F262849

General Info

Members Datasets Scaffolds Average Seq Length
173 119 172 337

Family's Representative Sequence

Representative Sequence 3300028577|Ga0265318_10000404|Ga0265318_1000040420
Length 377
Sequence MRAILETETPSPFDKLRVREWFVPRLLQLSPSKDEGHLRRRQPRVRLFCACLALLLPFAAHAATFTLNAAPDTVAWGNYDAARAPVLRIKSGDTVVFRTLLTNSPTGLEKAGVAPGDVEQALRDVFAKVTDKGPGGHILNGPVYVEGAEPGDTLEIHIKKIDPAIPYAYNGFRYGAGILTDDFPYSRIKIIPLDRKRMVANFAPGIEIPLHPFFGSMGVAPPADFGRYDSTPPTINGGNMDNKELVAGTTLYLPVWNKGALFEIGDGHAGQGNGEVDVTAMETSLIGTLEFVVRKDLHITYPRAETPTHYIAMGFDDDLSIAAHKAVREMVDFLVSTKHMSRDDAYMLVSVAGDVDVTEVVDRNKGVHVMLPKGVFK

Samples

Sample ID Description Type Environment
1 2895395659 Rhodanobacter sp. T12-5 Isolate Unclassified
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
10 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
11 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
14 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
17 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
20 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
21 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
22 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
23 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
24 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
25 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
26 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
27 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
28 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
29 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
30 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
31 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
32 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
33 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
34 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
35 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
36 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
37 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
38 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
39 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
40 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
41 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
42 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
43 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
44 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
45 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
46 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
47 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
48 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
49 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
50 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
83 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
84 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
85 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
86 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
87 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
88 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
89 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
90 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
91 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
92 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
93 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
94 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
95 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
96 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
97 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
98 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
99 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
100 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
101 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
102 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
103 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
104 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
105 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
106 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
107 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
108 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
109 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
110 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
111 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
112 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
113 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
114 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
115 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
116 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
117 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
118 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
119 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.42
Metatranscriptomes 0
Isolates 0.58

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.73
Nodule 0
Rhizoplane 1.73
Rhizosphere 92.49
Stem 0
Stem Tuber 0
Unclassified 4.05

