F243767

General Info

Members Datasets Scaffolds Average Seq Length
164 125 163 115

Family's Representative Sequence

Representative Sequence 3300009094|Ga0111539_10017152|Ga0111539_100171528
Length 131
Sequence MSMKEAAAVTRDAGRGSRLMADKIKIVAAALLVVAGVAGFYCLGERAMIIRVAAVLLGFAAAAGVFATSQPGKEFYDYSQESIAETKKVVWPTRKETLQTTGIVFAFVVIMALFLWMVDASLLWVVKKLLG

Samples

Sample ID Description Type Environment
1 2574179768 Azoarcus communis DSM 12120 Isolate Unclassified
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
6 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
7 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
8 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
9 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
10 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
11 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
12 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
13 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
14 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
15 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
16 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
17 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
18 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
19 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
20 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
21 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
22 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
23 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
24 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
25 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
26 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
27 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
28 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
29 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
30 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
31 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
32 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
33 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
34 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
35 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
36 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
37 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
40 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
41 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
42 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
43 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
44 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
45 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
46 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
54 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
55 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
56 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
57 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
58 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
59 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
60 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
61 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
62 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
63 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
64 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
65 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
66 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
67 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
68 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
69 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
70 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
71 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
72 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
73 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
74 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
75 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
76 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
77 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
78 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
79 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
80 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
81 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
82 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
83 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
84 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
85 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
86 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
87 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
88 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
89 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
90 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
91 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
92 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
93 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
94 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
95 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
96 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
97 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
98 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
99 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
100 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
101 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
102 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
103 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
104 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
105 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
106 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
107 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
108 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
109 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
110 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
111 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
112 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
113 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
114 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
115 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
116 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
117 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
118 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
119 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
120 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
121 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
122 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
123 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
124 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
125 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.39
Metatranscriptomes 0
Isolates 0.61

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.63
Nodule 0
Rhizoplane 1.83
Rhizosphere 82.93
Stem 0
Stem Tuber 0
Unclassified 0.61

