F285996

General Info

Members Datasets Scaffolds Average Seq Length
186 143 186 168

Family's Representative Sequence

Representative Sequence 3300013296|Ga0157374_10087554|Ga0157374_100875543
Length 189
Sequence MIRPFPASRVFGIAGWSGSGKTTLMIKLIPVLVERGLKVATLKHAHHAFQVDLPGKDSYEHRRAGASEVIVSSSSRWVQIHENVDEGEPTLADLLGLLSPCDLLLIEGFRRERYPKLEVYRAEVGKPMLHPGDPHVLAMASAGPVADVKIPVIDLDDVTAIADFVCDHAQPLTAVLSALAGAGSEGSIH

Samples

Sample ID Description Type Environment
1 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
8 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
9 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
10 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
11 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
12 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
13 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
14 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
15 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
16 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
17 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
18 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
19 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
20 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
21 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
22 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
23 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
24 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
25 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
26 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
27 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
28 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
29 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
30 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
31 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
32 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
33 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
34 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
35 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
36 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
37 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
38 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
40 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
42 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
43 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
44 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
45 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
46 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
47 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
48 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
49 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
70 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
71 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
72 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
73 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
74 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
75 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
76 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
77 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
79 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
80 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
81 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
82 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
83 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
84 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
85 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
86 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
87 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
88 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
89 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
90 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
91 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
92 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
93 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
94 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
95 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
96 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
97 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
98 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
99 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
100 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
101 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
102 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
103 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
104 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
105 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
106 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
107 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
108 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
109 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
110 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
111 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
112 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
113 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
114 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
115 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
116 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
117 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
118 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
119 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
120 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
121 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
122 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
123 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
124 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
125 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
126 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
127 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
128 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
129 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
130 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
131 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
132 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
133 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
134 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
135 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
136 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
137 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
138 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
139 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
140 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
141 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
142 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
143 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.54
Nodule 0
Rhizoplane 0.54
Rhizosphere 98.39
Stem 0
Stem Tuber 0
Unclassified 0.54

