F183406

General Info

Members Datasets Scaffolds Average Seq Length
141 99 282 158

Family's Representative Sequence

Representative Sequence 3300042006|Ga0439432_119105|Ga0439432_119105_78_653
Length 191
Sequence LPVLVLCSSAQQSRLPLQLTCRHSILDMAGITGNQMINNDVLRSIRYMLDLGDAHVVEISKLPDPGFVIAKEDVQAFLKKEDEPGYVECSDRVLAHFLDGLVIHHRGRDDSLPPRPVEKRITNNVVLKKLRVAFELKDADMHQAFADAGFPLSKPELSALFRQPGHKNFRACGDQLLRNFLKGLTLRVRGG

Samples

Sample ID Description Type Environment
1 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
2 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
3 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
4 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
5 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
6 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
7 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
8 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
9 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
10 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
11 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
12 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
13 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
14 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
15 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
16 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
17 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
18 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
19 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
20 3300012491 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.8.old.040610 Metagenome Rhizosphere
21 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
22 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
23 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
24 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
25 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
26 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
27 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
28 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
29 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
30 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
31 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
32 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
33 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
34 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
35 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
45 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
46 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
47 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
48 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
49 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
50 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
51 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
52 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
53 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
54 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
55 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
56 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
57 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
58 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
59 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
60 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
61 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
62 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
63 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
64 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
65 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
66 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
67 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
68 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
69 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
70 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
71 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
72 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
73 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
74 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
75 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
76 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
77 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
78 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
79 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
80 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
81 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
82 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
83 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
84 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
85 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
86 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
87 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
88 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
89 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
90 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
91 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
