F274162

General Info

Members Datasets Scaffolds Average Seq Length
179 127 171 238

Family's Representative Sequence

Representative Sequence 3300037471|Ga0395905_0315669|Ga0395905_0315669_193_957
Length 254
Sequence MLVLRSLLFTLYLYGSMVVMGTVFAPVLMLSRPTVMRFAKGWARSVLWALRVICGVRVEMRGLQHRPAGAALIAAKHQGMLDVIAPFIYLDDPCFVLKKELIGLPFFGWYASRMRMIPVDRGAQTKALKQMVADMRDRLQEQRQIVIFPEGTRVALDAKGDYKPGVAALYRDLGDTPCTPVATNSGLYWPAHGFIRKPGVAVFEFLEPIPAGVKRGPFMQELETRIETASKALVAEGRRLAAPAVSVDQASTNA

Samples

Sample ID Description Type Environment
1 2643221574 Brevundimonas sp. Root608 Isolate Unclassified
2 2643221663 Brevundimonas sp. Root1279 Isolate Unclassified
3 2643221699 Brevundimonas sp. Root1423 Isolate Unclassified
4 2739367756 Asticcacaulis sp. CF398 Isolate Unclassified
5 2928972540 Brevundimonas sp. 1080 Isolate Rhizosphere
6 2941485952 Brevundimonas faecalis 2814 Isolate Rhizosphere
7 2977240413 Brevundimonas vesicularis SORGH_AS 431 Isolate Unclassified
8 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
9 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
10 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
11 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
23 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
24 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
25 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
26 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
27 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
28 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
29 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
30 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
31 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
32 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
33 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
34 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
35 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
36 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
37 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
38 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
39 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
40 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
41 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
42 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
43 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
44 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
45 3300015684 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.2_F02 Metagenome Unclassified
46 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
47 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
48 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
49 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
50 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
51 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
52 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
68 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
72 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
73 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
74 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
75 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
76 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
77 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
78 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
79 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
80 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
81 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
82 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
83 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
84 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
85 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
86 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
87 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
88 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
89 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
90 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
91 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
92 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
93 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
94 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
95 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
96 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
97 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
98 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
99 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
100 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
101 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
102 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
103 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
104 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
105 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
106 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
107 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
108 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
109 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
110 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
111 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
112 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
113 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
114 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
115 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
116 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
117 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
118 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
119 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
120 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
121 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
122 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
123 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
124 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
125 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
126 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
127 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.53
Metatranscriptomes 0
Isolates 4.47

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.15
Nodule 0.56
Rhizoplane 4.47
Rhizosphere 70.39
Stem 0
Stem Tuber 0
Unclassified 18.44

