F496945

General Info

Members Datasets Scaffolds Average Seq Length
2605 474 2605 131

Family's Representative Sequence

Representative Sequence 3300009094|Ga0111539_10790177|Ga0111539_107901772
Length 156
Sequence VKVLALDYGAARTGVAVSDPTGTLARPLEVVGRAASPPGLARLAELVRLEEAERVVVGLPLTLRGEHGAQAEETARFVEALRGVVDVPVETFDERFTTALAGQDSGVAEEDARAAAHLLASYLEWTSSRPACASARAADGSRSWPRRGSARARRPF

Samples

Sample ID Description Type Environment
1 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
2 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
3 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
4 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
5 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
21 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
33 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
34 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
35 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
36 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
37 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
38 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
39 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
40 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
41 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
42 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
43 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
44 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
45 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
46 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
47 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
48 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
49 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
50 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
51 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
52 3300005507 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v2 (version 2) Metagenome Rhizosphere
53 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
54 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
55 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
56 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
57 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
58 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
59 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
60 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
61 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
62 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
63 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
64 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
65 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
66 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
67 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
68 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
69 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
70 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
71 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
72 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
73 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
74 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
75 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
76 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
77 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
78 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
79 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
80 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
81 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
82 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
83 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
84 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
85 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
86 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
87 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
88 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
89 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
90 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
91 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
92 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
93 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
94 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
95 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
96 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
97 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
98 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
99 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
100 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
101 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
102 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
103 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
104 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
105 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
106 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
107 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
108 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
109 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
110 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
111 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
112 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
113 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
114 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
115 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
116 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
117 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
118 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
119 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
120 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
121 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
122 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
123 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
124 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
125 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
126 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
127 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
128 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
129 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
130 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
131 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