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065707_10446958 3300005295 Bacteria 804
2 Ga0070670_101723198 3300005331 Bacteria 577
3 Ga0070680_101671657 3300005336 Bacteria 552
4 Ga0070687_100143392 3300005343 Bacteria 1394
5 Ga0070692_10237150 3300005345 Bacteria 1085
6 Ga0070671_101708700 3300005355 Bacteria 559
7 Ga0070673_102054750 3300005364 Bacteria 542
8 Ga0070700_100150485 3300005441 Bacteria 1591
9 Ga0070694_100548414 3300005444 Bacteria 925
10 Ga0070662_100097782 3300005457 Bacteria 2216
11 Ga0068867_100080004 3300005459 Bacteria 2460
12 Ga0068867_100172817 3300005459 Bacteria 1712
13 Ga0070698_100878921 3300005471 Bacteria 842
14 Ga0070697_100489463 3300005536 Bacteria 1075
15 Ga0070686_100373159 3300005544 Bacteria 1078
16 Ga0070695_100150308 3300005545 Bacteria 1625
17 Ga0070695_101552929 3300005545 Bacteria 552
18 Ga0070696_100045244 3300005546 Bacteria 3049
19 Ga0070696_100528060 3300005546 Bacteria 943
20 Ga0070693_100886583 3300005547 Bacteria 668
21 Ga0070693_101014330 3300005547 Bacteria 629
22 Ga0068859_100572085 3300005617 Bacteria 1224
23 Ga0068866_10076731 3300005718 Bacteria 1783
24 Ga0068862_101860005 3300005844 Bacteria 612
25 Ga0075365_10564055 3300006038 Bacteria 805
26 Ga0075368_10000628 3300006042 Bacteria 10684
27 Ga0075363_100006560 3300006048 Bacteria 5300
28 Ga0075364_10264042 3300006051 Bacteria 1170
29 Ga0075362_10004474 3300006177 Bacteria 5031
30 Ga0075367_11093437 3300006178 Bacteria 510
31 Ga0075369_10002613 3300006186 Bacteria 6450
32 Ga0075366_10050420 3300006195 Bacteria 2471
33 Ga0075370_10029634 3300006353 Bacteria 3049
34 Ga0075428_100009067 3300006844 Bacteria 11040
35 Ga0075428_100147640 3300006844 Bacteria 2556
36 Ga0075434_100170182 3300006871 Bacteria 2198
37 Ga0075429_100028830 3300006880 Bacteria 4821
38 Ga0075429_100897552 3300006880 Bacteria 776
39 Ga0075429_101725607 3300006880 Bacteria 544
40 Ga0075436_100543375 3300006914 Bacteria 852
41 Ga0097620_100572089 3300006931 Bacteria 1224
42 Ga0099794_10047615 3300007265 Bacteria 2056
43 Ga0111539_10017152 3300009094 Bacteria 8964
44 Ga0111539_10143217 3300009094 Bacteria 2798
45 Ga0111539_12554532 3300009094 Bacteria 592
46 Ga0114129_11637201 3300009147 Bacteria 787
47 Ga0105243_10472995 3300009148 Bacteria 1181
48 Ga0105243_11142327 3300009148 Bacteria 789
49 Ga0105242_10363624 3300009176 Bacteria 1340
50 Ga0105246_11771736 3300011119 Bacteria 589
51 Ga0157378_10253865 3300013297 Bacteria 1684
52 Ga0157378_13256771 3300013297 Bacteria 504
53 Ga0163162_10852379 3300013306 Bacteria 1026
54 Ga0157375_11813847 3300013308 Bacteria 723
