F194496

General Info

Members Datasets Scaffolds Average Seq Length
145 107 290 218

Family's Representative Sequence

Representative Sequence 3300009094|Ga0111539_10798096|Ga0111539_107980962
Length 235
Sequence MCANVPADRNTGAGMGRLLDIVTPLHRQTKRDYIGRMMDDKVACMRKAKEYEFDYWDGDRRYGYGGYKFIAGRWKPVAQALIDTYGLTEQSKILDVGCGKAFLLYEIKQLLPGIEVAGFDISHYGLAGARDEVKPFLFRHRAEEPYPYADKQFDLVISLATLHNLRVFDLQKAVREIERVGRHGYIMVESYRNEQELFNLQCWALTAEAFFDTDAWVWLYRHFGYSGDYEFIFFE

Samples

Sample ID Description Type Environment
1 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
4 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
5 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
6 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
7 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
8 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
9 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
10 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
11 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
12 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
13 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
14 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
15 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
16 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
17 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
18 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
19 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
20 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
21 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
22 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
23 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
24 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
25 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
26 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
27 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
28 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
29 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
30 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
31 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
32 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
33 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
34 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
35 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
36 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
37 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
38 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
39 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
40 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
41 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
42 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
43 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
44 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300028023 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 Metagenome Rhizosphere
56 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
58 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
59 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
60 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
61 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
62 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
63 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
64 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
65 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
66 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
67 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
68 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
69 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
70 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
71 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
72 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
73 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
74 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
75 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
76 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
77 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
78 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
79 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
80 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
81 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
82 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
83 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
84 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
85 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
86 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
87 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
88 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
89 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
90 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
91 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
92 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
93 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
94 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
95 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
96 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
97 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
98 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
99 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
100 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
101 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
102 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
103 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
104 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
105 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
106 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
107 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.31
Metatranscriptomes 0.69
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 17.24
Nodule 0
Rhizoplane 2.07
Rhizosphere 71.03
Stem 0
Stem Tuber 0
Unclassified 6.9

