F286054

General Info

Members Datasets Scaffolds Average Seq Length
186 151 372 139

Family's Representative Sequence

Representative Sequence 3300014969|Ga0157376_10449252|Ga0157376_104492522
Length 160
Sequence LLSTYFRARFPAQLGKGFMSITLHNLHPNEGSTKAKKGVKGQKARPGHHGARFAFEGGQMPMPRRIPKRGFKNPNRVEAFPINVSTLEKQFAAGATVDLDALRAKGIVPKLVETVKILGEGELTKKLVIKAHRISEAAKAKVEAAGGSVELVNTQVAPKA

Samples

Sample ID Description Type Environment
1 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
2 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
3 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
20 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
21 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
22 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
23 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
31 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
32 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
33 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
34 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
35 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
36 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
37 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
38 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
40 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
41 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
42 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
45 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
46 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
47 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
48 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
49 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
50 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
51 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
52 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
53 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
54 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
55 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
56 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
57 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
76 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
77 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
78 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
79 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
80 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
81 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
82 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
83 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
84 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
85 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
86 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
87 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
88 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
89 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
90 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
91 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
92 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
93 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
94 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
95 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
96 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
97 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
98 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
99 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
100 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
101 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
102 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
103 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
104 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
105 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
106 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
107 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
108 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
109 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
110 3300049556 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
111 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
112 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
113 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
114 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
115 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
116 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
117 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
118 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
119 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
120 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
121 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
122 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
123 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
124 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
125 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
126 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
127 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
128 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
129 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
130 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
131 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
132 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
133 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
134 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
135 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
136 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
137 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
138 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
139 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
140 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
141 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
142 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
143 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
144 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
145 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
146 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
147 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
148 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
149 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
150 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
151 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.55
Metatranscriptomes 6.45
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.84
Nodule 0
Rhizoplane 0
Rhizosphere 89.25
Stem 0
Stem Tuber 0
Unclassified 4.84