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065707_10224031 3300005295 Bacteria 1214
2 Ga0070676_10187405 3300005328 Bacteria 1349
3 Ga0070683_100207978 3300005329 Bacteria 1858
4 Ga0070690_100004445 3300005330 Bacteria 7785
5 Ga0070670_100368343 3300005331 Bacteria 1264
6 Ga0068868_100481102 3300005338 Bacteria 1084
7 Ga0070691_10044110 3300005341 Bacteria 2114
8 Ga0070691_10610588 3300005341 Bacteria 645
9 Ga0070674_100002036 3300005356 Bacteria 11079
10 Ga0070713_100000306 3300005436 Bacteria 32507
11 Ga0070711_100158227 3300005439 Bacteria 1715
12 Ga0070711_100657820 3300005439 Bacteria 879
13 Ga0070694_100429672 3300005444 Bacteria 1039
14 Ga0070678_100009519 3300005456 Bacteria 5892
15 Ga0070662_100042006 3300005457 Bacteria 3265
16 Ga0070681_10039275 3300005458 Bacteria 4745
17 Ga0068867_100040346 3300005459 Bacteria 3407
18 Ga0070707_100295099 3300005468 Bacteria 1575
19 Ga0070699_100911590 3300005518 Bacteria 805
20 Ga0070697_100003738 3300005536 Bacteria 11689
21 Ga0068853_100396727 3300005539 Bacteria 1291
22 Ga0070696_100041988 3300005546 Bacteria 3162
23 Ga0070696_101145905 3300005546 Bacteria 655
24 Ga0070693_100000467 3300005547 Bacteria 18138
25 Ga0070693_100547481 3300005547 Bacteria 828
26 Ga0068854_100004760 3300005578 Bacteria 8557
27 Ga0068854_100259498 3300005578 Bacteria 1391
28 Ga0068856_100096774 3300005614 Bacteria 2940
29 Ga0068856_100186826 3300005614 Bacteria 2086
30 Ga0070702_100055311 3300005615 Bacteria 2288
31 Ga0068866_10018317 3300005718 Bacteria 3164
32 Ga0068851_10219697 3300005834 Bacteria 1067
33 Ga0068863_101100439 3300005841 Unclassified 799
34 Ga0081539_10095277 3300005985 Bacteria 1529
35 Ga0070712_100086490 3300006175 Bacteria 2285
36 Ga0075428_100005404 3300006844 Bacteria 14201
37 Ga0075428_100078234 3300006844 Bacteria 3610
38 Ga0075430_100038327 3300006846 Bacteria 4060
39 Ga0075431_100237065 3300006847 Bacteria 1857
40 Ga0075431_101307733 3300006847 Bacteria 686
41 Ga0075434_100401255 3300006871 Bacteria 1392
42 Ga0075429_100155470 3300006880 Bacteria 2003
43 Ga0068865_100172411 3300006881 Bacteria 1660
44 Ga0075436_100041734 3300006914 Bacteria 3165
45 Ga0105240_11227826 3300009093 Bacteria 793
46 Ga0111539_11777959 3300009094 Bacteria 715
47 Ga0105245_10002199 3300009098 Bacteria 17673
48 Ga0114129_10197026 3300009147 Bacteria 2731
49 Ga0114129_10454023 3300009147 Bacteria 1680
50 Ga0105241_10016092 3300009174 Bacteria 5483
51 Ga0105242_10004755 3300009176 Bacteria 10516
52 Ga0105249_10150326 3300009553 Bacteria 2242
53 Ga0157371_10496229 3300013102 Bacteria 901
54 Ga0157374_10087554 3300013296 Bacteria 2965
55 Ga0157378_10004277 3300013297 Bacteria 12578
56 Ga0163162_10010901 3300013306 Bacteria 8849
57 Ga0157372_10801499 3300013307 Bacteria 1094
58 Ga0207692_10633322 3300025898 Bacteria 690
59 Ga0207642_10002825 3300025899 Bacteria 5422
60 Ga0207645_10067872 3300025907 Bacteria 2279
61 Ga0207693_10105625 3300025915 Bacteria 2209