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10000496 3300003320 Bacteria 59982
2 Ga0070658_10111171 3300005327 Bacteria 2270
3 Ga0070666_10248768 3300005335 Bacteria 1258
4 Ga0070680_100000140 3300005336 Bacteria 44004
5 Ga0070680_100027373 3300005336 Bacteria 4565
6 Ga0070680_100080716 3300005336 Bacteria 2683
7 Ga0070680_100100536 3300005336 Bacteria 2400
8 Ga0068868_100180633 3300005338 Bacteria 1750
9 Ga0070660_100173721 3300005339 Bacteria 1741
10 Ga0070660_100230247 3300005339 Bacteria 1508
11 Ga0070661_100007852 3300005344 Bacteria 7366
12 Ga0070659_100025121 3300005366 Bacteria 4573
13 Ga0070659_100043033 3300005366 Bacteria 3532
14 Ga0070667_100000053 3300005367 Bacteria 151974
15 Ga0070709_10009212 3300005434 Bacteria 5434
16 Ga0070714_100006677 3300005435 Bacteria 8932
17 Ga0070714_100181174 3300005435 Bacteria 1917
18 Ga0070714_100183655 3300005435 Bacteria 1904
19 Ga0070711_100097161 3300005439 Bacteria 2135
20 Ga0070711_100143485 3300005439 Bacteria 1793
21 Ga0070708_100067196 3300005445 Bacteria 3218
22 Ga0070708_100432499 3300005445 Bacteria 1241
23 Ga0070681_10000021 3300005458 Bacteria 116877
24 Ga0070681_10000322 3300005458 Bacteria 39028
25 Ga0070681_10027754 3300005458 Bacteria 5692
26 Ga0070681_10034368 3300005458 Bacteria 5090
27 Ga0070681_10054993 3300005458 Bacteria 3965
28 Ga0070706_100164904 3300005467 Bacteria 2069
29 Ga0070698_100182263 3300005471 Bacteria 2038
30 Ga0070679_100000298 3300005530 Bacteria 42304
31 Ga0070679_100041421 3300005530 Bacteria 4584
32 Ga0068853_100007776 3300005539 Bacteria 8597
33 Ga0068853_100019164 3300005539 Bacteria 5671
34 Ga0070696_100001160 3300005546 Bacteria 17091
35 Ga0070665_100000290 3300005548 Bacteria 79561
36 Ga0068855_100052537 3300005563 Bacteria 4797
37 Ga0068855_100066184 3300005563 Bacteria 4213
38 Ga0068855_100108991 3300005563 Bacteria 3181
39 Ga0068852_100118762 3300005616 Bacteria 2417
40 Ga0068861_100032054 3300005719 Bacteria 3866
41 Ga0068863_100040028 3300005841 Bacteria 4457
42 Ga0068863_100178111 3300005841 Unclassified 2041
43 Ga0068860_100000344 3300005843 Bacteria 62777
44 Ga0070712_100315849 3300006175 Bacteria 1269
45 Ga0068865_100005302 3300006881 Bacteria 7802
46 Ga0075436_100004327 3300006914 Bacteria 9745
47 Ga0099794_10048473 3300007265 Bacteria 2039
48 Ga0099795_10005236 3300007788 Bacteria 3430
49 Ga0105240_10199417 3300009093 Bacteria 2347
50 Ga0105240_10240208 3300009093 Bacteria 2100
51 Ga0105240_10359488 3300009093 Bacteria 1650
52 Ga0105245_10015309 3300009098 Bacteria 6684
53 Ga0105247_10117494 3300009101 Bacteria 1719
54 Ga0105241_10114376 3300009174 Bacteria 2164
55 Ga0105241_10263362 3300009174 Bacteria 1466
56 Ga0105242_10021342 3300009176 Bacteria 5082
57 Ga0105237_10147296 3300009545 Bacteria 2349
58 Ga0105238_10137655 3300009551 Bacteria 2419
59 Ga0105249_10108213 3300009553 Bacteria 2624
60 Ga0105239_10008108 3300010375 Bacteria 11989
61 Ga0105239_10031980 3300010375 Bacteria 5782
62 Ga0157373_10020917 3300013100 Bacteria 4751
63 Ga0157370_10003917 3300013104 Bacteria 17339
64 Ga0157370_10006438 3300013104 Bacteria 12954
65 Ga0157369_10000032 3300013105 Bacteria 202272
66 Ga0157369_10003770 3300013105 Bacteria 18016
67 Ga0157378_10382070 3300013297 Bacteria 1383
68 Ga0157372_10099341 3300013307 Bacteria 3320
69 Ga0157376_10261334 3300014969 Bacteria 1622
70 Ga0213872_10004748 3300021361 Bacteria 7123
71 Ga0213872_10016135 3300021361 Bacteria 3468
72 Ga0213872_10025182 3300021361 Bacteria 2735
73 Ga0213876_10000184 3300021384 Bacteria 64563
74 Ga0209148_1010404 3300025254 Bacteria 1767
75 Ga0207705_10001005 3300025909 Bacteria 22914
76 Ga0207705_10002447 3300025909 Bacteria 14320
77 Ga0207707_10000002 3300025912 Bacteria 1142054
78 Ga0207707_10000252 3300025912 Bacteria 58932
79 Ga0207707_10026625 3300025912 Bacteria 5054
80 Ga0207707_10107623 3300025912 Bacteria 2437
81 Ga0207695_10005065 3300025913 Bacteria 17669
82 Ga0207695_10010907 3300025913 Bacteria 11055
83 Ga0207695_10213090 3300025913 Bacteria 1841
84 Ga0207671_10086924 3300025914 Bacteria 2351
85 Ga0207663_10191141 3300025916 Bacteria 1470
86 Ga0207660_10002105 3300025917 Bacteria 13204
