F252798

General Info

Members Datasets Scaffolds Average Seq Length
168 129 336 239

Family's Representative Sequence

Representative Sequence 3300025920|Ga0207649_10392697|Ga0207649_103926971
Length 242
Sequence MGRAFERRKASIFKTAANNSKLYSKYSKQLYVAAKNGVPDPAANPVLRSVVEKAKKDNVPSHVIDKAIQKAAGKGGEDFQSVRYEGFGPGGALIIVECLTDNNVRTIADVRSYFAKAGAKLAASGSVVMSFDHLAVISFKDAGGDAEEKVMEALFAADVAVEDVQSKDGVITVFTPPAEFYKAKTAVLEAMPGVELDVQEITFLPQATKTLGAEELASFEKFLQTLDENDDVQEVYHNIVLP

Samples

Sample ID Description Type Environment
1 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
6 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
7 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
8 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
9 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
10 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
11 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
12 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
13 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
14 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
15 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
16 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
17 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
18 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
19 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
20 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
21 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
22 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
23 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
24 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
25 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
26 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
27 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
28 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
29 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
30 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
31 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
32 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
33 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
62 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
63 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
64 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
65 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
66 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
67 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
68 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
69 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
70 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
71 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
72 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
73 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
74 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
75 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
76 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
77 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
78 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
79 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
80 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
81 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
82 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
83 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
84 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
85 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
86 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
87 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
88 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
89 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
90 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
91 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
92 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
93 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
94 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
95 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
96 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
97 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
98 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
99 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
100 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
101 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
102 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
103 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
104 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
105 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
106 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
107 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
108 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
109 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
110 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
111 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
112 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
113 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
114 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
115 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
116 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
117 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
118 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
119 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
120 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
121 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
122 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
123 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
124 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
125 2671180531 Gemmata sp. SH-PL17 Isolate Unclassified
126 2687453257 Planctomyces sp. SH-PL62 Isolate Unclassified
127 2889415604 Paludisphaera rhizosphaerae JC665 Isolate Rhizosphere
128 2916178963 Pseudoalteromonas rhizosphaerae RA15 Isolate Rhizosphere
129 2920107658 Aquisphaera insulae JC669 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.02
Metatranscriptomes 0
Isolates 2.98

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.71
Nodule 0
Rhizoplane 0.6
Rhizosphere 79.17
Stem 0
Stem Tuber 0
Unclassified 2.38