62 Ga0207663_10436462 3300025916 Bacteria 1008
63 Ga0207646_10056644 3300025922 Bacteria 3503
64 Ga0207687_10002349 3300025927 Bacteria 12859
65 Ga0207700_10000184 3300025928 Bacteria 37705
66 Ga0207644_10027733 3300025931 Bacteria 3914
67 Ga0207706_10019409 3300025933 Bacteria 6116
68 Ga0207686_10001680 3300025934 Bacteria 12324
69 Ga0207670_10894590 3300025936 Bacteria 743
70 Ga0207669_10001376 3300025937 Bacteria 10343
71 Ga0207704_10148984 3300025938 Bacteria 1648
72 Ga0207712_10151204 3300025961 Bacteria 1793
73 Ga0207640_10019025 3300025981 Bacteria 4049
74 Ga0207640_10243443 3300025981 Bacteria 1391
75 Ga0207678_10966363 3300026067 Bacteria 754
76 Ga0207702_10021957 3300026078 Bacteria 5287
77 Ga0207641_11080937 3300026088 Unclassified 800
78 Ga0207683_10001322 3300026121 Bacteria 22379
79 Ga0209969_1008504 3300027360 Bacteria 1456
80 Ga0209969_1025567 3300027360 Bacteria 890
81 Ga0209967_1015310 3300027364 Bacteria 1097
82 Ga0210000_1001637 3300027462 Bacteria 3161
83 Ga0209999_1017129 3300027543 Bacteria 1320
84 Ga0209970_1076390 3300027614 Bacteria 626
85 Ga0209983_1039666 3300027665 Bacteria 1017
86 Ga0209971_1033110 3300027682 Bacteria 1241
87 Ga0209974_10004365 3300027876 Bacteria 5027
88 Ga0268264_10047562 3300028381 Bacteria 3567
89 Ga0265331_10075333 3300031250 Bacteria 1574
90 Ga0265327_10003173 3300031251 Bacteria 16090
91 Ga0265327_10008463 3300031251 Bacteria 7653
92 Ga0307409_100809050 3300031995 Bacteria 945
93 Ga0307416_100850816 3300032002 Bacteria 1010
94 Ga0307414_10969911 3300032004 Bacteria 782
95 Ga0307415_102398243 3300032126 Bacteria 519
96 Ga0316583_10012065 3300032133 Bacteria 3118
97 Ga0316583_10021452 3300032133 Bacteria 2315
98 Ga0373944_0063196 3300035089 Bacteria 1192
99 Ga0373923_0220002 3300035111 Bacteria 882
100 Ga0373945_0279967 3300035116 Bacteria 710
101 Ga0373946_0326517 3300035171 Bacteria 763
102 Ga0373931_0581053 3300035691 Bacteria 731
103 Ga0373935_0027865 3300035692 Bacteria 3491
104 Ga0373935_0033288 3300035692 Bacteria 3206
105 Ga0373927_0135332 3300035695 Bacteria 1610
106 Ga0373947_0023742 3300035725 Bacteria 3569
107 Ga0373947_0033136 3300035725 Bacteria 3048
108 Ga0373925_0020867 3300037068 Bacteria 4774
109 Ga0373925_0035833 3300037068 Bacteria 3662
110 Ga0395899_0295843 3300037312 Unclassified 1097
111 Ga0395900_0066638 3300037418 Bacteria 3700
112 Ga0395898_0695707 3300037466 Unclassified 958
113 Ga0395901_0194508 3300038443 Unclassified 2127
114 Ga0451853_0090339 3300041512 Bacteria 706
115 Ga0451577_0003352 3300042876 Bacteria 17943
116 Ga0451577_0022848 3300042876 Bacteria 5709
117 Ga0451577_0048812 3300042876 Bacteria 3780
118 Ga0451577_0156618 3300042876 Bacteria 2050
119 Ga0451577_0511453 3300042876 Bacteria 1090
120 Ga0453683_0173147 3300044673 Bacteria 1367
121 Ga0453684_0000005 3300044712 Bacteria 1431632
122 Ga0453684_0000193 3300044712 Bacteria 266146
123 Ga0453684_0001126 3300044712 Bacteria 83760
124 Ga0453684_0822986 3300044712 Bacteria 1000
