F286841

General Info

Members Datasets Scaffolds Average Seq Length
186 144 372 187

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2671180531|2673164465
Length 213
Sequence DRDAESASEEYNGLIRTPAPEQPGRHPTGPDVPPAPRPTPAQLRAAQNKTVPDVIAPGLSVLFCGINPGLYTAAIGHHFGRPGNRFWPTLHAAGFTPRLLDPSEELELLPLGYGITNVVARATVGADELTNKEIIAGGAILAAKVREFAPRYLAVLGIGAYRTAFAKPKAVVGLQPDAIGETRVWVLPNPSGLNAHYQGKDLVKVFRQLRDTA

Samples

Sample ID Description Type Environment
1 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
2 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
3 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
4 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
5 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
6 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
7 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
8 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
9 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
10 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
11 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
12 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
13 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
14 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
15 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
16 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
17 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
18 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
19 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
20 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
21 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
22 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
23 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
24 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
25 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
26 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
27 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
28 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
29 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
30 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
31 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
32 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
33 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
34 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
35 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
36 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
37 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
38 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
39 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
53 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
54 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
55 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
56 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
57 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
58 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
59 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
60 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
61 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
62 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
63 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
64 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
65 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
66 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
67 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
68 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
69 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
70 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
71 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
72 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
73 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
74 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
75 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
76 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
77 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
78 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
79 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
80 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
81 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
82 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
83 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
84 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
85 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
86 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
87 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
88 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
89 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
90 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
91 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
92 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
93 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
94 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
95 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
96 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
97 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
98 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
99 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
100 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
101 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
102 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
103 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
104 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
105 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
106 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
107 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
108 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
109 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
110 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
111 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
112 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
113 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
114 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
115 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
116 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
117 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
118 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
119 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
120 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
121 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
122 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
123 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
124 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
125 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
126 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
127 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
128 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
129 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
130 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
131 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
132 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
133 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
134 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
135 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
136 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
137 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
138 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
139 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
140 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
141 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
142 2671180531 Gemmata sp. SH-PL17 Isolate Unclassified
143 2558860280 Kutzneria sp. 744 Isolate Unclassified
144 2917736166 Amycolatopsis dendrobii DR6-1 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.39
Metatranscriptomes 0
Isolates 1.61

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.54
Rhizosphere 95.7
Stem 0
Stem Tuber 0
Unclassified 8.06