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootL2_10033621 3300003322 Bacteria 2662
2 rootL2_10264607 3300003322 Bacteria 4405
3 rootH1_10052101 3300003323 Bacteria 2129
4 rootH1_10054677 3300003323 Bacteria 6907
5 Ga0055536_1000455 3300003781 Bacteria 28769
6 Ga0055531_10023206 3300003794 Bacteria 2335
7 Ga0070670_100019351 3300005331 Bacteria 5841
8 Ga0070670_100129484 3300005331 Bacteria 2178
9 Ga0070666_10164312 3300005335 Bacteria 1552
10 Ga0070682_100027486 3300005337 Bacteria 3414
11 Ga0070660_100052743 3300005339 Bacteria 3136
12 Ga0070668_100014850 3300005347 Bacteria 5821
13 Ga0070668_100049084 3300005347 Bacteria 3247
14 Ga0070669_100289917 3300005353 Bacteria 1314
15 Ga0070659_100000143 3300005366 Bacteria 55183
16 Ga0070659_100061113 3300005366 Bacteria 2977
17 Ga0070667_100034378 3300005367 Bacteria 4240
18 Ga0070667_100382891 3300005367 Bacteria 1278
19 Ga0070678_100113423 3300005456 Bacteria 2125
20 Ga0070662_100056072 3300005457 Bacteria 2860
21 Ga0068853_100040708 3300005539 Bacteria 3966
22 Ga0068853_100079438 3300005539 Bacteria 2869
23 Ga0068854_100066153 3300005578 Bacteria 2630
24 Ga0068856_100152029 3300005614 Bacteria 2324
25 Ga0068859_100006364 3300005617 Bacteria 11977
26 Ga0068864_100009389 3300005618 Bacteria 8069
27 Ga0068864_100305013 3300005618 Bacteria 1492
28 Ga0068864_100454984 3300005618 Bacteria 1225
29 Ga0068861_100168543 3300005719 Bacteria 1813
30 Ga0068863_100018754 3300005841 Bacteria 6620
31 Ga0068863_100224704 3300005841 Bacteria 1810
32 Ga0068863_100289825 3300005841 Bacteria 1587
33 Ga0068863_100498223 3300005841 Bacteria 1199
34 Ga0068860_100005340 3300005843 Bacteria 13040
35 Ga0068862_100003825 3300005844 Bacteria 12817
36 Ga0068862_100231506 3300005844 Bacteria 1676
37 Ga0075369_10122951 3300006186 Bacteria 1176
38 Ga0068871_100312815 3300006358 Bacteria 1381
39 Ga0097620_100006364 3300006931 Bacteria 11977
40 Ga0079104_1018562 3300006946 Bacteria 1968
41 Ga0105240_10006793 3300009093 Bacteria 16737
42 Ga0105240_10134118 3300009093 Bacteria 2966
43 Ga0105248_10036116 3300009177 Bacteria 5527
44 Ga0105248_10076068 3300009177 Bacteria 3773
45 Ga0105238_10117104 3300009551 Bacteria 2644
46 Ga0105239_10518023 3300010375 Bacteria 1357
47 Ga0157373_10000482 3300013100 Bacteria 31638
48 Ga0157373_10000483 3300013100 Bacteria 31535
49 Ga0157370_10049766 3300013104 Bacteria 4009
50 Ga0157370_10149758 3300013104 Bacteria 2172
51 Ga0157369_10119979 3300013105 Bacteria 2790
52 Ga0157374_10263056 3300013296 Bacteria 1699
53 Ga0157375_10113356 3300013308 Bacteria 2812
54 Ga0157379_10469978 3300014968 Bacteria 1163
55 Ga0183365_10001 3300015684 Bacteria 2090444
56 Ga0163161_10388689 3300017792 Bacteria 1116