125 Ga0453684_1880293 3300044712 Bacteria 606
126 Ga0451576_0057358 3300045051 Bacteria 4071
127 Ga0451576_0073100 3300045051 Bacteria 3568
128 Ga0495659_0078136 3300046664 Bacteria 1251
129 Ga0495613_0000435 3300046689 Bacteria 35741
130 Ga0496107_0054355 3300048910 Bacteria 2890
131 Ga0501033_0034475 3300049570 Bacteria 3797
132 Ga0501036_0016963 3300049572 Bacteria 6085
133 Ga0501036_0052603 3300049572 Bacteria 3449
134 Ga0501038_0335071 3300049574 Bacteria 1181
135 Ga0501038_0372360 3300049574 Bacteria 1109
136 Ga0501039_1067183 3300049575 Bacteria 626
137 Ga0501040_0114203 3300049576 Bacteria 1890
138 Ga0501040_0401191 3300049576 Bacteria 985
139 Ga0501041_0002727 3300049577 Bacteria 10078
140 Ga0501042_0014640 3300049578 Bacteria 5357
141 Ga0501042_0069271 3300049578 Bacteria 2523
142 Ga0501043_0081548 3300049579 Bacteria 2542
143 Ga0501043_1040840 3300049579 Bacteria 581
144 Ga0501068_0257728 3300049584 Bacteria 1112
145 Ga0501069_0088791 3300049585 Bacteria 1747
146 Ga0501069_0154992 3300049585 Bacteria 1317
147 Ga0501070_0005049 3300049586 Bacteria 11257
148 Ga0501070_0023441 3300049586 Bacteria 5171
149 Ga0501071_0045186 3300049587 Bacteria 3161
150 Ga0501071_0124450 3300049587 Bacteria 1913
151 Ga0501072_0144663 3300049588 Bacteria 1896
152 Ga0501072_0247306 3300049588 Bacteria 1420
153 Ga0501073_0176196 3300049589 Bacteria 1480
154 Ga0501074_0127249 3300049590 Bacteria 1823
155 Ga0501074_0208565 3300049590 Bacteria 1392
156 Ga0501075_0112082 3300049591 Bacteria 2074
157 Ga0501075_0533525 3300049591 Bacteria 895
158 Ga0501076_0022335 3300049592 Bacteria 4863
159 Ga0501077_0381402 3300049593 Bacteria 900
160 Ga0501209_001906 3300049656 Bacteria 3077
161 Ga0501079_0053799 3300049741 Bacteria 3105
162 Ga0501080_0121858 3300049742 Bacteria 2416
163 Ga0501081_0008891 3300049743 Bacteria 6526
164 Ga0501081_0079149 3300049743 Bacteria 2299
165 Ga0501035_0000621 3300049822 Bacteria 39045
166 Ga0501035_0289831 3300049822 Bacteria 1382
167 Ga0501044_0186016 3300049823 Bacteria 2042
168 Ga0501045_0145565 3300049824 Bacteria 1762
169 nmdc:mga05p37_1253608_c1 3300050507 Bacteria 760
170 nmdc:mga09592_278519_c1 3300050508 Bacteria 1451
171 nmdc:mga09592_327856_c1 3300050508 Bacteria 1326
172 nmdc:mga06r32_17397_c1 3300050510 Bacteria 6561
173 nmdc:mga06r32_422165_c1 3300050510 Bacteria 1315
174 nmdc:mga08y16_142489_c1 3300050511 Bacteria 2492
175 nmdc:mga08y16_264924_c1 3300050511 Bacteria 1774
176 nmdc:mga0n895_353470_c1 3300050512 Bacteria 1488
177 nmdc:mga08x19_347960_c1 3300050514 Bacteria 1034
178 nmdc:mga08x19_57446_c1 3300050514 Bacteria 2514
179 Ga0495612_0014911 3300053078 Bacteria 3118
180 Ga0495595_0048739 3300053084 Bacteria 1957
181 Ga0495619_0012843 3300053085 Bacteria 5275
182 Ga0500608_234636 3300053122 Bacteria 729
183 Ga0501084_0014173 3300054114 Bacteria 6601
184 Ga0501084_0079043 3300054114 Bacteria 2757
185 Ga0501082_0031267 3300060353 Bacteria 4589
186 Ga0530510_0001427 3300061734 Bacteria 16004