92 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
93 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
94 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
95 3300049772 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control Metagenome Rhizosphere
96 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
97 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
98 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
99 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.77
Nodule 0
Rhizoplane 9.93
Rhizosphere 56.74
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0439432_119105 3300042006 Bacteria 782
2 JGI25152J39213_1000033 3300002773 Bacteria 95187
3 JGI25150J39212_1000310 3300002774 Bacteria 24161
4 JGI25151J46595_10000142 3300003187 Bacteria 95187
5 JGI25153J46596_10000107 3300003215 Bacteria 95187
6 Ga0055531_10010269 3300003794 Bacteria 4676
7 Ga0070688_100179814 3300005365 Bacteria 1466
8 Ga0070663_100404894 3300005455 Bacteria 1116
9 Ga0070685_10008024 3300005466 Bacteria 5412
10 Ga0070679_101314154 3300005530 Bacteria 669
11 Ga0070672_100019639 3300005543 Bacteria 4908
12 Ga0070665_100034726 3300005548 Bacteria 5072
13 Ga0070665_100111199 3300005548 Bacteria 2742
14 Ga0070704_101476317 3300005549 Bacteria 625
15 Ga0068854_101205575 3300005578 Bacteria 678
16 Ga0068852_100010711 3300005616 Bacteria 6865
17 Ga0075364_10000300 3300006051 Bacteria 24079
18 Ga0075364_10014924 3300006051 Bacteria 4809
19 Ga0075364_10125031 3300006051 Bacteria 1723
20 Ga0105248_10000930 3300009177 Bacteria 32616
21 Ga0105237_10001014 3300009545 Bacteria 37785
22 Ga0105239_10137553 3300010375 Bacteria 2720
23 Ga0157329_1005747 3300012491 Bacteria 851
24 Ga0157345_1024438 3300012498 Bacteria 638
25 Ga0157371_11107691 3300013102 Bacteria 607
26 Ga0157369_10009495 3300013105 Bacteria 11122
27 Ga0157372_10065697 3300013307 Bacteria 4074
28 Ga0157372_10344972 3300013307 Bacteria 1735
29 Ga0182008_10489014 3300014497 Bacteria 675
30 Ga0157376_10637260 3300014969 Bacteria 1065
31 Ga0182006_1009928 3300015261 Bacteria 4255
32 Ga0182006_1019801 3300015261 Bacteria 2828
33 Ga0183369_1012 3300015685 Bacteria 251554
34 Ga0183361_10442 3300016635 Bacteria 1782
35 Ga0163161_10007101 3300017792 Bacteria 7742
36 Ga0163161_10184099 3300017792 Bacteria 1603
37 Ga0209129_1000101 3300025258 Bacteria 161931
38 Ga0209025_1000048 3300025294 Bacteria 335574
39 Ga0209758_1000056 3300025297 Bacteria 335574
40 Ga0209257_1000078 3300025304 Bacteria 317483
41 Ga0207671_10016516 3300025914 Bacteria 5732
42 Ga0207657_10579966 3300025919 Bacteria 876
43 Ga0207691_10326937 3300025940 Bacteria 1314
44 Ga0207668_10002592 3300025972 Bacteria 10569
45 Ga0207678_10336705 3300026067 Bacteria 1300
46 Ga0207674_10812304 3300026116 Bacteria 902
47 Ga0207683_10090986 3300026121 Bacteria 2718
48 Ga0207698_10067750 3300026142 Bacteria 2816
49 Ga0268266_10055548 3300028379 Bacteria 3404
50 Ga0268266_10422011 3300028379 Bacteria 1264
51 Ga0316177_1016221 3300030731 Bacteria 1989
52 Ga0314311_1084423 3300030733 Bacteria 1277
53 Ga0316183_1117578 3300030742 Bacteria 1384
54 Ga0316182_1057231 3300030745 Bacteria 986
55 Ga0307513_10185374 3300031456 Bacteria 1939
56 Ga0307516_10004748 3300031730 Bacteria 16602
57 Ga0307412_10001898 3300031911 Bacteria 11556
58 Ga0307414_10000298 3300032004 Bacteria 29057
59 Ga0307414_10084423 3300032004 Bacteria 2335
60 Ga0307414_10121707 3300032004 Bacteria 2007
61 Ga0307414_10179685 3300032004 Bacteria 1700
62 Ga0307414_10258622 3300032004 Bacteria 1451
63 Ga0307414_10278805 3300032004 Bacteria 1403
64 Ga0307414_10307787 3300032004 Bacteria 1343
65 Ga0307414_10364060 3300032004 Bacteria 1245
66 Ga0307414_10650250 3300032004 Bacteria 950
67 Ga0307415_100904703 3300032126 Bacteria 814
68 Ga0395899_0047806 3300037312 Bacteria 3185
69 Ga0395900_0178237 3300037418 Bacteria 2161
70 Ga0395900_0280368 3300037418 Bacteria 1659
71 Ga0395898_0002604 3300037466 Bacteria 21051
72 Ga0395901_0020475 3300038443 Bacteria 6770
73 Ga0237819_00356 3300038705 Bacteria 16343
74 Ga0439465_0000106 3300041413 Bacteria 19204
75 Ga0439465_0003838 3300041413 Bacteria 4903
76 Ga0451789_0699006 3300041443 Bacteria 1856
77 Ga0451791_0323511 3300041451 Bacteria 939
78 Ga0451797_0907702 3300041453 Bacteria 1145
79 Ga0451798_0367560 3300041458 Bacteria 1099
80 Ga0451802_0009836 3300041460 Bacteria 995
81 Ga0451802_0540584 3300041460 Bacteria 6362
82 Ga0451802_0562207 3300041460 Bacteria 579
83 Ga0451802_1302190 3300041460 Bacteria 1936
84 Ga0451802_1556153 3300041460 Bacteria 674
85 Ga0451804_0920854 3300041463 Bacteria 924
86 Ga0451807_0073782 3300041486 Bacteria 3186
87 Ga0451807_0752635 3300041486 Bacteria 681
88 Ga0451807_2736333 3300041486 Bacteria 1775
89 Ga0451833_1325662 3300041491 Bacteria 646
90 Ga0451837_0018264 3300041494 Bacteria 4263
91 Ga0451837_0042830 3300041494 Bacteria 2447
92 Ga0451837_0806350 3300041494 Bacteria 920
93 Ga0451837_0841504 3300041494 Bacteria 589
94 Ga0451837_1657407 3300041494 Bacteria 1446
95 Ga0451843_0137801 3300041509 Bacteria 778
96 Ga0451843_1386084 3300041509 Bacteria 1230
97 Ga0451843_1507787 3300041509 Bacteria 1950
98 Ga0451853_0020289 3300041512 Bacteria 1303
99 Ga0451853_1362955 3300041512 Bacteria 967