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070670_100403197 3300005331 Unclassified 1207
2 Ga0070668_100004834 3300005347 Bacteria 9990
3 Ga0070669_100415477 3300005353 Unclassified 1103
4 Ga0070675_100109878 3300005354 Bacteria 2331
5 Ga0070674_100367672 3300005356 Bacteria 1166
6 Ga0070673_100368272 3300005364 Bacteria 1279
7 Ga0070667_100046244 3300005367 Bacteria 3661
8 Ga0070713_100131731 3300005436 Bacteria 2206
9 Ga0070705_100050375 3300005440 Unclassified 2422
10 Ga0070694_100399310 3300005444 Bacteria 1076
11 Ga0070678_100957577 3300005456 Unclassified 785
12 Ga0070685_10432931 3300005466 Unclassified 918
13 Ga0070698_100001951 3300005471 Bacteria 22915
14 Ga0070698_100264348 3300005471 Bacteria 1652
15 Ga0070698_100336750 3300005471 Unclassified 1440
16 Ga0070698_100624302 3300005471 Bacteria 1018
17 Ga0070699_100010187 3300005518 Bacteria 8131
18 Ga0070699_100407082 3300005518 Bacteria 1230
19 Ga0070699_100711466 3300005518 Bacteria 918
20 Ga0070699_100887424 3300005518 Unclassified 817
21 Ga0070695_100298709 3300005545 Bacteria 1189
22 Ga0068856_101076225 3300005614 Bacteria 822
23 Ga0068859_100001052 3300005617 Bacteria 28304
24 Ga0068861_100160058 3300005719 Bacteria 1856
25 Ga0068860_100972452 3300005843 Bacteria 866
26 Ga0081538_10005736 3300005981 Bacteria 11096
27 Ga0081540_1143357 3300005983 Bacteria 955
28 Ga0070717_10004624 3300006028 Bacteria 9972
29 Ga0075433_10010655 3300006852 Bacteria 7391
30 Ga0075429_100063440 3300006880 Bacteria 3219
31 Ga0075429_100325190 3300006880 Bacteria 1346
32 Ga0068865_101127136 3300006881 Unclassified 692
33 Ga0097620_100001052 3300006931 Bacteria 28304
34 Ga0114129_10001011 3300009147 Bacteria 36664
35 Ga0114129_10014136 3300009147 Bacteria 11372
36 Ga0114129_10137206 3300009147 Bacteria 3355
37 Ga0105243_10000198 3300009148 Bacteria 70514
38 Ga0105242_10000072 3300009176 Bacteria 71112
39 Ga0105246_10868756 3300011119 Bacteria 806
40 Ga0157378_10711581 3300013297 Bacteria 1024
41 Ga0163162_10151285 3300013306 Bacteria 2439
42 Ga0163162_10737484 3300013306 Bacteria 1105
43 Ga0157375_11156959 3300013308 Unclassified 907
44 Ga0163163_11157303 3300014325 Unclassified 836
45 Ga0157380_10433532 3300014326 Bacteria 1257
46 Ga0157376_11526119 3300014969 Unclassified 701
47 Ga0182005_1057250 3300015265 Bacteria 1063
48 Ga0213876_10000359 3300021384 Bacteria 39020
49 Ga0207697_10046988 3300025315 Bacteria 1779
50 Ga0207646_10000541 3300025922 Bacteria 49906
51 Ga0207646_10016721 3300025922 Bacteria 6881
52 Ga0207646_10388634 3300025922 Unclassified 1260
53 Ga0207681_10373861 3300025923 Unclassified 1146
54 Ga0207650_10108719 3300025925 Bacteria 2144
55 Ga0207659_10076281 3300025926 Bacteria 2463
56 Ga0207686_10000057 3300025934 Bacteria 103125
57 Ga0207709_10000140 3300025935 Bacteria 101921
58 Ga0207709_10159118 3300025935 Bacteria 1573
59 Ga0207665_10123227 3300025939 Bacteria 1833
60 Ga0207712_10053058 3300025961 Bacteria 2843
61 Ga0207712_10452634 3300025961 Unclassified 1089
62 Ga0207668_10002882 3300025972 Bacteria 10088
63 Ga0207668_10225033 3300025972 Bacteria 1509
64 Ga0207674_10046518 3300026116 Bacteria 4455
65 Ga0268265_11390261 3300028380 Bacteria 704
66 Ga0268264_10892772 3300028381 Bacteria 892
67 Ga0307513_10011459 3300031456 Bacteria 11020
68 Ga0307405_10000576 3300031731 Bacteria 14015
69 Ga0307405_10845878 3300031731 Bacteria 770
70 Ga0307413_10003054 3300031824 Bacteria 6959
71 Ga0307413_10006470 3300031824 Bacteria 5355
72 Ga0307410_10751236 3300031852 Bacteria 826
73 Ga0307406_10012257 3300031901 Bacteria 4887
74 Ga0307406_10333228 3300031901 Bacteria 1179
75 Ga0307412_10046945 3300031911 Bacteria 2833
76 Ga0307409_100023179 3300031995 Bacteria 4295
77 Ga0307409_100389168 3300031995 Bacteria 1328
78 Ga0307416_100016938 3300032002 Bacteria 5082
79 Ga0307416_100073825 3300032002 Bacteria 2846
80 Ga0307416_100122761 3300032002 Bacteria 2319
81 Ga0307416_100176794 3300032002 Bacteria 1995
82 Ga0307414_10099519 3300032004 Bacteria 2185
83 Ga0307414_10152302 3300032004 Bacteria 1826
84 Ga0307414_10545913 3300032004 Bacteria 1032
85 Ga0307411_10154527 3300032005 Bacteria 1710
86 Ga0307415_100005174 3300032126 Bacteria 6887
87 Ga0307415_100623242 3300032126 Bacteria 963
88 Ga0307415_101037035 3300032126 Bacteria 764
89 Ga0373955_0245593 3300035172 Bacteria 1073
90 Ga0373947_0163283 3300035725 Bacteria 1441