55 Ga0157380_10414970 3300014326 Bacteria 1282
56 Ga0207688_10203043 3300025901 Bacteria 1189
57 Ga0207662_10041145 3300025918 Bacteria 2720
58 Ga0207706_11152653 3300025933 Bacteria 646
59 Ga0207686_10397388 3300025934 Bacteria 1049
60 Ga0207679_11110629 3300025945 Bacteria 725
61 Ga0207708_10006819 3300026075 Bacteria 8445
62 Ga0207698_10715244 3300026142 Bacteria 998
63 Ga0209969_1000121 3300027360 Bacteria 9895
64 Ga0209967_1000661 3300027364 Bacteria 4444
65 Ga0209996_1028919 3300027395 Bacteria 801
66 Ga0209995_1009054 3300027471 Bacteria 1609
67 Ga0209995_1013411 3300027471 Bacteria 1343
68 Ga0209999_1003351 3300027543 Bacteria 2858
69 Ga0209983_1032562 3300027665 Bacteria 1114
70 Ga0209971_1004442 3300027682 Bacteria 3330
71 Ga0209971_1144364 3300027682 Bacteria 587
72 Ga0209813_10000415 3300027866 Bacteria 10405
73 Ga0209974_10009039 3300027876 Bacteria 3387
74 Ga0209974_10133657 3300027876 Bacteria 886
75 Ga0209974_10149845 3300027876 Bacteria 841
76 Ga0207428_10004883 3300027907 Bacteria 12630
77 Ga0265336_10001056 3300028666 Bacteria 13481
78 Ga0265336_10067919 3300028666 Bacteria 1066
79 Ga0265338_10360427 3300028800 Bacteria 1043
80 Ga0265324_10000002 3300029957 Bacteria 382754
81 Ga0265324_10007160 3300029957 Bacteria 4560
82 Ga0265324_10025548 3300029957 Bacteria 2093
83 Ga0265330_10197656 3300031235 Bacteria 850
84 Ga0265328_10000007 3300031239 Bacteria 224310
85 Ga0265325_10001584 3300031241 Bacteria 15862
86 Ga0265325_10304907 3300031241 Bacteria 710
87 Ga0265329_10075315 3300031242 Bacteria 1068
88 Ga0265327_10003630 3300031251 Bacteria 14515
89 Ga0265316_10024328 3300031344 Bacteria 5079
90 Ga0307408_100532096 3300031548 Bacteria 1034
91 Ga0307408_101062499 3300031548 Bacteria 749
92 Ga0316575_10000652 3300031665 Bacteria 10246
93 Ga0265314_10027699 3300031711 Bacteria 4241
94 Ga0265314_10396322 3300031711 Bacteria 747
95 Ga0316583_10075406 3300032133 Bacteria 1179
96 Ga0373951_0268038 3300035091 Bacteria 518
97 Ga0373927_0065635 3300035695 Bacteria 2348
98 Ga0373925_0110721 3300037068 Bacteria 2121
99 Ga0451807_2296442 3300041486 Bacteria 596
100 Ga0439441_067253 3300042001 Bacteria 763
101 Ga0451577_0000013 3300042876 Bacteria 550689
102 Ga0451577_0072686 3300042876 Bacteria 3069
103 Ga0451577_0343221 3300042876 Bacteria 1354
104 Ga0453683_0000059 3300044673 Bacteria 187158
105 Ga0453684_0010947 3300044712 Bacteria 15337
106 Ga0453684_0010950 3300044712 Bacteria 15335
107 Ga0453684_0139828 3300044712 Bacteria 2893
108 Ga0453684_0340237 3300044712 Bacteria 1694
109 Ga0453684_1314883 3300044712 Bacteria 753
110 Ga0453684_1890659 3300044712 Bacteria 604