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157376_10449252 3300014969 Bacteria 1257
2 Ga0058859_10156518 3300004798 Bacteria 2840
3 Ga0058859_11547941 3300004798 Unclassified 703
4 Ga0058863_11944644 3300004799 Unclassified 854
5 Ga0058862_12070470 3300004803 Bacteria 839
6 Ga0058862_12874265 3300004803 Bacteria 1295
7 Ga0070690_100010654 3300005330 Bacteria 5356
8 Ga0068869_100090702 3300005334 Bacteria 2298
9 Ga0070680_100480724 3300005336 Unclassified 1062
10 Ga0070680_100709138 3300005336 Bacteria 866
11 Ga0070682_100564767 3300005337 Bacteria 893
12 Ga0068868_100931253 3300005338 Bacteria 791
13 Ga0068868_101206315 3300005338 Unclassified 700
14 Ga0070689_100026062 3300005340 Bacteria 4398
15 Ga0070689_100038150 3300005340 Bacteria 3674
16 Ga0070692_10204040 3300005345 Bacteria 1159
17 Ga0070668_101266756 3300005347 Bacteria 669
18 Ga0070671_100260509 3300005355 Bacteria 1474
19 Ga0070674_100316224 3300005356 Bacteria 1250
20 Ga0070673_100009068 3300005364 Bacteria 6660
21 Ga0070688_100141307 3300005365 Bacteria 1635
22 Ga0070688_100188474 3300005365 Bacteria 1435
23 Ga0070678_100006006 3300005456 Bacteria 7078
24 Ga0070681_10429687 3300005458 Bacteria 1233
25 Ga0068867_101519480 3300005459 Bacteria 624
26 Ga0070685_10215691 3300005466 Bacteria 1255
27 Ga0070706_100043773 3300005467 Bacteria 4136
28 Ga0070698_100007715 3300005471 Bacteria 11639
29 Ga0070698_100703202 3300005471 Bacteria 953
30 Ga0070699_100772259 3300005518 Bacteria 879
31 Ga0070679_100029856 3300005530 Bacteria 5379
32 Ga0070684_100168505 3300005535 Bacteria 1989
33 Ga0068853_100028509 3300005539 Bacteria 4697
34 Ga0070686_100758327 3300005544 Bacteria 779
35 Ga0070665_100003873 3300005548 Bacteria 15830
36 Ga0068855_100915038 3300005563 Bacteria 926
37 Ga0070702_101284144 3300005615 Bacteria 594
38 Ga0068852_100562248 3300005616 Bacteria 1142
39 Ga0068859_101020217 3300005617 Bacteria 909
40 Ga0068859_102547224 3300005617 Bacteria 563
41 Ga0068861_101171593 3300005719 Bacteria 742
42 Ga0068851_10342547 3300005834 Bacteria 868
43 Ga0068860_100100948 3300005843 Bacteria 2753
44 Ga0068862_100216973 3300005844 Bacteria 1731
45 Ga0070717_10114341 3300006028 Bacteria 2305
46 Ga0097621_101444195 3300006237 Bacteria 652
47 Ga0075431_100135713 3300006847 Bacteria 2536
48 Ga0075429_100578580 3300006880 Bacteria 984
49 Ga0075429_100802188 3300006880 Bacteria 824
50 Ga0068865_100146412 3300006881 Bacteria 1787
51 Ga0097620_101020314 3300006931 Bacteria 909
52 Ga0097620_102547808 3300006931 Bacteria 563
53 Ga0111539_12138974 3300009094 Bacteria 649
54 Ga0105245_10006329 3300009098 Bacteria 10417
55 Ga0105245_10170732 3300009098 Bacteria 2071
56 Ga0105243_10031904 3300009148 Bacteria 4065
57 Ga0105242_10137712 3300009176 Bacteria 2115
58 Ga0105238_11156811 3300009551 Bacteria 797
59 Ga0105238_11389406 3300009551 Unclassified 729
60 Ga0105249_10027935 3300009553 Bacteria 5092
61 Ga0105239_10580793 3300010375 Bacteria 1277
62 Ga0157374_10032506 3300013296 Bacteria 4751
63 Ga0157378_10399800 3300013297 Bacteria 1353
64 Ga0157378_11731297 3300013297 Unclassified 672
65 Ga0157372_10485029 3300013307 Bacteria 1441
66 Ga0163163_11408713 3300014325 Bacteria 759
67 Ga0157380_10018384 3300014326 Bacteria 5186
68 Ga0157380_11272834 3300014326 Bacteria 782