91 Ga0395899_0195189 3300037312 Bacteria 1415
92 Ga0395900_0026551 3300037418 Bacteria 5929
93 Ga0395898_0075190 3300037466 Bacteria 3263
94 Ga0395905_0080413 3300037471 Bacteria 3054
95 Ga0395901_0076431 3300038443 Bacteria 3493
96 Ga0436365_0945968 3300039437 Bacteria 1053
97 Ga0436365_1311852 3300039437 Bacteria 65317
98 Ga0439459_0011349 3300042438 Bacteria 1569
99 Ga0451577_0186249 3300042876 Bacteria 1872
100 Ga0439440_0160007 3300042993 Bacteria 649
101 Ga0466969_0027037 3300044656 Bacteria 2939
102 Ga0466966_0011646 3300044684 Bacteria 5830
103 Ga0466961_0012214 3300044693 Bacteria 5490
104 Ga0466961_0047060 3300044693 Bacteria 2758
105 Ga0453684_0629753 3300044712 Bacteria 1172
106 Ga0466960_0001295 3300044901 Bacteria 9081
107 Ga0466959_0008402 3300045049 Bacteria 7297
108 Ga0495592_0383322 3300046454 Bacteria 894
109 Ga0495603_0024429 3300046455 Bacteria 3655
110 Ga0495629_0018333 3300046459 Bacteria 5010
111 Ga0495653_0295304 3300046463 Bacteria 1058
112 Ga0495616_0129473 3300046513 Bacteria 1158
113 Ga0495630_0530083 3300046517 Bacteria 903
114 Ga0495643_0125498 3300046522 Bacteria 1293
115 Ga0495652_0224003 3300046529 Bacteria 1411
116 Ga0495586_0113854 3300046535 Bacteria 1507
117 Ga0495587_0354020 3300046536 Bacteria 818
118 Ga0495667_0117334 3300046559 Bacteria 1719
119 Ga0495634_0186624 3300046642 Bacteria 1295
120 Ga0495635_0374146 3300046663 Bacteria 948
121 Ga0495658_0104083 3300046683 Bacteria 1698
122 Ga0495613_0151652 3300046689 Bacteria 1652
123 Ga0495581_0003489 3300047315 Bacteria 9029
124 Ga0495674_0185007 3300047319 Bacteria 1733
125 Ga0495680_0016638 3300047322 Bacteria 6310
126 Ga0495684_0167416 3300047471 Bacteria 1636
127 Ga0495614_0062666 3300048089 Bacteria 1598
128 Ga0496113_0415642 3300048916 Bacteria 1080
129 Ga0501031_0069499 3300049568 Bacteria 2294
130 Ga0501032_0022137 3300049569 Bacteria 4410
131 Ga0501033_0062450 3300049570 Bacteria 2743
132 Ga0501036_0003648 3300049572 Bacteria 12312
133 Ga0501037_0038641 3300049573 Bacteria 3516
134 Ga0501037_0080478 3300049573 Bacteria 2364
135 Ga0501038_0020529 3300049574 Bacteria 5937
136 Ga0501039_0000354 3300049575 Bacteria 32857
137 Ga0501040_0000917 3300049576 Bacteria 18488
138 Ga0501041_0026686 3300049577 Bacteria 3475
139 Ga0501041_0451586 3300049577 Bacteria 816
140 Ga0501042_0001703 3300049578 Bacteria 13132
141 Ga0501042_1093904 3300049578 Bacteria 581
142 Ga0501043_0015919 3300049579 Bacteria 5894
143 Ga0501046_0003337 3300049580 Bacteria 14754
144 Ga0501047_0003171 3300049581 Bacteria 15586
145 Ga0501048_0008248 3300049582 Bacteria 7881
146 Ga0501068_0085961 3300049584 Bacteria 1936
147 Ga0501069_0139175 3300049585 Bacteria 1392
148 Ga0501070_0638846 3300049586 Bacteria 846
149 Ga0501071_0000370 3300049587 Bacteria 22025
150 Ga0501072_0001751 3300049588 Bacteria 16134
151 Ga0501073_0247452 3300049589 Bacteria 1231
152 Ga0501074_0010824 3300049590 Bacteria 6624
153 Ga0501075_0000450 3300049591 Bacteria 24475
154 Ga0501076_0024730 3300049592 Bacteria 4643
155 Ga0501076_0154243 3300049592 Bacteria 1869
156 Ga0501077_0002520 3300049593 Bacteria 10966
157 Ga0501079_0001334 3300049741 Bacteria 17363
158 Ga0501079_0197453 3300049741 Bacteria 1571
159 Ga0501080_0009695 3300049742 Bacteria 8794
160 Ga0501080_0185572 3300049742 Bacteria 1912
161 Ga0501080_0410376 3300049742 Bacteria 1218
162 Ga0501081_0008806 3300049743 Bacteria 6558
163 Ga0501083_0153871 3300049744 Bacteria 1505
164 Ga0501044_0001921 3300049823 Bacteria 24051
165 Ga0501044_0157355 3300049823 Bacteria 2251
166 Ga0501044_0447792 3300049823 Bacteria 1198
167 Ga0501045_0001613 3300049824 Bacteria 15098
168 nmdc:mga09592_101311_c1 3300050508 Bacteria 2467
169 nmdc:mga09592_422431_c1 3300050508 Bacteria 1151
170 nmdc:mga0n895_48656_c1 3300050512 Unclassified 4151
171 nmdc:mga0a205_45453_c1 3300050515 Bacteria 4234
172 Ga0495601_0002799 3300053077 Bacteria 9898
173 Ga0495601_0183563 3300053077 Bacteria 1367
174 Ga0495595_0163804 3300053084 Bacteria 1098
175 Ga0495619_0004995 3300053085 Bacteria 8427
176 Ga0501084_0026010 3300054114 Bacteria 4881
177 Ga0501084_0102815 3300054114 Bacteria 2399
178 Ga0501084_0145278 3300054114 Bacteria 1998
179 Ga0501084_1007544 3300054114 Bacteria 700
180 Ga0590071_056522 3300059421 Bacteria 955
181 Ga0501082_0007058 3300060353 Bacteria 9697
182 Ga0466962_0136069 3300061719 Bacteria 1189
183 Ga0530510_0000669 3300061734 Bacteria 22218
