F269671

General Info

Members Datasets Scaffolds Average Seq Length
177 134 172 234

Family's Representative Sequence

Representative Sequence 3300005367|Ga0070667_100000667|Ga0070667_10000066722
Length 277
Sequence MGLHGKEAMDDGRIDRGDAGAVGIFVERAVKRMAGAVAGWWPEGMSQAANPFRYFHTSPEVIRLVVLMYVRFPLSLRSVEDLLFERGIDLCHETVRLWWNRFGPLFAADIRRQRVSRMREFRHWRWHVDEVHVRISGEIHYLWRAVDHEVLESYVTKKRDKSAALRFLKKALKRHGKAAVIVTDELKSYPAAMRKLGNLEHREMGRWLNNRAENSHLPFRRRERAMLRVRQMKSLQKFASVHASVSNHFNSERHLVDRQTYRYRRSAALAEWRSLMA

Samples

Sample ID Description Type Environment
1 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
2 2643221588 Altererythrobacter sp. Root672 Isolate Unclassified
3 2840878972 Albibacillus kandeliae J95 Isolate Rhizosphere
4 2896429255 Sphingomonas rhizophila KACC 19189 Isolate Rhizosphere
5 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
6 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
9 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
15 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
16 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
17 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
18 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
19 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
20 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
21 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
22 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
23 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
24 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
25 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
26 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
27 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
28 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
29 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
30 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
31 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
32 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
33 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
34 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
35 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
36 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
37 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
38 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
39 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
40 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
41 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
42 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
43 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
44 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
45 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
46 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
47 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
69 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
73 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
74 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
75 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
76 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
77 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
78 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
79 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
80 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
81 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
82 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
83 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
84 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
85 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
86 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
87 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
88 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
89 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
90 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
91 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
92 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
93 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
94 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
95 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
96 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
97 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
98 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
99 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
100 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
101 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
102 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
103 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
104 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
105 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
106 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
107 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
108 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
109 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
110 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
111 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
112 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
113 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
114 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
115 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
116 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
117 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
118 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
119 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
120 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
121 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
122 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
123 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
124 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
125 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
126 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
127 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
128 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
129 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
130 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
131 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
132 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
133 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
134 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.18
Metatranscriptomes 0.56
Isolates 2.26

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.78
Nodule 0.56
Rhizoplane 7.91
Rhizosphere 78.53
Stem 0
Stem Tuber 0
Unclassified 6.21

