F246953

General Info

Members Datasets Scaffolds Average Seq Length
165 127 154 146

Family's Representative Sequence

Representative Sequence 3300046694|Ga0495649_0000418|Ga0495649_0000418_31950_32450
Length 166
Sequence MAGHDERFMRMALDLAQAAADAGEVPVGAVIVDESTGEVVSTGENGPVAAHDPTAHAEIVALRRAGAALQNYRLTGLTLYVTLEPCAMCAGAISHARIGRVVWAADDPKGGAVIHGPKIFDQPTCHWRPVAEAGPNAEEAGEMLRGFFRKRRGGTARKDGALADQA

Samples

Sample ID Description Type Environment
1 2595698237 Methylobacterium sp. UNCCL125 Isolate Unclassified
2 2842775625 Roseomonas sp. R-71825 Isolate Unclassified
3 2902330777 Methylobacterium sp. 2A Isolate Unclassified
4 2902405164 Methylobacterium sp. P1-11 Isolate Unclassified
5 2928027323 Sphingomonas sp. 1185 Isolate Unclassified
6 2928125067 Methylobacterium sp. 1973 Isolate Unclassified
7 2977240413 Brevundimonas vesicularis SORGH_AS 431 Isolate Unclassified
8 2984555340 Sphingomonas sp. SORGH_AS789 Isolate Aerial Root
9 2984564862 Sphingomonas sp. SORGH_AS870 Isolate Aerial Root
10 2993356040 Sphingomonas sp. SORGH_AS742 Isolate Aerial Root
11 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
16 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
17 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
18 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
19 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
20 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
21 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
22 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
23 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
24 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
25 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
26 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
27 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
28 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
29 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
30 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
31 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
32 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
33 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
34 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
35 3300009988 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_233 metaG Metagenome Rhizosphere
36 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
37 3300013875 Rhizosphere microbial communities from switchgrass unharvested rhizosphere in Austin, TX, USA - RS_233 Metagenome Rhizosphere
38 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
39 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
40 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
41 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
42 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
43 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
44 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
45 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
52 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
53 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
54 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
55 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
59 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
60 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
61 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
62 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
63 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
64 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
65 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
66 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
67 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
68 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
69 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
70 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
71 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
72 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
73 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
74 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
75 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
76 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
77 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
78 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
79 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
80 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
81 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
82 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
83 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
84 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
85 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
86 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
87 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
88 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
89 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
90 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
91 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
92 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
93 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
94 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
95 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
96 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
97 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
98 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
99 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
100 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
101 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
102 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
103 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
104 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
105 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
106 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
107 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
108 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
109 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
110 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
111 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
112 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
113 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
114 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
115 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
116 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
117 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
118 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
119 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
120 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
121 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
122 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
123 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
124 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
125 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
126 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
127 8057101203 Sphingomonas lycopersici MMSM20 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.12
Metatranscriptomes 1.21
Isolates 6.67

Biome Distribution

Category Percentage (%)
Aerial Root 1.82
Bulb 0
Endosphere 21.82
Nodule 0
Rhizoplane 7.27
Rhizosphere 60
Stem 0
Stem Tuber 0
Unclassified 9.09

