F261243

General Info

Members Datasets Scaffolds Average Seq Length
172 107 344 179

Family's Representative Sequence

Representative Sequence 3300044842|Ga0466957_0291225|Ga0466957_0291225_212_775
Length 187
Sequence MVAGMRIAVIGRGNVGGGLADRWERKGHEVTRLGRDGGDVGDADAVLLAAPGRAVAEVLDAYGGLEGRTVLDATNLVGASPPDGFSSNAEYVKSRTGGPTAKTFNLNFAAVYDRIDGASSTPGNIWCGDEEAREVVEQLIADAGYEPIYAGGLETAAAQEAALGLLFAISQGGMGPFLYRMAPPDKL

Samples

Sample ID Description Type Environment
1 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
4 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
5 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
6 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
7 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
8 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
9 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
10 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
11 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
12 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
13 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
14 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
15 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
16 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
17 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
18 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
19 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
20 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
21 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
22 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
23 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
24 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
25 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
26 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
35 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
36 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
37 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
38 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
39 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
40 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
41 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
42 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
43 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
44 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
45 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
46 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
47 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
48 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
49 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
50 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
51 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
52 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
53 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
54 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
55 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
56 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
57 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
58 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
59 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
60 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
61 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
62 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
63 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
64 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
65 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
66 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
67 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
68 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
69 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
70 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
71 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
72 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
73 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
74 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
75 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
76 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
77 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
78 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
79 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
80 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
81 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
82 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
83 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
84 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
85 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
86 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
87 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
88 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
89 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
90 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
91 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
92 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
93 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
94 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
95 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
96 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
97 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
98 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
99 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
100 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
101 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
102 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
103 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
104 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
105 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
106 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
107 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.16
Nodule 0
Rhizoplane 2.91
Rhizosphere 87.21
Stem 0
Stem Tuber 0
Unclassified 12.21