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24738J21930_10011377 3300002075 Bacteria 1957
2 JGI24751J29686_10000785 3300002459 Bacteria 7437
3 JGI24751J29686_10020026 3300002459 Bacteria 1385
4 rootH1_10288349 3300003323 Bacteria 1127
5 Ga0065704_10136182 3300005289 Bacteria 1568
6 Ga0065707_10176996 3300005295 Bacteria 1444
7 Ga0065707_10183960 3300005295 Bacteria 1400
8 Ga0070658_10100955 3300005327 Bacteria 2385
9 Ga0070668_100001223 3300005347 Bacteria 18252
10 Ga0070668_100012688 3300005347 Bacteria 6271
11 Ga0070675_100359373 3300005354 Bacteria 1293
12 Ga0070667_100000667 3300005367 Bacteria 33258
13 Ga0070710_10181916 3300005437 Bacteria 1317
14 Ga0070678_100109672 3300005456 Bacteria 2157
15 Ga0070662_100014269 3300005457 Bacteria 5304
16 Ga0070662_100064037 3300005457 Bacteria 2691
17 Ga0068855_100062102 3300005563 Bacteria 4363
18 Ga0068855_100289608 3300005563 Bacteria 1816
19 Ga0068855_100431183 3300005563 Bacteria 1441
20 Ga0068857_100498501 3300005577 Bacteria 1143
21 Ga0068857_100641178 3300005577 Bacteria 1006
22 Ga0068857_100786485 3300005577 Bacteria 908
23 Ga0068854_100008922 3300005578 Bacteria 6458
24 Ga0068854_100187478 3300005578 Bacteria 1619
25 Ga0068852_100264881 3300005616 Bacteria 1651
26 Ga0068852_100621803 3300005616 Bacteria 1086
27 Ga0068861_100000468 3300005719 Bacteria 23587
28 Ga0068863_100081028 3300005841 Bacteria 3075
29 Ga0068858_100143825 3300005842 Bacteria 2239
30 Ga0068860_100066946 3300005843 Bacteria 3413
31 Ga0068862_100151634 3300005844 Bacteria 2063
32 Ga0070712_100345895 3300006175 Unclassified 1216
33 Ga0075366_10000122 3300006195 Bacteria 32264
34 Ga0075366_10193623 3300006195 Bacteria 1236
35 Ga0097621_100083935 3300006237 Bacteria 2655
36 Ga0097621_100326192 3300006237 Bacteria 1361
37 Ga0068871_100127645 3300006358 Bacteria 2154
38 Ga0099795_10152591 3300007788 Bacteria 947
39 Ga0105240_10001974 3300009093 Bacteria 33910
40 Ga0105240_10425396 3300009093 Bacteria 1491
41 Ga0105248_10005088 3300009177 Bacteria 14506
42 Ga0105248_10215951 3300009177 Bacteria 2160
43 Ga0105238_10020214 3300009551 Bacteria 6777
44 Ga0105249_10036449 3300009553 Bacteria 4461
45 Ga0099796_10127557 3300010159 Bacteria 983
46 Ga0105246_10000072 3300011119 Bacteria 41904
47 Ga0157373_10152137 3300013100 Bacteria 1627
48 Ga0157371_10002672 3300013102 Bacteria 16869
49 Ga0157369_10000782 3300013105 Bacteria 41020
50 Ga0163162_10004746 3300013306 Bacteria 13110
51 Ga0157375_10022941 3300013308 Bacteria 5751
52 Ga0157380_10006139 3300014326 Bacteria 8425
53 Ga0157380_10065106 3300014326 Bacteria 2928
54 Ga0157380_10966349 3300014326 Bacteria 883
55 Ga0157377_10112865 3300014745 Bacteria 1636
56 Ga0157379_10000820 3300014968 Bacteria 25204