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0006562J51391_1023065 3300003578 Bacteria 7257
2 Ga0006562J51391_1023067 3300003578 Bacteria 5790
3 Ga0070675_101449295 3300005354 Bacteria 633
4 Ga0070673_100951779 3300005364 Bacteria 798
5 Ga0070659_100763495 3300005366 Bacteria 839
6 Ga0070707_101318706 3300005468 Bacteria 688
7 Ga0070697_100245477 3300005536 Bacteria 1530
8 Ga0070665_100795397 3300005548 Bacteria 959
9 Ga0068858_100716891 3300005842 Bacteria 974
10 Ga0068860_101158601 3300005843 Bacteria 793
11 Ga0081455_10000538 3300005937 Bacteria 49235
12 Ga0081455_10606145 3300005937 Bacteria 713
13 Ga0081539_10002053 3300005985 Bacteria 30227
14 Ga0081539_10016794 3300005985 Bacteria 5195
15 Ga0081539_10092425 3300005985 Bacteria 1560
16 Ga0075365_10022494 3300006038 Bacteria 3951
17 Ga0075365_10227961 3300006038 Bacteria 1307
18 Ga0075365_10309663 3300006038 Bacteria 1112
19 Ga0075365_10314124 3300006038 Bacteria 1103
20 Ga0075368_10094407 3300006042 Bacteria 1225
21 Ga0075363_100105200 3300006048 Bacteria 1565
22 Ga0075363_100838146 3300006048 Bacteria 561
23 Ga0070716_100322422 3300006173 Bacteria 1083
24 Ga0075362_10051218 3300006177 Bacteria 1847
25 Ga0075362_10140838 3300006177 Bacteria 1152
26 Ga0075362_10201129 3300006177 Bacteria 970
27 Ga0075367_10153072 3300006178 Bacteria 1432
28 Ga0075366_10199521 3300006195 Bacteria 1217
29 Ga0075366_10222499 3300006195 Bacteria 1150
30 Ga0097621_102387426 3300006237 Bacteria 506
31 Ga0075370_10136414 3300006353 Bacteria 1433
32 Ga0075370_10488815 3300006353 Bacteria 742
33 Ga0099794_10125656 3300007265 Bacteria 1293
34 Ga0114129_11825328 3300009147 Bacteria 739
35 Ga0105243_10625660 3300009148 Bacteria 1040
36 Ga0105248_10478558 3300009177 Bacteria 1403
37 Ga0105248_13196386 3300009177 Bacteria 521
38 Ga0105035_101708 3300009988 Bacteria 1552
39 Ga0105035_102214 3300009988 Bacteria 1417
40 Ga0157375_11014042 3300013308 Bacteria 969
41 Ga0157515_102026 3300013875 Bacteria 602
42 Ga0163163_10994508 3300014325 Bacteria 902
43 Ga0163163_11068915 3300014325 Bacteria 870
44 Ga0157380_12472802 3300014326 Bacteria 585
45 Ga0182008_10774618 3300014497 Bacteria 555
46 Ga0157379_10336817 3300014968 Bacteria 1379
47 Ga0213872_10017279 3300021361 Bacteria 3336
48 Ga0213872_10069677 3300021361 Bacteria 1586
49 Ga0213876_10003111 3300021384 Bacteria 9596
50 Ga0213871_10007406 3300021441 Bacteria 2372
51 Ga0207652_10391164 3300025921 Bacteria 1255
52 Ga0207681_11532676 3300025923 Bacteria 559
53 Ga0207644_11145521 3300025931 Bacteria 654
54 Ga0207670_10720416 3300025936 Bacteria 827
55 Ga0207669_10511441 3300025937 Bacteria 963
56 Ga0207711_10632593 3300025941 Bacteria 998
57 Ga0209983_1013989 3300027665 Bacteria 1652
58 Ga0209813_10039980 3300027866 Bacteria 1423
59 Ga0209813_10058258 3300027866 Bacteria 1227
60 Ga0209974_10035579 3300027876 Bacteria 1654
61 Ga0207428_10893854 3300027907 Bacteria 628
62 Ga0268266_10709255 3300028379 Bacteria 970
63 Ga0268265_11185364 3300028380 Bacteria 761
64 Ga0268264_10417810 3300028381 Bacteria 1293
65 Ga0265325_10038856 3300031241 Bacteria 2509
66 Ga0265340_10064320 3300031247 Bacteria 1749
67 Ga0265340_10199732 3300031247 Bacteria 899
68 Ga0265327_10016790 3300031251 Bacteria 4627
69 Ga0265316_10041852 3300031344 Bacteria 3664
70 Ga0265313_10008663 3300031595 Bacteria 6726
71 Ga0265313_10228931 3300031595 Bacteria 764
72 Ga0316575_10117958 3300031665 Bacteria 1085
73 Ga0265314_10152461 3300031711 Bacteria 1415
74 Ga0265342_10100263 3300031712 Bacteria 1651
75 Ga0307413_10512782 3300031824 Bacteria 965
76 Ga0307414_10125009 3300032004 Bacteria 1985
77 Ga0307415_100512781 3300032126 Bacteria 1051