57 Ga0213872_10029881 3300021361 Bacteria 2499
58 Ga0213876_10000074 3300021384 Bacteria 120394
59 Ga0213876_10025596 3300021384 Bacteria 3112
60 Ga0213875_10116357 3300021388 Bacteria 1249
61 Ga0213875_10134076 3300021388 Unclassified 1158
62 Ga0209676_1001151 3300025292 Bacteria 28912
63 Ga0209257_1000090 3300025304 Bacteria 274746
64 Ga0207680_10149099 3300025903 Bacteria 1558
65 Ga0207705_10249805 3300025909 Unclassified 1353
66 Ga0207695_10008830 3300025913 Bacteria 12549
67 Ga0207695_10175874 3300025913 Bacteria 2063
68 Ga0207657_10062083 3300025919 Bacteria 3201
69 Ga0207650_10011859 3300025925 Bacteria 6005
70 Ga0207650_10159211 3300025925 Bacteria 1788
71 Ga0207644_10022329 3300025931 Bacteria 4323
72 Ga0207644_10045897 3300025931 Bacteria 3110
73 Ga0207644_10101700 3300025931 Bacteria 2160
74 Ga0207690_10000617 3300025932 Bacteria 23012
75 Ga0207690_10030803 3300025932 Bacteria 3426
76 Ga0207711_10197046 3300025941 Bacteria 1837
77 Ga0207711_10240730 3300025941 Bacteria 1659
78 Ga0207679_10001519 3300025945 Bacteria 14513
79 Ga0207668_10003285 3300025972 Bacteria 9478
80 Ga0207668_10149849 3300025972 Bacteria 1804
81 Ga0207658_10159580 3300025986 Bacteria 1847
82 Ga0207658_10233953 3300025986 Bacteria 1552
83 Ga0207639_10130038 3300026041 Bacteria 2083
84 Ga0207702_10222286 3300026078 Bacteria 1760
85 Ga0207641_10013816 3300026088 Bacteria 6622
86 Ga0207641_10483916 3300026088 Bacteria 1200
87 Ga0207683_10033426 3300026121 Bacteria 4467
88 Ga0209974_10107435 3300027876 Bacteria 980
89 Ga0268266_10068669 3300028379 Bacteria 3069
90 Ga0268266_10098576 3300028379 Bacteria 2572
91 Ga0268265_10142169 3300028380 Bacteria 2010
92 Ga0268265_10191162 3300028380 Bacteria 1768
93 Ga0268264_10076186 3300028381 Bacteria 2853
94 Ga0307517_10001670 3300028786 Bacteria 36710
95 Ga0307517_10126465 3300028786 Bacteria 1862
96 Ga0307515_10116313 3300028794 Bacteria 3071
97 Ga0307515_10296815 3300028794 Bacteria 1305
98 Ga0265338_10009437 3300028800 Bacteria 11631
99 Ga0265338_10211279 3300028800 Bacteria 1456
100 Ga0307513_10004456 3300031456 Bacteria 18698
101 Ga0307513_10036930 3300031456 Bacteria 5442
102 Ga0307516_10000002 3300031730 Bacteria 467851
103 Ga0307413_10673016 3300031824 Bacteria 856
104 Ga0307406_10004212 3300031901 Bacteria 7829
105 Ga0307412_10245475 3300031911 Bacteria 1387
106 Ga0307414_10021925 3300032004 Bacteria 4020
107 Ga0307414_10041908 3300032004 Bacteria 3105
108 Ga0307414_10097089 3300032004 Bacteria 2206
109 Ga0307414_10159571 3300032004 Bacteria 1789
110 Ga0307510_10033533 3300033180 Bacteria 5765
111 Ga0373960_0015031 3300035121 Unclassified 1970
112 Ga0373931_0413220 3300035691 Unclassified 856
113 Ga0395899_0000018 3300037312 Bacteria 423194
114 Ga0395905_0041841 3300037471 Bacteria 4300