111 Ga0451576_0000018 3300045051 Bacteria 550689
112 Ga0451576_0091847 3300045051 Bacteria 3158
113 Ga0451576_0116440 3300045051 Bacteria 2782
114 Ga0451576_0731687 3300045051 Bacteria 1039
115 Ga0451576_1188709 3300045051 Bacteria 796
116 Ga0496106_0426923 3300048909 Bacteria 1065
117 Ga0496108_0186519 3300048911 Bacteria 1797
118 Ga0501297_024751 3300049520 Bacteria 769
119 Ga0501299_045929 3300049522 Bacteria 890
120 Ga0501038_0706928 3300049574 Bacteria 755
121 Ga0501048_0586008 3300049582 Bacteria 801
122 Ga0501068_0069437 3300049584 Bacteria 2148
123 Ga0501070_0266808 3300049586 Bacteria 1398
124 Ga0501070_0530865 3300049586 Bacteria 943
125 Ga0501071_0335791 3300049587 Bacteria 1149
126 Ga0501073_0022800 3300049589 Bacteria 4504
127 Ga0501074_0024041 3300049590 Bacteria 4428
128 Ga0501074_0306852 3300049590 Bacteria 1127
129 Ga0501076_0162210 3300049592 Bacteria 1821
130 Ga0501233_126939 3300049668 Bacteria 694
131 Ga0501079_0773335 3300049741 Bacteria 756
132 Ga0501080_0040658 3300049742 Bacteria 4336
133 Ga0501081_1377385 3300049743 Bacteria 535
134 Ga0501083_0342394 3300049744 Bacteria 972
135 Ga0501035_0394558 3300049822 Bacteria 1152
136 Ga0501045_0256846 3300049824 Bacteria 1300
137 nmdc:mga03683_91820_c1 3300050489 Bacteria 1325
138 nmdc:mga03n38_96866_c1 3300050490 Bacteria 1416
139 nmdc:mga00v17_1062983_c1 3300050491 Bacteria 508
140 nmdc:mga00v17_52497_c1 3300050491 Bacteria 2481
141 nmdc:mga0k408_168482_c1 3300050493 Bacteria 1306
142 nmdc:mga06z11_106580_c1 3300050494 Bacteria 1546
143 nmdc:mga04h51_43980_c1 3300050495 Bacteria 1471
144 nmdc:mga07m45_91409_c1 3300050496 Bacteria 1744
145 nmdc:mga09592_1424172_c1 3300050508 Bacteria 566
146 nmdc:mga09592_1553543_c1 3300050508 Bacteria 537
147 nmdc:mga09592_65811_c1 3300050508 Bacteria 3071
148 nmdc:mga0qj67_202535_c1 3300050509 Bacteria 1612
149 nmdc:mga0qj67_941756_c1 3300050509 Bacteria 679
150 nmdc:mga08y16_104821_c1 3300050511 Bacteria 2944
151 nmdc:mga08y16_304975_c1 3300050511 Bacteria 1641
152 nmdc:mga0n895_202200_c1 3300050512 Bacteria 2017
153 nmdc:mga0rr50_1123611_c1 3300050513 Bacteria 668
154 nmdc:mga0sz30_68211_c1 3300050516 Bacteria 1528
155 Ga0500594_0022217 3300053118 Bacteria 1598
156 Ga0500588_0217237 3300053146 Bacteria 712
157 Ga0500636_0004187 3300053177 Bacteria 8173
158 Ga0500637_0255870 3300053178 Bacteria 974
159 Ga0500625_050351 3300053729 Bacteria 1926
160 Ga0590074_063877 3300059423 Bacteria 687
161 Ga0590075_106187 3300059424 Bacteria 732
162 Ga0590077_007416 3300059426 Bacteria 2243
163 Ga0501082_0673691 3300060353 Bacteria 905