78 Ga0373936_0470601 3300035113 Bacteria 582
79 Ga0373941_0038116 3300035115 Bacteria 1470
80 Ga0373941_0311349 3300035115 Bacteria 631
81 Ga0373943_0760182 3300035170 Bacteria 576
82 Ga0316574_0073379 3300035398 Bacteria 2164
83 Ga0373931_0771515 3300035691 Bacteria 639
84 Ga0373927_0073177 3300035695 Bacteria 2219
85 Ga0395899_0038497 3300037312 Bacteria 3582
86 Ga0395900_0048493 3300037418 Bacteria 4375
87 Ga0395900_0760760 3300037418 Bacteria 899
88 Ga0395898_0236732 3300037466 Bacteria 1741
89 Ga0436364_0037169 3300037853 Bacteria 3416
90 Ga0395901_0210391 3300038443 Bacteria 2036
91 Ga0436365_0990465 3300039437 Bacteria 14414
92 Ga0436360_0649825 3300039438 Bacteria 728
93 Ga0436360_0650722 3300039438 Bacteria 574
94 Ga0436360_1052595 3300039438 Bacteria 3124
95 Ga0436361_0225546 3300039447 Bacteria 7518
96 Ga0436361_0262327 3300039447 Bacteria 1564
97 Ga0439458_0022720 3300042157 Bacteria 1459
98 Ga0439459_0004464 3300042438 Bacteria 2251
99 Ga0451577_0048928 3300042876 Bacteria 3775
100 Ga0453683_0066060 3300044673 Bacteria 2261
101 Ga0453684_0099256 3300044712 Bacteria 3567
102 Ga0453684_0817351 3300044712 Bacteria 1004
103 Ga0466970_0502753 3300044765 Bacteria 698
104 Ga0451576_1444810 3300045051 Bacteria 715
105 Ga0495586_0336556 3300046535 Bacteria 866
106 Ga0495633_0000510 3300046558 Bacteria 39075
107 Ga0495649_0000418 3300046694 Bacteria 36933
108 Ga0496100_0215453 3300048903 Bacteria 1407
109 Ga0496104_0007119 3300048907 Bacteria 9862
110 Ga0496104_0389125 3300048907 Bacteria 1307
111 Ga0496105_0072555 3300048908 Bacteria 2845
112 Ga0496106_0013086 3300048909 Bacteria 6124
113 Ga0496107_0672650 3300048910 Bacteria 762
114 Ga0496108_0914751 3300048911 Bacteria 752
115 Ga0496109_0074204 3300048912 Bacteria 3127
116 Ga0496110_0134579 3300048913 Bacteria 2233
117 Ga0496111_0136220 3300048914 Bacteria 1819
118 Ga0496111_0168482 3300048914 Bacteria 1627
119 Ga0496115_0469380 3300048918 Bacteria 1014
120 Ga0496121_0000123 3300048924 Bacteria 172448
121 Ga0496122_0023946 3300048925 Bacteria 5360
122 Ga0496123_0000699 3300048926 Bacteria 55169
123 Ga0501033_0199161 3300049570 Bacteria 1431
124 Ga0501034_0353185 3300049571 Bacteria 1398
125 Ga0501037_0111630 3300049573 Bacteria 1969
126 Ga0501041_0661941 3300049577 Bacteria 668
127 Ga0501073_0193640 3300049589 Bacteria 1407
128 Ga0501073_0984471 3300049589 Bacteria 580
129 Ga0501073_1208759 3300049589 Bacteria 519
130 Ga0501076_0997236 3300049592 Bacteria 690
131 nmdc:mga03683_29465_c2 3300050489 Bacteria 1604
132 nmdc:mga03683_38907_c1 3300050489 Bacteria 1945
133 nmdc:mga03683_51993_c2 3300050489 Bacteria 1396
134 nmdc:mga03n38_371302_c1 3300050490 Bacteria 782
135 nmdc:mga0yw44_127691_c1 3300050492 Bacteria 1643
136 nmdc:mga0yw44_31619_c1 3300050492 Bacteria 3079
137 nmdc:mga0yw44_483820_c1 3300050492 Bacteria 840
138 nmdc:mga0yw44_633587_c1 3300050492 Bacteria 727
139 nmdc:mga0yw44_90970_c1 3300050492 Bacteria 1928
140 nmdc:mga06z11_468504_c1 3300050494 Bacteria 762
141 nmdc:mga04h51_69672_c1 3300050495 Bacteria 1225
142 nmdc:mga07m45_158087_c1 3300050496 Bacteria 1315
143 nmdc:mga08y16_157337_c1 3300050511 Bacteria 2361
144 nmdc:mga08y16_930911_c1 3300050511 Bacteria 853
145 nmdc:mga0sz30_732_c1 3300050516 Bacteria 11989
146 Ga0495601_0647485 3300053077 Bacteria 676
147 Ga0500610_0452095 3300053079 Bacteria 503
148 Ga0500651_0010462 3300053093 Bacteria 5561
149 Ga0500651_0061064 3300053093 Bacteria 2355
150 Ga0500641_0001314 3300053096 Bacteria 8825
151 Ga0500573_0060345 3300053140 Bacteria 2172
152 Ga0500573_0162264 3300053140 Bacteria 1216
153 Ga0501082_0395551 3300060353 Bacteria 1206
154 Ga0530510_0693393 3300061734 Bacteria 776