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049572 Ga0501036_0052603 Ga0501036_0052603_27_479 147
2 3300049588 Ga0501072_0247306 Ga0501072_0247306_945_1397 147
3 3300025922 Ga0207646_10056644 Ga0207646_100566444 151
4 3300005468 Ga0070707_100295099 Ga0070707_1002950991 152
5 3300032002 Ga0307416_100850816 Ga0307416_1008508162 159
6 3300025898 Ga0207692_10633322 Ga0207692_106333222 161
7 3300027462 Ga0210000_1001637 Ga0210000_10016372 161
8 3300042876 Ga0451577_0003352 Ga0451577_0003352_9611_10105 161
9 3300044712 Ga0453684_0000005 Ga0453684_0000005_624372_624866 161
10 3300044712 Ga0453684_0000193 Ga0453684_0000193_10464_10958 161
11 3300044712 Ga0453684_1880293 Ga0453684_1880293_65_559 161
12 3300049579 Ga0501043_1040840 Ga0501043_1040840_66_551 161
13 3300005331 Ga0070670_100368343 Ga0070670_1003683432 162
14 3300044712 Ga0453684_0001126 Ga0453684_0001126_17385_17894 162
15 3300006844 Ga0075428_100078234 Ga0075428_1000782345 163
16 3300027543 Ga0209999_1017129 Ga0209999_10171292 163
17 3300041512 Ga0451853_0090339 Ga0451853_0090339_25_591 163
18 3300049656 Ga0501209_001906 Ga0501209_001906_18_512 163
19 3300053122 Ga0500608_234636 Ga0500608_234636_194_703 163
20 3300005295 Ga0065707_10224031 Ga0065707_102240312 164
21 3300005328 Ga0070676_10187405 Ga0070676_101874052 164
22 3300005329 Ga0070683_100207978 Ga0070683_1002079783 164
23 3300005330 Ga0070690_100004445 Ga0070690_1000044455 164
24 3300005338 Ga0068868_100481102 Ga0068868_1004811021 164
25 3300005341 Ga0070691_10044110 Ga0070691_100441102 164
26 3300005341 Ga0070691_10610588 Ga0070691_106105881 164
27 3300005356 Ga0070674_100002036 Ga0070674_1000020368 164
28 3300005436 Ga0070713_100000306 Ga0070713_1000003067 164
29 3300005439 Ga0070711_100158227 Ga0070711_1001582272 164
30 3300005439 Ga0070711_100657820 Ga0070711_1006578202 164
31 3300005444 Ga0070694_100429672 Ga0070694_1004296722 164
32 3300005456 Ga0070678_100009519 Ga0070678_1000095196 164
33 3300005457 Ga0070662_100042006 Ga0070662_1000420062 164
34 3300005458 Ga0070681_10039275 Ga0070681_100392755 164
35 3300005459 Ga0068867_100040346 Ga0068867_1000403465 164
36 3300005518 Ga0070699_100911590 Ga0070699_1009115902 164
37 3300005536 Ga0070697_100003738 Ga0070697_1000037385 164
38 3300005539 Ga0068853_100396727 Ga0068853_1003967272 164
39 3300005546 Ga0070696_100041988 Ga0070696_1000419884 164
40 3300005546 Ga0070696_101145905 Ga0070696_1011459051 164
41 3300005547 Ga0070693_100000467 Ga0070693_1000004678 164
42 3300005547 Ga0070693_100547481 Ga0070693_1005474812 164
43 3300005578 Ga0068854_100004760 Ga0068854_1000047607 164
44 3300005578 Ga0068854_100259498 Ga0068854_1002594982 164
45 3300005614 Ga0068856_100096774 Ga0068856_1000967742 164
46 3300005614 Ga0068856_100186826 Ga0068856_1001868263 164
47 3300005615 Ga0070702_100055311 Ga0070702_1000553112 164
48 3300005718 Ga0068866_10018317 Ga0068866_100183172 164
49 3300005834 Ga0068851_10219697 Ga0068851_102196972 164
50 3300005841 Ga0068863_101100439 Ga0068863_1011004391 164
51 3300005985 Ga0081539_10095277 Ga0081539_100952772 164
52 3300006175 Ga0070712_100086490 Ga0070712_1000864903 164
53 3300006844 Ga0075428_100005404 Ga0075428_1000054042 164
54 3300006846 Ga0075430_100038327 Ga0075430_1000383272 164
55 3300006847 Ga0075431_100237065 Ga0075431_1002370652 164
56 3300006847 Ga0075431_101307733 Ga0075431_1013077331 164
57 3300006871 Ga0075434_100401255 Ga0075434_1004012552 164
58 3300006880 Ga0075429_100155470 Ga0075429_1001554702 164
59 3300006881 Ga0068865_100172411 Ga0068865_1001724112 164
60 3300006914 Ga0075436_100041734 Ga0075436_1000417345 164
61 3300009093 Ga0105240_11227826 Ga0105240_112278261 164
62 3300009094 Ga0111539_11777959 Ga0111539_117779591 164
63 3300009098 Ga0105245_10002199 Ga0105245_1000219918 164
64 3300009147 Ga0114129_10197026 Ga0114129_101970264 164