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466957_0291225 3300044842 Bacteria 1095
2 Ga0070683_100010974 3300005329 Bacteria 7806
3 Ga0070682_100000016 3300005337 Bacteria 239799
4 Ga0070667_100872185 3300005367 Bacteria 837
5 Ga0070710_10042074 3300005437 Unclassified 2524
6 Ga0070707_100401038 3300005468 Bacteria 1331
7 Ga0070684_100016597 3300005535 Bacteria 6022
8 Ga0068854_100000474 3300005578 Bacteria 24680
9 Ga0068858_100000043 3300005842 Bacteria 132444
10 Ga0081539_10200035 3300005985 Bacteria 924
11 Ga0070717_10033406 3300006028 Bacteria 4151
12 Ga0070712_100021116 3300006175 Bacteria 4270
13 Ga0075431_100572400 3300006847 Bacteria 1116
14 Ga0111539_10134350 3300009094 Bacteria 2897
15 Ga0114129_10918439 3300009147 Bacteria 1108
16 Ga0105243_10112798 3300009148 Bacteria 2278
17 Ga0105241_10404523 3300009174 Bacteria 1198
18 Ga0105249_10164095 3300009553 Bacteria 2149
19 Ga0105249_10918488 3300009553 Bacteria 943
20 Ga0157378_10185256 3300013297 Unclassified 1960
21 Ga0157372_10000064 3300013307 Bacteria 114648
22 Ga0157375_12216164 3300013308 Bacteria 655
23 Ga0213871_10017448 3300021441 Bacteria 1744
24 Ga0207692_10057907 3300025898 Unclassified 1995
25 Ga0207705_10184056 3300025909 Bacteria 1578
26 Ga0207684_10587147 3300025910 Bacteria 952
27 Ga0207707_10333719 3300025912 Bacteria 1308
28 Ga0207646_10470172 3300025922 Bacteria 1134
29 Ga0207646_10769528 3300025922 Bacteria 858
30 Ga0207706_10565713 3300025933 Bacteria 978
31 Ga0207661_10070628 3300025944 Bacteria 2851
32 Ga0207651_10658565 3300025960 Bacteria 920
33 Ga0207712_10344193 3300025961 Bacteria 1237
34 Ga0207640_10000122 3300025981 Bacteria 59302
35 Ga0207658_10273114 3300025986 Unclassified 1446
36 Ga0207703_10000053 3300026035 Bacteria 143924
37 Ga0265322_10004139 3300028654 Bacteria 4337
38 Ga0265336_10006179 3300028666 Bacteria 4336
39 Ga0265338_10078569 3300028800 Bacteria 2782
40 Ga0265330_10142439 3300031235 Bacteria 1019
41 Ga0265339_10048607 3300031249 Bacteria 2325
42 Ga0265327_10019288 3300031251 Bacteria 4197
43 Ga0265327_10275688 3300031251 Bacteria 744
44 Ga0265316_10014235 3300031344 Bacteria 7015
45 Ga0265316_10374714 3300031344 Bacteria 1027
46 Ga0265314_10012972 3300031711 Bacteria 6766
47 Ga0265314_10021143 3300031711 Bacteria 5011
48 Ga0265314_10083294 3300031711 Bacteria 2103
49 Ga0307413_10569850 3300031824 Unclassified 922
50 Ga0307412_10393725 3300031911 Bacteria 1126
51 Ga0307416_100420663 3300032002 Unclassified 1380
52 Ga0307416_100537262 3300032002 Bacteria 1240
53 Ga0307416_100658064 3300032002 Bacteria 1133
54 Ga0307416_100944541 3300032002 Bacteria 964
55 Ga0307416_100969445 3300032002 Bacteria 953
56 Ga0307416_101636777 3300032002 Bacteria 749
57 Ga0307416_102467788 3300032002 Unclassified 619
58 Ga0307414_10575785 3300032004 Unclassified 1007
59 Ga0395899_0305739 3300037312 Bacteria 1075
60 Ga0395900_0005798 3300037418 Bacteria 12901
61 Ga0395900_0060284 3300037418 Bacteria 3905
62 Ga0395898_0017316 3300037466 Bacteria 7361
63 Ga0395898_0300339 3300037466 Bacteria 1532
64 Ga0395905_0025222 3300037471 Bacteria 5607
65 Ga0395905_0078159 3300037471 Bacteria 3101
66 Ga0436364_0559533 3300037853 Bacteria 2797
67 Ga0395901_0017197 3300038443 Bacteria 7377
68 Ga0395901_0054259 3300038443 Bacteria 4165
69 Ga0395901_0261784 3300038443 Bacteria 1800
70 Ga0395901_0391406 3300038443 Bacteria 1429
71 Ga0395901_0626935 3300038443 Bacteria 1081
72 Ga0436365_0371644 3300039437 Bacteria 813
73 Ga0436365_0926815 3300039437 Bacteria 1363
74 Ga0436360_1053528 3300039438 Bacteria 1726
75 Ga0436361_0250573 3300039447 Bacteria 1410
76 Ga0436362_1280694 3300039453 Bacteria 1760
77 Ga0439450_051505 3300042008 Unclassified 979
78 Ga0439440_0109823 3300042993 Bacteria 758
79 Ga0466965_0122519 3300044683 Unclassified 1344
80 Ga0466965_0637010 3300044683 Unclassified 608
81 Ga0466966_0068193 3300044684 Bacteria 2233
82 Ga0466966_0125280 3300044684 Bacteria 1576
83 Ga0466966_0202048 3300044684 Bacteria 1202
84 Ga0466966_0240907 3300044684 Bacteria 1090