100 Ga0439431_0081401 3300041997 Bacteria 873
101 Ga0439432_160736 3300042006 Bacteria 657
102 Ga0439449_0021636 3300042007 Bacteria 2408
103 Ga0439457_085418 3300042014 Bacteria 727
104 Ga0450911_000911 3300042115 Bacteria 7867
105 Ga0450905_002038 3300042142 Bacteria 2579
106 Ga0495638_0082808 3300046460 Bacteria 1945
107 Ga0495638_0139270 3300046460 Bacteria 1418
108 Ga0495616_0054420 3300046513 Bacteria 1985
109 Ga0495663_0000695 3300046525 Bacteria 11575
110 Ga0495663_0002423 3300046525 Bacteria 5605
111 Ga0495663_0022082 3300046525 Bacteria 1836
112 Ga0495598_0089841 3300046537 Bacteria 1000
113 Ga0495633_0008474 3300046558 Bacteria 5782
114 Ga0495671_0003112 3300046692 Bacteria 10309
115 Ga0495672_0072825 3300047320 Bacteria 1939
116 Ga0495686_0095292 3300047472 Bacteria 1802
117 Ga0496113_0168155 3300048916 Bacteria 1736
118 Ga0496116_0002397 3300048919 Bacteria 19749
119 Ga0496117_0073840 3300048920 Bacteria 2273
120 Ga0496118_0035283 3300048921 Bacteria 4064
121 Ga0496119_0217061 3300048922 Bacteria 981
122 Ga0496120_0148502 3300048923 Bacteria 1181
123 Ga0496120_0201642 3300048923 Bacteria 963
124 Ga0496121_0023871 3300048924 Bacteria 5868
125 Ga0496121_0496702 3300048924 Bacteria 775
126 Ga0496122_0000719 3300048925 Bacteria 64886
127 Ga0496122_0034828 3300048925 Bacteria 4111
128 Ga0496122_0088143 3300048925 Bacteria 2128
129 Ga0496123_0000325 3300048926 Bacteria 90905
130 Ga0496123_0009025 3300048926 Bacteria 9043
131 Ga0496123_0084263 3300048926 Bacteria 1917
132 Ga0501034_0031716 3300049571 Bacteria 5367
133 Ga0501048_0100332 3300049582 Bacteria 2042
134 Ga0501225_0016111 3300049705 Bacteria 2078
135 Ga0501275_000267 3300049772 Bacteria 5969
136 nmdc:mga00v17_20765_c1 3300050491 Bacteria 3767
137 nmdc:mga00v17_265_c1 3300050491 Bacteria 30890
138 nmdc:mga00v17_37617_c1 3300050491 Bacteria 2891
139 Ga0500597_000025 3300053120 Bacteria 32403
140 Ga0500577_0144667 3300053142 Bacteria 1005
141 Ga0500609_038913 3300053731 Bacteria 657
142 Ga0439432_119105
143 JGI25152J39213_1000033
144 JGI25150J39212_1000310
145 JGI25151J46595_10000142
146 JGI25153J46596_10000107
147 Ga0055531_10010269
148 Ga0070688_100179814
149 Ga0070663_100404894
150 Ga0070685_10008024
151 Ga0070679_101314154
152 Ga0070672_100019639
153 Ga0070665_100034726
154 Ga0070665_100111199
155 Ga0070704_101476317
156 Ga0068854_101205575
157 Ga0068852_100010711
158 Ga0075364_10000300
159 Ga0075364_10014924
160 Ga0075364_10125031
161 Ga0105248_10000930
162 Ga0105237_10001014
163 Ga0105239_10137553
164 Ga0157329_1005747
165 Ga0157345_1024438
166 Ga0157371_11107691
167 Ga0157369_10009495
168 Ga0157372_10065697
169 Ga0157372_10344972
170 Ga0182008_10489014
171 Ga0157376_10637260
172 Ga0182006_1009928
173 Ga0182006_1019801
174 Ga0183369_1012
175 Ga0183361_10442
176 Ga0163161_10007101
177 Ga0163161_10184099
178 Ga0209129_1000101
179 Ga0209025_1000048
180 Ga0209758_1000056
181 Ga0209257_1000078
182 Ga0207671_10016516
183 Ga0207657_10579966
184 Ga0207691_10326937
185 Ga0207668_10002592
186 Ga0207678_10336705
187 Ga0207674_10812304
188 Ga0207683_10090986
189 Ga0207698_10067750
190 Ga0268266_10055548
191 Ga0268266_10422011
192 Ga0316177_1016221
193 Ga0314311_1084423
194 Ga0316183_1117578
195 Ga0316182_1057231
196 Ga0307513_10185374
197 Ga0307516_10004748
198 Ga0307412_10001898
199 Ga0307414_10000298
200 Ga0307414_10084423
201 Ga0307414_10121707
202 Ga0307414_10179685
203 Ga0307414_10258622
204 Ga0307414_10278805
205 Ga0307414_10307787
206 Ga0307414_10364060
207 Ga0307414_10650250
208 Ga0307415_100904703
209 Ga0395899_0047806
210 Ga0395900_0178237
211 Ga0395900_0280368
212 Ga0395898_0002604
213 Ga0395901_0020475
214 Ga0237819_00356
215 Ga0439465_0000106
216 Ga0439465_0003838
217 Ga0451789_0699006
218 Ga0451791_0323511
219 Ga0451797_0907702
220 Ga0451798_0367560
221 Ga0451802_0009836
222 Ga0451802_0540584
223 Ga0451802_0562207
224 Ga0451802_1302190
225 Ga0451802_1556153
226 Ga0451804_0920854
227 Ga0451807_0073782
228 Ga0451807_0752635
229 Ga0451807_2736333
230 Ga0451833_1325662
231 Ga0451837_0018264
232 Ga0451837_0042830
233 Ga0451837_0806350
234 Ga0451837_0841504
235 Ga0451837_1657407
236 Ga0451843_0137801
237 Ga0451843_1386084
238 Ga0451843_1507787
239 Ga0451853_0020289
240 Ga0451853_1362955
241 Ga0439431_0081401
242 Ga0439432_160736
243 Ga0439449_0021636
244 Ga0439457_085418
245 Ga0450911_000911
246 Ga0450905_002038
247 Ga0495638_0082808
248 Ga0495638_0139270
249 Ga0495616_0054420
250 Ga0495663_0000695
251 Ga0495663_0002423
252 Ga0495663_0022082
253 Ga0495598_0089841
254 Ga0495633_0008474
255 Ga0495671_0003112
256 Ga0495672_0072825
257 Ga0495686_0095292
258 Ga0496113_0168155
259 Ga0496116_0002397
260 Ga0496117_0073840
261 Ga0496118_0035283
262 Ga0496119_0217061
263 Ga0496120_0148502
264 Ga0496120_0201642
265 Ga0496121_0023871
266 Ga0496121_0496702
267 Ga0496122_0000719
268 Ga0496122_0034828
269 Ga0496122_0088143
270 Ga0496123_0000325
271 Ga0496123_0009025
272 Ga0496123_0084263
273 Ga0501034_0031716
274 Ga0501048_0100332
275 Ga0501225_0016111
276 Ga0501275_000267
277 nmdc:mga00v17_20765_c1
278 nmdc:mga00v17_265_c1
279 nmdc:mga00v17_37617_c1
280 Ga0500597_000025
281 Ga0500577_0144667
282 Ga0500609_038913