132 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
133 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
134 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
135 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
136 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
137 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
138 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
139 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
140 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
141 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
142 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
143 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
144 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
208 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
209 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
213 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
214 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
215 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
216 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
217 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
218 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
219 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
220 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
221 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
222 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
223 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
224 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
225 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
226 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
227 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
228 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
229 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
230 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
231 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
232 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
233 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
234 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
235 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
236 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
237 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
238 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
239 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
240 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
241 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
242 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
243 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
244 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
245 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
246 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
247 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
248 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
249 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
250 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
251 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
252 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
253 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
254 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
255 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
256 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
257 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
258 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
259 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
260 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
261 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
262 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
263 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
264 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
265 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
266 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
267 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
268 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
269 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
270 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
271 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
272 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
273 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
274 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
275 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
276 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
277 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
278 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
279 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
280 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
281 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
282 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
283 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
284 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
285 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
286 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
287 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
288 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
289 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
290 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
291 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
292 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
293 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
294 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
295 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
296 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
297 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
298 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
299 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
300 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
301 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
302 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
303 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
304 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
305 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
306 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
307 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
308 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
309 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
310 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
311 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
312 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
313 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
314 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
315 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
316 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
317 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
318 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
319 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
320 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
321 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
322 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
323 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
324 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
325 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
326 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
327 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
328 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
329 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
330 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
331 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
332 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
333 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
334 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
335 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
336 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
337 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
338 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
339 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
340 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
341 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
342 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
343 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
344 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
345 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
346 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
347 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
348 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
349 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
350 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
351 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
352 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
353 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
354 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
355 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
356 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
357 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
358 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
359 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
360 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
361 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
362 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
363 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
364 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
365 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
366 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
367 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
368 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
369 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
370 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
371 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
372 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
373 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
374 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
375 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
376 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
377 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
378 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
379 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
380 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
381 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
382 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
383 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
384 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
385 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
386 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
387 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
388 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
389 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
390 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
391 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
392 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
393 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
394 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
395 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
396 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
397 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
398 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
399 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
400 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
401 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
402 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
403 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
404 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
405 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
406 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
407 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
408 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
409 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
410 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
411 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
412 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
413 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
414 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
415 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
416 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
417 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
418 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
419 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