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005355 Ga0070671_101708700 Ga0070671_1017087001 105
2 3300009148 Ga0105243_11142327 Ga0105243_111423272 105
3 3300011119 Ga0105246_11771736 Ga0105246_117717362 105
4 3300013306 Ga0163162_10852379 Ga0163162_108523791 105
5 3300025901 Ga0207688_10203043 Ga0207688_102030432 105
6 3300026142 Ga0207698_10715244 Ga0207698_107152441 105
7 3300045051 Ga0451576_0091847 Ga0451576_0091847_2519_2872 105
8 3300048909 Ga0496106_0426923 Ga0496106_0426923_553_900 105
9 3300009094 Ga0111539_10143217 Ga0111539_101432173 107
10 3300050508 nmdc:mga09592_1424172_c1 nmdc:mga09592_1424172_c1_42_386 107
11 3300050511 nmdc:mga08y16_304975_c1 nmdc:mga08y16_304975_c1_287_634 107
12 3300005336 Ga0070680_101671657 Ga0070680_1016716571 109
13 3300006178 Ga0075367_11093437 Ga0075367_110934371 109
14 iso_pu_bacteria 2574179768 2574433399 110
15 3300005544 Ga0070686_100373159 Ga0070686_1003731592 112
16 3300006844 Ga0075428_100009067 Ga0075428_1000090679 112
17 3300006871 Ga0075434_100170182 Ga0075434_1001701822 112
18 3300006880 Ga0075429_100028830 Ga0075429_1000288304 112
19 3300006880 Ga0075429_100897552 Ga0075429_1008975522 112
20 3300009094 Ga0111539_10017152 Ga0111539_100171528 112
21 3300027907 Ga0207428_10004883 Ga0207428_100048833 112
22 3300050508 nmdc:mga09592_1553543_c1 nmdc:mga09592_1553543_c1_18_395 112
23 3300050508 nmdc:mga09592_65811_c1 nmdc:mga09592_65811_c1_242_637 112
24 3300050509 nmdc:mga0qj67_941756_c1 nmdc:mga0qj67_941756_c1_240_635 112
25 3300050511 nmdc:mga08y16_104821_c1 nmdc:mga08y16_104821_c1_242_637 112
26 3300050512 nmdc:mga0n895_202200_c1 nmdc:mga0n895_202200_c1_1390_1782 112
27 3300050513 nmdc:mga0rr50_1123611_c1 nmdc:mga0rr50_1123611_c1_180_572 112
28 3300005444 Ga0070694_100548414 Ga0070694_1005484142 114
29 3300006038 Ga0075365_10564055 Ga0075365_105640553 114
30 3300006042 Ga0075368_10000628 Ga0075368_100006289 114
31 3300006048 Ga0075363_100006560 Ga0075363_1000065603 114
32 3300006051 Ga0075364_10264042 Ga0075364_102640422 114
33 3300006177 Ga0075362_10004474 Ga0075362_100044747 114
34 3300006186 Ga0075369_10002613 Ga0075369_100026139 114
35 3300006195 Ga0075366_10050420 Ga0075366_100504204 114
36 3300006353 Ga0075370_10029634 Ga0075370_100296345 114
37 3300006880 Ga0075429_101725607 Ga0075429_1017256072 114
38 3300027866 Ga0209813_10000415 Ga0209813_100004158 114
39 3300031548 Ga0307408_100532096 Ga0307408_1005320963 114
40 3300035091 Ga0373951_0268038 Ga0373951_0268038_107_451 114
41 3300042876 Ga0451577_0343221 Ga0451577_0343221_251_595 114
42 3300044712 Ga0453684_0010950 Ga0453684_0010950_294_638 114
43 3300044712 Ga0453684_0139828 Ga0453684_0139828_436_780 114
44 3300045051 Ga0451576_1188709 Ga0451576_1188709_60_404 114
45 3300049587 Ga0501071_0335791 Ga0501071_0335791_168_512 114
46 3300049592 Ga0501076_0162210 Ga0501076_0162210_498_842 114
47 3300049824 Ga0501045_0256846 Ga0501045_0256846_918_1262 114
48 3300050489 nmdc:mga03683_91820_c1 nmdc:mga03683_91820_c1_387_737 114
49 3300050490 nmdc:mga03n38_96866_c1 nmdc:mga03n38_96866_c1_198_548 114
50 3300050491 nmdc:mga00v17_1062983_c1 nmdc:mga00v17_1062983_c1_54_404 114
51 3300050491 nmdc:mga00v17_52497_c1 nmdc:mga00v17_52497_c1_193_543 114
52 3300050493 nmdc:mga0k408_168482_c1 nmdc:mga0k408_168482_c1_415_765 114
53 3300050494 nmdc:mga06z11_106580_c1 nmdc:mga06z11_106580_c1_782_1132 114
54 3300050495 nmdc:mga04h51_43980_c1 nmdc:mga04h51_43980_c1_184_534 114