57 Ga0157379_10768099 3300014968 Bacteria 908
58 Ga0213872_10199109 3300021361 Bacteria 859
59 Ga0228598_1019446 3300024227 Bacteria 1338
60 Ga0207697_10012521 3300025315 Bacteria 3556
61 Ga0207656_10163498 3300025321 Bacteria 1060
62 Ga0207647_10083995 3300025904 Bacteria 1906
63 Ga0207705_10001273 3300025909 Bacteria 20222
64 Ga0207695_10002005 3300025913 Bacteria 31419
65 Ga0207695_10035762 3300025913 Bacteria 5380
66 Ga0207693_10154934 3300025915 Unclassified 1802
67 Ga0207693_10237520 3300025915 Bacteria 1431
68 Ga0207663_10576823 3300025916 Bacteria 882
69 Ga0207657_10417142 3300025919 Bacteria 1055
70 Ga0207681_10001303 3300025923 Bacteria 16089
71 Ga0207681_10363420 3300025923 Bacteria 1161
72 Ga0207706_10001541 3300025933 Bacteria 22819
73 Ga0207706_10277732 3300025933 Bacteria 1461
74 Ga0207679_10661118 3300025945 Bacteria 946
75 Ga0207667_10029342 3300025949 Bacteria 5966
76 Ga0207667_10104985 3300025949 Bacteria 2915
77 Ga0207667_10147359 3300025949 Bacteria 2423
78 Ga0207667_10214454 3300025949 Bacteria 1973
79 Ga0207668_10042030 3300025972 Bacteria 3093
80 Ga0207668_10103910 3300025972 Bacteria 2116
81 Ga0207640_10001122 3300025981 Bacteria 14763
82 Ga0207640_10063425 3300025981 Bacteria 2456
83 Ga0207658_10001084 3300025986 Bacteria 22045
84 Ga0207703_10078579 3300026035 Bacteria 2742
85 Ga0207702_10002635 3300026078 Bacteria 16847
86 Ga0207702_10305110 3300026078 Bacteria 1512
87 Ga0207676_10690265 3300026095 Bacteria 988
88 Ga0207674_10873312 3300026116 Bacteria 867
89 Ga0207675_100001419 3300026118 Bacteria 23997
90 Ga0207698_10000346 3300026142 Bacteria 27406
91 Ga0207698_10676265 3300026142 Bacteria 1025
92 Ga0209974_10102734 3300027876 Bacteria 1000
93 Ga0268266_10281830 3300028379 Bacteria 1546
94 Ga0268266_10710382 3300028379 Bacteria 969
95 Ga0268265_10068730 3300028380 Bacteria 2748
96 Ga0268265_11180372 3300028380 Bacteria 762
97 Ga0268264_10011771 3300028381 Bacteria 7213
98 Ga0265760_10065305 3300031090 Bacteria 1110
99 Ga0307408_100186952 3300031548 Bacteria 1666
100 Ga0307508_10044811 3300031616 Bacteria 3955
101 Ga0307413_10497861 3300031824 Bacteria 978
102 Ga0307412_10305718 3300031911 Bacteria 1259
103 Ga0307409_100625103 3300031995 Bacteria 1067
104 Ga0307416_100217272 3300032002 Bacteria 1830
105 Ga0307414_10016862 3300032004 Bacteria 4455
106 Ga0307414_10017267 3300032004 Bacteria 4411
107 Ga0307411_10229686 3300032005 Bacteria 1445
108 Ga0316583_10116679 3300032133 Bacteria 931
109 Ga0373930_0053850 3300034816 Bacteria 884
110 Ga0373958_0052137 3300034819 Bacteria 866
111 Ga0373949_0070855 3300035090 Bacteria 913
112 Ga0373952_0030556 3300035092 Bacteria 1194
113 Ga0373946_0202233 3300035171 Bacteria 952
114 Ga0373962_0129416 3300035242 Bacteria 811
