F197975

General Info

Members Datasets Scaffolds Average Seq Length
146 92 292 146

Family's Representative Sequence

Representative Sequence 3300031251|Ga0265327_10000646|Ga0265327_1000064637
Length 164
Sequence VASGGPWLHSAPVTPSSDQPPAVTVSEATEVTDELVEAFVALIPQLSTSSPPTSRDELAAIIGSEADTLFVARDEQGRIVGTLTLAVFRIPTGVRAWIEDVVVDDGARGKGVGDALVDAAVAKAGAAGAKTVDLTSRPSREAANRLYVRKGFELRTTNVYRVTL

Samples

Sample ID Description Type Environment
1 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
2 2162886006 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 Metagenome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
7 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
8 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
9 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
10 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
11 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
12 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
13 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
14 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
15 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
16 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
17 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
18 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
19 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
20 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
21 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
22 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
23 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
24 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
25 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
26 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
27 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
28 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
29 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
35 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
36 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
37 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
38 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
39 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
40 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
41 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
42 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
43 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
44 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
45 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
46 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
47 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
48 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
49 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
50 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
51 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
52 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
53 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
54 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
55 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
56 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
57 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
58 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
59 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
60 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
61 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
62 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
63 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
64 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
65 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
66 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
67 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
68 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
69 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
70 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
71 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
72 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
73 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
74 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
75 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
76 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
77 3300049659 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control Metagenome Rhizosphere
78 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
79 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
80 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
81 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
82 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
83 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
84 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
85 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
86 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
87 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
88 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
89 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
90 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
91 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
92 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 99.32
Metatranscriptomes 0
Isolates 0.68

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.68
Nodule 0.68
Rhizoplane 0
Rhizosphere 90.41
Stem 0
Stem Tuber 0
Unclassified 27.4