65 3300009147 Ga0114129_10454023 Ga0114129_104540231 164
66 3300009174 Ga0105241_10016092 Ga0105241_100160925 164
67 3300009176 Ga0105242_10004755 Ga0105242_100047559 164
68 3300009553 Ga0105249_10150326 Ga0105249_101503262 164
69 3300013102 Ga0157371_10496229 Ga0157371_104962292 164
70 3300013296 Ga0157374_10087554 Ga0157374_100875543 164
71 3300013297 Ga0157378_10004277 Ga0157378_1000427713 164
72 3300013306 Ga0163162_10010901 Ga0163162_100109011 164
73 3300013307 Ga0157372_10801499 Ga0157372_108014992 164
74 3300025899 Ga0207642_10002825 Ga0207642_100028255 164
75 3300025907 Ga0207645_10067872 Ga0207645_100678723 164
76 3300025915 Ga0207693_10105625 Ga0207693_101056252 164
77 3300025916 Ga0207663_10436462 Ga0207663_104364622 164
78 3300025927 Ga0207687_10002349 Ga0207687_1000234911 164
79 3300025928 Ga0207700_10000184 Ga0207700_1000018432 164
80 3300025931 Ga0207644_10027733 Ga0207644_100277331 164
81 3300025933 Ga0207706_10019409 Ga0207706_100194097 164
82 3300025934 Ga0207686_10001680 Ga0207686_1000168011 164
83 3300025936 Ga0207670_10894590 Ga0207670_108945902 164
84 3300025937 Ga0207669_10001376 Ga0207669_100013767 164
85 3300025938 Ga0207704_10148984 Ga0207704_101489842 164
86 3300025961 Ga0207712_10151204 Ga0207712_101512042 164
87 3300025981 Ga0207640_10019025 Ga0207640_100190252 164
88 3300025981 Ga0207640_10243443 Ga0207640_102434432 164
89 3300026067 Ga0207678_10966363 Ga0207678_109663631 164
90 3300026078 Ga0207702_10021957 Ga0207702_100219575 164
91 3300026088 Ga0207641_11080937 Ga0207641_110809371 164
92 3300026121 Ga0207683_10001322 Ga0207683_100013227 164
93 3300027360 Ga0209969_1008504 Ga0209969_10085043 164
94 3300027360 Ga0209969_1025567 Ga0209969_10255671 164
95 3300027364 Ga0209967_1015310 Ga0209967_10153101 164
96 3300027614 Ga0209970_1076390 Ga0209970_10763901 164
97 3300027665 Ga0209983_1039666 Ga0209983_10396663 164
98 3300027682 Ga0209971_1033110 Ga0209971_10331101 164
99 3300027876 Ga0209974_10004365 Ga0209974_100043655 164
100 3300028381 Ga0268264_10047562 Ga0268264_100475621 164
101 3300031250 Ga0265331_10075333 Ga0265331_100753331 164
102 3300031251 Ga0265327_10003173 Ga0265327_1000317314 164
103 3300031251 Ga0265327_10008463 Ga0265327_100084637 164
104 3300031995 Ga0307409_100809050 Ga0307409_1008090502 164
105 3300032004 Ga0307414_10969911 Ga0307414_109699112 164
106 3300032126 Ga0307415_102398243 Ga0307415_1023982431 164
107 3300032133 Ga0316583_10012065 Ga0316583_100120652 164
108 3300032133 Ga0316583_10021452 Ga0316583_100214522 164
109 3300035089 Ga0373944_0063196 Ga0373944_0063196_60_569 164
110 3300035111 Ga0373923_0220002 Ga0373923_0220002_176_685 164
111 3300035116 Ga0373945_0279967 Ga0373945_0279967_99_608 164
112 3300035171 Ga0373946_0326517 Ga0373946_0326517_181_690 164
113 3300035691 Ga0373931_0581053 Ga0373931_0581053_153_650 164
114 3300035692 Ga0373935_0027865 Ga0373935_0027865_1951_2460 164
115 3300035692 Ga0373935_0033288 Ga0373935_0033288_114_626 164
116 3300035695 Ga0373927_0135332 Ga0373927_0135332_630_1139 164
117 3300035725 Ga0373947_0023742 Ga0373947_0023742_67_576 164
118 3300035725 Ga0373947_0033136 Ga0373947_0033136_1869_2378 164
119 3300037068 Ga0373925_0020867 Ga0373925_0020867_2646_3155 164
120 3300037068 Ga0373925_0035833 Ga0373925_0035833_2459_2968 164
121 3300037312 Ga0395899_0295843 Ga0395899_0295843_494_1039 164
122 3300037418 Ga0395900_0066638 Ga0395900_0066638_394_939 164
123 3300037466 Ga0395898_0695707 Ga0395898_0695707_30_575 164
124 3300038443 Ga0395901_0194508 Ga0395901_0194508_282_827 164
125 3300042876 Ga0451577_0022848 Ga0451577_0022848_551_1066 164
126 3300042876 Ga0451577_0048812 Ga0451577_0048812_489_1001 164
127 3300042876 Ga0451577_0156618 Ga0451577_0156618_1444_1941 164
128 3300042876 Ga0451577_0511453 Ga0451577_0511453_221_787 164