85 Ga0466961_0007918 3300044693 Bacteria 6769
86 Ga0466961_0026747 3300044693 Bacteria 3709
87 Ga0466961_0404942 3300044693 Bacteria 828
88 Ga0466963_0000929 3300044694 Bacteria 14955
89 Ga0466963_0008419 3300044694 Bacteria 6180
90 Ga0466963_0213498 3300044694 Unclassified 1351
91 Ga0466971_0036085 3300044719 Bacteria 2217
92 Ga0466971_0059752 3300044719 Bacteria 1722
93 Ga0466968_0020074 3300044735 Bacteria 2694
94 Ga0466968_0108406 3300044735 Bacteria 1247
95 Ga0466968_0275037 3300044735 Bacteria 805
96 Ga0466970_0029157 3300044765 Bacteria 2904
97 Ga0466957_0002966 3300044842 Bacteria 9207
98 Ga0466957_0005752 3300044842 Bacteria 6964
99 Ga0466957_0006139 3300044842 Bacteria 6781
100 Ga0466957_0050648 3300044842 Bacteria 2527
101 Ga0466957_0135661 3300044842 Bacteria 1581
102 Ga0466957_0727408 3300044842 Unclassified 702
103 Ga0466957_0939499 3300044842 Unclassified 619
104 Ga0466959_0063097 3300045049 Bacteria 2691
105 Ga0466959_0111255 3300045049 Bacteria 1954
106 Ga0466959_0130981 3300045049 Unclassified 1778
107 Ga0466959_0132163 3300045049 Unclassified 1769
108 Ga0466959_0185692 3300045049 Bacteria 1453
109 Ga0466958_0004336 3300045836 Bacteria 7474
110 Ga0466958_0006052 3300045836 Bacteria 6557
111 Ga0466958_0019084 3300045836 Bacteria 3989
112 Ga0466958_0062265 3300045836 Bacteria 2274
113 Ga0466958_0091560 3300045836 Bacteria 1882
114 Ga0466958_0093484 3300045836 Bacteria 1862
115 Ga0466958_0246132 3300045836 Bacteria 1143
116 Ga0466967_0047285 3300045976 Bacteria 3750
117 Ga0466967_0047606 3300045976 Bacteria 3738
118 Ga0466967_0055869 3300045976 Bacteria 3478
119 Ga0466967_0096940 3300045976 Bacteria 2691
120 Ga0466967_0111703 3300045976 Bacteria 2512
121 Ga0466967_0190184 3300045976 Bacteria 1939
122 Ga0466967_0231754 3300045976 Bacteria 1758
123 Ga0466967_0347999 3300045976 Bacteria 1434
124 Ga0466967_0368723 3300045976 Bacteria 1392
125 Ga0466967_1443856 3300045976 Bacteria 685
126 Ga0495580_0422098 3300046472 Bacteria 897
127 Ga0495582_0311892 3300046473 Bacteria 905
128 Ga0495608_0000001 3300046511 Bacteria 411278
129 Ga0495608_0237268 3300046511 Bacteria 1140
130 Ga0495628_0147989 3300046516 Bacteria 1789
131 Ga0495628_0202940 3300046516 Bacteria 1493
132 Ga0495630_0700598 3300046517 Unclassified 775
133 Ga0495640_0254169 3300046533 Bacteria 1100
134 Ga0495657_0000002 3300046675 Bacteria 411958
135 Ga0495646_0229612 3300046680 Bacteria 1001
136 Ga0495647_0194989 3300046681 Bacteria 886
137 Ga0495674_1199697 3300047319 Bacteria 573
138 Ga0495675_0000228 3300047444 Bacteria 40555
139 Ga0495684_0371956 3300047471 Bacteria 1010
140 Ga0495686_0248708 3300047472 Bacteria 1000
141 Ga0496100_0129717 3300048903 Unclassified 1774
142 Ga0496101_0035626 3300048904 Bacteria 3521
143 Ga0496102_0177594 3300048905 Bacteria 2005
144 Ga0496106_0017294 3300048909 Bacteria 5338
145 Ga0496107_0042502 3300048910 Bacteria 3264
146 Ga0496116_0000014 3300048919 Bacteria 569049
147 Ga0496117_0021569 3300048920 Bacteria 5204
148 Ga0496118_0000090 3300048921 Bacteria 175645
149 Ga0496118_0162998 3300048921 Bacteria 1375
150 Ga0496118_0229007 3300048921 Bacteria 1074
151 Ga0496119_0000441 3300048922 Bacteria 56986
152 Ga0496119_0048910 3300048922 Bacteria 2618
153 Ga0496120_0002591 3300048923 Bacteria 17983
154 Ga0496121_0021107 3300048924 Bacteria 6398
155 Ga0496125_0024991 3300048928 Bacteria 5481
156 Ga0496126_0173263 3300048929 Bacteria 1837
157 Ga0496126_0300409 3300048929 Unclassified 1325
158 Ga0501067_0175374 3300049583 Bacteria 1194
159 Ga0501071_0515845 3300049587 Bacteria 917
160 Ga0501075_0875377 3300049591 Bacteria 683
161 Ga0501209_078525 3300049656 Unclassified 949
162 Ga0501080_0265848 3300049742 Bacteria 1562
163 nmdc:mga0yw44_42416_c1 3300050492 Bacteria 2713
164 nmdc:mga05p37_849714_c1 3300050507 Bacteria 991
165 nmdc:mga08y16_107123_c1 3300050511 Bacteria 2909
166 Ga0495601_0232927 3300053077 Unclassified 1203
167 Ga0495595_0000001 3300053084 Bacteria 495226
168 Ga0495619_0000046 3300053085 Bacteria 104451
169 Ga0500595_026776 3300053119 Bacteria 1983