420 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
421 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
422 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
423 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
424 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
425 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
426 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
427 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
428 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
429 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
430 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
431 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
432 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
433 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
434 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
435 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
436 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
437 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
438 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
439 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
440 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
441 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
442 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
443 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
444 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
445 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
446 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
447 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
448 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
449 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
450 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
451 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
452 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
453 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
454 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
455 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
456 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
457 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
458 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
459 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
460 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
461 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
462 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
463 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
464 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
465 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
466 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
467 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
468 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
469 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
470 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
471 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
472 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
473 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
474 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.58
Metatranscriptomes 0.42
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.27
Nodule 0
Rhizoplane 10.13
Rhizosphere 89.33
Stem 0
Stem Tuber 0
Unclassified 0.27

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24737J22298_10088119 3300001990 Unclassified 921
2 JGI24749J21850_1034484 3300002076 Bacteria 732
3 JGI24744J21845_10007629 3300002077 Unclassified 2235
4 JGI24742J22300_10010854 3300002244 Bacteria 1510
5 JGI25406J46586_10099668 3300003203 Bacteria 868
6 rootH1_10353615 3300003323 Bacteria 1394
7 JGI25407J50210_10000981 3300003373 Bacteria 6177
8 JGI25407J50210_10055418 3300003373 Bacteria 1000
9 Ga0070658_10007519 3300005327 Bacteria 8793
10 Ga0070658_10058099 3300005327 Bacteria 3147
11 Ga0070658_10072865 3300005327 Bacteria 2816
12 Ga0070658_10179413 3300005327 Bacteria 1782
13 Ga0070658_10344550 3300005327 Bacteria 1275
14 Ga0070658_11825187 3300005327 Unclassified 526
15 Ga0070676_10352535 3300005328 Bacteria 1012
16 Ga0070683_100001832 3300005329 Bacteria 16576
17 Ga0070683_100002787 3300005329 Bacteria 13976
18 Ga0070683_100011298 3300005329 Bacteria 7710
19 Ga0070683_100092821 3300005329 Bacteria 2835
20 Ga0070683_100121782 3300005329 Bacteria 2465
21 Ga0070683_100170355 3300005329 Bacteria 2067
22 Ga0070683_100457846 3300005329 Unclassified 1217
23 Ga0070683_100507787 3300005329 Bacteria 1152
24 Ga0070683_100741587 3300005329 Unclassified 941
25 Ga0070683_101275318 3300005329 Unclassified 706
26 Ga0070683_101414154 3300005329 Unclassified 668
27 Ga0070683_101919322 3300005329 Bacteria 569
28 Ga0070690_100027686 3300005330 Bacteria 3505
29 Ga0070690_100063794 3300005330 Bacteria 2378
30 Ga0070670_100031063 3300005331 Bacteria 4600
31 Ga0070670_100257154 3300005331 Bacteria 1522
32 Ga0068869_100010268 3300005334 Bacteria 6101
33 Ga0068869_100251667 3300005334 Bacteria 1411
34 Ga0068869_100343046 3300005334 Bacteria 1216
35 Ga0068869_100712624 3300005334 Bacteria 857
36 Ga0068869_101241562 3300005334 Unclassified 656
37 Ga0070666_10052549 3300005335 Bacteria 2746
38 Ga0070666_10538123 3300005335 Bacteria 849
39 Ga0070680_100074347 3300005336 Bacteria 2796
40 Ga0070680_100079913 3300005336 Bacteria 2696
41 Ga0070680_100120437 3300005336 Bacteria 2190
42 Ga0070680_100160776 3300005336 Bacteria 1887
43 Ga0070680_100241847 3300005336 Bacteria 1526
44 Ga0070680_100582390 3300005336 Bacteria 960
45 Ga0070682_100007524 3300005337 Bacteria 6140
46 Ga0070682_100056900 3300005337 Unclassified 2461
47 Ga0070682_100083992 3300005337 Bacteria 2068
48 Ga0070682_100703178 3300005337 Bacteria 811
49 Ga0070682_101301044 3300005337 Bacteria 618
50 Ga0070682_101823976 3300005337 Bacteria 531
51 Ga0068868_100038831 3300005338 Bacteria 3696
52 Ga0068868_100040437 3300005338 Bacteria 3629
53 Ga0068868_100118688 3300005338 Unclassified 2156
54 Ga0068868_100150429 3300005338 Bacteria 1917
55 Ga0068868_100253416 3300005338 Bacteria 1482
56 Ga0068868_100353712 3300005338 Bacteria 1259
57 Ga0068868_100393157 3300005338 Bacteria 1195
58 Ga0068868_100713706 3300005338 Bacteria 898
59 Ga0068868_100857904 3300005338 Bacteria 823
60 Ga0070660_100004247 3300005339 Bacteria 9893
61 Ga0070660_100008515 3300005339 Bacteria 7179
62 Ga0070660_100073397 3300005339 Bacteria 2675
63 Ga0070660_100110648 3300005339 Bacteria 2185