55 3300050496 nmdc:mga07m45_91409_c1 nmdc:mga07m45_91409_c1_472_822 114
56 3300050509 nmdc:mga0qj67_202535_c1 nmdc:mga0qj67_202535_c1_1097_1441 114
57 3300050516 nmdc:mga0sz30_68211_c1 nmdc:mga0sz30_68211_c1_792_1142 114
58 3300053118 Ga0500594_0022217 Ga0500594_0022217_387_737 114
59 3300053146 Ga0500588_0217237 Ga0500588_0217237_88_438 114
60 3300059423 Ga0590074_063877 Ga0590074_063877_30_374 114
61 3300059424 Ga0590075_106187 Ga0590075_106187_225_569 114
62 3300059426 Ga0590077_007416 Ga0590077_007416_839_1183 114
63 3300005295 Ga0065707_10446958 Ga0065707_104469582 115
64 3300005331 Ga0070670_101723198 Ga0070670_1017231982 115
65 3300005343 Ga0070687_100143392 Ga0070687_1001433923 115
66 3300005345 Ga0070692_10237150 Ga0070692_102371502 115
67 3300005364 Ga0070673_102054750 Ga0070673_1020547501 115
68 3300005441 Ga0070700_100150485 Ga0070700_1001504851 115
69 3300005457 Ga0070662_100097782 Ga0070662_1000977822 115
70 3300005459 Ga0068867_100080004 Ga0068867_1000800043 115
71 3300005459 Ga0068867_100172817 Ga0068867_1001728173 115
72 3300005471 Ga0070698_100878921 Ga0070698_1008789212 115
73 3300005536 Ga0070697_100489463 Ga0070697_1004894631 115
74 3300005545 Ga0070695_100150308 Ga0070695_1001503081 115
75 3300005545 Ga0070695_101552929 Ga0070695_1015529292 115
76 3300005546 Ga0070696_100045244 Ga0070696_1000452442 115
77 3300005546 Ga0070696_100528060 Ga0070696_1005280602 115
78 3300005547 Ga0070693_100886583 Ga0070693_1008865832 115
79 3300005547 Ga0070693_101014330 Ga0070693_1010143301 115
80 3300005617 Ga0068859_100572085 Ga0068859_1005720853 115
81 3300005718 Ga0068866_10076731 Ga0068866_100767312 115
82 3300005844 Ga0068862_101860005 Ga0068862_1018600052 115
83 3300006844 Ga0075428_100147640 Ga0075428_1001476404 115
84 3300006914 Ga0075436_100543375 Ga0075436_1005433753 115
85 3300006931 Ga0097620_100572089 Ga0097620_1005720893 115
86 3300007265 Ga0099794_10047615 Ga0099794_100476152 115
87 3300009094 Ga0111539_12554532 Ga0111539_125545321 115
88 3300009147 Ga0114129_11637201 Ga0114129_116372012 115
89 3300009148 Ga0105243_10472995 Ga0105243_104729953 115
90 3300009176 Ga0105242_10363624 Ga0105242_103636242 115
91 3300013297 Ga0157378_10253865 Ga0157378_102538654 115
92 3300013297 Ga0157378_13256771 Ga0157378_132567711 115
93 3300013308 Ga0157375_11813847 Ga0157375_118138471 115
94 3300014326 Ga0157380_10414970 Ga0157380_104149703 115
95 3300025918 Ga0207662_10041145 Ga0207662_100411453 115
96 3300025933 Ga0207706_11152653 Ga0207706_111526532 115
97 3300025934 Ga0207686_10397388 Ga0207686_103973882 115
98 3300025945 Ga0207679_11110629 Ga0207679_111106292 115
99 3300026075 Ga0207708_10006819 Ga0207708_100068194 115
100 3300027360 Ga0209969_1000121 Ga0209969_10001217 115
101 3300027364 Ga0209967_1000661 Ga0209967_10006618 115
102 3300027395 Ga0209996_1028919 Ga0209996_10289193 115
103 3300027471 Ga0209995_1009054 Ga0209995_10090543 115
104 3300027471 Ga0209995_1013411 Ga0209995_10134113 115
105 3300027543 Ga0209999_1003351 Ga0209999_10033515 115
106 3300027665 Ga0209983_1032562 Ga0209983_10325623 115
107 3300027682 Ga0209971_1004442 Ga0209971_10044426 115
108 3300027682 Ga0209971_1144364 Ga0209971_11443642 115
109 3300027876 Ga0209974_10009039 Ga0209974_100090396 115
110 3300027876 Ga0209974_10133657 Ga0209974_101336572 115
111 3300027876 Ga0209974_10149845 Ga0209974_101498452 115
112 3300028666 Ga0265336_10001056 Ga0265336_100010563 115
