F183475

General Info

Members Datasets Scaffolds Average Seq Length
141 106 282 139

Family's Representative Sequence

Representative Sequence 3300044684|Ga0466966_0035605|Ga0466966_0035605_652_1125
Length 157
Sequence LLPAAHKAHGGKKTDSRGGRRMSLEDCRIIELPKIHDPRGNLTFIESNNQIPFAIERVYYLYDVPGGSERGGHAHKGLHQLIVAMSGSFDVVLDDGKDKKRVHLSRSYYGLYVCPMIWRELDNFSSGSVCMVLASNKYDEDDYYRDYSEFMRARWHA

Samples

Sample ID Description Type Environment
1 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
7 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
8 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
9 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
10 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
11 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
12 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
16 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
17 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
18 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
19 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
20 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
21 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
22 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
23 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
24 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
25 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
26 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
27 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
28 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
29 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
33 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
34 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
35 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
36 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
37 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
38 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
39 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
40 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
41 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
42 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
43 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
44 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
45 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
46 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
47 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
48 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
49 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
50 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
51 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
52 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
53 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
54 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
55 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
56 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
57 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
58 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
59 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
60 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
61 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
62 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
63 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
64 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
65 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
66 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
67 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
68 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
69 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
70 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
71 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
72 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
73 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
74 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
75 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
76 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
77 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
78 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
79 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
80 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
81 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
82 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
83 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
84 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
85 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
86 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
87 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
88 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
89 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
90 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
91 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
92 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
93 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
94 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
95 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
96 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
97 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
98 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
99 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
100 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
101 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
102 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
103 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
104 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
105 2643221544 Pelomonas sp. Root1444 Isolate Unclassified
106 2738541337 Pelomonas sp. BT06 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.58
Metatranscriptomes 0
Isolates 1.42

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.18
Nodule 0
Rhizoplane 1.42
Rhizosphere 73.76
Stem 0
Stem Tuber 0
Unclassified 13.48