129 3300044673 Ga0453683_0173147 Ga0453683_0173147_213_728 164
130 3300044712 Ga0453684_0822986 Ga0453684_0822986_235_732 164
131 3300045051 Ga0451576_0057358 Ga0451576_0057358_1424_1990 164
132 3300045051 Ga0451576_0073100 Ga0451576_0073100_781_1296 164
133 3300046664 Ga0495659_0078136 Ga0495659_0078136_167_676 164
134 3300046689 Ga0495613_0000435 Ga0495613_0000435_24255_24824 164
135 3300048910 Ga0496107_0054355 Ga0496107_0054355_2245_2790 164
136 3300049570 Ga0501033_0034475 Ga0501033_0034475_1820_2329 164
137 3300049572 Ga0501036_0016963 Ga0501036_0016963_5452_5961 164
138 3300049574 Ga0501038_0335071 Ga0501038_0335071_561_1055 164
139 3300049574 Ga0501038_0372360 Ga0501038_0372360_493_1002 164
140 3300049575 Ga0501039_1067183 Ga0501039_1067183_38_547 164
141 3300049576 Ga0501040_0114203 Ga0501040_0114203_1086_1595 164
142 3300049576 Ga0501040_0401191 Ga0501040_0401191_418_912 164
143 3300049577 Ga0501041_0002727 Ga0501041_0002727_3148_3657 164
144 3300049578 Ga0501042_0014640 Ga0501042_0014640_4061_4570 164
145 3300049578 Ga0501042_0069271 Ga0501042_0069271_810_1319 164
146 3300049579 Ga0501043_0081548 Ga0501043_0081548_329_838 164
147 3300049584 Ga0501068_0257728 Ga0501068_0257728_135_644 164
148 3300049585 Ga0501069_0088791 Ga0501069_0088791_849_1358 164
149 3300049585 Ga0501069_0154992 Ga0501069_0154992_439_948 164
150 3300049586 Ga0501070_0005049 Ga0501070_0005049_9848_10357 164
151 3300049586 Ga0501070_0023441 Ga0501070_0023441_1872_2381 164
152 3300049587 Ga0501071_0045186 Ga0501071_0045186_246_755 164
153 3300049587 Ga0501071_0124450 Ga0501071_0124450_840_1349 164
154 3300049588 Ga0501072_0144663 Ga0501072_0144663_695_1204 164
155 3300049589 Ga0501073_0176196 Ga0501073_0176196_907_1416 164
156 3300049590 Ga0501074_0127249 Ga0501074_0127249_1109_1618 164
157 3300049590 Ga0501074_0208565 Ga0501074_0208565_255_764 164
158 3300049591 Ga0501075_0112082 Ga0501075_0112082_609_1118 164
159 3300049591 Ga0501075_0533525 Ga0501075_0533525_296_805 164
160 3300049592 Ga0501076_0022335 Ga0501076_0022335_807_1316 164
161 3300049593 Ga0501077_0381402 Ga0501077_0381402_68_577 164
162 3300049741 Ga0501079_0053799 Ga0501079_0053799_2376_2885 164
163 3300049742 Ga0501080_0121858 Ga0501080_0121858_1363_1872 164
164 3300049743 Ga0501081_0008891 Ga0501081_0008891_164_673 164
165 3300049743 Ga0501081_0079149 Ga0501081_0079149_1757_2251 164
166 3300049822 Ga0501035_0000621 Ga0501035_0000621_19789_20298 164
167 3300049822 Ga0501035_0289831 Ga0501035_0289831_562_1071 164
168 3300049823 Ga0501044_0186016 Ga0501044_0186016_1087_1596 164
169 3300049824 Ga0501045_0145565 Ga0501045_0145565_943_1452 164
170 3300050507 nmdc:mga05p37_1253608_c1 nmdc:mga05p37_1253608_c1_83_577 164
171 3300050508 nmdc:mga09592_278519_c1 nmdc:mga09592_278519_c1_165_659 164
172 3300050508 nmdc:mga09592_327856_c1 nmdc:mga09592_327856_c1_657_1151 164
173 3300050510 nmdc:mga06r32_17397_c1 nmdc:mga06r32_17397_c1_3381_3875 164
174 3300050510 nmdc:mga06r32_422165_c1 nmdc:mga06r32_422165_c1_293_787 164
175 3300050511 nmdc:mga08y16_142489_c1 nmdc:mga08y16_142489_c1_1852_2346 164
176 3300050511 nmdc:mga08y16_264924_c1 nmdc:mga08y16_264924_c1_128_634 164
177 3300050512 nmdc:mga0n895_353470_c1 nmdc:mga0n895_353470_c1_63_560 164
178 3300050514 nmdc:mga08x19_347960_c1 nmdc:mga08x19_347960_c1_39_551 164
179 3300050514 nmdc:mga08x19_57446_c1 nmdc:mga08x19_57446_c1_1735_2232 164
180 3300053078 Ga0495612_0014911 Ga0495612_0014911_1389_1898 164
181 3300053084 Ga0495595_0048739 Ga0495595_0048739_369_878 164
182 3300053085 Ga0495619_0012843 Ga0495619_0012843_70_579 164
183 3300054114 Ga0501084_0014173 Ga0501084_0014173_1733_2242 164
184 3300054114 Ga0501084_0079043 Ga0501084_0079043_1781_2296 164
185 3300060353 Ga0501082_0031267 Ga0501082_0031267_142_651 164
186 3300061734 Ga0530510_0001427 Ga0530510_0001427_7680_8189 164

