model_v4 | Type III pantothenate kinase (EC 2.7.1.33) (PanK-III) (Pantothenic acid kinase) | 0.9838 | 1 | 253 |
GO:0004594
GO:0005524 GO:0005737 GO:0015937 GO:0046872 |
| AF-A0A2D5HHA7-F1-model_v4 | Type III pantothenate kinase (EC 2.7.1.33) (PanK-III) (Pantothenic acid kinase) | 0.9828 | 1 | 251 |
GO:0004594
GO:0005524 GO:0005737 GO:0015937 GO:0046872 |
| AF-A0A7C2IBU7-F1-model_v4 | Type III pantothenate kinase (EC 2.7.1.33) (PanK-III) (Pantothenic acid kinase) | 0.9822 | 1 | 253 |
GO:0004594
GO:0005524 GO:0005737 GO:0015937 GO:0046872 |