87 Ga0207660_10014973 3300025917 Bacteria 5111
88 Ga0207660_10029255 3300025917 Bacteria 3776
89 Ga0207657_10000543 3300025919 Bacteria 40303
90 Ga0207657_10001124 3300025919 Bacteria 28399
91 Ga0207657_10164452 3300025919 Bacteria 1801
92 Ga0207649_10014688 3300025920 Bacteria 4391
93 Ga0207652_10000223 3300025921 Bacteria 59425
94 Ga0207652_10001196 3300025921 Bacteria 23351
95 Ga0207652_10010298 3300025921 Bacteria 7526
96 Ga0207652_10186177 3300025921 Bacteria 1867
97 Ga0207694_10061672 3300025924 Bacteria 2918
98 Ga0207664_10028589 3300025929 Bacteria 4239
99 Ga0207690_10001527 3300025932 Bacteria 14481
100 Ga0207706_10088679 3300025933 Bacteria 2719
101 Ga0207686_10019843 3300025934 Bacteria 3831
102 Ga0207704_10005068 3300025938 Bacteria 6063
103 Ga0207711_10007478 3300025941 Bacteria 9136
104 Ga0207689_10001296 3300025942 Bacteria 24095
105 Ga0207679_10172703 3300025945 Bacteria 1781
106 Ga0207667_10038670 3300025949 Bacteria 5092
107 Ga0207640_10082796 3300025981 Bacteria 2198
108 Ga0207658_10000363 3300025986 Bacteria 44647
109 Ga0207639_10003858 3300026041 Bacteria 10098
110 Ga0207678_10442871 3300026067 Bacteria 1129
111 Ga0207702_10077404 3300026078 Bacteria 2877
112 Ga0207641_10019004 3300026088 Bacteria 5636
113 Ga0207641_10094815 3300026088 Bacteria 2618
114 Ga0207676_10016717 3300026095 Bacteria 5312
115 Ga0207674_10099658 3300026116 Bacteria 2888
116 Ga0207675_100000644 3300026118 Bacteria 34301
117 Ga0207698_10286104 3300026142 Bacteria 1527
118 Ga0209588_1019347 3300027671 Unclassified 2124
119 Ga0268266_10000612 3300028379 Bacteria 48661
120 Ga0268264_10000161 3300028381 Bacteria 150917
121 Ga0265318_10000404 3300028577 Bacteria 33512
122 Ga0265340_10076984 3300031247 Bacteria 1575
123 Ga0265327_10006927 3300031251 Bacteria 8908
124 Ga0307513_10002819 3300031456 Bacteria 23846
125 Ga0265314_10004456 3300031711 Bacteria 12996
126 Ga0307516_10081339 3300031730 Bacteria 3082
127 Ga0307510_10037421 3300033180 Bacteria 5384
128 Ga0373936_0008555 3300035113 Bacteria 3853
129 Ga0373937_0033502 3300036401 Bacteria 4666
130 Ga0395899_0000003 3300037312 Bacteria 1232684
131 Ga0395900_0000127 3300037418 Bacteria 127554
132 Ga0395900_0002169 3300037418 Bacteria 21931
133 Ga0395900_0068683 3300037418 Bacteria 3642
134 Ga0395900_0074033 3300037418 Bacteria 3502
135 Ga0395898_0005850 3300037466 Bacteria 13225
136 Ga0395898_0352441 3300037466 Bacteria 1403
137 Ga0395905_0005860 3300037471 Bacteria 12490
138 Ga0395905_0029406 3300037471 Bacteria 5176
139 Ga0395905_0032790 3300037471 Bacteria 4883
140 Ga0395905_0041379 3300037471 Bacteria 4324
141 Ga0395901_0009885 3300038443 Bacteria 9671
142 Ga0395901_0021867 3300038443 Bacteria 6555
143 Ga0242420_013213 3300038996 Bacteria 1405
144 Ga0436365_1849791 3300039437 Bacteria 109940
145 Ga0436361_0012604 3300039447 Bacteria 4032
146 Ga0436361_0356218 3300039447 Bacteria 3788
147 Ga0436361_0453783 3300039447 Bacteria 3077
148 Ga0436361_0675976 3300039447 Bacteria 9570
149 Ga0436361_1162354 3300039447 Bacteria 2626
150 Ga0436361_1190313 3300039447 Bacteria 2013
151 Ga0436361_1204025 3300039447 Bacteria 2016
152 Ga0466957_0012959 3300044842 Bacteria 4830
153 Ga0466959_0030905 3300045049 Bacteria 3965
154 Ga0466958_0003573 3300045836 Bacteria 8097
155 Ga0495638_0000007 3300046460 Bacteria 602783
156 Ga0495664_0078879 3300046477 Bacteria 1973
157 Ga0495583_0027600 3300046506 Bacteria 2801
158 Ga0495628_0114795 3300046516 Bacteria 2069
159 Ga0495669_0016708 3300046684 Bacteria 3146
160 Ga0496106_0124922 3300048909 Bacteria 2014
161 Ga0496109_0402394 3300048912 Bacteria 1293
162 Ga0496115_0020976 3300048918 Bacteria 5042
163 Ga0501047_0199345 3300049581 Bacteria 1863
164 Ga0501069_0098180 3300049585 Bacteria 1661
165 Ga0501070_0001219 3300049586 Bacteria 23013
166 Ga0501073_0000650 3300049589 Bacteria 24375
167 Ga0501074_0003437 3300049590 Bacteria 11230
168 Ga0501080_0168405 3300049742 Bacteria 2021
169 Ga0501035_0018305 3300049822 Bacteria 6454
170 nmdc:mga08x19_24835_c1 3300050514 Bacteria 3729
171 Ga0500595_027282 3300053119 Bacteria 1957
172 Ga0500616_0038646 3300053153 Bacteria 2577