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0111539_10798096 3300009094 Bacteria 1099
2 Ga0070683_100890938 3300005329 Unclassified 853
3 Ga0070666_10005745 3300005335 Bacteria 7619
4 Ga0070689_100163620 3300005340 Bacteria 1800
5 Ga0070673_100176594 3300005364 Bacteria 1826
6 Ga0070667_100281162 3300005367 Bacteria 1494
7 Ga0070713_100363235 3300005436 Bacteria 1346
8 Ga0070710_10287688 3300005437 Bacteria 1069
9 Ga0070711_100022069 3300005439 Bacteria 4123
10 Ga0070684_100191723 3300005535 Bacteria 1860
11 Ga0070672_100340107 3300005543 Bacteria 1278
12 Ga0070695_100172653 3300005545 Unclassified 1526
13 Ga0070665_100972896 3300005548 Bacteria 861
14 Ga0068857_100248610 3300005577 Bacteria 1630
15 Ga0068852_100601002 3300005616 Bacteria 1104
16 Ga0068859_101137956 3300005617 Bacteria 859
17 Ga0068861_100804075 3300005719 Bacteria 883
18 Ga0068858_100016090 3300005842 Bacteria 7026
19 Ga0068858_100424857 3300005842 Bacteria 1278
20 Ga0070717_10000058 3300006028 Bacteria 95200
21 Ga0070717_10796565 3300006028 Bacteria 860
22 Ga0075365_10318532 3300006038 Bacteria 1095
23 Ga0075364_10014501 3300006051 Bacteria 4871
24 Ga0075364_10027952 3300006051 Bacteria 3607
25 Ga0075362_10000878 3300006177 Bacteria 9101
26 Ga0075367_10015543 3300006178 Bacteria 4142
27 Ga0075367_10045120 3300006178 Bacteria 2586
28 Ga0075366_10007735 3300006195 Bacteria 5953
29 Ga0075366_10019233 3300006195 Bacteria 3948
30 Ga0075428_100721065 3300006844 Bacteria 1062
31 Ga0075428_101108368 3300006844 Bacteria 836
32 Ga0075433_10041235 3300006852 Bacteria 3999
33 Ga0075434_100017535 3300006871 Bacteria 6902
34 Ga0075434_100728158 3300006871 Bacteria 1009
35 Ga0075434_100974388 3300006871 Unclassified 862
36 Ga0097620_101138075 3300006931 Bacteria 859
37 Ga0075435_100870823 3300007076 Bacteria 785
38 Ga0099795_10192078 3300007788 Bacteria 858
39 Ga0111539_10009669 3300009094 Bacteria 12169
40 Ga0111539_10014388 3300009094 Bacteria 9874
41 Ga0111539_10187004 3300009094 Bacteria 2418
42 Ga0114129_10005982 3300009147 Bacteria 17233
43 Ga0114129_10107626 3300009147 Bacteria 3850
44 Ga0105237_10642883 3300009545 Bacteria 1068
45 Ga0105246_10406504 3300011119 Bacteria 1132
46 Ga0163162_10208682 3300013306 Bacteria 2083
47 Ga0163162_11203154 3300013306 Bacteria 860
48 Ga0157375_10000016 3300013308 Bacteria 295002
49 Ga0157375_11555601 3300013308 Bacteria 781
50 Ga0163163_10326204 3300014325 Bacteria 1589
51 Ga0163163_10968169 3300014325 Bacteria 914
52 Ga0157380_10528535 3300014326 Bacteria 1152
53 Ga0213873_10013291 3300021358 Bacteria 1803
54 Ga0213872_10121303 3300021361 Bacteria 1156
55 Ga0213876_10218860 3300021384 Bacteria 1012
56 Ga0213871_10054554 3300021441 Bacteria 1102
57 Ga0209233_1003592 3300025261 Bacteria 5438
58 Ga0209758_1017121 3300025297 Bacteria 3633
59 Ga0207680_10005836 3300025903 Bacteria 5909
60 Ga0207647_10166845 3300025904 Bacteria 1283
61 Ga0207645_10169966 3300025907 Bacteria 1428
62 Ga0207695_10295058 3300025913 Bacteria 1513
63 Ga0207663_10016118 3300025916 Bacteria 4136
64 Ga0207663_10022464 3300025916 Bacteria 3606
65 Ga0207694_10055211 3300025924 Bacteria 3084
66 Ga0207706_10374905 3300025933 Bacteria 1235
67 Ga0207691_10343438 3300025940 Bacteria 1278
68 Ga0207703_10182229 3300026035 Unclassified 1854
69 Ga0207703_10720140 3300026035 Bacteria 950
70 Ga0207708_10256043 3300026075 Bacteria 1412
71 Ga0207648_10528458 3300026089 Unclassified 1082
72 Ga0265357_1004085 3300028023 Bacteria 1299
73 Ga0268266_10197491 3300028379 Bacteria 1840
74 Ga0265319_1019376 3300028563 Bacteria 2539
75 Ga0265336_10051034 3300028666 Bacteria 1249
76 Ga0265338_10026471 3300028800 Bacteria 5847
77 Ga0265338_10073882 3300028800 Bacteria 2904
78 Ga0265760_10006964 3300031090 Bacteria 3241
79 Ga0265331_10000247 3300031250 Bacteria 64888
80 Ga0265331_10172390 3300031250 Bacteria 979
81 Ga0265327_10033190 3300031251 Bacteria 2880
82 Ga0265316_10002491 3300031344 Archaea 19085
83 Ga0265342_10000015 3300031712 Archaea 194661
84 Ga0373937_0071034 3300036401 Unclassified 3211
85 Ga0373937_0606851 3300036401 Bacteria 1039
86 Ga0395900_0036772 3300037418 Bacteria 5047
87 Ga0436364_1151777 3300037853 Bacteria 10390
88 Ga0395901_0176639 3300038443 Bacteria 2240
89 Ga0395901_0940069 3300038443 Bacteria 844
90 Ga0400490_14458 3300038726 Bacteria 9786
91 Ga0400485_08379 3300038735 Bacteria 31740
92 Ga0400486_32826 3300038742 Unclassified 1824
93 Ga0400489_36148 3300039093 Bacteria 13756
94 Ga0400487_58355 3300039110 Bacteria 1546
95 Ga0436365_0334104 3300039437 Bacteria 1098
96 Ga0436365_1236169 3300039437 Bacteria 8575
97 Ga0436361_1145703 3300039447 Unclassified 2832
98 Ga0436362_0060587 3300039453 Bacteria 2249
99 Ga0436362_0544517 3300039453 Bacteria 1043
100 Ga0436362_0853754 3300039453 Bacteria 2259
101 Ga0451577_0000415 3300042876 Bacteria 77375
102 Ga0451577_0182365 3300042876 Bacteria 1893
103 Ga0453684_0000519 3300044712 Bacteria 147315
104 Ga0453684_0068070 3300044712 Bacteria 4523
105 Ga0453684_0498488 3300044712 Bacteria 1349
106 Ga0453684_1088774 3300044712 Bacteria 845
107 Ga0495645_0199370 3300046543 Bacteria 1359
108 Ga0495657_0297918 3300046675 Bacteria 962
109 Ga0495657_0378168 3300046675 Unclassified 836