64 Ga0070660_100165983 3300005339 Bacteria 1781
65 Ga0070660_100246358 3300005339 Bacteria 1456
66 Ga0070660_100247328 3300005339 Bacteria 1453
67 Ga0070660_100332757 3300005339 Unclassified 1249
68 Ga0070660_100335750 3300005339 Bacteria 1243
69 Ga0070660_100522402 3300005339 Bacteria 989
70 Ga0070689_100096706 3300005340 Bacteria 2334
71 Ga0070689_100106658 3300005340 Bacteria 2223
72 Ga0070689_100107963 3300005340 Unclassified 2210
73 Ga0070689_100184064 3300005340 Bacteria 1698
74 Ga0070689_100983338 3300005340 Bacteria 750
75 Ga0070691_10022623 3300005341 Bacteria 2917
76 Ga0070691_10076600 3300005341 Bacteria 1631
77 Ga0070691_10090806 3300005341 Bacteria 1505
78 Ga0070691_10096474 3300005341 Bacteria 1464
79 Ga0070691_10193445 3300005341 Bacteria 1065
80 Ga0070687_100277072 3300005343 Bacteria 1054
81 Ga0070661_100017193 3300005344 Bacteria 5127
82 Ga0070661_100035578 3300005344 Bacteria 3617
83 Ga0070661_101646531 3300005344 Bacteria 543
84 Ga0070692_10024902 3300005345 Bacteria 2945
85 Ga0070692_10112154 3300005345 Bacteria 1510
86 Ga0070692_10200976 3300005345 Unclassified 1167
87 Ga0070668_100020729 3300005347 Bacteria 4964
88 Ga0070668_100035438 3300005347 Bacteria 3805
89 Ga0070668_100166121 3300005347 Bacteria 1794
90 Ga0070668_100410495 3300005347 Bacteria 1158
91 Ga0070668_100495748 3300005347 Bacteria 1057
92 Ga0070669_100571015 3300005353 Bacteria 945
93 Ga0070669_100602169 3300005353 Bacteria 921
94 Ga0070669_101658492 3300005353 Bacteria 557
95 Ga0070675_100020843 3300005354 Bacteria 5232
96 Ga0070675_100062571 3300005354 Bacteria 3075
97 Ga0070675_100544715 3300005354 Unclassified 1049
98 Ga0070675_100950668 3300005354 Unclassified 788
99 Ga0070675_101376100 3300005354 Bacteria 651
100 Ga0070671_100020521 3300005355 Bacteria 5389
101 Ga0070671_100043764 3300005355 Bacteria 3720
102 Ga0070671_100145151 3300005355 Bacteria 2003
103 Ga0070671_100149487 3300005355 Bacteria 1972
104 Ga0070671_100640069 3300005355 Bacteria 920
105 Ga0070674_100001343 3300005356 Bacteria 12955
106 Ga0070674_100033830 3300005356 Unclassified 3406
107 Ga0070674_100119027 3300005356 Bacteria 1952
108 Ga0070674_100150317 3300005356 Bacteria 1757
109 Ga0070674_100409178 3300005356 Bacteria 1110
110 Ga0070674_100487995 3300005356 Bacteria 1024
111 Ga0070674_100979137 3300005356 Bacteria 741
112 Ga0070674_101066413 3300005356 Unclassified 712
113 Ga0070674_101806944 3300005356 Unclassified 554
114 Ga0070673_100029717 3300005364 Bacteria 4078
115 Ga0070673_100228369 3300005364 Unclassified 1614
116 Ga0070673_100418319 3300005364 Bacteria 1201
117 Ga0070673_100444588 3300005364 Bacteria 1165
118 Ga0070688_100207580 3300005365 Bacteria 1374
119 Ga0070659_100140528 3300005366 Bacteria 1966
120 Ga0070659_100250419 3300005366 Bacteria 1468
121 Ga0070659_100466601 3300005366 Unclassified 1073
122 Ga0070659_100485453 3300005366 Bacteria 1052
123 Ga0070659_100650693 3300005366 Bacteria 909
124 Ga0070703_10001452 3300005406 Bacteria 7141
125 Ga0070703_10077130 3300005406 Unclassified 1126
126 Ga0070703_10255015 3300005406 Bacteria 713
127 Ga0070709_10074672 3300005434 Bacteria 2198
128 Ga0070709_10077456 3300005434 Bacteria 2161
129 Ga0070709_10082000 3300005434 Bacteria 2107
130 Ga0070709_10109341 3300005434 Bacteria 1855
131 Ga0070709_10486002 3300005434 Bacteria 936
132 Ga0070714_100010799 3300005435 Bacteria 7230
133 Ga0070714_100022365 3300005435 Bacteria 5184
134 Ga0070714_100034451 3300005435 Bacteria 4240
135 Ga0070714_100081112 3300005435 Bacteria 2824
136 Ga0070714_100088901 3300005435 Bacteria 2703
137 Ga0070714_100095648 3300005435 Bacteria 2609
138 Ga0070714_100277832 3300005435 Unclassified 1555
139 Ga0070714_100291076 3300005435 Bacteria 1520
140 Ga0070714_100449104 3300005435 Unclassified 1224
141 Ga0070714_100517970 3300005435 Bacteria 1139
142 Ga0070714_100774771 3300005435 Bacteria 928
143 Ga0070714_100824544 3300005435 Bacteria 899
144 Ga0070714_101755904 3300005435 Unclassified 606
145 Ga0070714_102173834 3300005435 Unclassified 540
146 Ga0070713_100010281 3300005436 Bacteria 6755
147 Ga0070713_100041335 3300005436 Bacteria 3756
148 Ga0070713_100066447 3300005436 Bacteria 3032
149 Ga0070713_100083973 3300005436 Bacteria 2724
150 Ga0070713_100318403 3300005436 Bacteria 1436
151 Ga0070713_101029493 3300005436 Unclassified 795
152 Ga0070713_102050525 3300005436 Unclassified 555
153 Ga0070710_10000963 3300005437 Bacteria 13656
154 Ga0070710_10016371 3300005437 Bacteria 3771
155 Ga0070710_10108234 3300005437 Bacteria 1666
156 Ga0070701_10058334 3300005438 Bacteria 2026
157 Ga0070701_10087453 3300005438 Bacteria 1700
158 Ga0070701_10087635 3300005438 Bacteria 1699
159 Ga0070701_10103662 3300005438 Bacteria 1579
160 Ga0070701_10303893 3300005438 Bacteria 982
161 Ga0070701_11034059 3300005438 Unclassified 575
162 Ga0070701_11038322 3300005438 Bacteria 574
163 Ga0070711_100005662 3300005439 Bacteria 7484
164 Ga0070711_100030301 3300005439 Bacteria 3580
165 Ga0070711_100062394 3300005439 Bacteria 2597
166 Ga0070711_100077703 3300005439 Bacteria 2356
167 Ga0070711_100294614 3300005439 Bacteria 1288
168 Ga0070711_100911684 3300005439 Bacteria 750
169 Ga0070711_101882211 3300005439 Bacteria 525
170 Ga0070705_100007340 3300005440 Bacteria 5424
171 Ga0070705_100009370 3300005440 Bacteria 4866
172 Ga0070705_100075394 3300005440 Bacteria 2053
173 Ga0070705_100097435 3300005440 Bacteria 1848
174 Ga0070705_100111064 3300005440 Bacteria 1751
175 Ga0070705_100272150 3300005440 Bacteria 1200
176 Ga0070705_100325299 3300005440 Unclassified 1112
177 Ga0070705_100457251 3300005440 Unclassified 959
178 Ga0070705_101379595 3300005440 Bacteria 587
179 Ga0070700_100028676 3300005441 Bacteria 3313
180 Ga0070700_100033754 3300005441 Bacteria 3085
181 Ga0070700_100104516 3300005441 Unclassified 1871
182 Ga0070700_100126864 3300005441 Bacteria 1717
183 Ga0070700_100173339 3300005441 Bacteria 1495
184 Ga0070694_100026337 3300005444 Bacteria 3768
185 Ga0070694_100102647 3300005444 Bacteria 2025
186 Ga0070694_100186688 3300005444 Bacteria 1537
187 Ga0070694_100222452 3300005444 Bacteria 1416
188 Ga0070694_100239386 3300005444 Bacteria 1368
189 Ga0070694_100240712 3300005444 Bacteria 1365
190 Ga0070694_100936444 3300005444 Bacteria 717
191 Ga0070708_100128736 3300005445 Bacteria 2342
192 Ga0070708_100145484 3300005445 Bacteria 2201
193 Ga0070708_100231093 3300005445 Unclassified 1735
194 Ga0070708_100334070 3300005445 Unclassified 1428
195 Ga0070708_100382510 3300005445 Bacteria 1327