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466966_0035605 3300044684 Bacteria 3215
2 JGI24740J21852_10001952 3300001979 Bacteria 9441
3 JGI25159J45721_1000090 3300002987 Bacteria 43639
4 rootL2_10107965 3300003322 Bacteria 2144
5 rootH1_10006679 3300003323 Bacteria 27659
6 rootH1_10152532 3300003323 Bacteria 2342
7 JGI25160J50197_1000136 3300003354 Bacteria 66161
8 JGI25161J50226_1000007 3300003374 Bacteria 256181
9 Ga0055530_10009142 3300003791 Bacteria 3850
10 Ga0055530_10053758 3300003791 Bacteria 924
11 Ga0055531_10000203 3300003794 Bacteria 65490
12 Ga0055543_1000061 3300004625 Bacteria 98138
13 Ga0065165_1001162 3300005262 Bacteria 30684
14 Ga0070658_10182737 3300005327 Bacteria 1765
15 Ga0070658_10271982 3300005327 Bacteria 1441
16 Ga0070658_10414387 3300005327 Bacteria 1158
17 Ga0070682_100013142 3300005337 Bacteria 4756
18 Ga0070675_100158781 3300005354 Bacteria 1943
19 Ga0068853_100750382 3300005539 Bacteria 933
20 Ga0070672_101508798 3300005543 Bacteria 602
21 Ga0068855_100020376 3300005563 Bacteria 7954
22 Ga0068852_100149850 3300005616 Bacteria 2168
23 Ga0068851_10214096 3300005834 Bacteria 1080
24 Ga0075366_10126448 3300006195 Bacteria 1542
25 Ga0075366_10875910 3300006195 Bacteria 559
26 Ga0157374_11412014 3300013296 Bacteria 719
27 Ga0157372_11621813 3300013307 Bacteria 745
28 Ga0213872_10001074 3300021361 Bacteria 18845
29 Ga0213872_10080032 3300021361 Bacteria 1468
30 Ga0209436_100640 3300025208 Bacteria 14894
31 Ga0209130_1000184 3300025284 Bacteria 87817
32 Ga0209050_1002560 3300025298 Bacteria 15172
33 Ga0209050_1005754 3300025298 Bacteria 7644
34 Ga0207426_1000091 3300025302 Bacteria 280561
35 Ga0209257_1000017 3300025304 Bacteria 866287
36 Ga0207705_10395589 3300025909 Bacteria 1068
37 Ga0207705_10542421 3300025909 Bacteria 904
38 Ga0207650_10062862 3300025925 Bacteria 2774
39 Ga0207659_10117037 3300025926 Bacteria 2036
40 Ga0207667_10017417 3300025949 Bacteria 8087
41 Ga0207641_11898962 3300026088 Bacteria 597
42 Ga0207698_10134846 3300026142 Bacteria 2117
43 Ga0265337_1000611 3300028556 Bacteria 18856
44 Ga0265337_1002257 3300028556 Bacteria 8962
45 Ga0265323_10034790 3300028653 Unclassified 1860
46 Ga0265336_10008532 3300028666 Unclassified 3588
47 Ga0265336_10013770 3300028666 Bacteria 2691
48 Ga0265336_10029969 3300028666 Bacteria 1696
49 Ga0307515_10001640 3300028794 Bacteria 49762
50 Ga0307515_10038310 3300028794 Bacteria 7673
51 Ga0265338_10003629 3300028800 Bacteria 21489
52 Ga0265338_10014198 3300028800 Bacteria 8895
53 Ga0265338_10215331 3300028800 Bacteria 1439
54 Ga0265324_10074795 3300029957 Bacteria 1153
55 Ga0265328_10000154 3300031239 Bacteria 32453
56 Ga0265328_10001622 3300031239 Bacteria 10354
57 Ga0265320_10000750 3300031240 Bacteria 24907
58 Ga0265320_10028016 3300031240 Unclassified 2929
59 Ga0265320_10028074 3300031240 Unclassified 2925
60 Ga0265339_10006189 3300031249 Bacteria 7881
61 Ga0265339_10544989 3300031249 Unclassified 534
62 Ga0265331_10000115 3300031250 Bacteria 105212
63 Ga0265331_10467210 3300031250 Bacteria 567
64 Ga0265327_10000045 3300031251 Bacteria 282880
65 Ga0265327_10065491 3300031251 Bacteria 1837
66 Ga0265316_10403749 3300031344 Bacteria 984
67 Ga0265316_11049152 3300031344 Unclassified 566
68 Ga0265314_10082985 3300031711 Unclassified 2107
69 Ga0265342_10004763 3300031712 Bacteria 10543
70 Ga0307409_100206830 3300031995 Bacteria 1761
71 Ga0307414_10062419 3300032004 Bacteria 2644
72 Ga0307414_10097265 3300032004 Bacteria 2205
73 Ga0307411_10000469 3300032005 Bacteria 13979
74 Ga0373923_0207624 3300035111 Bacteria 907
75 Ga0373953_0115574 3300035117 Bacteria 1137
76 Ga0373956_0012443 3300035119 Bacteria 3528
77 Ga0373957_0047736 3300035120 Bacteria 1629
78 Ga0373955_0052252 3300035172 Bacteria 2229
79 Ga0373955_0201681 3300035172 Bacteria 1184
80 Ga0373927_0323014 3300035695 Bacteria 1016
81 Ga0373933_0013178 3300035724 Bacteria 4580
82 Ga0373933_0114824 3300035724 Unclassified 1682
83 Ga0373937_0012927 3300036401 Bacteria 7353
84 Ga0373937_0448967 3300036401 Bacteria 1224
85 Ga0373925_0383810 3300037068 Bacteria 1144
86 Ga0237819_00223 3300038705 Bacteria 20561
87 Ga0436361_0096994 3300039447 Bacteria 1128
88 Ga0436361_0507490 3300039447 Bacteria 19202
89 Ga0436361_0720995 3300039447 Bacteria 8366
90 Ga0451802_0774796 3300041460 Bacteria 829
91 Ga0451804_1033519 3300041463 Bacteria 596
92 Ga0451855_1326729 3300041511 Unclassified 692
93 Ga0439445_0153943 3300042004 Bacteria 670
94 Ga0451577_1085115 3300042876 Bacteria 717
95 Ga0466972_0132250 3300044658 Bacteria 1175
96 Ga0453683_0129658 3300044673 Bacteria 1588
97 Ga0453683_0702310 3300044673 Bacteria 663
98 Ga0466965_0041628 3300044683 Bacteria 2264
99 Ga0453684_0001658 3300044712 Bacteria 60385
100 Ga0453684_0118406 3300044712 Bacteria 3203
101 Ga0453684_0739581 3300044712 Archaea 1066
102 Ga0453684_0890779 3300044712 Unclassified 954
103 Ga0466957_0103964 3300044842 Bacteria 1794
104 Ga0495653_0425669 3300046463 Bacteria 839