170 Ga0466962_0008089 3300061719 Bacteria 5042
171 Ga0466962_0027250 3300061719 Bacteria 2743
172 Ga0466962_0122953 3300061719 Bacteria 1253
173 Ga0466957_0291225
174 Ga0070683_100010974
175 Ga0070682_100000016
176 Ga0070667_100872185
177 Ga0070710_10042074
178 Ga0070707_100401038
179 Ga0070684_100016597
180 Ga0068854_100000474
181 Ga0068858_100000043
182 Ga0081539_10200035
183 Ga0070717_10033406
184 Ga0070712_100021116
185 Ga0075431_100572400
186 Ga0111539_10134350
187 Ga0114129_10918439
188 Ga0105243_10112798
189 Ga0105241_10404523
190 Ga0105249_10164095
191 Ga0105249_10918488
192 Ga0157378_10185256
193 Ga0157372_10000064
194 Ga0157375_12216164
195 Ga0213871_10017448
196 Ga0207692_10057907
197 Ga0207705_10184056
198 Ga0207684_10587147
199 Ga0207707_10333719
200 Ga0207646_10470172
201 Ga0207646_10769528
202 Ga0207706_10565713
203 Ga0207661_10070628
204 Ga0207651_10658565
205 Ga0207712_10344193
206 Ga0207640_10000122
207 Ga0207658_10273114
208 Ga0207703_10000053
209 Ga0265322_10004139
210 Ga0265336_10006179
211 Ga0265338_10078569
212 Ga0265330_10142439
213 Ga0265339_10048607
214 Ga0265327_10019288
215 Ga0265327_10275688
216 Ga0265316_10014235
217 Ga0265316_10374714
218 Ga0265314_10012972
219 Ga0265314_10021143
220 Ga0265314_10083294
221 Ga0307413_10569850
222 Ga0307412_10393725
223 Ga0307416_100420663
224 Ga0307416_100537262
225 Ga0307416_100658064
226 Ga0307416_100944541
227 Ga0307416_100969445
228 Ga0307416_101636777
229 Ga0307416_102467788
230 Ga0307414_10575785
231 Ga0395899_0305739
232 Ga0395900_0005798
233 Ga0395900_0060284
234 Ga0395898_0017316
235 Ga0395898_0300339
236 Ga0395905_0025222
237 Ga0395905_0078159
238 Ga0436364_0559533
239 Ga0395901_0017197
240 Ga0395901_0054259
241 Ga0395901_0261784
242 Ga0395901_0391406
243 Ga0395901_0626935
244 Ga0436365_0371644
245 Ga0436365_0926815
246 Ga0436360_1053528
247 Ga0436361_0250573
248 Ga0436362_1280694
249 Ga0439450_051505
250 Ga0439440_0109823
251 Ga0466965_0122519
252 Ga0466965_0637010
253 Ga0466966_0068193
254 Ga0466966_0125280
255 Ga0466966_0202048
256 Ga0466966_0240907
257 Ga0466961_0007918
258 Ga0466961_0026747
259 Ga0466961_0404942
260 Ga0466963_0000929
261 Ga0466963_0008419
262 Ga0466963_0213498
263 Ga0466971_0036085
264 Ga0466971_0059752
265 Ga0466968_0020074
266 Ga0466968_0108406
267 Ga0466968_0275037
268 Ga0466970_0029157
269 Ga0466957_0002966
270 Ga0466957_0005752
271 Ga0466957_0006139
272 Ga0466957_0050648
273 Ga0466957_0135661
274 Ga0466957_0727408
275 Ga0466957_0939499
276 Ga0466959_0063097
277 Ga0466959_0111255
278 Ga0466959_0130981
279 Ga0466959_0132163
280 Ga0466959_0185692
281 Ga0466958_0004336
282 Ga0466958_0006052
283 Ga0466958_0019084
284 Ga0466958_0062265
285 Ga0466958_0091560
286 Ga0466958_0093484
287 Ga0466958_0246132
288 Ga0466967_0047285
289 Ga0466967_0047606
290 Ga0466967_0055869
291 Ga0466967_0096940
292 Ga0466967_0111703
293 Ga0466967_0190184
294 Ga0466967_0231754
295 Ga0466967_0347999
296 Ga0466967_0368723
297 Ga0466967_1443856
298 Ga0495580_0422098
299 Ga0495582_0311892
300 Ga0495608_0000001
301 Ga0495608_0237268
302 Ga0495628_0147989
303 Ga0495628_0202940
304 Ga0495630_0700598
305 Ga0495640_0254169
306 Ga0495657_0000002
307 Ga0495646_0229612
308 Ga0495647_0194989
309 Ga0495674_1199697
310 Ga0495675_0000228
311 Ga0495684_0371956
312 Ga0495686_0248708
313 Ga0496100_0129717
314 Ga0496101_0035626
315 Ga0496102_0177594
316 Ga0496106_0017294
317 Ga0496107_0042502
318 Ga0496116_0000014
319 Ga0496117_0021569
320 Ga0496118_0000090
321 Ga0496118_0162998
322 Ga0496118_0229007
323 Ga0496119_0000441
324 Ga0496119_0048910
325 Ga0496120_0002591
326 Ga0496121_0021107
327 Ga0496125_0024991
328 Ga0496126_0173263
329 Ga0496126_0300409
330 Ga0501067_0175374
331 Ga0501071_0515845
332 Ga0501075_0875377
333 Ga0501209_078525
334 Ga0501080_0265848
335 nmdc:mga0yw44_42416_c1
336 nmdc:mga05p37_849714_c1
337 nmdc:mga08y16_107123_c1
338 Ga0495601_0232927
339 Ga0495595_0000001
340 Ga0495619_0000046
341 Ga0500595_026776
342 Ga0466962_0008089
343 Ga0466962_0027250
344 Ga0466962_0122953