196 Ga0070708_100415485 3300005445 Archaea 1269
197 Ga0070708_100426379 3300005445 Bacteria 1251
198 Ga0070708_100560855 3300005445 Bacteria 1077
199 Ga0070708_100761550 3300005445 Unclassified 910
200 Ga0070663_100042059 3300005455 Bacteria 3209
201 Ga0070663_100229809 3300005455 Bacteria 1460
202 Ga0070663_100432212 3300005455 Bacteria 1082
203 Ga0070663_100489957 3300005455 Bacteria 1019
204 Ga0070678_100005401 3300005456 Bacteria 7374
205 Ga0070678_100019338 3300005456 Bacteria 4437
206 Ga0070678_100096193 3300005456 Bacteria 2284
207 Ga0070678_100193290 3300005456 Bacteria 1674
208 Ga0070678_100255702 3300005456 Bacteria 1471
209 Ga0070678_100542969 3300005456 Bacteria 1031
210 Ga0070678_100628747 3300005456 Bacteria 961
211 Ga0070678_100870780 3300005456 Bacteria 822
212 Ga0070678_101352260 3300005456 Bacteria 664
213 Ga0070662_100032084 3300005457 Bacteria 3690
214 Ga0070662_100068275 3300005457 Bacteria 2613
215 Ga0070662_100106745 3300005457 Bacteria 2128
216 Ga0070662_100158412 3300005457 Bacteria 1769
217 Ga0070662_100408917 3300005457 Bacteria 1121
218 Ga0070662_100752871 3300005457 Bacteria 826
219 Ga0070662_101319562 3300005457 Bacteria 621
220 Ga0070681_10095218 3300005458 Bacteria 2926
221 Ga0070681_10106407 3300005458 Bacteria 2746
222 Ga0070681_10340567 3300005458 Bacteria 1409
223 Ga0070681_10355606 3300005458 Bacteria 1375
224 Ga0070681_10407144 3300005458 Bacteria 1272
225 Ga0070681_10414042 3300005458 Bacteria 1260
226 Ga0070681_10953723 3300005458 Unclassified 777
227 Ga0068867_100103695 3300005459 Bacteria 2175
228 Ga0068867_100125030 3300005459 Bacteria 1992
229 Ga0068867_100202456 3300005459 Bacteria 1590
230 Ga0068867_100567230 3300005459 Bacteria 985
231 Ga0068867_100825894 3300005459 Bacteria 828
232 Ga0068867_101364309 3300005459 Bacteria 656
233 Ga0068867_101383057 3300005459 Bacteria 652
234 Ga0070685_10031234 3300005466 Bacteria 2974
235 Ga0070685_10075075 3300005466 Bacteria 2013
236 Ga0070685_10472968 3300005466 Bacteria 882
237 Ga0070685_10657041 3300005466 Unclassified 760
238 Ga0070685_10689976 3300005466 Bacteria 743
239 Ga0070706_100002089 3300005467 Bacteria 20346
240 Ga0070706_100082223 3300005467 Bacteria 2983
241 Ga0070706_100089835 3300005467 Bacteria 2849
242 Ga0070706_100512377 3300005467 Bacteria 1116
243 Ga0070706_101099516 3300005467 Unclassified 732
244 Ga0070707_100001273 3300005468 Bacteria 24807
245 Ga0070707_100004087 3300005468 Bacteria 13701
246 Ga0070707_100016944 3300005468 Bacteria 6844
247 Ga0070707_100182658 3300005468 Bacteria 2045
248 Ga0070707_100229384 3300005468 Bacteria 1808
249 Ga0070707_100437297 3300005468 Bacteria 1269
250 Ga0070707_100554989 3300005468 Bacteria 1111
251 Ga0070707_100614955 3300005468 Bacteria 1049
252 Ga0070707_101120201 3300005468 Unclassified 753
253 Ga0070698_100010276 3300005471 Bacteria 9999
254 Ga0070698_100015668 3300005471 Bacteria 8007
255 Ga0070698_100021402 3300005471 Bacteria 6773
256 Ga0070698_100080693 3300005471 Bacteria 3248
257 Ga0070698_100129731 3300005471 Bacteria 2477
258 Ga0070698_100156087 3300005471 Bacteria 2228
259 Ga0070698_100173341 3300005471 Bacteria 2097
260 Ga0070698_100309827 3300005471 Bacteria 1509
261 Ga0070698_100369945 3300005471 Bacteria 1365
262 Ga0070698_100530590 3300005471 Bacteria 1116
263 Ga0070698_101336993 3300005471 Bacteria 667
264 Ga0074259_11481910 3300005507 Bacteria 519
265 Ga0070699_100011697 3300005518 Bacteria 7579
266 Ga0070699_100017340 3300005518 Bacteria 6183
267 Ga0070699_100066789 3300005518 Bacteria 3123
268 Ga0070699_100069518 3300005518 Bacteria 3060
269 Ga0070699_100081125 3300005518 Bacteria 2827
270 Ga0070699_100116535 3300005518 Bacteria 2348
271 Ga0070699_100202651 3300005518 Bacteria 1765
272 Ga0070699_100616428 3300005518 Bacteria 990
273 Ga0070699_101964065 3300005518 Bacteria 535
274 Ga0070679_100030645 3300005530 Bacteria 5312
275 Ga0070679_100065408 3300005530 Bacteria 3624
276 Ga0070679_100138666 3300005530 Bacteria 2413
277 Ga0070679_100257226 3300005530 Bacteria 1701
278 Ga0070679_100571664 3300005530 Bacteria 1074
279 Ga0070679_100669022 3300005530 Bacteria 981
280 Ga0070679_100785267 3300005530 Bacteria 895
281 Ga0070679_100836656 3300005530 Bacteria 864
282 Ga0070684_100000559 3300005535 Bacteria 25574
283 Ga0070684_100005143 3300005535 Bacteria 10001
284 Ga0070684_100006202 3300005535 Bacteria 9226
285 Ga0070684_100022436 3300005535 Bacteria 5265
286 Ga0070684_100025050 3300005535 Bacteria 5010
287 Ga0070684_100060992 3300005535 Bacteria 3300
288 Ga0070684_100096502 3300005535 Bacteria 2635
289 Ga0070684_100138225 3300005535 Unclassified 2202
290 Ga0070684_100212833 3300005535 Bacteria 1762
291 Ga0070684_100345260 3300005535 Bacteria 1368
292 Ga0070684_100374474 3300005535 Bacteria 1311
293 Ga0070684_100384536 3300005535 Bacteria 1293
294 Ga0070684_100544986 3300005535 Bacteria 1076
295 Ga0070684_100903042 3300005535 Bacteria 828
296 Ga0070684_101072542 3300005535 Unclassified 757
297 Ga0070684_101219401 3300005535 Unclassified 708
298 Ga0070684_101318131 3300005535 Bacteria 680
299 Ga0070684_101366341 3300005535 Bacteria 667
300 Ga0070684_101434425 3300005535 Bacteria 650
301 Ga0070684_101461788 3300005535 Unclassified 644
302 Ga0070697_100189350 3300005536 Bacteria 1746
303 Ga0070697_100245147 3300005536 Bacteria 1531
304 Ga0070697_100290997 3300005536 Bacteria 1403
305 Ga0070697_100496554 3300005536 Bacteria 1067
306 Ga0070697_100724611 3300005536 Bacteria 878
307 Ga0070697_101342646 3300005536 Bacteria 638
308 Ga0068853_100019256 3300005539 Bacteria 5657
309 Ga0068853_100310723 3300005539 Unclassified 1459
310 Ga0068853_100884215 3300005539 Unclassified 858
311 Ga0068853_101295737 3300005539 Bacteria 704
312 Ga0070672_100016196 3300005543 Bacteria 5333
313 Ga0070672_100045887 3300005543 Bacteria 3384
314 Ga0070672_101116513 3300005543 Unclassified 701
315 Ga0070672_101129491 3300005543 Bacteria 697
316 Ga0070672_101357534 3300005543 Bacteria 635
317 Ga0070686_100013904 3300005544 Bacteria 4622
318 Ga0070686_100024493 3300005544 Bacteria 3618
319 Ga0070686_100047379 3300005544 Bacteria 2718
320 Ga0070686_100054962 3300005544 Bacteria 2548
321 Ga0070686_100222186 3300005544 Bacteria 1366
322 Ga0070686_100301851 3300005544 Bacteria 1188
323 Ga0070686_100655035 3300005544 Unclassified 833
324 Ga0070695_100000023 3300005545 Bacteria 60293
325 Ga0070695_100050461 3300005545 Bacteria 2666
326 Ga0070695_100057760 3300005545 Bacteria 2507