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265327_10000646 3300031251 Bacteria 56310
2 SwRhRL3b_contig_266202 2162886006 Bacteria 1646
3 Ga0065704_10203943 3300005289 Bacteria 1135
4 Ga0065712_10474221 3300005290 Bacteria 668
5 Ga0065707_10082437 3300005295 Bacteria 15151
6 Ga0065707_10090864 3300005295 Unclassified 4042
7 Ga0070705_100258104 3300005440 Bacteria 1227
8 Ga0070705_100595722 3300005440 Unclassified 854
9 Ga0070694_100715501 3300005444 Bacteria 815
10 Ga0070708_100326667 3300005445 Bacteria 1445
11 Ga0070707_100321433 3300005468 Bacteria 1504
12 Ga0070698_100004104 3300005471 Bacteria 16000
13 Ga0070699_101024881 3300005518 Bacteria 757
14 Ga0070702_100764298 3300005615 Unclassified 743
15 Ga0068861_100149352 3300005719 Bacteria 1916
16 Ga0068862_100142992 3300005844 Bacteria 2124
17 Ga0075364_10047371 3300006051 Bacteria 2800
18 Ga0075428_100062738 3300006844 Bacteria 4068
19 Ga0075428_100198060 3300006844 Unclassified 2172
20 Ga0075428_100233037 3300006844 Unclassified 1987
21 Ga0075430_100171340 3300006846 Unclassified 1806
22 Ga0075430_100917400 3300006846 Archaea 721
23 Ga0075430_101249778 3300006846 Unclassified 611
24 Ga0075431_100012687 3300006847 Bacteria 8510
25 Ga0075431_100147294 3300006847 Bacteria 2426
26 Ga0075433_10425807 3300006852 Bacteria 1170
27 Ga0075434_100335566 3300006871 Unclassified 1532
28 Ga0075429_100003947 3300006880 Bacteria 12687
29 Ga0075429_100015502 3300006880 Bacteria 6604
30 Ga0075429_100463914 3300006880 Bacteria 1110
31 Ga0075429_101165742 3300006880 Unclassified 673
32 Ga0111539_11724979 3300009094 Unclassified 726
33 Ga0105245_10016770 3300009098 Bacteria 6396
34 Ga0114129_10000583 3300009147 Bacteria 45033
35 Ga0114129_10002866 3300009147 Bacteria 24126
36 Ga0114129_10043210 3300009147 Bacteria 6341
37 Ga0114129_10051983 3300009147 Bacteria 5751
38 Ga0114129_10158918 3300009147 Unclassified 3089
39 Ga0114129_10824071 3300009147 Bacteria 1182
40 Ga0114129_11543048 3300009147 Archaea 815
41 Ga0114129_11850129 3300009147 Bacteria 733
42 Ga0105243_10189613 3300009148 Bacteria 1795
43 Ga0105249_10523183 3300009553 Unclassified 1234
44 Ga0105249_12018871 3300009553 Unclassified 649
45 Ga0157379_11105163 3300014968 Unclassified 759
46 Ga0213875_10055302 3300021388 Bacteria 1859
47 Ga0213875_10084573 3300021388 Bacteria 1480
48 Ga0213875_10169331 3300021388 Bacteria 1025
49 Ga0207660_10097450 3300025917 Bacteria 2191
50 Ga0207646_11235747 3300025922 Unclassified 654
51 Ga0207687_10013963 3300025927 Bacteria 5250
52 Ga0207709_10027802 3300025935 Bacteria 3263
53 Ga0207712_10148681 3300025961 Bacteria 1807
54 Ga0207674_10446628 3300026116 Bacteria 1250
55 Ga0207675_100206260 3300026118 Bacteria 1889
56 Ga0209967_1015255 3300027364 Bacteria 1099
57 Ga0268265_10249497 3300028380 Bacteria 1571
58 Ga0307413_10017545 3300031824 Unclassified 3731
59 Ga0307410_10017702 3300031852 Bacteria 4287
60 Ga0307410_10846166 3300031852 Unclassified 781
61 Ga0307407_10036737 3300031903 Unclassified 2702
62 Ga0307412_10639034 3300031911 Bacteria 906
63 Ga0307409_101252232 3300031995 Bacteria 766
64 Ga0307416_100612490 3300032002 Bacteria 1170
65 Ga0307414_11854604 3300032004 Unclassified 563
66 Ga0307411_10168273 3300032005 Bacteria 1650
67 Ga0373936_0097639 3300035113 Bacteria 1237
68 Ga0373941_0358237 3300035115 Unclassified 595
69 Ga0395899_0043111 3300037312 Bacteria 3366
70 Ga0395900_0056093 3300037418 Bacteria 4056
71 Ga0395900_0063358 3300037418 Bacteria 3800
72 Ga0395900_0333410 3300037418 Bacteria 1494
73 Ga0395898_0046255 3300037466 Bacteria 4274
74 Ga0395898_0313423 3300037466 Unclassified 1497
75 Ga0395905_0134917 3300037471 Bacteria 2322
76 Ga0395905_0295259 3300037471 Bacteria 1507
77 Ga0395905_1716310 3300037471 Bacteria 533
78 Ga0436364_0318624 3300037853 Bacteria 7692
79 Ga0436364_1168565 3300037853 Bacteria 2063
80 Ga0436364_1301795 3300037853 Bacteria 2123
81 Ga0436364_1371692 3300037853 Bacteria 531
82 Ga0395901_0067867 3300038443 Bacteria 3715
83 Ga0395901_0254092 3300038443 Bacteria 1830
84 Ga0400485_12907 3300038735 Bacteria 10092
85 Ga0400488_54171 3300038741 Bacteria 2164
86 Ga0400486_05669 3300038742 Bacteria 64843
87 Ga0400487_09198 3300039110 Bacteria 2332
88 Ga0436363_0014168 3300039450 Bacteria 602
89 Ga0450922_034097 3300042124 Unclassified 562
90 Ga0451577_1531081 3300042876 Unclassified 589
91 Ga0453683_0175126 3300044673 Unclassified 1359
92 Ga0453683_0236679 3300044673 Unclassified 1162
93 Ga0453683_0864850 3300044673 Unclassified 597
94 Ga0453684_0018864 3300044712 Bacteria 10553
95 Ga0453684_0108853 3300044712 Bacteria 3372
96 Ga0453684_0141763 3300044712 Bacteria 2869
97 Ga0453684_0251555 3300044712 Unclassified 2029
98 Ga0453684_0254728 3300044712 Unclassified 2014
99 Ga0453684_0305369 3300044712 Bacteria 1807
100 Ga0453684_0352843 3300044712 Bacteria 1658
101 Ga0453684_0451666 3300044712 Bacteria 1430
102 Ga0453684_0498204 3300044712 Bacteria 1349
103 Ga0453684_0594028 3300044712 Bacteria 1214
104 Ga0453684_0947367 3300044712 Unclassified 919
105 Ga0453684_1244256 3300044712 Unclassified 779
106 Ga0466967_0208559 3300045976 Bacteria 1853
107 Ga0495664_0086322 3300046477 Bacteria 1885
108 Ga0495628_0367086 3300046516 Bacteria 1056