184 2673164465 2671180531 Bacteria 9045424
185 2559424279 2558860280 Bacteria 11429938
186 2917744190 2917736166 Bacteria 9690793
187 Ga0070670_100403197
188 Ga0070668_100004834
189 Ga0070669_100415477
190 Ga0070675_100109878
191 Ga0070674_100367672
192 Ga0070673_100368272
193 Ga0070667_100046244
194 Ga0070713_100131731
195 Ga0070705_100050375
196 Ga0070694_100399310
197 Ga0070678_100957577
198 Ga0070685_10432931
199 Ga0070698_100001951
200 Ga0070698_100264348
201 Ga0070698_100336750
202 Ga0070698_100624302
203 Ga0070699_100010187
204 Ga0070699_100407082
205 Ga0070699_100711466
206 Ga0070699_100887424
207 Ga0070695_100298709
208 Ga0068856_101076225
209 Ga0068859_100001052
210 Ga0068861_100160058
211 Ga0068860_100972452
212 Ga0081538_10005736
213 Ga0081540_1143357
214 Ga0070717_10004624
215 Ga0075433_10010655
216 Ga0075429_100063440
217 Ga0075429_100325190
218 Ga0068865_101127136
219 Ga0097620_100001052
220 Ga0114129_10001011
221 Ga0114129_10014136
222 Ga0114129_10137206
223 Ga0105243_10000198
224 Ga0105242_10000072
225 Ga0105246_10868756
226 Ga0157378_10711581
227 Ga0163162_10151285
228 Ga0163162_10737484
229 Ga0157375_11156959
230 Ga0163163_11157303
231 Ga0157380_10433532
232 Ga0157376_11526119
233 Ga0182005_1057250
234 Ga0213876_10000359
235 Ga0207697_10046988
236 Ga0207646_10000541
237 Ga0207646_10016721
238 Ga0207646_10388634
239 Ga0207681_10373861
240 Ga0207650_10108719
241 Ga0207659_10076281
242 Ga0207686_10000057
243 Ga0207709_10000140
244 Ga0207709_10159118
245 Ga0207665_10123227
246 Ga0207712_10053058
247 Ga0207712_10452634
248 Ga0207668_10002882
249 Ga0207668_10225033
250 Ga0207674_10046518
251 Ga0268265_11390261
252 Ga0268264_10892772
253 Ga0307513_10011459
254 Ga0307405_10000576
255 Ga0307405_10845878
256 Ga0307413_10003054
257 Ga0307413_10006470
258 Ga0307410_10751236
259 Ga0307406_10012257
260 Ga0307406_10333228
261 Ga0307412_10046945
262 Ga0307409_100023179
263 Ga0307409_100389168
264 Ga0307416_100016938
265 Ga0307416_100073825
266 Ga0307416_100122761
267 Ga0307416_100176794
268 Ga0307414_10099519
269 Ga0307414_10152302
270 Ga0307414_10545913
271 Ga0307411_10154527
272 Ga0307415_100005174
273 Ga0307415_100623242
274 Ga0307415_101037035
275 Ga0373955_0245593
276 Ga0373947_0163283
277 Ga0395899_0195189
278 Ga0395900_0026551
279 Ga0395898_0075190
280 Ga0395905_0080413
281 Ga0395901_0076431
282 Ga0436365_0945968
283 Ga0436365_1311852
284 Ga0439459_0011349
285 Ga0451577_0186249
286 Ga0439440_0160007
287 Ga0466969_0027037
288 Ga0466966_0011646
289 Ga0466961_0012214
290 Ga0466961_0047060
291 Ga0453684_0629753
292 Ga0466960_0001295
293 Ga0466959_0008402
294 Ga0495592_0383322
295 Ga0495603_0024429
296 Ga0495629_0018333
297 Ga0495653_0295304
298 Ga0495616_0129473
299 Ga0495630_0530083
300 Ga0495643_0125498
301 Ga0495652_0224003
302 Ga0495586_0113854
303 Ga0495587_0354020
304 Ga0495667_0117334
305 Ga0495634_0186624
306 Ga0495635_0374146
307 Ga0495658_0104083
308 Ga0495613_0151652
309 Ga0495581_0003489
310 Ga0495674_0185007
311 Ga0495680_0016638
312 Ga0495684_0167416
313 Ga0495614_0062666
314 Ga0496113_0415642
315 Ga0501031_0069499
316 Ga0501032_0022137
317 Ga0501033_0062450
318 Ga0501036_0003648
319 Ga0501037_0038641
320 Ga0501037_0080478
321 Ga0501038_0020529
322 Ga0501039_0000354
323 Ga0501040_0000917
324 Ga0501041_0026686
325 Ga0501041_0451586
326 Ga0501042_0001703
327 Ga0501042_1093904
328 Ga0501043_0015919
329 Ga0501046_0003337
330 Ga0501047_0003171
331 Ga0501048_0008248
332 Ga0501068_0085961
333 Ga0501069_0139175
334 Ga0501070_0638846
335 Ga0501071_0000370
336 Ga0501072_0001751
337 Ga0501073_0247452
338 Ga0501074_0010824
339 Ga0501075_0000450
340 Ga0501076_0024730
341 Ga0501076_0154243
342 Ga0501077_0002520
343 Ga0501079_0001334
344 Ga0501079_0197453
345 Ga0501080_0009695
346 Ga0501080_0185572
347 Ga0501080_0410376
348 Ga0501081_0008806
349 Ga0501083_0153871
350 Ga0501044_0001921
351 Ga0501044_0157355
352 Ga0501044_0447792
353 Ga0501045_0001613
354 nmdc:mga09592_101311_c1
355 nmdc:mga09592_422431_c1
356 nmdc:mga0n895_48656_c1
357 nmdc:mga0a205_45453_c1
358 Ga0495601_0002799
359 Ga0495601_0183563
360 Ga0495595_0163804
361 Ga0495619_0004995
362 Ga0501084_0026010
363 Ga0501084_0102815
364 Ga0501084_0145278
365 Ga0501084_1007544
366 Ga0590071_056522
367 Ga0501082_0007058
368 Ga0466962_0136069
369 Ga0530510_0000669
370 2673164465
371 2559424279
372 2917744190