113 3300028666 Ga0265336_10067919 Ga0265336_100679193 115
114 3300028800 Ga0265338_10360427 Ga0265338_103604272 115
115 3300029957 Ga0265324_10000002 Ga0265324_1000000253 115
116 3300029957 Ga0265324_10007160 Ga0265324_100071607 115
117 3300029957 Ga0265324_10025548 Ga0265324_100255482 115
118 3300031235 Ga0265330_10197656 Ga0265330_101976562 115
119 3300031239 Ga0265328_10000007 Ga0265328_10000007112 115
120 3300031241 Ga0265325_10001584 Ga0265325_100015843 115
121 3300031241 Ga0265325_10304907 Ga0265325_103049073 115
122 3300031242 Ga0265329_10075315 Ga0265329_100753152 115
123 3300031251 Ga0265327_10003630 Ga0265327_1000363011 115
124 3300031344 Ga0265316_10024328 Ga0265316_100243285 115
125 3300031548 Ga0307408_101062499 Ga0307408_1010624993 115
126 3300031665 Ga0316575_10000652 Ga0316575_100006523 115
127 3300031711 Ga0265314_10027699 Ga0265314_100276994 115
128 3300031711 Ga0265314_10396322 Ga0265314_103963222 115
129 3300032133 Ga0316583_10075406 Ga0316583_100754063 115
130 3300035695 Ga0373927_0065635 Ga0373927_0065635_247_597 115
131 3300037068 Ga0373925_0110721 Ga0373925_0110721_352_702 115
132 3300041486 Ga0451807_2296442 Ga0451807_2296442_12_359 115
133 3300042001 Ga0439441_067253 Ga0439441_067253_335_685 115
134 3300042876 Ga0451577_0000013 Ga0451577_0000013_399055_399402 115
135 3300042876 Ga0451577_0072686 Ga0451577_0072686_747_1094 115
136 3300044673 Ga0453683_0000059 Ga0453683_0000059_35524_35871 115
137 3300044712 Ga0453684_0010947 Ga0453684_0010947_14697_15044 115
138 3300044712 Ga0453684_0340237 Ga0453684_0340237_432_779 115
139 3300044712 Ga0453684_1314883 Ga0453684_1314883_114_461 115
140 3300044712 Ga0453684_1890659 Ga0453684_1890659_63_410 115
141 3300045051 Ga0451576_0000018 Ga0451576_0000018_151288_151635 115
142 3300045051 Ga0451576_0116440 Ga0451576_0116440_2075_2422 115
143 3300045051 Ga0451576_0731687 Ga0451576_0731687_444_791 115
144 3300048911 Ga0496108_0186519 Ga0496108_0186519_1367_1714 115
145 3300049520 Ga0501297_024751 Ga0501297_024751_377_748 115
146 3300049522 Ga0501299_045929 Ga0501299_045929_35_382 115
147 3300049574 Ga0501038_0706928 Ga0501038_0706928_26_373 115
148 3300049582 Ga0501048_0586008 Ga0501048_0586008_227_574 115
149 3300049584 Ga0501068_0069437 Ga0501068_0069437_315_662 115
150 3300049586 Ga0501070_0266808 Ga0501070_0266808_394_741 115
151 3300049586 Ga0501070_0530865 Ga0501070_0530865_228_575 115
152 3300049589 Ga0501073_0022800 Ga0501073_0022800_287_634 115
153 3300049590 Ga0501074_0024041 Ga0501074_0024041_3782_4129 115
154 3300049590 Ga0501074_0306852 Ga0501074_0306852_220_567 115
155 3300049668 Ga0501233_126939 Ga0501233_126939_210_581 115
156 3300049741 Ga0501079_0773335 Ga0501079_0773335_254_601 115
157 3300049742 Ga0501080_0040658 Ga0501080_0040658_275_622 115
158 3300049743 Ga0501081_1377385 Ga0501081_1377385_86_433 115
159 3300049744 Ga0501083_0342394 Ga0501083_0342394_226_573 115
160 3300049822 Ga0501035_0394558 Ga0501035_0394558_648_995 115
161 3300053177 Ga0500636_0004187 Ga0500636_0004187_296_658 115
162 3300053178 Ga0500637_0255870 Ga0500637_0255870_325_687 115
163 3300053729 Ga0500625_050351 Ga0500625_050351_116_478 115
164 3300060353 Ga0501082_0673691 Ga0501082_0673691_358_705 115

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00584

SecE

SecE/Sec61-gamma subunits of protein translocation complex

76

130

0.94

Feature Viewer

pLDDT pTM Quality
87.48 0.47 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map