105 Ga0495639_0351733 3300046475 Unclassified 740
106 Ga0495596_0015908 3300046500 Bacteria 3134
107 Ga0495618_0265430 3300046514 Bacteria 1074
108 Ga0495598_0017658 3300046537 Bacteria 1843
109 Ga0495667_0053774 3300046559 Unclassified 2651
110 Ga0495634_0442336 3300046642 Bacteria 768
111 Ga0495661_0439470 3300046665 Unclassified 629
112 Ga0495657_0372474 3300046675 Unclassified 843
113 Ga0495670_0116604 3300046691 Unclassified 1385
114 Ga0495589_0006894 3300046794 Bacteria 5972
115 Ga0495660_0070453 3300046810 Bacteria 1856
116 Ga0495680_0353187 3300047322 Unclassified 1023
117 Ga0495684_0075337 3300047471 Unclassified 2564
118 Ga0495686_0002609 3300047472 Bacteria 16714
119 Ga0495626_0090042 3300048091 Bacteria 1350
120 Ga0496121_0002764 3300048924 Bacteria 26033
121 Ga0496122_0048639 3300048925 Unclassified 3257
122 Ga0496125_0006558 3300048928 Bacteria 12542
123 Ga0496125_0007061 3300048928 Bacteria 11997
124 Ga0496125_0017270 3300048928 Bacteria 6890
125 Ga0496125_0061581 3300048928 Bacteria 3008
126 Ga0495682_0005597 3300049460 Bacteria 5196
127 Ga0501036_0715784 3300049572 Bacteria 827
128 Ga0501043_0000266 3300049579 Bacteria 47581
129 Ga0501046_0768945 3300049580 Unclassified 676
130 Ga0501047_0098813 3300049581 Bacteria 2797
131 Ga0501223_021390 3300049663 Bacteria 1265
132 Ga0501227_024023 3300049665 Bacteria 1420
133 Ga0501262_016478 3300049759 Bacteria 978
134 Ga0500644_0002037 3300053088 Bacteria 5130
135 Ga0500559_0280332 3300053136 Bacteria 784
136 Ga0500616_0040274 3300053153 Bacteria 2514
137 Ga0500616_0172256 3300053153 Bacteria 982
138 Ga0590075_024317 3300059424 Bacteria 1520
139 Ga0466962_0387734 3300061719 Bacteria 698
140 2643745607 2643221544 Bacteria 5886209
141 2739058725 2738541337 Bacteria 6183410
142 Ga0466966_0035605
143 JGI24740J21852_10001952
144 JGI25159J45721_1000090
145 rootL2_10107965
146 rootH1_10006679
147 rootH1_10152532
148 JGI25160J50197_1000136
149 JGI25161J50226_1000007
150 Ga0055530_10009142
151 Ga0055530_10053758
152 Ga0055531_10000203
153 Ga0055543_1000061
154 Ga0065165_1001162
155 Ga0070658_10182737
156 Ga0070658_10271982
157 Ga0070658_10414387
158 Ga0070682_100013142
159 Ga0070675_100158781
160 Ga0068853_100750382
161 Ga0070672_101508798
162 Ga0068855_100020376
163 Ga0068852_100149850
164 Ga0068851_10214096
165 Ga0075366_10126448
166 Ga0075366_10875910
167 Ga0157374_11412014
168 Ga0157372_11621813
169 Ga0213872_10001074
170 Ga0213872_10080032
171 Ga0209436_100640
172 Ga0209130_1000184
173 Ga0209050_1002560
174 Ga0209050_1005754
175 Ga0207426_1000091
176 Ga0209257_1000017
177 Ga0207705_10395589
178 Ga0207705_10542421
179 Ga0207650_10062862
180 Ga0207659_10117037
181 Ga0207667_10017417
182 Ga0207641_11898962
183 Ga0207698_10134846
184 Ga0265337_1000611
185 Ga0265337_1002257
186 Ga0265323_10034790
187 Ga0265336_10008532
188 Ga0265336_10013770
189 Ga0265336_10029969
190 Ga0307515_10001640
191 Ga0307515_10038310
192 Ga0265338_10003629
193 Ga0265338_10014198
194 Ga0265338_10215331
195 Ga0265324_10074795
196 Ga0265328_10000154
197 Ga0265328_10001622
198 Ga0265320_10000750
199 Ga0265320_10028016
200 Ga0265320_10028074
201 Ga0265339_10006189
202 Ga0265339_10544989
203 Ga0265331_10000115
204 Ga0265331_10467210
205 Ga0265327_10000045
206 Ga0265327_10065491
207 Ga0265316_10403749
208 Ga0265316_11049152
209 Ga0265314_10082985
210 Ga0265342_10004763
211 Ga0307409_100206830
212 Ga0307414_10062419
213 Ga0307414_10097265
214 Ga0307411_10000469
215 Ga0373923_0207624
216 Ga0373953_0115574
217 Ga0373956_0012443
218 Ga0373957_0047736
219 Ga0373955_0052252
220 Ga0373955_0201681
221 Ga0373927_0323014
222 Ga0373933_0013178
223 Ga0373933_0114824
224 Ga0373937_0012927
225 Ga0373937_0448967
226 Ga0373925_0383810
227 Ga0237819_00223
228 Ga0436361_0096994
229 Ga0436361_0507490
230 Ga0436361_0720995
231 Ga0451802_0774796
232 Ga0451804_1033519
233 Ga0451855_1326729
234 Ga0439445_0153943
235 Ga0451577_1085115
236 Ga0466972_0132250
237 Ga0453683_0129658
238 Ga0453683_0702310
239 Ga0466965_0041628
240 Ga0453684_0001658
241 Ga0453684_0118406
242 Ga0453684_0739581
243 Ga0453684_0890779
244 Ga0466957_0103964
245 Ga0495653_0425669
246 Ga0495639_0351733
247 Ga0495596_0015908
248 Ga0495618_0265430
249 Ga0495598_0017658
250 Ga0495667_0053774
251 Ga0495634_0442336
252 Ga0495661_0439470
253 Ga0495657_0372474
254 Ga0495670_0116604
255 Ga0495589_0006894
256 Ga0495660_0070453
257 Ga0495680_0353187
258 Ga0495684_0075337
259 Ga0495686_0002609
260 Ga0495626_0090042
261 Ga0496121_0002764
262 Ga0496122_0048639
263 Ga0496125_0006558
264 Ga0496125_0007061
265 Ga0496125_0017270
266 Ga0496125_0061581
267 Ga0495682_0005597
268 Ga0501036_0715784
269 Ga0501043_0000266
270 Ga0501046_0768945
271 Ga0501047_0098813
272 Ga0501223_021390
273 Ga0501227_024023
274 Ga0501262_016478
275 Ga0500644_0002037
276 Ga0500559_0280332
277 Ga0500616_0040274
278 Ga0500616_0172256
279 Ga0590075_024317
280 Ga0466962_0387734
281 2643745607
282 2739058725