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
5eow-assembly1.cif.gz_A crystal structure of 6-hydroxynicotinic acid 3-monooxygenase from pseudomonas putida kt2440 0.9944 4 33
1f8s-assembly1.cif.gz_B crystal structure of l-amino acid oxidase from calloselasma rhodostoma, complexed with three molecules of o-aminobenzoate. 0.9911 2 32
3kve-assembly1.cif.gz_D structure of native l-amino acid oxidase from vipera ammodytes ammodytes: stabilization of the quaternary structure by divalent ions and structural changes in the dynamic active site 0.9849 1 32
5ts5-assembly2.cif.gz_D crystal structure of l-amino acid oxidase from bothrops atrox 0.971 1 32
4gut-assembly1.cif.gz_A crystal structure of lsd2-npac 0.9704 3 32
ID Description Score Start End Superfamily
5eowA00 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9944 4 33 3.50.50.60
3rp8A01 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9541 3 32 3.50.50.60
4hb9A01 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9497 4 34 3.50.50.60
2jaeB01 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9465 1 32 3.50.50.60
af_A0A1D6HR89_2_270_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9438 1 34 3.50.50.60
ID Description Score Start End GO Terms
AF-A0A538J3D1-F1-model_v4 Dinucleotide-binding protein 0.9905 3 183
AF-A0A4R7ZUM3-F1-model_v4 Uncharacterized protein 0.9842 93 181
AF-A0A538J3D1-F1-model_v4 Dinucleotide-binding protein 0.9798 3 183
AF-A0A533STC8-F1-model_v4 Dinucleotide-binding protein 0.975 45 183
AF-A0A7Y9DQD2-F1-model_v4 Pyrroline-5-carboxylate reductase catalytic N-terminal domain-containing protein 0.9748 3 182

Map