109 Ga0495630_0025285 3300046517 Bacteria 4389
110 Ga0495586_0061821 3300046535 Bacteria 2038
111 Ga0495634_0000284 3300046642 Bacteria 48538
112 Ga0495674_0001193 3300047319 Bacteria 25116
113 Ga0495680_0634360 3300047322 Bacteria 712
114 Ga0501041_0104390 3300049577 Bacteria 1756
115 Ga0501070_0471390 3300049586 Bacteria 1011
116 Ga0501071_0491483 3300049587 Bacteria 941
117 Ga0501072_0706945 3300049588 Bacteria 792
118 Ga0501073_0990155 3300049589 Unclassified 578
119 Ga0501076_0018186 3300049592 Bacteria 5352
120 Ga0501076_0152179 3300049592 Unclassified 1882
121 Ga0501214_097882 3300049659 Unclassified 513
122 Ga0501236_034741 3300049670 Bacteria 813
123 Ga0501079_0086747 3300049741 Bacteria 2423
124 Ga0501080_0421024 3300049742 Bacteria 1200
125 Ga0501080_0491055 3300049742 Unclassified 1098
126 Ga0501081_0082752 3300049743 Bacteria 2249
127 Ga0501081_0142219 3300049743 Bacteria 1720
128 Ga0501283_042715 3300049779 Bacteria 788
129 nmdc:mga05p37_133000_c1 3300050507 Unclassified 3051
130 nmdc:mga05p37_16_c1 3300050507 Bacteria 130728
131 nmdc:mga05p37_1965_c1 3300050507 Bacteria 19296
132 nmdc:mga05p37_671565_c1 3300050507 Unclassified 1156
133 nmdc:mga05p37_76653_c1 3300050507 Unclassified 4116
134 nmdc:mga05p37_95549_c1 3300050507 Bacteria 3661
135 nmdc:mga09592_192272_c1 3300050508 Bacteria 1766
136 nmdc:mga09592_26638_c1 3300050508 Bacteria 4792
137 nmdc:mga09592_4188_c1 3300050508 Bacteria 11652
138 nmdc:mga09592_602563_c1 3300050508 Bacteria 941
139 nmdc:mga0qj67_174723_c1 3300050509 Unclassified 1744
140 nmdc:mga06r32_60817_c1 3300050510 Unclassified 3635
141 nmdc:mga0a205_295610_c1 3300050515 Bacteria 1493
142 Ga0495601_0013092 3300053077 Bacteria 4986
143 Ga0501084_0489804 3300054114 Bacteria 1039
144 Ga0501082_1330945 3300060353 Unclassified 627
145 Ga0530510_0336276 3300061734 Bacteria 1133
146 2874130318 2874123672 Bacteria 7238285
147 Ga0265327_10000646
148 SwRhRL3b_contig_266202
149 Ga0065704_10203943
150 Ga0065712_10474221
151 Ga0065707_10082437
152 Ga0065707_10090864
153 Ga0070705_100258104
154 Ga0070705_100595722
155 Ga0070694_100715501
156 Ga0070708_100326667
157 Ga0070707_100321433
158 Ga0070698_100004104
159 Ga0070699_101024881
160 Ga0070702_100764298
161 Ga0068861_100149352
162 Ga0068862_100142992
163 Ga0075364_10047371
164 Ga0075428_100062738
165 Ga0075428_100198060
166 Ga0075428_100233037
167 Ga0075430_100171340
168 Ga0075430_100917400
169 Ga0075430_101249778
170 Ga0075431_100012687
171 Ga0075431_100147294
172 Ga0075433_10425807
173 Ga0075434_100335566
174 Ga0075429_100003947
175 Ga0075429_100015502
176 Ga0075429_100463914
177 Ga0075429_101165742
178 Ga0111539_11724979
179 Ga0105245_10016770
180 Ga0114129_10000583
181 Ga0114129_10002866
182 Ga0114129_10043210
183 Ga0114129_10051983
184 Ga0114129_10158918
185 Ga0114129_10824071
186 Ga0114129_11543048
187 Ga0114129_11850129
188 Ga0105243_10189613
189 Ga0105249_10523183
190 Ga0105249_12018871
191 Ga0157379_11105163
192 Ga0213875_10055302
193 Ga0213875_10084573
194 Ga0213875_10169331
195 Ga0207660_10097450
196 Ga0207646_11235747
197 Ga0207687_10013963
198 Ga0207709_10027802
199 Ga0207712_10148681
200 Ga0207674_10446628
201 Ga0207675_100206260
202 Ga0209967_1015255
203 Ga0268265_10249497
204 Ga0307413_10017545
205 Ga0307410_10017702
206 Ga0307410_10846166
207 Ga0307407_10036737
208 Ga0307412_10639034
209 Ga0307409_101252232
210 Ga0307416_100612490
211 Ga0307414_11854604
212 Ga0307411_10168273
213 Ga0373936_0097639
214 Ga0373941_0358237
215 Ga0395899_0043111
216 Ga0395900_0056093
217 Ga0395900_0063358
218 Ga0395900_0333410
219 Ga0395898_0046255
220 Ga0395898_0313423
221 Ga0395905_0134917
222 Ga0395905_0295259
223 Ga0395905_1716310
224 Ga0436364_0318624
225 Ga0436364_1168565
226 Ga0436364_1301795
227 Ga0436364_1371692
228 Ga0395901_0067867
229 Ga0395901_0254092
230 Ga0400485_12907
231 Ga0400488_54171
232 Ga0400486_05669
233 Ga0400487_09198
234 Ga0436363_0014168
235 Ga0450922_034097
236 Ga0451577_1531081
237 Ga0453683_0175126
238 Ga0453683_0236679
239 Ga0453683_0864850
240 Ga0453684_0018864
241 Ga0453684_0108853
242 Ga0453684_0141763
243 Ga0453684_0251555
244 Ga0453684_0254728
245 Ga0453684_0305369
246 Ga0453684_0352843
247 Ga0453684_0451666
248 Ga0453684_0498204
249 Ga0453684_0594028
250 Ga0453684_0947367
251 Ga0453684_1244256
252 Ga0466967_0208559
253 Ga0495664_0086322
254 Ga0495628_0367086
255 Ga0495630_0025285
256 Ga0495586_0061821
257 Ga0495634_0000284
258 Ga0495674_0001193
259 Ga0495680_0634360
260 Ga0501041_0104390
261 Ga0501070_0471390
262 Ga0501071_0491483
263 Ga0501072_0706945
264 Ga0501073_0990155
265 Ga0501076_0018186
266 Ga0501076_0152179
267 Ga0501214_097882
268 Ga0501236_034741
269 Ga0501079_0086747
270 Ga0501080_0421024
271 Ga0501080_0491055
272 Ga0501081_0082752
273 Ga0501081_0142219
274 Ga0501283_042715
275 nmdc:mga05p37_133000_c1
276 nmdc:mga05p37_16_c1
277 nmdc:mga05p37_1965_c1
278 nmdc:mga05p37_671565_c1
279 nmdc:mga05p37_76653_c1
280 nmdc:mga05p37_95549_c1
281 nmdc:mga09592_192272_c1
282 nmdc:mga09592_26638_c1
283 nmdc:mga09592_4188_c1
284 nmdc:mga09592_602563_c1
285 nmdc:mga0qj67_174723_c1
286 nmdc:mga06r32_60817_c1
287 nmdc:mga0a205_295610_c1
288 Ga0495601_0013092
289 Ga0501084_0489804
290 Ga0501082_1330945
291 Ga0530510_0336276
292 2874130318