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05523

FdtA

WxcM-like, C-terminal

25

155

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
7n67-assembly1.cif.gz_B crystal structure of hcan_0198, a 3,4-ketoisomerase from helicobacter canadensis 0.9745 5 135
5tpu-assembly1.cif.gz_B x-ray structure of the wlarb tdp-quinovose 3,4-ketoisomerase from campylobacter jejuni 0.9645 3 131
4o9e-assembly1.cif.gz_B crystal structure of qdta, a sugar 3,4-ketoisemerase from thermoanaerobacterium thermosaccharolyticum in complex with tdp 0.9627 2 134
4o9g-assembly1.cif.gz_B crystal structure of the h51n mutant of the 3,4-ketoisomerase qdta from thermoanaerobacterium thermosaccharolyticum in complex with tdp-4-keto-6-deoxyglucose 0.9627 2 132
4zu7-assembly2.cif.gz_C x-ray structure if the qdta 3,4-ketoisomerase from thermoanaerobacterium thermosaccharolyticum, double mutant y17r/r97h, in complex with tdp 0.9566 2 132
ID Description Score Start End Superfamily
2pa7A00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.959 8 134 2.60.120.10
5tpvC00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9508 6 133 2.60.120.10
4mzuI02 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9307 1 134 2.60.120.10
5tpvC00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9229 6 133 2.60.120.10
4mzuI02 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9176 1 134 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A2H0IUP3-F1-model_v4 Erythromycin biosynthesis sensory transduction protein eryC1 1.001 2 133 GO:0000271
GO:0008483
GO:0030170
AF-A0A6G1V4J2-F1-model_v4 deleted 1.001 53 134
AF-A0A257DG64-F1-model_v4 Sugar 3,4-ketoisomerase QdtA cupin domain-containing protein 0.9971 1 134
AF-A0A7V9U2N5-F1-model_v4 WxcM-like domain-containing protein 0.9968 1 133
AF-A0A127STZ8-F1-model_v4 WxcM-like, C-terminal 0.9968 16 132

Map