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03205

MobB

Molybdopterin guanine dinucleotide synthesis protein B

10

142

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
3adc-assembly1.cif.gz_A crystal structure of o-phosphoseryl-trna kinase complexed with selenocysteine trna and amppnp (crystal type 2) 0.9184 3 36
5x8j-assembly1.cif.gz_A k16m mutant of thermus thermophilus hb8 thymidylate kinase 0.8957 2 37
5xal-assembly1.cif.gz_A y99f mutant of thermus thermophilus hb8 thymidylate kinase 0.8927 2 38
1p9n-assembly1.cif.gz_B crystal structure of escherichia coli mobb. 0.8795 1 161
3a4n-assembly1.cif.gz_B crystal structure of archaeal o-phosphoseryl-trna(sec) kinase 0.8788 1 36
ID Description Score Start End Superfamily
3adcA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9123 4 36 3.40.50.300
af_P32125_6_175_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9083 2 161 3.40.50.300
af_P32916_375_621_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8834 2 36 3.40.50.300
af_P32125_6_175_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8822 2 161 3.40.50.300
1np6B02 Mainly Beta;Single Sheet;N-terminal domain of TfIIb; 0.856 47 75 2.20.25.120
ID Description Score Start End GO Terms
AF-A0A1F4F8S5-F1-model_v4 Molybdopterin-guanine dinucleotide biosynthesis protein B 0.9803 1 164 GO:0005525
GO:0006777
AF-A0A5A9GWA5-F1-model_v4 Molybdopterin-guanine dinucleotide biosynthesis protein B 0.9735 1 164 GO:0005525
GO:0006777
AF-A0A3D2F9U6-F1-model_v4 Molybdopterin-guanine dinucleotide biosynthesis protein B 0.9721 1 164 GO:0005525
GO:0006777
AF-A0A0E9MI98-F1-model_v4 Molybdopterin-guanine dinucleotide biosynthesis protein MobB 0.972 1 164 GO:0005525
GO:0006777
AF-A0A1B8S7X5-F1-model_v4 Molybdopterin-guanine dinucleotide biosynthesis protein B 0.9719 1 163 GO:0005525
GO:0006777

Feature Viewer

pLDDT pTM Quality
91.86 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map