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207649_10392697 3300025920 Bacteria 1036
2 Ga0070658_10668890 3300005327 Bacteria 901
3 Ga0070690_100000888 3300005330 Bacteria 15257
4 Ga0068869_100052106 3300005334 Bacteria 2970
5 Ga0068869_100053056 3300005334 Bacteria 2946
6 Ga0070689_100017587 3300005340 Bacteria 5254
7 Ga0070689_100045417 3300005340 Bacteria 3383
8 Ga0070688_100091526 3300005365 Bacteria 1988
9 Ga0070688_100433529 3300005365 Bacteria 979
10 Ga0070709_10141058 3300005434 Bacteria 1656
11 Ga0070681_10141327 3300005458 Bacteria 2337
12 Ga0070681_10180539 3300005458 Bacteria 2032
13 Ga0070698_100015826 3300005471 Bacteria 7966
14 Ga0070679_100015514 3300005530 Bacteria 7321
15 Ga0070695_100433122 3300005545 Bacteria 1004
16 Ga0070665_100008041 3300005548 Bacteria 10682
17 Ga0070704_100340892 3300005549 Bacteria 1262
18 Ga0068856_100084922 3300005614 Bacteria 3145
19 Ga0068859_100869951 3300005617 Bacteria 987
20 Ga0068864_100532357 3300005618 Bacteria 1134
21 Ga0068864_100589315 3300005618 Bacteria 1078
22 Ga0068863_100117202 3300005841 Bacteria 2538
23 Ga0068863_100405670 3300005841 Bacteria 1334
24 Ga0068860_100021743 3300005843 Bacteria 6208
25 Ga0068860_100022743 3300005843 Bacteria 6061
26 Ga0068862_100267924 3300005844 Bacteria 1561
27 Ga0070717_10049458 3300006028 Bacteria 3451
28 Ga0070717_10232179 3300006028 Bacteria 1624
29 Ga0075430_100099366 3300006846 Bacteria 2430
30 Ga0075429_100049073 3300006880 Bacteria 3671
31 Ga0097620_100870028 3300006931 Bacteria 987
32 Ga0105245_10000074 3300009098 Bacteria 103733
33 Ga0105243_10176735 3300009148 Bacteria 1853
34 Ga0105237_10034957 3300009545 Bacteria 5086
35 Ga0105237_10790562 3300009545 Bacteria 956
36 Ga0105249_10072739 3300009553 Bacteria 3179
37 Ga0105239_10171388 3300010375 Bacteria 2427
38 Ga0105239_10691671 3300010375 Bacteria 1166
39 Ga0157374_10141594 3300013296 Bacteria 2335
40 Ga0157378_10485601 3300013297 Bacteria 1232
41 Ga0157376_10005058 3300014969 Bacteria 9197
42 Ga0157376_10257092 3300014969 Bacteria 1634
43 Ga0213876_10106846 3300021384 Bacteria 1485
44 Ga0207682_10186667 3300025893 Bacteria 949
45 Ga0207642_10066138 3300025899 Bacteria 1701
46 Ga0207643_10272404 3300025908 Bacteria 1048
47 Ga0207705_10580035 3300025909 Bacteria 872
48 Ga0207671_10054703 3300025914 Bacteria 2956
49 Ga0207671_10466623 3300025914 Bacteria 1006
50 Ga0207660_10641980 3300025917 Bacteria 865
51 Ga0207662_10090275 3300025918 Bacteria 1883
52 Ga0207652_10084045 3300025921 Bacteria 2788
53 Ga0207681_10513500 3300025923 Bacteria 983
54 Ga0207687_10000195 3300025927 Bacteria 40937
55 Ga0207687_10137371 3300025927 Bacteria 1850
56 Ga0207644_10487661 3300025931 Bacteria 1016
57 Ga0207644_10555558 3300025931 Bacteria 951
58 Ga0207670_10010209 3300025936 Bacteria 5400
59 Ga0207689_10051754 3300025942 Bacteria 3385
60 Ga0207689_10174170 3300025942 Bacteria 1774
61 Ga0207679_10952387 3300025945 Bacteria 786
62 Ga0207712_10290943 3300025961 Unclassified 1337
63 Ga0207668_10321552 3300025972 Bacteria 1284
64 Ga0207658_10868172 3300025986 Bacteria 821
65 Ga0207677_10211357 3300026023 Unclassified 1550
66 Ga0207708_10201697 3300026075 Bacteria 1587
67 Ga0207702_10093199 3300026078 Bacteria 2641
68 Ga0207702_10494403 3300026078 Bacteria 1192
69 Ga0207641_10042841 3300026088 Bacteria 3799
70 Ga0207641_10170839 3300026088 Bacteria 1984
71 Ga0207648_10088837 3300026089 Bacteria 2698
72 Ga0207676_10364623 3300026095 Bacteria 1340
73 Ga0207676_10624397 3300026095 Bacteria 1037
74 Ga0207674_10332235 3300026116 Bacteria 1470
75 Ga0207674_10634294 3300026116 Bacteria 1032
76 Ga0207674_10791700 3300026116 Bacteria 915
77 Ga0207674_10878274 3300026116 Bacteria 864
78 Ga0207683_10007189 3300026121 Bacteria 9544
79 Ga0268266_10000673 3300028379 Bacteria 46152
80 Ga0268266_10002201 3300028379 Bacteria 21323
81 Ga0268266_10011936 3300028379 Bacteria 7521
82 Ga0268265_10339175 3300028380 Bacteria 1368