115 Ga0373935_0334255 3300035692 Bacteria 1077
116 Ga0373947_0512512 3300035725 Bacteria 815
117 Ga0373937_0738700 3300036401 Bacteria 931
118 Ga0316584_0523477 3300036712 Bacteria 831
119 Ga0395905_0359311 3300037471 Bacteria 1349
120 Ga0400483_167448 3300039062 Bacteria 1698
121 Ga0436361_0699971 3300039447 Bacteria 1243
122 Ga0436361_0764248 3300039447 Unclassified 1489
123 Ga0436361_0816185 3300039447 Bacteria 1080
124 Ga0436362_0170033 3300039453 Unclassified 859
125 Ga0436362_0511671 3300039453 Bacteria 1278
126 Ga0451802_0501360 3300041460 Bacteria 1141
127 Ga0450893_0012439 3300042532 Bacteria 1413
128 Ga0466963_0405573 3300044694 Bacteria 961
129 Ga0466959_0004759 3300045049 Bacteria 9148
130 Ga0451576_0000041 3300045051 Bacteria 343432
131 Ga0466967_0688244 3300045976 Bacteria 1012
132 Ga0495640_0397588 3300046533 Bacteria 846
133 Ga0495634_0367583 3300046642 Bacteria 859
134 Ga0495635_0371213 3300046663 Bacteria 953
135 Ga0495635_0506963 3300046663 Bacteria 794
136 Ga0495581_0455790 3300047315 Bacteria 745
137 Ga0495676_0351232 3300047321 Bacteria 986
138 Ga0495686_0000944 3300047472 Bacteria 36054
139 Ga0495602_0594007 3300048088 Bacteria 762
140 Ga0496101_0006772 3300048904 Bacteria 7391
141 Ga0496102_0528544 3300048905 Bacteria 1102
142 Ga0496105_0456406 3300048908 Bacteria 1008
143 Ga0496106_0002549 3300048909 Bacteria 13537
144 Ga0496106_0551905 3300048909 Bacteria 924
145 Ga0496107_0000162 3300048910 Bacteria 34272
146 Ga0496109_0229550 3300048912 Bacteria 1746
147 Ga0496109_0566649 3300048912 Bacteria 1071
148 Ga0496111_0415904 3300048914 Bacteria 993
149 Ga0496112_0142544 3300048915 Bacteria 2365
150 Ga0496112_0692855 3300048915 Bacteria 947
151 Ga0496114_0047396 3300048917 Bacteria 3575
152 Ga0496115_0487633 3300048918 Bacteria 992
153 Ga0496118_0079841 3300048921 Bacteria 2305
154 Ga0496121_0000548 3300048924 Bacteria 70933
155 Ga0496121_0190496 3300048924 Bacteria 1471
156 Ga0496125_0186933 3300048928 Bacteria 1373
157 Ga0496126_0006453 3300048929 Bacteria 13068
158 Ga0496126_0019960 3300048929 Bacteria 6584
159 Ga0496126_0440892 3300048929 Bacteria 1050
160 Ga0501253_009665 3300049683 Bacteria 1429
161 Ga0495619_0458816 3300053085 Bacteria 878
162 Ga0500643_000004 3300053087 Bacteria 857484
163 Ga0500592_010098 3300053116 Bacteria 1503
164 Ga0500594_0074926 3300053118 Bacteria 1002
165 Ga0500595_063576 3300053119 Unclassified 1109
166 Ga0500568_0090240 3300053139 Bacteria 1156
167 Ga0500573_0203521 3300053140 Bacteria 1049
168 Ga0500616_0000559 3300053153 Bacteria 45881
169 Ga0500622_0052656 3300053156 Bacteria 2093
170 Ga0500645_009241 3300053730 Bacteria 3319
171 Ga0500645_016093 3300053730 Bacteria 2360
172 Ga0466962_0125552 3300061719 Bacteria 1239