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07308

DUF1456

Protein of unknown function (DUF1456)

123

190

1

PF07308

DUF1456

Protein of unknown function (DUF1456)

38

107

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
4z31-assembly1.cif.gz_B crystal structure of the rc3h2 roq domain in complex with stem-loop and double-stranded forms of rna 0.29 88 150
4z31-assembly1.cif.gz_A crystal structure of the rc3h2 roq domain in complex with stem-loop and double-stranded forms of rna 0.29 88 150
1egm-assembly1.cif.gz_A crystal structure of diol dehydratase-cyanocobalamin complex at 100k. 0.2888 62 154
6rqt-assembly1.cif.gz_O rna polymerase i-twh-rrn3-dna 0.2694 17 155
6cth-assembly1.cif.gz_A crystal structure of pathogenesis-related protein 1g (pr-1g) kinase domain from cacao 0.2541 52 152
ID Description Score Start End Superfamily
2rfgB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.3313 50 154 3.20.20.70
5yrtJ00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Diol/glycerol dehydratase, large subunit 0.3182 86 154 3.20.20.350
af_Q9URX8_499_810_1.20.58.1780 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.3118 41 156 1.20.58.1780
af_K7TU41_105_396_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.3103 63 154 3.40.50.300
af_A0A1D8PFH4_1327_1449_1.20.120.330 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Nucleotidyltransferases 0.2815 63 155 1.20.120.330
ID Description Score Start End GO Terms
AF-A0A3M3XLN9-F1-model_v4 Uncharacterized protein 0.9926 85 155
AF-A0A4R4IBT6-F1-model_v4 DUF1456 family protein 0.9885 1 154
AF-A0A2X2CM77-F1-model_v4 Protein of uncharacterized function (DUF1456) 0.9876 93 152
AF-A0A368ZF82-F1-model_v4 Uncharacterized protein DUF1456 0.9873 87 155
AF-A0A2A4WGZ7-F1-model_v4 Uncharacterized protein 0.9872 86 155

Map