83 Ga0268264_10031319 3300028381 Bacteria 4362
84 Ga0268264_10446282 3300028381 Bacteria 1252
85 Ga0268264_10469307 3300028381 Bacteria 1222
86 Ga0307517_10059805 3300028786 Bacteria 3641
87 Ga0307515_10001075 3300028794 Bacteria 62570
88 Ga0265338_10036110 3300028800 Bacteria 4737
89 Ga0265338_10046472 3300028800 Bacteria 3978
90 Ga0265338_10129689 3300028800 Bacteria 1994
91 Ga0307511_10195021 3300030521 Bacteria 1063
92 Ga0265327_10000014 3300031251 Bacteria 506288
93 Ga0265316_10567626 3300031344 Bacteria 806
94 Ga0307513_10007635 3300031456 Bacteria 13976
95 Ga0307509_10009386 3300031507 Bacteria 12245
96 Ga0307509_10065581 3300031507 Bacteria 3812
97 Ga0307508_10303557 3300031616 Bacteria 1189
98 Ga0307508_10336216 3300031616 Bacteria 1102
99 Ga0307412_10506997 3300031911 Bacteria 1006
100 Ga0307416_100091242 3300032002 Bacteria 2616
101 Ga0307415_100475291 3300032126 Bacteria 1087
102 Ga0373949_0000650 3300035090 Bacteria 11341
103 Ga0373936_0000117 3300035113 Bacteria 28004
104 Ga0373956_0079057 3300035119 Bacteria 1507
105 Ga0373961_0000023 3300035241 Bacteria 98390
106 Ga0395899_0107273 3300037312 Bacteria 2010
107 Ga0395900_0213868 3300037418 Unclassified 1946
108 Ga0395900_0407496 3300037418 Bacteria 1322
109 Ga0395905_0063731 3300037471 Bacteria 3449
110 Ga0395905_0499882 3300037471 Bacteria 1116
111 Ga0395901_0052551 3300038443 Bacteria 4234
112 Ga0395901_0085840 3300038443 Bacteria 3291
113 Ga0436365_0088767 3300039437 Bacteria 1771
114 Ga0436365_1869100 3300039437 Bacteria 3146
115 Ga0436360_1118617 3300039438 Bacteria 1391
116 Ga0436361_0810535 3300039447 Bacteria 720
117 Ga0436363_1100626 3300039450 Bacteria 806
118 Ga0436363_1646193 3300039450 Bacteria 1507
119 Ga0436362_0480026 3300039453 Bacteria 869
120 Ga0453684_0107538 3300044712 Bacteria 3396
121 Ga0451576_0872944 3300045051 Archaea 944
122 Ga0495650_0010390 3300046471 Bacteria 5199
123 Ga0495599_0196285 3300046678 Bacteria 1241
124 Ga0496115_0016497 3300048918 Bacteria 5625
125 Ga0496126_0492189 3300048929 Bacteria 981
126 Ga0501031_0267412 3300049568 Bacteria 1111
127 Ga0501034_0001595 3300049571 Bacteria 29525
128 Ga0501047_0201491 3300049581 Bacteria 1851
129 Ga0501067_0256904 3300049583 Bacteria 973
130 Ga0501069_0011216 3300049585 Bacteria 4754
131 Ga0501070_0103364 3300049586 Bacteria 2356
132 Ga0501072_0669548 3300049588 Bacteria 816
133 Ga0501073_0376297 3300049589 Bacteria 981
134 Ga0501077_0100289 3300049593 Bacteria 1835
135 Ga0501227_000594 3300049665 Bacteria 7877
136 Ga0501227_024776 3300049665 Bacteria 1402
137 Ga0501230_028562 3300049667 Bacteria 1026
138 Ga0501080_0573537 3300049742 Bacteria 1004
139 Ga0501035_0333740 3300049822 Bacteria 1272
140 Ga0501044_0101057 3300049823 Bacteria 2902
141 Ga0501044_0127377 3300049823 Archaea 2542
142 Ga0501044_0781104 3300049823 Bacteria 835
143 nmdc:mga09592_31002_c1 3300050508 Bacteria 4453
144 nmdc:mga0qj67_293239_c1 3300050509 Bacteria 1318
145 Ga0495601_0167868 3300053077 Bacteria 1434
146 Ga0500646_0008282 3300053090 Bacteria 2660
147 Ga0500583_0062616 3300053092 Bacteria 1760
148 Ga0500566_0008091 3300053094 Bacteria 6222
149 Ga0500566_0021039 3300053094 Bacteria 3837
150 Ga0500640_066379 3300053095 Bacteria 1555
151 Ga0500654_104641 3300053099 Bacteria 1189
152 Ga0500554_010818 3300053102 Bacteria 2239
153 Ga0500554_033565 3300053102 Bacteria 1531
154 Ga0500572_008908 3300053111 Bacteria 2359
155 Ga0500595_002533 3300053119 Bacteria 8971
156 Ga0500614_008425 3300053123 Bacteria 2186
157 Ga0500559_0037504 3300053136 Bacteria 2101
158 Ga0500564_103740 3300053138 Bacteria 1254
159 Ga0500622_0019735 3300053156 Unclassified 3579
160 Ga0500636_0110116 3300053177 Bacteria 1557
161 Ga0500637_0097094 3300053178 Bacteria 1708
162 Ga0500596_022129 3300053735 Bacteria 960
163 Ga0500601_003546 3300053737 Bacteria 1692
164 2673163784 2671180531 Bacteria 9045424
165 2688068042 2687453257 Bacteria 6784659