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2840878972 2840880577 197
2 3300044694 Ga0466963_0405573 Ga0466963_0405573_80_796 209
3 3300045049 Ga0466959_0004759 Ga0466959_0004759_8389_9105 209
4 3300045976 Ga0466967_0688244 Ga0466967_0688244_218_934 209
5 3300061719 Ga0466962_0125552 Ga0466962_0125552_191_907 209
6 iso_pu_bacteria 2896429255 2896429505 209
7 3300031995 Ga0307409_100625103 Ga0307409_1006251031 210
8 3300005578 Ga0068854_100187478 Ga0068854_1001874783 211
9 3300009093 Ga0105240_10425396 Ga0105240_104253962 211
10 3300013105 Ga0157369_10000782 Ga0157369_1000078243 211
11 3300025904 Ga0207647_10083995 Ga0207647_100839951 211
12 3300005578 Ga0068854_100008922 Ga0068854_1000089229 212
13 3300009551 Ga0105238_10020214 Ga0105238_100202143 212
14 3300009553 Ga0105249_10036449 Ga0105249_100364493 212
15 3300014326 Ga0157380_10065106 Ga0157380_100651062 212
16 3300025913 Ga0207695_10035762 Ga0207695_100357625 212
17 3300025949 Ga0207667_10029342 Ga0207667_100293422 212
18 3300026078 Ga0207702_10002635 Ga0207702_100026359 212
19 3300026142 Ga0207698_10000346 Ga0207698_100003468 212
20 3300048904 Ga0496101_0006772 Ga0496101_0006772_1705_2343 212
21 3300048909 Ga0496106_0002549 Ga0496106_0002549_11294_11932 212
22 3300048910 Ga0496107_0000162 Ga0496107_0000162_22549_23187 212
23 3300028380 Ga0268265_11180372 Ga0268265_111803721 213
24 3300032004 Ga0307414_10016862 Ga0307414_100168622 213
25 3300005843 Ga0068860_100066946 Ga0068860_1000669464 215
26 3300028381 Ga0268264_10011771 Ga0268264_100117715 215
27 3300002459 JGI24751J29686_10000785 JGI24751J29686_1000078512 216
28 3300025981 Ga0207640_10001122 Ga0207640_100011229 216
29 3300049683 Ga0501253_009665 Ga0501253_009665_568_1227 219
30 3300005295 Ga0065707_10183960 Ga0065707_101839602 221
31 3300025949 Ga0207667_10214454 Ga0207667_102144542 222
32 3300046663 Ga0495635_0506963 Ga0495635_0506963_50_724 223
33 3300048921 Ga0496118_0079841 Ga0496118_0079841_914_1588 223
34 3300048924 Ga0496121_0000548 Ga0496121_0000548_58042_58716 223
35 3300027876 Ga0209974_10102734 Ga0209974_101027342 224
36 iso_pu_bacteria 2643221588 2643951806 224
37 3300005347 Ga0070668_100001223 Ga0070668_1000012237 227
38 iso_pu_bacteria 2599185170 2599414157 229
39 3300039453 Ga0436362_0170033 Ga0436362_0170033_119_811 230
40 3300041460 Ga0451802_0501360 Ga0451802_0501360_65_781 230
41 3300013102 Ga0157371_10002672 Ga0157371_1000267210 231
42 3300005437 Ga0070710_10181916 Ga0070710_101819162 232
43 3300006175 Ga0070712_100345895 Ga0070712_1003458952 232
44 3300007788 Ga0099795_10152591 Ga0099795_101525912 232
45 3300010159 Ga0099796_10127557 Ga0099796_101275572 232
46 3300014968 Ga0157379_10768099 Ga0157379_107680991 232
47 3300021361 Ga0213872_10199109 Ga0213872_101991091 232
48 3300024227 Ga0228598_1019446 Ga0228598_10194461 232
49 3300025915 Ga0207693_10154934 Ga0207693_101549343 232
50 3300025915 Ga0207693_10237520 Ga0207693_102375202 232
51 3300025916 Ga0207663_10576823 Ga0207663_105768231 232
52 3300026078 Ga0207702_10305110 Ga0207702_103051102 232
53 3300031090 Ga0265760_10065305 Ga0265760_100653051 232
54 3300034816 Ga0373930_0053850 Ga0373930_0053850_166_864 232
55 3300034819 Ga0373958_0052137 Ga0373958_0052137_147_845 232
56 3300035090 Ga0373949_0070855 Ga0373949_0070855_51_749 232
57 3300035092 Ga0373952_0030556 Ga0373952_0030556_341_1042 232
58 3300035171 Ga0373946_0202233 Ga0373946_0202233_75_773 232
59 3300035242 Ga0373962_0129416 Ga0373962_0129416_83_781 232
60 3300035692 Ga0373935_0334255 Ga0373935_0334255_156_854 232
61 3300035725 Ga0373947_0512512 Ga0373947_0512512_69_767 232