69 Ga0157376_10087369 3300014969 Bacteria 2690
70 Ga0157376_11151248 3300014969 Unclassified 803
71 Ga0163161_10650975 3300017792 Bacteria 873
72 Ga0206352_10499487 3300020078 Bacteria 920
73 Ga0207684_10032043 3300025910 Bacteria 4471
74 Ga0207660_10364043 3300025917 Bacteria 1160
75 Ga0207652_10015305 3300025921 Bacteria 6229
76 Ga0207687_10002701 3300025927 Bacteria 11998
77 Ga0207687_10104320 3300025927 Bacteria 2092
78 Ga0207644_10290988 3300025931 Bacteria 1314
79 Ga0207686_10025405 3300025934 Bacteria 3445
80 Ga0207669_10234897 3300025937 Bacteria 1355
81 Ga0207704_10168773 3300025938 Bacteria 1567
82 Ga0207667_10833786 3300025949 Bacteria 917
83 Ga0207651_10049957 3300025960 Bacteria 2837
84 Ga0207712_10049384 3300025961 Bacteria 2931
85 Ga0207712_10172458 3300025961 Bacteria 1692
86 Ga0207703_10219453 3300026035 Bacteria 1699
87 Ga0207702_10333214 3300026078 Bacteria 1448
88 Ga0207674_10741308 3300026116 Bacteria 948
89 Ga0207683_10006434 3300026121 Bacteria 10061
90 Ga0207683_10406066 3300026121 Bacteria 1253
91 Ga0268266_10004072 3300028379 Bacteria 14133
92 Ga0268266_10680216 3300028379 Bacteria 991
93 Ga0268265_10353781 3300028380 Bacteria 1342
94 Ga0268264_10610693 3300028381 Bacteria 1076
95 Ga0307517_10047808 3300028786 Bacteria 4423
96 Ga0265338_10092849 3300028800 Bacteria 2488
97 Ga0307511_10283412 3300030521 Bacteria 764
98 Ga0265320_10321642 3300031240 Bacteria 684
99 Ga0307513_10323870 3300031456 Bacteria 1298
100 Ga0307509_10009750 3300031507 Bacteria 11917
101 Ga0307509_10037446 3300031507 Bacteria 5304
102 Ga0307408_100442271 3300031548 Bacteria 1126
103 Ga0307516_10029367 3300031730 Bacteria 5559
104 Ga0307516_10442235 3300031730 Bacteria 957
105 Ga0307405_10199881 3300031731 Bacteria 1451
106 Ga0307405_11235255 3300031731 Bacteria 648
107 Ga0307406_10000446 3300031901 Bacteria 24118
108 Ga0307416_100037641 3300032002 Bacteria 3725
109 Ga0307414_10054126 3300032004 Bacteria 2803
110 Ga0373936_0000006 3300035113 Bacteria 318697
111 Ga0373941_0060396 3300035115 Bacteria 1232
112 Ga0373954_0070683 3300035118 Bacteria 1659
113 Ga0373954_0177143 3300035118 Bacteria 1045
114 Ga0373942_0093893 3300035207 Bacteria 908
115 Ga0395899_0004913 3300037312 Bacteria 10399
116 Ga0395900_0007780 3300037418 Bacteria 11056
117 Ga0395905_0426761 3300037471 Bacteria 1222
118 Ga0395905_0805213 3300037471 Bacteria 842
119 Ga0395901_0244282 3300038443 Bacteria 1871
120 Ga0451849_0587942 3300041505 Bacteria 614
121 Ga0451853_2568605 3300041512 Bacteria 546
122 Ga0439444_0065461 3300042437 Bacteria 767
123 Ga0453684_0850139 3300044712 Bacteria 981
124 Ga0451576_0910203 3300045051 Bacteria 923
125 Ga0495638_0135593 3300046460 Bacteria 1442
126 Ga0495650_0036865 3300046471 Bacteria 2135
127 Ga0495622_0067346 3300046557 Bacteria 1654
128 Ga0495669_0171901 3300046684 Bacteria 1031
129 Ga0495686_0284748 3300047472 Bacteria 917
130 Ga0501308_004779 3300049128 Bacteria 1322
131 Ga0501309_041165 3300049129 Bacteria 706
132 Ga0501310_071660 3300049130 Bacteria 532
133 Ga0501292_015000 3300049515 Bacteria 1207
134 Ga0501298_005498 3300049521 Bacteria 2037
135 Ga0501340_007574 3300049556 Bacteria 751
136 Ga0501033_0084454 3300049570 Bacteria 2327
137 Ga0501034_0027536 3300049571 Bacteria 5782
138 Ga0501034_0741420 3300049571 Bacteria 878