166 2889418538 2889415604 Bacteria 8048700
167 2916179540 2916178963 Bacteria 5265078
168 2920109513 2920107658 Bacteria 10042636
169 Ga0207649_10392697
170 Ga0070658_10668890
171 Ga0070690_100000888
172 Ga0068869_100052106
173 Ga0068869_100053056
174 Ga0070689_100017587
175 Ga0070689_100045417
176 Ga0070688_100091526
177 Ga0070688_100433529
178 Ga0070709_10141058
179 Ga0070681_10141327
180 Ga0070681_10180539
181 Ga0070698_100015826
182 Ga0070679_100015514
183 Ga0070695_100433122
184 Ga0070665_100008041
185 Ga0070704_100340892
186 Ga0068856_100084922
187 Ga0068859_100869951
188 Ga0068864_100532357
189 Ga0068864_100589315
190 Ga0068863_100117202
191 Ga0068863_100405670
192 Ga0068860_100021743
193 Ga0068860_100022743
194 Ga0068862_100267924
195 Ga0070717_10049458
196 Ga0070717_10232179
197 Ga0075430_100099366
198 Ga0075429_100049073
199 Ga0097620_100870028
200 Ga0105245_10000074
201 Ga0105243_10176735
202 Ga0105237_10034957
203 Ga0105237_10790562
204 Ga0105249_10072739
205 Ga0105239_10171388
206 Ga0105239_10691671
207 Ga0157374_10141594
208 Ga0157378_10485601
209 Ga0157376_10005058
210 Ga0157376_10257092
211 Ga0213876_10106846
212 Ga0207682_10186667
213 Ga0207642_10066138
214 Ga0207643_10272404
215 Ga0207705_10580035
216 Ga0207671_10054703
217 Ga0207671_10466623
218 Ga0207660_10641980
219 Ga0207662_10090275
220 Ga0207652_10084045
221 Ga0207681_10513500
222 Ga0207687_10000195
223 Ga0207687_10137371
224 Ga0207644_10487661
225 Ga0207644_10555558
226 Ga0207670_10010209
227 Ga0207689_10051754
228 Ga0207689_10174170
229 Ga0207679_10952387
230 Ga0207712_10290943
231 Ga0207668_10321552
232 Ga0207658_10868172
233 Ga0207677_10211357
234 Ga0207708_10201697
235 Ga0207702_10093199
236 Ga0207702_10494403
237 Ga0207641_10042841
238 Ga0207641_10170839
239 Ga0207648_10088837
240 Ga0207676_10364623
241 Ga0207676_10624397
242 Ga0207674_10332235
243 Ga0207674_10634294
244 Ga0207674_10791700
245 Ga0207674_10878274
246 Ga0207683_10007189
247 Ga0268266_10000673
248 Ga0268266_10002201
249 Ga0268266_10011936
250 Ga0268265_10339175
251 Ga0268264_10031319
252 Ga0268264_10446282
253 Ga0268264_10469307
254 Ga0307517_10059805
255 Ga0307515_10001075
256 Ga0265338_10036110
257 Ga0265338_10046472
258 Ga0265338_10129689
259 Ga0307511_10195021
260 Ga0265327_10000014
261 Ga0265316_10567626
262 Ga0307513_10007635
263 Ga0307509_10009386
264 Ga0307509_10065581
265 Ga0307508_10303557
266 Ga0307508_10336216
267 Ga0307412_10506997
268 Ga0307416_100091242
269 Ga0307415_100475291
270 Ga0373949_0000650
271 Ga0373936_0000117
272 Ga0373956_0079057
273 Ga0373961_0000023
274 Ga0395899_0107273
275 Ga0395900_0213868
276 Ga0395900_0407496
277 Ga0395905_0063731
278 Ga0395905_0499882
279 Ga0395901_0052551
280 Ga0395901_0085840
281 Ga0436365_0088767
282 Ga0436365_1869100
283 Ga0436360_1118617
284 Ga0436361_0810535
285 Ga0436363_1100626
286 Ga0436363_1646193
287 Ga0436362_0480026
288 Ga0453684_0107538
289 Ga0451576_0872944
290 Ga0495650_0010390
291 Ga0495599_0196285
292 Ga0496115_0016497
293 Ga0496126_0492189
294 Ga0501031_0267412
295 Ga0501034_0001595
296 Ga0501047_0201491
297 Ga0501067_0256904
298 Ga0501069_0011216
299 Ga0501070_0103364
300 Ga0501072_0669548
301 Ga0501073_0376297
302 Ga0501077_0100289
303 Ga0501227_000594
304 Ga0501227_024776
305 Ga0501230_028562
306 Ga0501080_0573537
307 Ga0501035_0333740
308 Ga0501044_0101057
309 Ga0501044_0127377
310 Ga0501044_0781104
311 nmdc:mga09592_31002_c1
312 nmdc:mga0qj67_293239_c1
313 Ga0495601_0167868
314 Ga0500646_0008282
315 Ga0500583_0062616
316 Ga0500566_0008091
317 Ga0500566_0021039
318 Ga0500640_066379
319 Ga0500654_104641
320 Ga0500554_010818
321 Ga0500554_033565
322 Ga0500572_008908
323 Ga0500595_002533
324 Ga0500614_008425
325 Ga0500559_0037504
326 Ga0500564_103740
327 Ga0500622_0019735
328 Ga0500636_0110116
329 Ga0500637_0097094
330 Ga0500596_022129
331 Ga0500601_003546
332 2673163784
333 2688068042
334 2889418538
335 2916179540
336 2920109513