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300061734 Ga0530510_0693393 Ga0530510_0693393_376_744 122
2 3300006038 Ga0075365_10022494 Ga0075365_100224946 127
3 3300006195 Ga0075366_10222499 Ga0075366_102224992 127
4 3300005937 Ga0081455_10000538 Ga0081455_100005387 128
5 3300013308 Ga0157375_11014042 Ga0157375_110140422 129
6 3300037418 Ga0395900_0760760 Ga0395900_0760760_500_889 129
7 3300044673 Ga0453683_0066060 Ga0453683_0066060_1149_1583 134
8 3300005536 Ga0070697_100245477 Ga0070697_1002454773 135
9 3300031247 Ga0265340_10199732 Ga0265340_101997322 137
10 3300031711 Ga0265314_10152461 Ga0265314_101524612 137
11 3300021441 Ga0213871_10007406 Ga0213871_100074062 139
12 3300039438 Ga0436360_1052595 Ga0436360_1052595_1965_2423 139
13 3300044712 Ga0453684_0817351 Ga0453684_0817351_145_585 139
14 3300045051 Ga0451576_1444810 Ga0451576_1444810_53_520 139
15 3300021361 Ga0213872_10069677 Ga0213872_100696772 140
16 3300039447 Ga0436361_0262327 Ga0436361_0262327_454_912 140
17 3300042876 Ga0451577_0048928 Ga0451577_0048928_1867_2304 141
18 3300044712 Ga0453684_0099256 Ga0453684_0099256_259_696 141
19 3300005937 Ga0081455_10606145 Ga0081455_106061451 142
20 3300006173 Ga0070716_100322422 Ga0070716_1003224221 142
21 3300009177 Ga0105248_13196386 Ga0105248_131963861 142
22 3300021361 Ga0213872_10017279 Ga0213872_100172792 142
23 3300031595 Ga0265313_10008663 Ga0265313_100086635 142
24 3300037312 Ga0395899_0038497 Ga0395899_0038497_772_1260 142
25 3300037853 Ga0436364_0037169 Ga0436364_0037169_235_663 142
26 3300039447 Ga0436361_0225546 Ga0436361_0225546_4436_4876 142
27 3300048924 Ga0496121_0000123 Ga0496121_0000123_92145_92594 142
28 3300053077 Ga0495601_0647485 Ga0495601_0647485_216_644 142
29 iso_pu_bacteria 2842775625 2842779715 142
30 iso_pu_bacteria 2928027323 2928030800 142
31 iso_pu_bacteria 2984555340 2984556337 142
32 iso_pu_bacteria 2984564862 2984565474 142
33 iso_pu_bacteria 2993356040 2993356566 142
34 iso_pu_bacteria 8057101203 8057101555 142
35 3300005354 Ga0070675_101449295 Ga0070675_1014492951 143
36 3300005364 Ga0070673_100951779 Ga0070673_1009517792 143
37 3300005366 Ga0070659_100763495 Ga0070659_1007634951 143
38 3300005468 Ga0070707_101318706 Ga0070707_1013187061 143
39 3300005548 Ga0070665_100795397 Ga0070665_1007953972 143
40 3300005842 Ga0068858_100716891 Ga0068858_1007168912 143
41 3300005843 Ga0068860_101158601 Ga0068860_1011586012 143
42 3300005985 Ga0081539_10002053 Ga0081539_1000205323 143
43 3300005985 Ga0081539_10016794 Ga0081539_100167943 143
44 3300005985 Ga0081539_10092425 Ga0081539_100924252 143
45 3300006038 Ga0075365_10227961 Ga0075365_102279612 143
46 3300006038 Ga0075365_10309663 Ga0075365_103096631 143
47 3300006038 Ga0075365_10314124 Ga0075365_103141242 143
48 3300006042 Ga0075368_10094407 Ga0075368_100944072 143
49 3300006048 Ga0075363_100105200 Ga0075363_1001052003 143
50 3300006048 Ga0075363_100838146 Ga0075363_1008381462 143
51 3300006177 Ga0075362_10051218 Ga0075362_100512182 143
52 3300006177 Ga0075362_10140838 Ga0075362_101408382 143
53 3300006177 Ga0075362_10201129 Ga0075362_102011292 143
54 3300006178 Ga0075367_10153072 Ga0075367_101530722 143
55 3300006195 Ga0075366_10199521 Ga0075366_101995212 143
56 3300006237 Ga0097621_102387426 Ga0097621_1023874261 143
57 3300006353 Ga0075370_10136414 Ga0075370_101364142 143