327 Ga0070695_100059806 3300005545 Bacteria 2468
328 Ga0070695_100077299 3300005545 Bacteria 2193
329 Ga0070695_100400787 3300005545 Bacteria 1040
330 Ga0070695_100402575 3300005545 Bacteria 1038
331 Ga0070696_100001718 3300005546 Bacteria 14352
332 Ga0070696_100005194 3300005546 Bacteria 8702
333 Ga0070696_100037181 3300005546 Bacteria 3357
334 Ga0070696_100070263 3300005546 Bacteria 2462
335 Ga0070696_100153553 3300005546 Bacteria 1691
336 Ga0070696_100209747 3300005546 Bacteria 1458
337 Ga0070696_100353278 3300005546 Unclassified 1139
338 Ga0070696_101228716 3300005546 Unclassified 634
339 Ga0070693_100015619 3300005547 Bacteria 3912
340 Ga0070693_100052108 3300005547 Bacteria 2345
341 Ga0070693_100056598 3300005547 Bacteria 2263
342 Ga0070693_100060263 3300005547 Bacteria 2202
343 Ga0070693_100104049 3300005547 Bacteria 1735
344 Ga0070693_100117597 3300005547 Bacteria 1645
345 Ga0070693_100913236 3300005547 Unclassified 659
346 Ga0070665_100024645 3300005548 Bacteria 6063
347 Ga0070665_100580851 3300005548 Bacteria 1133
348 Ga0070665_101506232 3300005548 Bacteria 681
349 Ga0070704_100003463 3300005549 Bacteria 9053
350 Ga0070704_100068675 3300005549 Bacteria 2565
351 Ga0070704_100079795 3300005549 Bacteria 2405
352 Ga0070704_100119001 3300005549 Bacteria 2025
353 Ga0070704_100293172 3300005549 Bacteria 1352
354 Ga0070704_100332473 3300005549 Bacteria 1277
355 Ga0070704_100370391 3300005549 Unclassified 1214
356 Ga0070704_100401775 3300005549 Unclassified 1169
357 Ga0070704_100583497 3300005549 Bacteria 980
358 Ga0070704_100680066 3300005549 Unclassified 911
359 Ga0070704_100887663 3300005549 Bacteria 801
360 Ga0070704_101907819 3300005549 Unclassified 551
361 Ga0068855_100021414 3300005563 Bacteria 7752
362 Ga0068855_100046318 3300005563 Bacteria 5141
363 Ga0068855_100052773 3300005563 Bacteria 4786
364 Ga0068855_100223805 3300005563 Bacteria 2109
365 Ga0068855_100238533 3300005563 Bacteria 2033
366 Ga0068855_100303314 3300005563 Bacteria 1768
367 Ga0068855_100435705 3300005563 Bacteria 1432
368 Ga0068855_100485980 3300005563 Bacteria 1343
369 Ga0068855_100489373 3300005563 Bacteria 1338
370 Ga0068855_101094849 3300005563 Bacteria 833
371 Ga0068855_101653698 3300005563 Bacteria 654
372 Ga0070664_100043775 3300005564 Bacteria 3778
373 Ga0070664_100047292 3300005564 Bacteria 3634
374 Ga0070664_100048012 3300005564 Bacteria 3607
375 Ga0070664_100290073 3300005564 Bacteria 1477
376 Ga0070664_100438277 3300005564 Bacteria 1198
377 Ga0070664_100628822 3300005564 Unclassified 997
378 Ga0070664_101199042 3300005564 Bacteria 716
379 Ga0068857_100020730 3300005577 Bacteria 5784
380 Ga0068857_100031768 3300005577 Bacteria 4666
381 Ga0068857_100103593 3300005577 Bacteria 2555
382 Ga0068857_100592916 3300005577 Bacteria 1047
383 Ga0068857_101139131 3300005577 Bacteria 754
384 Ga0068854_100055808 3300005578 Bacteria 2845
385 Ga0068854_100161151 3300005578 Bacteria 1737
386 Ga0068854_100183278 3300005578 Bacteria 1637
387 Ga0068854_100484175 3300005578 Bacteria 1039
388 Ga0068854_100636377 3300005578 Unclassified 914
389 Ga0068854_100916416 3300005578 Unclassified 771
390 Ga0068854_101322859 3300005578 Unclassified 649
391 Ga0068856_100004494 3300005614 Bacteria 13869
392 Ga0068856_100032829 3300005614 Bacteria 5083
393 Ga0068856_100054577 3300005614 Bacteria 3942
394 Ga0068856_100139561 3300005614 Bacteria 2430
395 Ga0068856_100142028 3300005614 Unclassified 2408
396 Ga0068856_100203834 3300005614 Unclassified 1992
397 Ga0068856_100471326 3300005614 Bacteria 1276
398 Ga0068856_100650042 3300005614 Unclassified 1075
399 Ga0068856_101505028 3300005614 Unclassified 687
400 Ga0070702_100008309 3300005615 Bacteria 5019
401 Ga0070702_100012665 3300005615 Bacteria 4235
402 Ga0070702_100070325 3300005615 Bacteria 2065
403 Ga0070702_100097792 3300005615 Bacteria 1794
404 Ga0070702_100174825 3300005615 Bacteria 1400
405 Ga0070702_100188724 3300005615 Unclassified 1355
406 Ga0070702_100329946 3300005615 Bacteria 1066
407 Ga0070702_100394667 3300005615 Bacteria 988
408 Ga0070702_100596822 3300005615 Bacteria 827
409 Ga0070702_101289641 3300005615 Unclassified 593
410 Ga0070702_101514902 3300005615 Bacteria 552
411 Ga0068852_100048012 3300005616 Bacteria 3646
412 Ga0068852_100136315 3300005616 Bacteria 2267
413 Ga0068852_100167134 3300005616 Unclassified 2059
414 Ga0068852_100205689 3300005616 Bacteria 1865
415 Ga0068852_100270589 3300005616 Bacteria 1635
416 Ga0068852_100499749 3300005616 Bacteria 1211
417 Ga0068852_100750985 3300005616 Bacteria 988
418 Ga0068852_101976630 3300005616 Bacteria 605
419 Ga0068859_100065487 3300005617 Bacteria 3668
420 Ga0068859_100740385 3300005617 Unclassified 1072
421 Ga0068859_100766075 3300005617 Bacteria 1054
422 Ga0068864_100109160 3300005618 Bacteria 2463
423 Ga0068864_100130470 3300005618 Bacteria 2257
424 Ga0068866_10030576 3300005718 Unclassified 2586
425 Ga0068866_10038763 3300005718 Bacteria 2349
426 Ga0068866_10106583 3300005718 Bacteria 1556
427 Ga0068866_10164511 3300005718 Bacteria 1297
428 Ga0068866_10203160 3300005718 Unclassified 1185
429 Ga0068866_10312987 3300005718 Unclassified 985
430 Ga0068866_10390669 3300005718 Bacteria 895
431 Ga0068866_10495477 3300005718 Bacteria 807
432 Ga0068861_100018373 3300005719 Bacteria 4982
433 Ga0068861_100046270 3300005719 Bacteria 3279
434 Ga0068861_100090477 3300005719 Bacteria 2414
435 Ga0068861_100114884 3300005719 Bacteria 2162
436 Ga0068861_100169161 3300005719 Bacteria 1810
437 Ga0068861_100239208 3300005719 Bacteria 1543
438 Ga0068861_100323507 3300005719 Bacteria 1344
439 Ga0068861_100375107 3300005719 Unclassified 1255
440 Ga0068861_100512278 3300005719 Unclassified 1087
441 Ga0068861_100561173 3300005719 Bacteria 1042
442 Ga0068861_100754712 3300005719 Bacteria 909
443 Ga0068870_10001663 3300005840 Bacteria 9093
444 Ga0068870_10185903 3300005840 Bacteria 1251
445 Ga0068870_11221454 3300005840 Unclassified 545
446 Ga0068863_100141650 3300005841 Bacteria 2298
447 Ga0068863_100267834 3300005841 Bacteria 1653
448 Ga0068863_100464533 3300005841 Bacteria 1243
449 Ga0068858_100935786 3300005842 Bacteria 848
450 Ga0068858_101861045 3300005842 Bacteria 595
451 Ga0068860_100203861 3300005843 Unclassified 1917
452 Ga0068860_100439338 3300005843 Unclassified 1296
453 Ga0068860_100635758 3300005843 Bacteria 1074
454 Ga0068860_100680659 3300005843 Unclassified 1038
455 Ga0068862_100110596 3300005844 Bacteria 2411
456 Ga0068862_100270801 3300005844 Bacteria 1553