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025917 Ga0207660_10002105 Ga0207660_100021051 290
2 3300013297 Ga0157378_10382070 Ga0157378_103820701 297
3 3300005434 Ga0070709_10009212 Ga0070709_100092125 302
4 3300005435 Ga0070714_100006677 Ga0070714_1000066778 302
5 3300025929 Ga0207664_10028589 Ga0207664_100285892 302
6 3300046516 Ga0495628_0114795 Ga0495628_0114795_795_1817 306
7 3300005336 Ga0070680_100100536 Ga0070680_1001005362 307
8 3300005616 Ga0068852_100118762 Ga0068852_1001187623 307
9 3300026142 Ga0207698_10286104 Ga0207698_102861042 307
10 3300037312 Ga0395899_0000003 Ga0395899_0000003_162615_163634 308
11 3300005327 Ga0070658_10111171 Ga0070658_101111711 309
12 3300005336 Ga0070680_100027373 Ga0070680_1000273734 309
13 3300005339 Ga0070660_100173721 Ga0070660_1001737212 309
14 3300005439 Ga0070711_100097161 Ga0070711_1000971612 309
15 3300005458 Ga0070681_10054993 Ga0070681_100549934 309
16 3300005530 Ga0070679_100041421 Ga0070679_1000414214 309
17 3300005563 Ga0068855_100066184 Ga0068855_1000661843 309
18 3300025909 Ga0207705_10002447 Ga0207705_100024475 309
19 3300025912 Ga0207707_10107623 Ga0207707_101076234 309
20 3300025917 Ga0207660_10029255 Ga0207660_100292555 309
21 3300025919 Ga0207657_10001124 Ga0207657_1000112426 309
22 3300025921 Ga0207652_10010298 Ga0207652_100102984 309
23 3300025949 Ga0207667_10038670 Ga0207667_100386704 309
24 3300026078 Ga0207702_10077404 Ga0207702_100774043 309
25 3300026116 Ga0207674_10099658 Ga0207674_100996584 309
26 3300005458 Ga0070681_10027754 Ga0070681_100277546 310
27 3300031251 Ga0265327_10006927 Ga0265327_100069278 310
28 3300006881 Ga0068865_100005302 Ga0068865_1000053026 311
29 3300025938 Ga0207704_10005068 Ga0207704_100050682 311
30 3300005336 Ga0070680_100080716 Ga0070680_1000807162 312
31 3300005445 Ga0070708_100432499 Ga0070708_1004324991 312
32 3300005467 Ga0070706_100164904 Ga0070706_1001649042 312
33 3300014969 Ga0157376_10261334 Ga0157376_102613341 312
34 3300025933 Ga0207706_10088679 Ga0207706_100886792 312
35 3300025945 Ga0207679_10172703 Ga0207679_101727032 312
36 3300026095 Ga0207676_10016717 Ga0207676_100167172 312
37 3300048909 Ga0496106_0124922 Ga0496106_0124922_25_1056 312
38 3300048912 Ga0496109_0402394 Ga0496109_0402394_107_1138 312
39 3300039437 Ga0436365_1849791 Ga0436365_1849791_28751_29737 314
40 3300005339 Ga0070660_100230247 Ga0070660_1002302471 315
41 3300005366 Ga0070659_100025121 Ga0070659_1000251213 315
42 3300009176 Ga0105242_10021342 Ga0105242_100213423 315
43 3300025919 Ga0207657_10164452 Ga0207657_101644523 315
44 3300025932 Ga0207690_10001527 Ga0207690_1000152711 315
45 3300031730 Ga0307516_10081339 Ga0307516_100813392 315
46 3300036401 Ga0373937_0033502 Ga0373937_0033502_2304_3302 315
47 3300005439 Ga0070711_100143485 Ga0070711_1001434852 316
48 3300049590 Ga0501074_0003437 Ga0501074_0003437_1328_2398 316
49 3300049822 Ga0501035_0018305 Ga0501035_0018305_2915_3985 316
50 3300050514 nmdc:mga08x19_24835_c1 nmdc:mga08x19_24835_c1_1304_2314 316
51 3300005435 Ga0070714_100181174 Ga0070714_1001811741 317
52 3300009551 Ga0105238_10137655 Ga0105238_101376552 317
53 3300037418 Ga0395900_0074033 Ga0395900_0074033_1915_2928 317
54 3300037471 Ga0395905_0029406 Ga0395905_0029406_1924_2937 317
55 3300038443 Ga0395901_0021867 Ga0395901_0021867_3275_4288 317
56 3300053153 Ga0500616_0038646 Ga0500616_0038646_231_1226 317
57 3300005336 Ga0070680_100000140 Ga0070680_10000014036 318
58 3300005458 Ga0070681_10000021 Ga0070681_1000002186 318