58 3300007265 Ga0099794_10125656 Ga0099794_101256562 143
59 3300009147 Ga0114129_11825328 Ga0114129_118253282 143
60 3300009148 Ga0105243_10625660 Ga0105243_106256602 143
61 3300009177 Ga0105248_10478558 Ga0105248_104785582 143
62 3300009988 Ga0105035_101708 Ga0105035_1017082 143
63 3300009988 Ga0105035_102214 Ga0105035_1022142 143
64 3300013875 Ga0157515_102026 Ga0157515_1020261 143
65 3300014325 Ga0163163_10994508 Ga0163163_109945081 143
66 3300014325 Ga0163163_11068915 Ga0163163_110689151 143
67 3300014326 Ga0157380_12472802 Ga0157380_124728021 143
68 3300014968 Ga0157379_10336817 Ga0157379_103368172 143
69 3300021384 Ga0213876_10003111 Ga0213876_1000311110 143
70 3300025921 Ga0207652_10391164 Ga0207652_103911642 143
71 3300025923 Ga0207681_11532676 Ga0207681_115326761 143
72 3300025931 Ga0207644_11145521 Ga0207644_111455212 143
73 3300025936 Ga0207670_10720416 Ga0207670_107204162 143
74 3300025937 Ga0207669_10511441 Ga0207669_105114412 143
75 3300025941 Ga0207711_10632593 Ga0207711_106325932 143
76 3300027866 Ga0209813_10039980 Ga0209813_100399802 143
77 3300027866 Ga0209813_10058258 Ga0209813_100582582 143
78 3300027907 Ga0207428_10893854 Ga0207428_108938542 143
79 3300028379 Ga0268266_10709255 Ga0268266_107092552 143
80 3300028380 Ga0268265_11185364 Ga0268265_111853641 143
81 3300028381 Ga0268264_10417810 Ga0268264_104178101 143
82 3300031241 Ga0265325_10038856 Ga0265325_100388562 143
83 3300031247 Ga0265340_10064320 Ga0265340_100643202 143
84 3300031344 Ga0265316_10041852 Ga0265316_100418524 143
85 3300031712 Ga0265342_10100263 Ga0265342_101002632 143
86 3300032126 Ga0307415_100512781 Ga0307415_1005127812 143
87 3300035113 Ga0373936_0470601 Ga0373936_0470601_45_476 143
88 3300035115 Ga0373941_0038116 Ga0373941_0038116_469_900 143
89 3300035115 Ga0373941_0311349 Ga0373941_0311349_77_508 143
90 3300035170 Ga0373943_0760182 Ga0373943_0760182_126_557 143
91 3300035691 Ga0373931_0771515 Ga0373931_0771515_73_504 143
92 3300035695 Ga0373927_0073177 Ga0373927_0073177_631_1062 143
93 3300039437 Ga0436365_0990465 Ga0436365_0990465_9086_9532 143
94 3300039438 Ga0436360_0649825 Ga0436360_0649825_22_453 143
95 3300039438 Ga0436360_0650722 Ga0436360_0650722_117_548 143
96 3300042157 Ga0439458_0022720 Ga0439458_0022720_263_694 143
97 3300042438 Ga0439459_0004464 Ga0439459_0004464_18_449 143
98 3300044765 Ga0466970_0502753 Ga0466970_0502753_103_591 143
99 3300046535 Ga0495586_0336556 Ga0495586_0336556_417_848 143
100 3300048903 Ga0496100_0215453 Ga0496100_0215453_647_1078 143
101 3300048907 Ga0496104_0007119 Ga0496104_0007119_8691_9122 143
102 3300048908 Ga0496105_0072555 Ga0496105_0072555_1663_2094 143
103 3300048909 Ga0496106_0013086 Ga0496106_0013086_5064_5495 143
104 3300048910 Ga0496107_0672650 Ga0496107_0672650_205_636 143
105 3300048911 Ga0496108_0914751 Ga0496108_0914751_45_476 143
106 3300048912 Ga0496109_0074204 Ga0496109_0074204_1523_1954 143
107 3300048913 Ga0496110_0134579 Ga0496110_0134579_1048_1479 143
108 3300048914 Ga0496111_0168482 Ga0496111_0168482_535_966 143
109 3300048918 Ga0496115_0469380 Ga0496115_0469380_321_752 143
110 3300049571 Ga0501034_0353185 Ga0501034_0353185_149_580 143
111 3300049577 Ga0501041_0661941 Ga0501041_0661941_30_461 143
112 3300049589 Ga0501073_0193640 Ga0501073_0193640_539_970 143
113 3300049589 Ga0501073_1208759 Ga0501073_1208759_29_460 143