110 Ga0495674_0096197 3300047319 Bacteria 2524
111 Ga0496105_0021734 3300048908 Bacteria 5193
112 Ga0496108_1084140 3300048911 Bacteria 681
113 Ga0496115_0083177 3300048918 Bacteria 2609
114 Ga0496117_0048840 3300048920 Bacteria 3017
115 Ga0496118_0104598 3300048921 Bacteria 1900
116 Ga0496119_0104069 3300048922 Bacteria 1589
117 Ga0496121_0002205 3300048924 Bacteria 30418
118 Ga0496126_0287069 3300048929 Bacteria 1362
119 Ga0501042_0493254 3300049578 Bacteria 889
120 nmdc:mga03683_5314_c1 3300050489 Bacteria 4345
121 nmdc:mga00v17_28561_c1 3300050491 Bacteria 3267
122 nmdc:mga0k408_25990_c1 3300050493 Bacteria 3318
123 nmdc:mga0k408_28214_c1 3300050493 Bacteria 3191
124 nmdc:mga0k408_75215_c1 3300050493 Bacteria 1973
125 nmdc:mga06z11_4719_c1 3300050494 Bacteria 5387
126 nmdc:mga05p37_50958_c1 3300050507 Bacteria 5091
127 nmdc:mga05p37_690838_c1 3300050507 Bacteria 1135
128 nmdc:mga05p37_946099_c1 3300050507 Bacteria 923
129 nmdc:mga0qj67_44512_c1 3300050509 Bacteria 3498
130 nmdc:mga08y16_422614_c1 3300050511 Bacteria 1362
131 nmdc:mga08y16_854478_c1 3300050511 Bacteria 899
132 nmdc:mga0n895_658977_c1 3300050512 Bacteria 1045
133 nmdc:mga0n895_76841_c1 3300050512 Bacteria 3320
134 nmdc:mga0rr50_252853_c1 3300050513 Bacteria 1464
135 nmdc:mga0a205_46091_c2 3300050515 Bacteria 2196
136 Ga0495619_0041978 3300053085 Unclassified 2994
137 Ga0500644_0000482 3300053088 Bacteria 17537
138 Ga0500651_0000457 3300053093 Bacteria 21745
139 Ga0500651_0000557 3300053093 Bacteria 18965
140 Ga0500651_0108928 3300053093 Bacteria 1692
141 Ga0500651_0298987 3300053093 Bacteria 924
142 Ga0500595_005858 3300053119 Bacteria 5294
143 Ga0500655_008813 3300053133 Bacteria 1815
144 Ga0500616_0000001 3300053153 Bacteria 1986011
145 Ga0500645_000998 3300053730 Bacteria 15961
146 Ga0111539_10798096
147 Ga0070683_100890938
148 Ga0070666_10005745
149 Ga0070689_100163620
150 Ga0070673_100176594
151 Ga0070667_100281162
152 Ga0070713_100363235
153 Ga0070710_10287688
154 Ga0070711_100022069
155 Ga0070684_100191723
156 Ga0070672_100340107
157 Ga0070695_100172653
158 Ga0070665_100972896
159 Ga0068857_100248610
160 Ga0068852_100601002
161 Ga0068859_101137956
162 Ga0068861_100804075
163 Ga0068858_100016090
164 Ga0068858_100424857
165 Ga0070717_10000058
166 Ga0070717_10796565
167 Ga0075365_10318532
168 Ga0075364_10014501
169 Ga0075364_10027952
170 Ga0075362_10000878
171 Ga0075367_10015543
172 Ga0075367_10045120
173 Ga0075366_10007735
174 Ga0075366_10019233
175 Ga0075428_100721065
176 Ga0075428_101108368
177 Ga0075433_10041235
178 Ga0075434_100017535
179 Ga0075434_100728158
180 Ga0075434_100974388
181 Ga0097620_101138075
182 Ga0075435_100870823
183 Ga0099795_10192078
184 Ga0111539_10009669
185 Ga0111539_10014388
186 Ga0111539_10187004
187 Ga0114129_10005982
188 Ga0114129_10107626
189 Ga0105237_10642883
190 Ga0105246_10406504
191 Ga0163162_10208682
192 Ga0163162_11203154
193 Ga0157375_10000016
194 Ga0157375_11555601
195 Ga0163163_10326204
196 Ga0163163_10968169
197 Ga0157380_10528535
198 Ga0213873_10013291
199 Ga0213872_10121303
200 Ga0213876_10218860
201 Ga0213871_10054554
202 Ga0209233_1003592
203 Ga0209758_1017121
204 Ga0207680_10005836
205 Ga0207647_10166845
206 Ga0207645_10169966
207 Ga0207695_10295058
208 Ga0207663_10016118
209 Ga0207663_10022464
210 Ga0207694_10055211
211 Ga0207706_10374905
212 Ga0207691_10343438
213 Ga0207703_10182229
214 Ga0207703_10720140
215 Ga0207708_10256043
216 Ga0207648_10528458
217 Ga0265357_1004085
218 Ga0268266_10197491
219 Ga0265319_1019376
220 Ga0265336_10051034
221 Ga0265338_10026471
222 Ga0265338_10073882
223 Ga0265760_10006964
224 Ga0265331_10000247
225 Ga0265331_10172390
226 Ga0265327_10033190
227 Ga0265316_10002491
228 Ga0265342_10000015
229 Ga0373937_0071034
230 Ga0373937_0606851
231 Ga0395900_0036772
232 Ga0436364_1151777
233 Ga0395901_0176639
234 Ga0395901_0940069
235 Ga0400490_14458
236 Ga0400485_08379
237 Ga0400486_32826
238 Ga0400489_36148
239 Ga0400487_58355
240 Ga0436365_0334104
241 Ga0436365_1236169
242 Ga0436361_1145703
243 Ga0436362_0060587
244 Ga0436362_0544517
245 Ga0436362_0853754
246 Ga0451577_0000415
247 Ga0451577_0182365
248 Ga0453684_0000519
249 Ga0453684_0068070
250 Ga0453684_0498488
251 Ga0453684_1088774
252 Ga0495645_0199370
253 Ga0495657_0297918
254 Ga0495657_0378168
255 Ga0495674_0096197
256 Ga0496105_0021734
257 Ga0496108_1084140
258 Ga0496115_0083177
259 Ga0496117_0048840
260 Ga0496118_0104598
261 Ga0496119_0104069
262 Ga0496121_0002205
263 Ga0496126_0287069
264 Ga0501042_0493254
265 nmdc:mga03683_5314_c1
266 nmdc:mga00v17_28561_c1
267 nmdc:mga0k408_25990_c1
268 nmdc:mga0k408_28214_c1
269 nmdc:mga0k408_75215_c1
270 nmdc:mga06z11_4719_c1
271 nmdc:mga05p37_50958_c1
272 nmdc:mga05p37_690838_c1
273 nmdc:mga05p37_946099_c1
274 nmdc:mga0qj67_44512_c1
275 nmdc:mga08y16_422614_c1
276 nmdc:mga08y16_854478_c1
277 nmdc:mga0n895_658977_c1
278 nmdc:mga0n895_76841_c1
279 nmdc:mga0rr50_252853_c1
280 nmdc:mga0a205_46091_c2
281 Ga0495619_0041978
282 Ga0500644_0000482
283 Ga0500651_0000457
284 Ga0500651_0000557
285 Ga0500651_0108928
286 Ga0500651_0298987
287 Ga0500595_005858
288 Ga0500655_008813
289 Ga0500616_0000001
290 Ga0500645_000998