59 3300005530 Ga0070679_100000298 Ga0070679_10000029840 318
60 3300005539 Ga0068853_100007776 Ga0068853_1000077765 318
61 3300009093 Ga0105240_10359488 Ga0105240_103594881 318
62 3300010375 Ga0105239_10008108 Ga0105239_1000810813 318
63 3300025912 Ga0207707_10000002 Ga0207707_100000021187 318
64 3300025921 Ga0207652_10000223 Ga0207652_1000022359 318
65 3300025934 Ga0207686_10019843 Ga0207686_100198433 318
66 3300026041 Ga0207639_10003858 Ga0207639_100038584 318
67 3300033180 Ga0307510_10037421 Ga0307510_100374215 318
68 3300037418 Ga0395900_0002169 Ga0395900_0002169_228_1313 318
69 3300046477 Ga0495664_0078879 Ga0495664_0078879_914_1915 318
70 3300005435 Ga0070714_100183655 Ga0070714_1001836551 319
71 3300005445 Ga0070708_100067196 Ga0070708_1000671962 319
72 3300005471 Ga0070698_100182263 Ga0070698_1001822632 319
73 3300005563 Ga0068855_100108991 Ga0068855_1001089913 319
74 3300021361 Ga0213872_10016135 Ga0213872_100161353 319
75 3300021384 Ga0213876_10000184 Ga0213876_1000018417 319
76 3300025981 Ga0207640_10082796 Ga0207640_100827961 319
77 3300028577 Ga0265318_10000404 Ga0265318_1000040420 319
78 3300031456 Ga0307513_10002819 Ga0307513_1000281913 319
79 3300037466 Ga0395898_0352441 Ga0395898_0352441_114_1127 319
80 3300037471 Ga0395905_0041379 Ga0395905_0041379_2977_3999 319
81 3300039447 Ga0436361_0453783 Ga0436361_0453783_589_1593 319
82 3300039447 Ga0436361_1190313 Ga0436361_1190313_815_1819 319
83 3300046460 Ga0495638_0000007 Ga0495638_0000007_303172_304260 319
84 3300049586 Ga0501070_0001219 Ga0501070_0001219_1622_2758 319
85 3300049589 Ga0501073_0000650 Ga0501073_0000650_10302_11402 319
86 3300005458 Ga0070681_10034368 Ga0070681_100343682 320
87 3300005546 Ga0070696_100001160 Ga0070696_1000011609 320
88 3300005841 Ga0068863_100178111 Ga0068863_1001781111 320
89 3300006914 Ga0075436_100004327 Ga0075436_10000432711 320
90 3300009093 Ga0105240_10199417 Ga0105240_101994172 320
91 3300021361 Ga0213872_10025182 Ga0213872_100251822 320
92 3300025912 Ga0207707_10026625 Ga0207707_100266253 320
93 3300025913 Ga0207695_10010907 Ga0207695_100109078 320
94 3300025921 Ga0207652_10186177 Ga0207652_101861772 320
95 3300026088 Ga0207641_10094815 Ga0207641_100948152 320
96 3300031247 Ga0265340_10076984 Ga0265340_100769842 320
97 3300037471 Ga0395905_0005860 Ga0395905_0005860_9854_10879 320
98 3300039447 Ga0436361_0012604 Ga0436361_0012604_733_1740 320
99 3300039447 Ga0436361_1162354 Ga0436361_1162354_650_1657 320
100 iso_pu_bacteria 2895395659 2895398581 320
101 3300005335 Ga0070666_10248768 Ga0070666_102487681 321
102 3300005338 Ga0068868_100180633 Ga0068868_1001806332 321
103 3300005367 Ga0070667_100000053 Ga0070667_10000005340 321
104 3300005458 Ga0070681_10000322 Ga0070681_1000032216 321
105 3300005719 Ga0068861_100032054 Ga0068861_1000320542 321
106 3300005841 Ga0068863_100040028 Ga0068863_1000400284 321
107 3300005843 Ga0068860_100000344 Ga0068860_10000034437 321
108 3300007265 Ga0099794_10048473 Ga0099794_100484733 321
109 3300007788 Ga0099795_10005236 Ga0099795_100052362 321
110 3300009093 Ga0105240_10240208 Ga0105240_102402082 321
111 3300009098 Ga0105245_10015309 Ga0105245_100153096 321
112 3300009174 Ga0105241_10114376 Ga0105241_101143762 321
113 3300009545 Ga0105237_10147296 Ga0105237_101472962 321
114 3300009553 Ga0105249_10108213 Ga0105249_101082132 321
115 3300013100 Ga0157373_10020917 Ga0157373_100209172 321
116 3300013104 Ga0157370_10003917 Ga0157370_100039175 321