114 3300049592 Ga0501076_0997236 Ga0501076_0997236_43_501 143
115 3300050489 nmdc:mga03683_29465_c2 nmdc:mga03683_29465_c2_297_728 143
116 3300050489 nmdc:mga03683_38907_c1 nmdc:mga03683_38907_c1_946_1377 143
117 3300050489 nmdc:mga03683_51993_c2 nmdc:mga03683_51993_c2_675_1106 143
118 3300050490 nmdc:mga03n38_371302_c1 nmdc:mga03n38_371302_c1_281_712 143
119 3300050492 nmdc:mga0yw44_127691_c1 nmdc:mga0yw44_127691_c1_1068_1499 143
120 3300050492 nmdc:mga0yw44_31619_c1 nmdc:mga0yw44_31619_c1_2434_2865 143
121 3300050492 nmdc:mga0yw44_483820_c1 nmdc:mga0yw44_483820_c1_222_653 143
122 3300050492 nmdc:mga0yw44_633587_c1 nmdc:mga0yw44_633587_c1_101_532 143
123 3300050492 nmdc:mga0yw44_90970_c1 nmdc:mga0yw44_90970_c1_1223_1654 143
124 3300050494 nmdc:mga06z11_468504_c1 nmdc:mga06z11_468504_c1_277_708 143
125 3300050495 nmdc:mga04h51_69672_c1 nmdc:mga04h51_69672_c1_240_671 143
126 3300050511 nmdc:mga08y16_157337_c1 nmdc:mga08y16_157337_c1_664_1095 143
127 3300050511 nmdc:mga08y16_930911_c1 nmdc:mga08y16_930911_c1_101_532 143
128 3300050516 nmdc:mga0sz30_732_c1 nmdc:mga0sz30_732_c1_3416_3847 143
129 3300053079 Ga0500610_0452095 Ga0500610_0452095_18_449 143
130 3300053093 Ga0500651_0061064 Ga0500651_0061064_847_1278 143
131 3300053096 Ga0500641_0001314 Ga0500641_0001314_607_1038 143
132 iso_pu_bacteria 2595698237 2596372298 143
133 iso_pu_bacteria 2902330777 2902336731 143
134 iso_pu_bacteria 2902405164 2902406157 143
135 iso_pu_bacteria 2928125067 2928126843 143
136 3300031251 Ga0265327_10016790 Ga0265327_100167905 144
137 3300031665 Ga0316575_10117958 Ga0316575_101179581 144
138 3300035398 Ga0316574_0073379 Ga0316574_0073379_680_1114 144
139 3300048907 Ga0496104_0389125 Ga0496104_0389125_23_457 144
140 3300014497 Ga0182008_10774618 Ga0182008_107746181 145
141 3300027665 Ga0209983_1013989 Ga0209983_10139892 145
142 3300027876 Ga0209974_10035579 Ga0209974_100355792 145
143 3300037418 Ga0395900_0048493 Ga0395900_0048493_2163_2600 145
144 3300037466 Ga0395898_0236732 Ga0395898_0236732_1055_1492 145
145 3300038443 Ga0395901_0210391 Ga0395901_0210391_1287_1724 145
146 3300049570 Ga0501033_0199161 Ga0501033_0199161_102_539 145
147 3300049573 Ga0501037_0111630 Ga0501037_0111630_461_913 145
148 3300060353 Ga0501082_0395551 Ga0501082_0395551_132_569 145
149 3300031595 Ga0265313_10228931 Ga0265313_102289312 148
150 iso_pu_bacteria 2977240413 2977242254 148
151 3300006353 Ga0075370_10488815 Ga0075370_104888151 149
152 3300050496 nmdc:mga07m45_158087_c1 nmdc:mga07m45_158087_c1_631_1095 149
153 3300049589 Ga0501073_0984471 Ga0501073_0984471_46_498 150
154 3300003578 Ga0006562J51391_1023065 Ga0006562J51391_10230656 152
155 3300003578 Ga0006562J51391_1023067 Ga0006562J51391_10230673 152
156 3300031824 Ga0307413_10512782 Ga0307413_105127822 152
157 3300032004 Ga0307414_10125009 Ga0307414_101250092 152
158 3300046558 Ga0495633_0000510 Ga0495633_0000510_3540_4022 152
159 3300046694 Ga0495649_0000418 Ga0495649_0000418_31950_32450 152
160 3300048914 Ga0496111_0136220 Ga0496111_0136220_646_1128 152
161 3300048925 Ga0496122_0023946 Ga0496122_0023946_4192_4674 152
162 3300048926 Ga0496123_0000699 Ga0496123_0000699_35852_36334 152
163 3300053093 Ga0500651_0010462 Ga0500651_0010462_2264_2749 152
164 3300053140 Ga0500573_0060345 Ga0500573_0060345_366_851 152
165 3300053140 Ga0500573_0162264 Ga0500573_0162264_543_1028 152