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13649

Methyltransf_25

Methyltransferase domain

93

184

0.9

PF08241

Methyltransf_11

Methyltransferase domain

94

188

0.89

PF08242

Methyltransf_12

Methyltransferase domain

94

184

0.85

PF13847

Methyltransf_31

Methyltransferase domain

87

224

0.84

PF13489

Methyltransf_23

Methyltransferase domain

68

229

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ege-assembly1.cif.gz_A crystal structure of putative methyltransferase from antibiotic biosynthesis pathway (yp_324569.1) from anabaena variabilis atcc 29413 at 2.40 a resolution 0.8615 61 166
5dpl-assembly1.cif.gz_B the structure of pkmt2 from rickettsia typhi in complex with adohcy 0.8497 76 159
7pd7-assembly1.cif.gz_A crocagin methyl transferase cgnl 0.8354 60 168
2o57-assembly2.cif.gz_C crystal structure of a putative sarcosine dimethylglycine methyltransferase from galdieria sulphuraria 0.8319 58 168
3ccf-assembly1.cif.gz_A crystal structure of putative methyltransferase (yp_321342.1) from anabaena variabilis atcc 29413 at 1.90 a resolution 0.8228 64 160
ID Description Score Start End Superfamily
af_P9WFR3_19_228_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8738 59 168 3.40.50.150
af_A0A1D6HKL4_97_377_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8568 61 168 3.40.50.150
af_Q80WQ4_26_187_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8564 63 179 3.40.50.150
3egeA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8484 61 166 3.40.50.150
af_Q5ZAM6_92_238_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8483 67 166 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A1G3HBB2-F1-model_v4 SAM-dependent methyltransferase 0.9958 62 220 GO:0008757
GO:0032259
AF-A0A2E3XTZ0-F1-model_v4 SAM-dependent methyltransferase 0.9862 3 220 GO:0008757
GO:0032259
AF-A0A0F9D7A4-F1-model_v4 Methyltransferase domain-containing protein 0.9845 69 218 GO:0008168
AF-A0A533RNP5-F1-model_v4 Class I SAM-dependent methyltransferase 0.9843 3 220 GO:0008168
GO:0032259
AF-A0A1J5D1Q4-F1-model_v4 Methyltransferase domain-containing protein 0.9843 62 220

Map