62 3300036401 Ga0373937_0738700 Ga0373937_0738700_13_711 232
63 3300039447 Ga0436361_0699971 Ga0436361_0699971_274_975 232
64 3300039447 Ga0436361_0764248 Ga0436361_0764248_534_1232 232
65 3300039447 Ga0436361_0816185 Ga0436361_0816185_55_753 232
66 3300039453 Ga0436362_0511671 Ga0436362_0511671_437_1138 232
67 3300046533 Ga0495640_0397588 Ga0495640_0397588_112_813 232
68 3300046642 Ga0495634_0367583 Ga0495634_0367583_23_721 232
69 3300046663 Ga0495635_0371213 Ga0495635_0371213_155_853 232
70 3300047315 Ga0495581_0455790 Ga0495581_0455790_28_726 232
71 3300047321 Ga0495676_0351232 Ga0495676_0351232_64_765 232
72 3300048088 Ga0495602_0594007 Ga0495602_0594007_53_751 232
73 3300048905 Ga0496102_0528544 Ga0496102_0528544_112_813 232
74 3300048912 Ga0496109_0566649 Ga0496109_0566649_81_782 232
75 3300048918 Ga0496115_0487633 Ga0496115_0487633_197_895 232
76 3300048929 Ga0496126_0440892 Ga0496126_0440892_130_828 232
77 3300053085 Ga0495619_0458816 Ga0495619_0458816_72_770 232
78 3300053119 Ga0500595_063576 Ga0500595_063576_297_995 232
79 3300005457 Ga0070662_100064037 Ga0070662_1000640372 233
80 3300025933 Ga0207706_10277732 Ga0207706_102777322 233
81 3300025945 Ga0207679_10661118 Ga0207679_106611181 233
82 3300032133 Ga0316583_10116679 Ga0316583_101166791 233
83 3300039062 Ga0400483_167448 Ga0400483_167448_305_1009 233
84 3300005295 Ga0065707_10176996 Ga0065707_101769962 234
85 3300005577 Ga0068857_100641178 Ga0068857_1006411781 234
86 3300009177 Ga0105248_10215951 Ga0105248_102159513 234
87 3300031616 Ga0307508_10044811 Ga0307508_100448114 234
88 3300048915 Ga0496112_0142544 Ga0496112_0142544_1312_2019 234
89 3300048924 Ga0496121_0190496 Ga0496121_0190496_340_1047 234
90 3300005347 Ga0070668_100012688 Ga0070668_1000126883 236
91 3300005367 Ga0070667_100000667 Ga0070667_10000066722 236
92 3300005719 Ga0068861_100000468 Ga0068861_10000046824 236
93 3300005844 Ga0068862_100151634 Ga0068862_1001516341 236
94 3300014326 Ga0157380_10006139 Ga0157380_100061397 236
95 3300014968 Ga0157379_10000820 Ga0157379_1000082015 236
96 3300025972 Ga0207668_10103910 Ga0207668_101039103 236
97 3300025986 Ga0207658_10001084 Ga0207658_1000108412 236
98 3300026118 Ga0207675_100001419 Ga0207675_10000141923 236
99 3300002075 JGI24738J21930_10011377 JGI24738J21930_100113772 238
100 3300002459 JGI24751J29686_10020026 JGI24751J29686_100200262 238
101 3300003323 rootH1_10288349 rootH1_102883492 238
102 3300005289 Ga0065704_10136182 Ga0065704_101361822 238
103 3300005327 Ga0070658_10100955 Ga0070658_101009554 238
104 3300005354 Ga0070675_100359373 Ga0070675_1003593732 238
105 3300005456 Ga0070678_100109672 Ga0070678_1001096722 238
106 3300005457 Ga0070662_100014269 Ga0070662_1000142693 238
107 3300005563 Ga0068855_100062102 Ga0068855_1000621025 238
108 3300005563 Ga0068855_100289608 Ga0068855_1002896081 238
109 3300005563 Ga0068855_100431183 Ga0068855_1004311832 238
110 3300005577 Ga0068857_100498501 Ga0068857_1004985012 238
111 3300005577 Ga0068857_100786485 Ga0068857_1007864851 238
112 3300005616 Ga0068852_100264881 Ga0068852_1002648812 238
113 3300005616 Ga0068852_100621803 Ga0068852_1006218031 238
114 3300005841 Ga0068863_100081028 Ga0068863_1000810287 238
115 3300005842 Ga0068858_100143825 Ga0068858_1001438252 238
116 3300006195 Ga0075366_10000122 Ga0075366_1000012223 238
117 3300006195 Ga0075366_10193623 Ga0075366_101936232 238
118 3300006237 Ga0097621_100083935 Ga0097621_1000839354 238
119 3300006237 Ga0097621_100326192 Ga0097621_1003261921 238
120 3300006358 Ga0068871_100127645 Ga0068871_1001276453 238
121 3300009093 Ga0105240_10001974 Ga0105240_1000197421 238