139 Ga0501043_1119986 3300049579 Bacteria 555
140 Ga0501046_0240172 3300049580 Bacteria 1336
141 Ga0501047_0071641 3300049581 Bacteria 3335
142 Ga0501047_0105985 3300049581 Bacteria 2691
143 Ga0501048_0868665 3300049582 Bacteria 648
144 Ga0501068_0077294 3300049584 Bacteria 2038
145 Ga0501069_0345561 3300049585 Bacteria 876
146 Ga0501070_0071599 3300049586 Bacteria 2870
147 Ga0501071_0078123 3300049587 Bacteria 2419
148 Ga0501071_0532435 3300049587 Bacteria 902
149 Ga0501073_0050335 3300049589 Bacteria 2920
150 Ga0501074_0107261 3300049590 Bacteria 2000
151 Ga0501074_0182347 3300049590 Bacteria 1497
152 Ga0501074_0818499 3300049590 Bacteria 656
153 Ga0501077_0379744 3300049593 Bacteria 903
154 Ga0501202_025647 3300049652 Bacteria 1202
155 Ga0501217_033610 3300049661 Bacteria 1275
156 Ga0501227_000308 3300049665 Bacteria 10150
157 Ga0501227_010833 3300049665 Bacteria 1981
158 Ga0501233_008499 3300049668 Bacteria 1981
159 Ga0501236_031128 3300049670 Bacteria 844
160 Ga0501221_086379 3300049704 Bacteria 762
161 Ga0501225_0007899 3300049705 Bacteria 3070
162 Ga0501229_020311 3300049706 Bacteria 878
163 Ga0501080_0372029 3300049742 Bacteria 1288
164 Ga0501081_0162451 3300049743 Bacteria 1610
165 Ga0501083_0050903 3300049744 Bacteria 2786
166 Ga0501279_048990 3300049775 Unclassified 666
167 Ga0501044_0081988 3300049823 Bacteria 3264
168 Ga0501044_0179310 3300049823 Bacteria 2086
169 Ga0501044_0587746 3300049823 Bacteria 1007
170 nmdc:mga03n38_429240_c1 3300050490 Bacteria 732
171 nmdc:mga05p37_1247033_c1 3300050507 Bacteria 763
172 nmdc:mga09592_253043_c1 3300050508 Bacteria 1527
173 nmdc:mga09592_444572_c1 3300050508 Bacteria 1119
174 nmdc:mga08y16_187801_c1 3300050511 Bacteria 2144
175 Ga0495619_0550159 3300053085 Bacteria 792
176 Ga0500646_0001595 3300053090 Bacteria 5980
177 Ga0500654_026326 3300053099 Bacteria 3606
178 Ga0500562_009021 3300053108 Bacteria 2520
179 Ga0500614_068184 3300053123 Bacteria 971
180 Ga0500568_0024149 3300053139 Bacteria 2577
181 Ga0500568_0088189 3300053139 Bacteria 1172
182 Ga0500622_0053420 3300053156 Bacteria 2075
183 Ga0500639_038978 3300053163 Bacteria 2503
184 Ga0501084_0497496 3300054114 Bacteria 1030
185 Ga0587092_036165 3300059512 Unclassified 840
186 Ga0587062_049979 3300059639 Bacteria 705
187 Ga0157376_10449252
188 Ga0058859_10156518
189 Ga0058859_11547941
190 Ga0058863_11944644
191 Ga0058862_12070470
192 Ga0058862_12874265
193 Ga0070690_100010654
194 Ga0068869_100090702
195 Ga0070680_100480724
196 Ga0070680_100709138
197 Ga0070682_100564767
198 Ga0068868_100931253
199 Ga0068868_101206315
200 Ga0070689_100026062
201 Ga0070689_100038150
202 Ga0070692_10204040
203 Ga0070668_101266756
204 Ga0070671_100260509
205 Ga0070674_100316224
206 Ga0070673_100009068
207 Ga0070688_100141307
208 Ga0070688_100188474
209 Ga0070678_100006006
210 Ga0070681_10429687
211 Ga0068867_101519480
212 Ga0070685_10215691
213 Ga0070706_100043773
214 Ga0070698_100007715
215 Ga0070698_100703202
216 Ga0070699_100772259
217 Ga0070679_100029856
218 Ga0070684_100168505
219 Ga0068853_100028509
220 Ga0070686_100758327
221 Ga0070665_100003873
222 Ga0068855_100915038
223 Ga0070702_101284144
224 Ga0068852_100562248
225 Ga0068859_101020217
226 Ga0068859_102547224
227 Ga0068861_101171593