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00583

Acetyltransf_1

Acetyltransferase (GNAT) family

29

152

0.85

PF13673

Acetyltransf_10

Acetyltransferase (GNAT) domain

27

161

0.82

PF13508

Acetyltransf_7

Acetyltransferase (GNAT) domain

65

154

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
7ypu-assembly4.cif.gz_G orfe-coa-glycylthricin complex 0.8982 45 131
7ypu-assembly4.cif.gz_H orfe-coa-glycylthricin complex 0.897 44 131
5c82-assembly1.cif.gz_A-2 crystal structure of nourseothricin acetyltransferase 0.8893 43 134
3pp9-assembly2.cif.gz_B 1.6 angstrom resolution crystal structure of putative streptothricin acetyltransferase from bacillus anthracis str. ames in complex with acetyl coenzyme a 0.8823 37 131
7ypu-assembly2.cif.gz_D orfe-coa-glycylthricin complex 0.8818 41 131
ID Description Score Start End Superfamily
1y9wB01 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9133 45 133 3.40.630.30
af_K7WGP7_135_297_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9006 33 138 3.40.630.30
af_K7LZ12_255_436_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8927 33 136 3.40.630.30
5c82A00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8822 43 134 3.40.630.30
af_K7KMF1_95_188_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8789 43 117 3.40.630.30
ID Description Score Start End GO Terms
AF-A0A7W7H2T2-F1-model_v4 Ribosomal protein S18 acetylase RimI-like enzyme 0.9731 2 142 GO:0005840
GO:0016747
AF-A0A7W1E745-F1-model_v4 GNAT family N-acetyltransferase 0.9722 2 145 GO:0016747
AF-A0A6G2K150-F1-model_v4 GNAT family N-acetyltransferase 0.969 31 143 GO:0016747
AF-A0A1F8SNG9-F1-model_v4 N-acetyltransferase domain-containing protein 0.9683 1 144 GO:0016747
AF-A0A3A5Z275-F1-model_v4 deleted 0.9676 2 145

Map