122 3300009177 Ga0105248_10005088 Ga0105248_100050883 238
123 3300011119 Ga0105246_10000072 Ga0105246_1000007227 238
124 3300013100 Ga0157373_10152137 Ga0157373_101521372 238
125 3300013105 Ga0157369_10000782 Ga0157369_100007823 238
126 3300013306 Ga0163162_10004746 Ga0163162_1000474612 238
127 3300013308 Ga0157375_10022941 Ga0157375_100229416 238
128 3300014326 Ga0157380_10966349 Ga0157380_109663491 238
129 3300014745 Ga0157377_10112865 Ga0157377_101128651 238
130 3300025315 Ga0207697_10012521 Ga0207697_100125211 238
131 3300025321 Ga0207656_10163498 Ga0207656_101634981 238
132 3300025909 Ga0207705_10001273 Ga0207705_1000127311 238
133 3300025913 Ga0207695_10002005 Ga0207695_1000200519 238
134 3300025919 Ga0207657_10417142 Ga0207657_104171422 238
135 3300025923 Ga0207681_10001303 Ga0207681_1000130311 238
136 3300025923 Ga0207681_10363420 Ga0207681_103634201 238
137 3300025933 Ga0207706_10001541 Ga0207706_1000154126 238
138 3300025949 Ga0207667_10104985 Ga0207667_101049854 238
139 3300025949 Ga0207667_10147359 Ga0207667_101473593 238
140 3300025972 Ga0207668_10042030 Ga0207668_100420304 238
141 3300025981 Ga0207640_10063425 Ga0207640_100634252 238
142 3300026035 Ga0207703_10078579 Ga0207703_100785792 238
143 3300026095 Ga0207676_10690265 Ga0207676_106902652 238
144 3300026116 Ga0207674_10873312 Ga0207674_108733122 238
145 3300026142 Ga0207698_10676265 Ga0207698_106762651 238
146 3300028379 Ga0268266_10281830 Ga0268266_102818302 238
147 3300028379 Ga0268266_10710382 Ga0268266_107103821 238
148 3300028380 Ga0268265_10068730 Ga0268265_100687303 238
149 3300031548 Ga0307408_100186952 Ga0307408_1001869522 238
150 3300031824 Ga0307413_10497861 Ga0307413_104978612 238
151 3300031911 Ga0307412_10305718 Ga0307412_103057182 238
152 3300032002 Ga0307416_100217272 Ga0307416_1002172721 238
153 3300032004 Ga0307414_10017267 Ga0307414_100172672 238
154 3300032005 Ga0307411_10229686 Ga0307411_102296862 238
155 3300036712 Ga0316584_0523477 Ga0316584_0523477_42_758 238
156 3300037471 Ga0395905_0359311 Ga0395905_0359311_190_906 238
157 3300042532 Ga0450893_0012439 Ga0450893_0012439_342_1058 238
158 3300045051 Ga0451576_0000041 Ga0451576_0000041_86465_87472 238
159 3300047472 Ga0495686_0000944 Ga0495686_0000944_35170_35892 238
160 3300048908 Ga0496105_0456406 Ga0496105_0456406_250_972 238
161 3300048909 Ga0496106_0551905 Ga0496106_0551905_85_912 238
162 3300048912 Ga0496109_0229550 Ga0496109_0229550_610_1326 238
163 3300048914 Ga0496111_0415904 Ga0496111_0415904_72_794 238
164 3300048915 Ga0496112_0692855 Ga0496112_0692855_170_892 238
165 3300048917 Ga0496114_0047396 Ga0496114_0047396_195_917 238
166 3300048928 Ga0496125_0186933 Ga0496125_0186933_191_907 238
167 3300048929 Ga0496126_0006453 Ga0496126_0006453_9063_9785 238
168 3300048929 Ga0496126_0019960 Ga0496126_0019960_5053_5775 238
169 3300053087 Ga0500643_000004 Ga0500643_000004_284938_285654 238
170 3300053116 Ga0500592_010098 Ga0500592_010098_666_1388 238
171 3300053118 Ga0500594_0074926 Ga0500594_0074926_222_938 238
172 3300053139 Ga0500568_0090240 Ga0500568_0090240_141_857 238
173 3300053140 Ga0500573_0203521 Ga0500573_0203521_313_1029 238
174 3300053153 Ga0500616_0000559 Ga0500616_0000559_29477_30193 238
175 3300053156 Ga0500622_0052656 Ga0500622_0052656_94_810 238
176 3300053730 Ga0500645_009241 Ga0500645_009241_1192_1950 238
177 3300053730 Ga0500645_016093 Ga0500645_016093_1139_1906 238

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13610

DDE_Tnp_IS240

DDE domain

123

252

0.94

Feature Viewer

pLDDT pTM Quality
66.66 0.48 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map