228 Ga0068851_10342547
229 Ga0068860_100100948
230 Ga0068862_100216973
231 Ga0070717_10114341
232 Ga0097621_101444195
233 Ga0075431_100135713
234 Ga0075429_100578580
235 Ga0075429_100802188
236 Ga0068865_100146412
237 Ga0097620_101020314
238 Ga0097620_102547808
239 Ga0111539_12138974
240 Ga0105245_10006329
241 Ga0105245_10170732
242 Ga0105243_10031904
243 Ga0105242_10137712
244 Ga0105238_11156811
245 Ga0105238_11389406
246 Ga0105249_10027935
247 Ga0105239_10580793
248 Ga0157374_10032506
249 Ga0157378_10399800
250 Ga0157378_11731297
251 Ga0157372_10485029
252 Ga0163163_11408713
253 Ga0157380_10018384
254 Ga0157380_11272834
255 Ga0157376_10087369
256 Ga0157376_11151248
257 Ga0163161_10650975
258 Ga0206352_10499487
259 Ga0207684_10032043
260 Ga0207660_10364043
261 Ga0207652_10015305
262 Ga0207687_10002701
263 Ga0207687_10104320
264 Ga0207644_10290988
265 Ga0207686_10025405
266 Ga0207669_10234897
267 Ga0207704_10168773
268 Ga0207667_10833786
269 Ga0207651_10049957
270 Ga0207712_10049384
271 Ga0207712_10172458
272 Ga0207703_10219453
273 Ga0207702_10333214
274 Ga0207674_10741308
275 Ga0207683_10006434
276 Ga0207683_10406066
277 Ga0268266_10004072
278 Ga0268266_10680216
279 Ga0268265_10353781
280 Ga0268264_10610693
281 Ga0307517_10047808
282 Ga0265338_10092849
283 Ga0307511_10283412
284 Ga0265320_10321642
285 Ga0307513_10323870
286 Ga0307509_10009750
287 Ga0307509_10037446
288 Ga0307408_100442271
289 Ga0307516_10029367
290 Ga0307516_10442235
291 Ga0307405_10199881
292 Ga0307405_11235255
293 Ga0307406_10000446
294 Ga0307416_100037641
295 Ga0307414_10054126
296 Ga0373936_0000006
297 Ga0373941_0060396
298 Ga0373954_0070683
299 Ga0373954_0177143
300 Ga0373942_0093893
301 Ga0395899_0004913
302 Ga0395900_0007780
303 Ga0395905_0426761
304 Ga0395905_0805213
305 Ga0395901_0244282
306 Ga0451849_0587942
307 Ga0451853_2568605
308 Ga0439444_0065461
309 Ga0453684_0850139
310 Ga0451576_0910203
311 Ga0495638_0135593
312 Ga0495650_0036865
313 Ga0495622_0067346
314 Ga0495669_0171901
315 Ga0495686_0284748
316 Ga0501308_004779
317 Ga0501309_041165
318 Ga0501310_071660
319 Ga0501292_015000
320 Ga0501298_005498
321 Ga0501340_007574
322 Ga0501033_0084454
323 Ga0501034_0027536
324 Ga0501034_0741420
325 Ga0501043_1119986
326 Ga0501046_0240172
327 Ga0501047_0071641
328 Ga0501047_0105985
329 Ga0501048_0868665
330 Ga0501068_0077294
331 Ga0501069_0345561
332 Ga0501070_0071599
333 Ga0501071_0078123
334 Ga0501071_0532435
335 Ga0501073_0050335
336 Ga0501074_0107261
337 Ga0501074_0182347
338 Ga0501074_0818499
339 Ga0501077_0379744
340 Ga0501202_025647
341 Ga0501217_033610
342 Ga0501227_000308
343 Ga0501227_010833
344 Ga0501233_008499
345 Ga0501236_031128
346 Ga0501221_086379
347 Ga0501225_0007899
348 Ga0501229_020311
349 Ga0501080_0372029
350 Ga0501081_0162451
351 Ga0501083_0050903
352 Ga0501279_048990
353 Ga0501044_0081988
354 Ga0501044_0179310
355 Ga0501044_0587746
356 nmdc:mga03n38_429240_c1
357 nmdc:mga05p37_1247033_c1
358 nmdc:mga09592_253043_c1
359 nmdc:mga09592_444572_c1
360 nmdc:mga08y16_187801_c1
361 Ga0495619_0550159
362 Ga0500646_0001595
363 Ga0500654_026326
364 Ga0500562_009021
365 Ga0500614_068184
366 Ga0500568_0024149
367 Ga0500568_0088189
368 Ga0500622_0053420
369 Ga0500639_038978
370 Ga0501084_0497496
371 Ga0587092_036165
372 Ga0587062_049979