115 Ga0395905_0315669 3300037471 Bacteria 1452
116 Ga0436364_0657225 3300037853 Unclassified 1960
117 Ga0436364_1368267 3300037853 Bacteria 2045
118 Ga0395901_0159253 3300038443 Bacteria 2371
119 Ga0436365_1397425 3300039437 Bacteria 3366
120 Ga0436365_1583918 3300039437 Bacteria 9004
121 Ga0436361_0721539 3300039447 Bacteria 2629
122 Ga0436361_1113559 3300039447 Bacteria 6973
123 Ga0436361_1198148 3300039447 Bacteria 1390
124 Ga0439431_0008013 3300041997 Bacteria 2367
125 Ga0466969_0000722 3300044656 Bacteria 17863
126 Ga0466966_0197137 3300044684 Bacteria 1219
127 Ga0466961_0001425 3300044693 Bacteria 14831
128 Ga0466971_0001369 3300044719 Bacteria 10222
129 Ga0466970_0006553 3300044765 Bacteria 5818
130 Ga0466959_0000040 3300045049 Bacteria 101109
131 Ga0466959_0022370 3300045049 Bacteria 4674
132 Ga0466959_0041027 3300045049 Bacteria 3418
133 Ga0466958_0000417 3300045836 Bacteria 17527
134 Ga0495616_0096124 3300046513 Bacteria 1395
135 Ga0495625_0091287 3300046660 Bacteria 2105
136 Ga0495669_0085681 3300046684 Bacteria 1450
137 Ga0495636_0053897 3300047318 Bacteria 1689
138 Ga0495674_0372885 3300047319 Bacteria 1156
139 Ga0495677_0061368 3300047445 Bacteria 1394
140 Ga0496101_0092465 3300048904 Bacteria 2252
141 Ga0496102_0103489 3300048905 Bacteria 2648
142 Ga0496104_0143077 3300048907 Bacteria 2297
143 Ga0496109_0008454 3300048912 Bacteria 8751
144 Ga0496111_0114316 3300048914 Bacteria 1990
145 Ga0496112_0189159 3300048915 Bacteria 2021
146 Ga0496115_0001272 3300048918 Bacteria 18065
147 Ga0496115_0246879 3300048918 Bacteria 1470
148 Ga0496118_0191873 3300048921 Bacteria 1221
149 Ga0496121_0483460 3300048924 Unclassified 790
150 Ga0496122_0012019 3300048925 Bacteria 8680
151 Ga0496123_0001829 3300048926 Bacteria 27946
152 Ga0496123_0166671 3300048926 Unclassified 1167
153 Ga0496125_0000294 3300048928 Bacteria 98233
154 Ga0501033_0021369 3300049570 Bacteria 4882
155 Ga0501034_0028575 3300049571 Bacteria 5676
156 Ga0501034_0086724 3300049571 Bacteria 3131
157 Ga0501034_0086990 3300049571 Bacteria 3125
158 Ga0501034_0171605 3300049571 Bacteria 2136
159 Ga0501037_0131645 3300049573 Bacteria 1793
160 Ga0501038_0114814 3300049574 Bacteria 2227
161 Ga0501047_0009054 3300049581 Bacteria 9400
162 Ga0501035_0010890 3300049822 Bacteria 8420
163 Ga0501044_0015644 3300049823 Bacteria 8171
164 Ga0500643_001592 3300053087 Bacteria 12831
165 Ga0500644_0001276 3300053088 Bacteria 6864
166 Ga0500641_0001402 3300053096 Bacteria 8591
167 Ga0500595_052342 3300053119 Bacteria 1261
168 Ga0500608_003427 3300053122 Bacteria 5944
169 Ga0500608_163912 3300053122 Bacteria 960
170 Ga0466962_0000450 3300061719 Bacteria 17837
171 Ga0466962_0129694 3300061719 Bacteria 1218