117 3300013105 Ga0157369_10000032 Ga0157369_10000032130 321
118 3300021361 Ga0213872_10004748 Ga0213872_100047487 321
119 3300025254 Ga0209148_1010404 Ga0209148_10104042 321
120 3300025912 Ga0207707_10000252 Ga0207707_1000025226 321
121 3300025913 Ga0207695_10005065 Ga0207695_100050653 321
122 3300025913 Ga0207695_10213090 Ga0207695_102130902 321
123 3300025914 Ga0207671_10086924 Ga0207671_100869242 321
124 3300025916 Ga0207663_10191141 Ga0207663_101911411 321
125 3300025924 Ga0207694_10061672 Ga0207694_100616723 321
126 3300025942 Ga0207689_10001296 Ga0207689_100012968 321
127 3300025986 Ga0207658_10000363 Ga0207658_1000036344 321
128 3300026088 Ga0207641_10019004 Ga0207641_100190043 321
129 3300026118 Ga0207675_100000644 Ga0207675_10000064426 321
130 3300027671 Ga0209588_1019347 Ga0209588_10193472 321
131 3300028381 Ga0268264_10000161 Ga0268264_10000161106 321
132 3300031711 Ga0265314_10004456 Ga0265314_100044561 321
133 3300037418 Ga0395900_0068683 Ga0395900_0068683_1245_2285 321
134 3300038996 Ga0242420_013213 Ga0242420_013213_216_1229 321
135 3300039447 Ga0436361_0356218 Ga0436361_0356218_1496_2539 321
136 3300039447 Ga0436361_0675976 Ga0436361_0675976_1600_2616 321
137 3300039447 Ga0436361_1204025 Ga0436361_1204025_626_1636 321
138 3300044842 Ga0466957_0012959 Ga0466957_0012959_41_1051 321
139 3300045049 Ga0466959_0030905 Ga0466959_0030905_2657_3685 321
140 3300045836 Ga0466958_0003573 Ga0466958_0003573_795_1805 321
141 3300005344 Ga0070661_100007852 Ga0070661_1000078522 322
142 3300005366 Ga0070659_100043033 Ga0070659_1000430332 322
143 3300005548 Ga0070665_100000290 Ga0070665_10000029072 322
144 3300005563 Ga0068855_100052537 Ga0068855_1000525372 322
145 3300006175 Ga0070712_100315849 Ga0070712_1003158492 322
146 3300009101 Ga0105247_10117494 Ga0105247_101174942 322
147 3300009174 Ga0105241_10263362 Ga0105241_102633622 322
148 3300010375 Ga0105239_10031980 Ga0105239_100319805 322
149 3300013104 Ga0157370_10006438 Ga0157370_100064386 322
150 3300013105 Ga0157369_10003770 Ga0157369_100037707 322
151 3300013307 Ga0157372_10099341 Ga0157372_100993415 322
152 3300025909 Ga0207705_10001005 Ga0207705_1000100526 322
153 3300025917 Ga0207660_10014973 Ga0207660_100149736 322
154 3300025919 Ga0207657_10000543 Ga0207657_1000054323 322
155 3300025920 Ga0207649_10014688 Ga0207649_100146884 322
156 3300025921 Ga0207652_10001196 Ga0207652_1000119612 322
157 3300026067 Ga0207678_10442871 Ga0207678_104428711 322
158 3300028379 Ga0268266_10000612 Ga0268266_1000061245 322
159 3300037418 Ga0395900_0000127 Ga0395900_0000127_124753_125787 322
160 3300037466 Ga0395898_0005850 Ga0395898_0005850_1414_2448 322
161 3300037471 Ga0395905_0032790 Ga0395905_0032790_1415_2449 322
162 3300038443 Ga0395901_0009885 Ga0395901_0009885_7224_8258 322
163 3300048918 Ga0496115_0020976 Ga0496115_0020976_3965_4999 322
164 3300003320 rootH2_10000496 rootH2_1000049628 323
165 3300005539 Ga0068853_100019164 Ga0068853_1000191644 323
166 3300025941 Ga0207711_10007478 Ga0207711_100074785 323
167 3300035113 Ga0373936_0008555 Ga0373936_0008555_945_1997 323
168 3300046506 Ga0495583_0027600 Ga0495583_0027600_980_2011 323
169 3300046684 Ga0495669_0016708 Ga0495669_0016708_574_1608 323
170 3300049581 Ga0501047_0199345 Ga0501047_0199345_86_1186 323
171 3300049585 Ga0501069_0098180 Ga0501069_0098180_388_1488 323
172 3300049742 Ga0501080_0168405 Ga0501080_0168405_202_1302 323
173 3300053119 Ga0500595_027282 Ga0500595_027282_576_1601 323