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00828

Ribosomal_L27A

Ribosomal proteins 50S-L15, 50S-L18e, 60S-L27A

30

150

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
1w2b-assembly1.cif.gz_N trigger factor ribosome binding domain in complex with 50s 0.8963 57 127
1p90-assembly1.cif.gz_A the three-dimensional structure of the core domain of nafy from azotobacter vinelandii determined at 1.8 resolution 0.8857 106 129
6hix-assembly1.cif.gz_AP cryo-em structure of the trypanosoma brucei mitochondrial ribosome - this entry contains the large mitoribosomal subunit 0.8446 50 129
4v6u-assembly1.cif.gz_BP promiscuous behavior of proteins in archaeal ribosomes revealed by cryo-em: implications for evolution of eukaryotic ribosomes 0.8419 60 129
6ppk-assembly1.cif.gz_L rbga+45srbga complex 0.835 46 130
ID Description Score Start End Superfamily
af_P0A0F8_66_146_3.100.10.10 Alpha Beta;Ribosomal Protein L15; Chain: K; domain 2;Ribosomal Protein L15; Chain: K; domain 2; 0.942 49 130 3.100.10.10
5v7qL01 Alpha Beta;Ribosomal Protein L15; Chain: K; domain 2;Ribosomal Protein L15; Chain: K; domain 2; 0.9325 59 128 3.100.10.10
af_P0A0F8_66_146_3.100.10.10 Alpha Beta;Ribosomal Protein L15; Chain: K; domain 2;Ribosomal Protein L15; Chain: K; domain 2; 0.931 49 130 3.100.10.10
af_Q9BPN6_41_176_3.100.10.10 Alpha Beta;Ribosomal Protein L15; Chain: K; domain 2;Ribosomal Protein L15; Chain: K; domain 2; 0.9263 54 129 3.100.10.10
af_A0A0R0I064_101_171_3.100.10.10 Alpha Beta;Ribosomal Protein L15; Chain: K; domain 2;Ribosomal Protein L15; Chain: K; domain 2; 0.9255 69 129 3.100.10.10
ID Description Score Start End GO Terms
AF-A0A7C6CNH4-F1-model_v4 50S ribosomal protein L15 0.9941 57 130 GO:0003735
GO:0005840
GO:0006412
GO:0016020
GO:1990904
AF-A0A0S2I9B7-F1-model_v4 50S ribosomal protein L15 0.987 58 130 GO:0005840
GO:1990904
AF-A0A4V1QUN6-F1-model_v4 50S ribosomal protein L15 0.9858 56 130 GO:0003735
GO:0005840
GO:0006412
GO:0016020
GO:0030313
GO:1990904
AF-A0A2E7QQ07-F1-model_v4 50S ribosomal protein L15 0.9653 56 132 GO:0003735
GO:0006412
GO:0022625
AF-A0A353KSI4-F1-model_v4 50S ribosomal protein L15 0.9592 54 130 GO:0005840
GO:1990904

Map