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00383

dCMP_cyt_deam_1

Cytidine and deoxycytidylate deaminase zinc-binding region

2

105

0.97

PF14437

MafB19-deam

MafB19-like deaminase

3

152

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
4rap-assembly1.cif.gz_D crystal structure of bacterial iron-containing dodecameric glycosyltransferase tibc from enterotoxigenic e.coli h10407 0.9973 19 34
4rap-assembly1.cif.gz_F crystal structure of bacterial iron-containing dodecameric glycosyltransferase tibc from enterotoxigenic e.coli h10407 0.9929 19 34
2a8n-assembly1.cif.gz_B biochemical and structural studies of a-to-i editing by trna:a34 deaminases at the wobble position of transfer rna 0.9907 1 136
2a8n-assembly1.cif.gz_A biochemical and structural studies of a-to-i editing by trna:a34 deaminases at the wobble position of transfer rna 0.9877 1 126
3ocq-assembly1.cif.gz_A-2 crystal structure of trna-specific adenosine deaminase from salmonella enterica 0.9852 1 141
ID Description Score Start End Superfamily
af_A0A1D6PV52_1_75_3.40.140.10 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.9885 38 97 3.40.140.10
2a8nA00 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.9877 1 126 3.40.140.10
2b3jA00 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.9795 2 145 3.40.140.10
1wwrD00 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.9703 2 145 3.40.140.10
2nx8A00 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.9695 2 146 3.40.140.10
ID Description Score Start End GO Terms
AF-A0A258H141-F1-model_v4 tRNA-specific adenosine deaminase (EC 3.5.4.33) 1.003 1 143 GO:0002100
GO:0008270
GO:0052717
AF-A0A328AZQ7-F1-model_v4 tRNA-specific adenosine deaminase (EC 3.5.4.33) 1.001 1 145 GO:0002100
GO:0008270
GO:0052717
AF-A0A258FUQ1-F1-model_v4 tRNA-specific adenosine deaminase (EC 3.5.4.33) 1.001 1 122 GO:0002100
GO:0008270
GO:0052717
AF-A0A0F7KUI0-F1-model_v4 tRNA-specific adenosine deaminase (EC 3.5.4.33) 0.9999 1 143 GO:0002100
GO:0008270
GO:0052717
AF-A0A1H3EKR9-F1-model_v4 tRNA-specific adenosine deaminase (EC 3.5.4.33) 0.999 1 144 GO:0002100
GO:0008270
GO:0052717

Feature Viewer

pLDDT pTM Quality
94.83 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map