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300033180 Ga0307510_10033533 Ga0307510_100335333 208
2 3300039447 Ga0436361_1198148 Ga0436361_1198148_229_945 209
3 3300047445 Ga0495677_0061368 Ga0495677_0061368_621_1325 215
4 3300047319 Ga0495674_0372885 Ga0495674_0372885_397_1107 217
5 3300021361 Ga0213872_10029881 Ga0213872_100298812 219
6 3300039447 Ga0436361_0721539 Ga0436361_0721539_1597_2313 219
7 3300027876 Ga0209974_10107435 Ga0209974_101074352 221
8 3300003322 rootL2_10264607 rootL2_102646074 228
9 3300013104 Ga0157370_10149758 Ga0157370_101497582 228
10 3300048924 Ga0496121_0483460 Ga0496121_0483460_76_762 228
11 3300049571 Ga0501034_0086724 Ga0501034_0086724_1229_1918 228
12 3300037853 Ga0436364_0657225 Ga0436364_0657225_1042_1740 232
13 3300039437 Ga0436365_1583918 Ga0436365_1583918_3395_4093 232
14 3300006946 Ga0079104_1018562 Ga0079104_10185621 233
15 3300037312 Ga0395899_0000018 Ga0395899_0000018_85555_86271 233
16 3300041997 Ga0439431_0008013 Ga0439431_0008013_878_1582 233
17 3300044684 Ga0466966_0197137 Ga0466966_0197137_339_1055 233
18 3300045049 Ga0466959_0022370 Ga0466959_0022370_455_1171 233
19 3300049571 Ga0501034_0086990 Ga0501034_0086990_954_1658 233
20 3300049581 Ga0501047_0009054 Ga0501047_0009054_5131_5835 233
21 iso_pu_bacteria 2643221574 2643883406 233
22 iso_pu_bacteria 2643221663 2644351697 233
23 iso_pu_bacteria 2643221699 2644548522 233
24 iso_pu_bacteria 2643221699 2644548771 233
25 iso_pu_bacteria 2739367756 2739793543 233
26 iso_pu_bacteria 2928972540 2928974226 233
27 iso_pu_bacteria 2941485952 2941487724 233
28 iso_pu_bacteria 2977240413 2977240811 233
29 3300005331 Ga0070670_100019351 Ga0070670_1000193511 234
30 3300005331 Ga0070670_100129484 Ga0070670_1001294843 234
31 3300005335 Ga0070666_10164312 Ga0070666_101643122 234
32 3300005339 Ga0070660_100052743 Ga0070660_1000527434 234
33 3300005347 Ga0070668_100014850 Ga0070668_1000148506 234
34 3300005347 Ga0070668_100049084 Ga0070668_1000490844 234
35 3300005353 Ga0070669_100289917 Ga0070669_1002899172 234
36 3300005366 Ga0070659_100000143 Ga0070659_10000014346 234
37 3300005367 Ga0070667_100034378 Ga0070667_1000343785 234
38 3300005367 Ga0070667_100382891 Ga0070667_1003828911 234
39 3300005456 Ga0070678_100113423 Ga0070678_1001134232 234
40 3300005457 Ga0070662_100056072 Ga0070662_1000560722 234
41 3300005578 Ga0068854_100066153 Ga0068854_1000661533 234
42 3300005617 Ga0068859_100006364 Ga0068859_10000636412 234
43 3300005618 Ga0068864_100009389 Ga0068864_1000093893 234
44 3300005618 Ga0068864_100305013 Ga0068864_1003050132 234
45 3300005618 Ga0068864_100454984 Ga0068864_1004549842 234
46 3300005719 Ga0068861_100168543 Ga0068861_1001685432 234
47 3300005841 Ga0068863_100018754 Ga0068863_1000187549 234
48 3300005841 Ga0068863_100224704 Ga0068863_1002247043 234
49 3300005841 Ga0068863_100289825 Ga0068863_1002898253 234
50 3300005841 Ga0068863_100498223 Ga0068863_1004982232 234
51 3300005843 Ga0068860_100005340 Ga0068860_1000053402 234
52 3300005844 Ga0068862_100003825 Ga0068862_1000038252 234
53 3300005844 Ga0068862_100231506 Ga0068862_1002315063 234
54 3300006358 Ga0068871_100312815 Ga0068871_1003128152 234
55 3300006931 Ga0097620_100006364 Ga0097620_10000636412 234
56 3300009093 Ga0105240_10006793 Ga0105240_1000679310 234
57 3300009093 Ga0105240_10134118 Ga0105240_101341183 234
58 3300009177 Ga0105248_10036116 Ga0105248_100361162 234
59 3300009551 Ga0105238_10117104 Ga0105238_101171043 234
60 3300010375 Ga0105239_10518023 Ga0105239_105180232 234
61 3300013296 Ga0157374_10263056 Ga0157374_102630562 234