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03069

FmdA_AmdA

Acetamidase/Formamidase family

133

231

0.91

PF03069

FmdA_AmdA

Acetamidase/Formamidase family

224

377

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
2f4l-assembly2.cif.gz_D crystal structure of a putative acetamidase (tm0119) from thermotoga maritima msb8 at 2.50 a resolution 0.8811 23 322
2f4l-assembly2.cif.gz_C crystal structure of a putative acetamidase (tm0119) from thermotoga maritima msb8 at 2.50 a resolution 0.8795 23 322
2f4l-assembly2.cif.gz_D crystal structure of a putative acetamidase (tm0119) from thermotoga maritima msb8 at 2.50 a resolution 0.875 23 322
3t1c-assembly2.cif.gz_B crystal structure of nak channel d66y mutant 0.8724 272 297
2f4l-assembly1.cif.gz_A crystal structure of a putative acetamidase (tm0119) from thermotoga maritima msb8 at 2.50 a resolution 0.8678 23 322
ID Description Score Start End Superfamily
af_Q4D748_1_97_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9512 272 296 3.40.50.300
1s8nA02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9099 263 296 1.10.10.10
2f4lD03 Alpha Beta;Roll;Endonuclease I-creI;Acetamidase/Formamidase-like domains 0.8945 243 322 3.10.28.20
2f4lD03 Alpha Beta;Roll;Endonuclease I-creI;Acetamidase/Formamidase-like domains 0.8844 243 322 3.10.28.20
af_K7KDK8_16_102_3.30.70.1620 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8757 272 296 3.30.70.1620
ID Description Score Start End GO Terms
AF-A0A4Q2X506-F1-model_v4 deleted 0.9861 18 179
AF-A0A520IKA1-F1-model_v4 Acetamidase 0.9832 17 157 GO:0016811
AF-A0A2V8PKM7-F1-model_v4 Acetamidase 0.971 21 289 GO:0016811
AF-A0A7Y3PI71-F1-model_v4 Acetamidase 0.9686 245 323 GO:0016811
AF-A0A177RCR0-F1-model_v4 deleted 0.9673 19 323

Feature Viewer

pLDDT pTM Quality
92.27 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map