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03167

UDG

Uracil DNA glycosylase superfamily

52

210

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
1mwj-assembly1.cif.gz_A crystal structure of a mug-dna pseudo substrate complex 0.9808 23 186
1mtl-assembly1.cif.gz_A non-productive mug-dna complex 0.964 23 186
1mwj-assembly1.cif.gz_A crystal structure of a mug-dna pseudo substrate complex 0.9633 23 186
3ufj-assembly1.cif.gz_B human thymine dna glycosylase bound to substrate analog 2'-fluoro-2'-deoxyuridine 0.9604 22 185
1mtl-assembly1.cif.gz_A non-productive mug-dna complex 0.958 23 186
ID Description Score Start End Superfamily
1mtlA00 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.964 23 186 3.40.470.10
1mtlA00 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.958 23 186 3.40.470.10
3uobA00 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.9451 22 185 3.40.470.10
2d07A00 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.9185 19 185 3.40.470.10
af_Q9V4D8_761_956_3.40.470.10 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.9124 3 185 3.40.470.10
ID Description Score Start End GO Terms
AF-A0A537B7M3-F1-model_v4 G/U mismatch-specific DNA glycosylase (EC 3.2.2.28) 0.9938 7 185 GO:0006285
GO:0043739
AF-A0A367FEU3-F1-model_v4 G/U mismatch-specific DNA glycosylase 0.9935 23 186 GO:0004844
GO:0006285
GO:0008263
AF-A0A6I5DQS1-F1-model_v4 deleted 0.9931 16 186
AF-A0A6B3GZ74-F1-model_v4 Mismatch-specific DNA-glycosylase 0.9926 11 122 GO:0004844
GO:0006285
GO:0008263
AF-A0A1Q7F3S3-F1-model_v4 Uracil-DNA glycosylase-like domain-containing protein 0.9924 23 184 GO:0004844
GO:0006285
GO:0008263

Map