62 3300013308 Ga0157375_10113356 Ga0157375_101133564 234
63 3300014968 Ga0157379_10469978 Ga0157379_104699782 234
64 3300021384 Ga0213876_10000074 Ga0213876_1000007499 234
65 3300021388 Ga0213875_10116357 Ga0213875_101163572 234
66 3300021388 Ga0213875_10134076 Ga0213875_101340762 234
67 3300025903 Ga0207680_10149099 Ga0207680_101490992 234
68 3300025909 Ga0207705_10249805 Ga0207705_102498052 234
69 3300025913 Ga0207695_10008830 Ga0207695_100088307 234
70 3300025913 Ga0207695_10175874 Ga0207695_101758743 234
71 3300025919 Ga0207657_10062083 Ga0207657_100620835 234
72 3300025925 Ga0207650_10011859 Ga0207650_100118591 234
73 3300025925 Ga0207650_10159211 Ga0207650_101592112 234
74 3300025931 Ga0207644_10022329 Ga0207644_100223293 234
75 3300025931 Ga0207644_10045897 Ga0207644_100458972 234
76 3300025931 Ga0207644_10101700 Ga0207644_101017003 234
77 3300025932 Ga0207690_10000617 Ga0207690_100006174 234
78 3300025941 Ga0207711_10197046 Ga0207711_101970462 234
79 3300025972 Ga0207668_10003285 Ga0207668_100032856 234
80 3300025972 Ga0207668_10149849 Ga0207668_101498491 234
81 3300025986 Ga0207658_10159580 Ga0207658_101595802 234
82 3300025986 Ga0207658_10233953 Ga0207658_102339531 234
83 3300026088 Ga0207641_10013816 Ga0207641_100138161 234
84 3300026088 Ga0207641_10483916 Ga0207641_104839162 234
85 3300026121 Ga0207683_10033426 Ga0207683_100334262 234
86 3300028379 Ga0268266_10068669 Ga0268266_100686692 234
87 3300028380 Ga0268265_10142169 Ga0268265_101421693 234
88 3300028380 Ga0268265_10191162 Ga0268265_101911622 234
89 3300028381 Ga0268264_10076186 Ga0268264_100761864 234
90 3300028786 Ga0307517_10001670 Ga0307517_1000167033 234
91 3300028786 Ga0307517_10126465 Ga0307517_101264652 234
92 3300031456 Ga0307513_10004456 Ga0307513_1000445619 234
93 3300031456 Ga0307513_10036930 Ga0307513_100369303 234
94 3300031730 Ga0307516_10000002 Ga0307516_10000002101 234
95 3300039447 Ga0436361_1113559 Ga0436361_1113559_6055_6762 234
96 3300046660 Ga0495625_0091287 Ga0495625_0091287_265_972 234
97 3300046684 Ga0495669_0085681 Ga0495669_0085681_425_1132 234
98 3300047318 Ga0495636_0053897 Ga0495636_0053897_875_1582 234
99 3300048904 Ga0496101_0092465 Ga0496101_0092465_558_1265 234
100 3300048905 Ga0496102_0103489 Ga0496102_0103489_353_1060 234
101 3300048907 Ga0496104_0143077 Ga0496104_0143077_527_1234 234
102 3300048912 Ga0496109_0008454 Ga0496109_0008454_3213_3920 234
103 3300048915 Ga0496112_0189159 Ga0496112_0189159_998_1705 234
104 3300048918 Ga0496115_0001272 Ga0496115_0001272_6079_6786 234
105 3300048928 Ga0496125_0000294 Ga0496125_0000294_67833_68540 234
106 3300049573 Ga0501037_0131645 Ga0501037_0131645_153_860 234
107 3300049574 Ga0501038_0114814 Ga0501038_0114814_1267_1974 234
108 3300049823 Ga0501044_0015644 Ga0501044_0015644_3400_4107 234
109 3300053122 Ga0500608_163912 Ga0500608_163912_40_747 234
110 3300028794 Ga0307515_10116313 Ga0307515_101163134 235
111 3300028794 Ga0307515_10296815 Ga0307515_102968152 235
112 3300046513 Ga0495616_0096124 Ga0495616_0096124_36_746 235
113 3300048918 Ga0496115_0246879 Ga0496115_0246879_244_954 235
114 3300049570 Ga0501033_0021369 Ga0501033_0021369_910_1620 235
115 3300053087 Ga0500643_001592 Ga0500643_001592_11340_12053 235
116 3300003322 rootL2_10033621 rootL2_100336213 236
117 3300003323 rootH1_10052101 rootH1_100521013 236
118 3300003323 rootH1_10054677 rootH1_100546775 236
119 3300003781 Ga0055536_1000455 Ga0055536_100045527 236
120 3300003794 Ga0055531_10023206 Ga0055531_100232063 236
121 3300005337 Ga0070682_100027486 Ga0070682_1000274864 236