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF20772

TACO1_YebC_N

TACO1/YebC protein N-terminal domain

3

74

0.96

PF01709

Transcrip_reg

TACO1/YebC second and third domain

79

239

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
1vbk-assembly1.cif.gz_A crystal structure of ph1313 from pyrococcus horikoshii ot3 0.8259 135 182
1mw7-assembly1.cif.gz_A x-ray structure of y162_helpy northeast structural genomics consortium target pr6 0.8163 24 237
1vbk-assembly1.cif.gz_B crystal structure of ph1313 from pyrococcus horikoshii ot3 0.8155 135 182
1mw7-assembly1.cif.gz_A x-ray structure of y162_helpy northeast structural genomics consortium target pr6 0.7928 24 237
1lfp-assembly1.cif.gz_A crystal structure of a conserved hypothetical protein aq1575 from aquifex aeolicus 0.7899 20 239
ID Description Score Start End Superfamily
1lfpA02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;YebC, transcriptional regulation domain 0.9571 79 239 3.30.70.980
af_I1K9D8_53_128_1.10.10.200 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Integrase, N-terminal zinc-binding domain 0.9196 3 78 1.10.10.200
af_I1K9D8_53_128_1.10.10.200 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Integrase, N-terminal zinc-binding domain 0.9085 3 78 1.10.10.200
af_P9WGA5_1_79_1.10.10.200 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Integrase, N-terminal zinc-binding domain 0.9056 16 76 1.10.10.200
1mw7A01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Integrase, N-terminal zinc-binding domain 0.9047 25 74 1.10.10.200
ID Description Score Start End GO Terms
AF-A0A0F9KTL2-F1-model_v4 TACO1/YebC-like second and third domain-containing protein 0.9797 73 237 GO:0005829
AF-A0A3D4ANL8-F1-model_v4 YebC/PmpR family DNA-binding transcriptional regulator 0.9633 20 237 GO:0003677
GO:0005829
AF-A0A7X6TPP7-F1-model_v4 YebC/PmpR family DNA-binding transcriptional regulator 0.9542 1 211 GO:0003677
GO:0005829
AF-A0A3D5EE68-F1-model_v4 YebC/PmpR family DNA-binding transcriptional regulator 0.9487 33 237 GO:0003677
GO:0005829
AF-A0A2N1Q643-F1-model_v4 YebC/PmpR family DNA-binding transcriptional regulator 0.9439 90 238 GO:0003677
GO:0005829

Map