122 3300005366 Ga0070659_100061113 Ga0070659_1000611132 236
123 3300005539 Ga0068853_100040708 Ga0068853_1000407085 236
124 3300005539 Ga0068853_100079438 Ga0068853_1000794383 236
125 3300005614 Ga0068856_100152029 Ga0068856_1001520293 236
126 3300006186 Ga0075369_10122951 Ga0075369_101229512 236
127 3300009177 Ga0105248_10076068 Ga0105248_100760683 236
128 3300013100 Ga0157373_10000482 Ga0157373_1000048228 236
129 3300013100 Ga0157373_10000483 Ga0157373_100004837 236
130 3300013104 Ga0157370_10049766 Ga0157370_100497665 236
131 3300013105 Ga0157369_10119979 Ga0157369_101199794 236
132 3300015684 Ga0183365_10001 Ga0183365_10001154 236
133 3300017792 Ga0163161_10388689 Ga0163161_103886891 236
134 3300021384 Ga0213876_10025596 Ga0213876_100255962 236
135 3300025292 Ga0209676_1001151 Ga0209676_10011518 236
136 3300025304 Ga0209257_1000090 Ga0209257_1000090255 236
137 3300025932 Ga0207690_10030803 Ga0207690_100308033 236
138 3300025941 Ga0207711_10240730 Ga0207711_102407303 236
139 3300025945 Ga0207679_10001519 Ga0207679_100015199 236
140 3300026041 Ga0207639_10130038 Ga0207639_101300383 236
141 3300026078 Ga0207702_10222286 Ga0207702_102222862 236
142 3300028379 Ga0268266_10098576 Ga0268266_100985762 236
143 3300028800 Ga0265338_10009437 Ga0265338_100094374 236
144 3300028800 Ga0265338_10211279 Ga0265338_102112792 236
145 3300031824 Ga0307413_10673016 Ga0307413_106730161 236
146 3300031901 Ga0307406_10004212 Ga0307406_100042127 236
147 3300031911 Ga0307412_10245475 Ga0307412_102454752 236
148 3300032004 Ga0307414_10021925 Ga0307414_100219254 236
149 3300032004 Ga0307414_10041908 Ga0307414_100419082 236
150 3300032004 Ga0307414_10097089 Ga0307414_100970894 236
151 3300032004 Ga0307414_10159571 Ga0307414_101595712 236
152 3300035121 Ga0373960_0015031 Ga0373960_0015031_699_1427 236
153 3300035691 Ga0373931_0413220 Ga0373931_0413220_19_747 236
154 3300037471 Ga0395905_0041841 Ga0395905_0041841_2779_3507 236
155 3300037471 Ga0395905_0315669 Ga0395905_0315669_193_957 236
156 3300037853 Ga0436364_1368267 Ga0436364_1368267_12_746 236
157 3300038443 Ga0395901_0159253 Ga0395901_0159253_711_1439 236
158 3300039437 Ga0436365_1397425 Ga0436365_1397425_2028_2750 236
159 3300044656 Ga0466969_0000722 Ga0466969_0000722_1750_2475 236
160 3300044693 Ga0466961_0001425 Ga0466961_0001425_941_1720 236
161 3300044719 Ga0466971_0001369 Ga0466971_0001369_153_878 236
162 3300044765 Ga0466970_0006553 Ga0466970_0006553_2844_3623 236
163 3300045049 Ga0466959_0000040 Ga0466959_0000040_87115_87894 236
164 3300045049 Ga0466959_0041027 Ga0466959_0041027_836_1546 236
165 3300045836 Ga0466958_0000417 Ga0466958_0000417_6797_7576 236
166 3300048914 Ga0496111_0114316 Ga0496111_0114316_651_1388 236
167 3300048921 Ga0496118_0191873 Ga0496118_0191873_378_1211 236
168 3300048925 Ga0496122_0012019 Ga0496122_0012019_4923_5660 236
169 3300048926 Ga0496123_0001829 Ga0496123_0001829_2991_3728 236
170 3300048926 Ga0496123_0166671 Ga0496123_0166671_194_931 236
171 3300049571 Ga0501034_0028575 Ga0501034_0028575_3907_4629 236
172 3300049571 Ga0501034_0171605 Ga0501034_0171605_787_1533 236
173 3300049822 Ga0501035_0010890 Ga0501035_0010890_6356_7072 236
174 3300053088 Ga0500644_0001276 Ga0500644_0001276_5849_6562 236
175 3300053096 Ga0500641_0001402 Ga0500641_0001402_6936_7658 236
176 3300053119 Ga0500595_052342 Ga0500595_052342_293_1009 236
177 3300053122 Ga0500608_003427 Ga0500608_003427_2011_2736 236
178 3300061719 Ga0466962_0000450 Ga0466962_0000450_15230_15955 236
179 3300061719 Ga0466962_0129694 Ga0466962_0129694_345_1055 236

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01553

Acyltransferase

Acyltransferase

57

184

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
5kym-assembly1.cif.gz_A crystal structure of the 1-acyl-sn-glycerophosphate (lpa) acyltransferase, plsc, from thermotoga maritima 0.825 1 233
5kym-assembly1.cif.gz_A crystal structure of the 1-acyl-sn-glycerophosphate (lpa) acyltransferase, plsc, from thermotoga maritima 0.8124 1 233
5kym-assembly2.cif.gz_B crystal structure of the 1-acyl-sn-glycerophosphate (lpa) acyltransferase, plsc, from thermotoga maritima 0.7744 2 226
5kym-assembly2.cif.gz_B crystal structure of the 1-acyl-sn-glycerophosphate (lpa) acyltransferase, plsc, from thermotoga maritima 0.7509 2 226
1k30-assembly1.cif.gz_A crystal structure analysis of squash (cucurbita moschata) glycerol-3-phosphate (1)-acyltransferase 0.6332 38 233
ID Description Score Start End Superfamily
af_Q8GXU8_180_307_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.9068 56 178 3.40.50.2000
af_Q9VYJ4_80_210_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9066 58 178 3.40.50.620
af_Q9US20_86_212_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8808 70 176 3.40.50.620
af_I6YDI9_312_439_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8786 61 178 3.40.50.620
af_Q93841_73_201_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8746 56 178 3.40.50.620
ID Description Score Start End GO Terms
AF-V4Q576-F1-model_v4 1-acyl-sn-glycerol-3-phosphate acyltransferase 0.9976 2 235 GO:0003841
GO:0006654
GO:0016020
AF-A0A328B606-F1-model_v4 1-acyl-sn-glycerol-3-phosphate acyltransferase 0.991 3 233 GO:0003841
GO:0006654
GO:0016020
AF-A0A537VKD3-F1-model_v4 1-acyl-sn-glycerol-3-phosphate acyltransferase 0.9902 1 235 GO:0003841
GO:0006654
GO:0016020
AF-A0A519L7D5-F1-model_v4 1-acyl-sn-glycerol-3-phosphate acyltransferase 0.9899 3 178 GO:0003841
GO:0006654
GO:0016020
AF-A0A3C0TXI9-F1-model_v4 1-acyl-sn-glycerol-3-phosphate acyltransferase 0.9897 1 235 GO:0003841
GO:0006654
GO:0016020

Feature Viewer

pLDDT pTM Quality
93.86 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map