457 Ga0068862_100374309 3300005844 Bacteria 1327
458 Ga0068862_100701044 3300005844 Bacteria 981
459 Ga0081455_10010156 3300005937 Bacteria 9590
460 Ga0081455_10018043 3300005937 Bacteria 6739
461 Ga0081455_10026030 3300005937 Bacteria 5389
462 Ga0081455_10035626 3300005937 Bacteria 4444
463 Ga0081455_10040533 3300005937 Bacteria 4105
464 Ga0081455_10051210 3300005937 Bacteria 3543
465 Ga0081455_10107546 3300005937 Bacteria 2223
466 Ga0081455_10114326 3300005937 Bacteria 2139
467 Ga0081455_10336345 3300005937 Bacteria 1070
468 Ga0081538_10000196 3300005981 Bacteria 66606
469 Ga0081538_10000331 3300005981 Bacteria 53873
470 Ga0081538_10000451 3300005981 Bacteria 46242
471 Ga0081538_10000778 3300005981 Bacteria 34784
472 Ga0081538_10001466 3300005981 Bacteria 24208
473 Ga0081538_10009368 3300005981 Bacteria 8183
474 Ga0081538_10015452 3300005981 Bacteria 5905
475 Ga0081538_10016496 3300005981 Bacteria 5659
476 Ga0081538_10044531 3300005981 Bacteria 2766
477 Ga0081540_1001173 3300005983 Bacteria 22962
478 Ga0081540_1024966 3300005983 Bacteria 3454
479 Ga0081540_1030028 3300005983 Bacteria 3017
480 Ga0081539_10000041 3300005985 Bacteria 292660
481 Ga0081539_10000639 3300005985 Bacteria 70847
482 Ga0081539_10001492 3300005985 Bacteria 39584
483 Ga0081539_10002903 3300005985 Bacteria 22670
484 Ga0070717_10068031 3300006028 Bacteria 2964
485 Ga0070717_10088244 3300006028 Bacteria 2613
486 Ga0070717_10136404 3300006028 Bacteria 2113
487 Ga0070717_10481405 3300006028 Bacteria 1121
488 Ga0070717_11224238 3300006028 Bacteria 683
489 Ga0075365_10007066 3300006038 Bacteria 6253
490 Ga0075365_10337729 3300006038 Bacteria 1061
491 Ga0075365_10641154 3300006038 Unclassified 751
492 Ga0075364_10840519 3300006051 Bacteria 625
493 Ga0075432_10046823 3300006058 Bacteria 1519
494 Ga0075432_10057554 3300006058 Bacteria 1379
495 Ga0075432_10116059 3300006058 Unclassified 1002
496 Ga0075432_10254846 3300006058 Bacteria 713
497 Ga0070715_10001412 3300006163 Bacteria 6955
498 Ga0070715_10003209 3300006163 Bacteria 5151
499 Ga0070715_10173682 3300006163 Bacteria 1075
500 Ga0070716_100008206 3300006173 Bacteria 5174
501 Ga0070716_100039655 3300006173 Bacteria 2615
502 Ga0070716_100092640 3300006173 Bacteria 1832
503 Ga0070716_100095671 3300006173 Bacteria 1808
504 Ga0070716_100322502 3300006173 Unclassified 1083
505 Ga0070716_100380883 3300006173 Unclassified 1008
506 Ga0070716_100790255 3300006173 Unclassified 734
507 Ga0070716_101189387 3300006173 Unclassified 612
508 Ga0070712_100006380 3300006175 Bacteria 7317
509 Ga0070712_100009724 3300006175 Bacteria 6060
510 Ga0070712_100016655 3300006175 Bacteria 4749
511 Ga0070712_100019969 3300006175 Bacteria 4380
512 Ga0070712_100029937 3300006175 Bacteria 3653
513 Ga0070712_100168592 3300006175 Bacteria 1697
514 Ga0070712_100321191 3300006175 Bacteria 1259
515 Ga0070712_100418293 3300006175 Bacteria 1110
516 Ga0070712_100745030 3300006175 Bacteria 838
517 Ga0070712_101118727 3300006175 Bacteria 684
518 Ga0070712_101936633 3300006175 Unclassified 516
519 Ga0075367_10218403 3300006178 Bacteria 1193
520 Ga0097621_100015911 3300006237 Bacteria 5673
521 Ga0097621_100090698 3300006237 Bacteria 2558
522 Ga0097621_101833772 3300006237 Bacteria 578
523 Ga0068871_100100068 3300006358 Unclassified 2428
524 Ga0068871_100207652 3300006358 Bacteria 1693
525 Ga0068871_100325896 3300006358 Bacteria 1354
526 Ga0068871_100843801 3300006358 Bacteria 846
527 Ga0075428_100000381 3300006844 Bacteria 43984
528 Ga0075428_100133934 3300006844 Unclassified 2695
529 Ga0075428_100140630 3300006844 Bacteria 2625
530 Ga0075428_100161388 3300006844 Bacteria 2433
531 Ga0075428_100205341 3300006844 Bacteria 2129
532 Ga0075428_100382459 3300006844 Bacteria 1509
533 Ga0075428_100471432 3300006844 Bacteria 1344
534 Ga0075428_100946272 3300006844 Bacteria 913
535 Ga0075428_101073592 3300006844 Bacteria 851
536 Ga0075428_101104403 3300006844 Bacteria 838
537 Ga0075428_101601668 3300006844 Unclassified 681
538 Ga0075430_100080209 3300006846 Bacteria 2734
539 Ga0075430_100165628 3300006846 Bacteria 1839
540 Ga0075430_100250663 3300006846 Bacteria 1467
541 Ga0075430_100265478 3300006846 Bacteria 1421
542 Ga0075430_100774821 3300006846 Bacteria 790
543 Ga0075431_100052191 3300006847 Bacteria 4217
544 Ga0075431_100342428 3300006847 Bacteria 1504
545 Ga0075431_100514815 3300006847 Bacteria 1186
546 Ga0075433_10007908 3300006852 Bacteria 8457
547 Ga0075433_10025878 3300006852 Bacteria 4963
548 Ga0075433_10029605 3300006852 Bacteria 4667
549 Ga0075433_10115499 3300006852 Bacteria 2382
550 Ga0075433_10154539 3300006852 Unclassified 2041
551 Ga0075433_10177239 3300006852 Bacteria 1897
552 Ga0075433_10381013 3300006852 Unclassified 1245
553 Ga0075433_10584070 3300006852 Bacteria 981
554 Ga0075433_10588396 3300006852 Bacteria 977
555 Ga0075433_10994577 3300006852 Bacteria 731
556 Ga0075434_100000658 3300006871 Bacteria 26789
557 Ga0075434_100001094 3300006871 Bacteria 22189
558 Ga0075434_100013194 3300006871 Bacteria 7851
559 Ga0075434_100046551 3300006871 Bacteria 4304
560 Ga0075434_100153433 3300006871 Unclassified 2323
561 Ga0075434_100196681 3300006871 Bacteria 2036
562 Ga0075434_100468536 3300006871 Bacteria 1281
563 Ga0075434_100956392 3300006871 Bacteria 871
564 Ga0075434_102460035 3300006871 Unclassified 522
565 Ga0075429_100006626 3300006880 Bacteria 10033
566 Ga0075429_100259138 3300006880 Bacteria 1522
567 Ga0075429_100286978 3300006880 Bacteria 1441
568 Ga0068865_100008018 3300006881 Bacteria 6521
569 Ga0068865_100042186 3300006881 Bacteria 3110
570 Ga0068865_100076856 3300006881 Bacteria 2384
571 Ga0068865_100205487 3300006881 Bacteria 1532
572 Ga0068865_100571100 3300006881 Bacteria 952
573 Ga0068865_101204523 3300006881 Bacteria 670
574 Ga0075436_100002736 3300006914 Bacteria 12126
575 Ga0075436_100140439 3300006914 Bacteria 1697
576 Ga0075436_100246696 3300006914 Bacteria 1271
577 Ga0075436_100310183 3300006914 Bacteria 1132
578 Ga0075436_100351918 3300006914 Bacteria 1062
579 Ga0075436_100431101 3300006914 Bacteria 958
580 Ga0075436_100682814 3300006914 Bacteria 760
581 Ga0097620_100065488 3300006931 Bacteria 3668
582 Ga0097620_100740403 3300006931 Unclassified 1072
583 Ga0097620_100766044 3300006931 Bacteria 1054
584 Ga0075435_100001676 3300007076 Bacteria 14382
585 Ga0075435_100084443 3300007076 Bacteria 2612
586 Ga0075435_100260441 3300007076 Bacteria 1478
587 Ga0075435_100541767 3300007076 Bacteria 1007
588 Ga0075435_100959562 3300007076 Bacteria 746
589 Ga0075435_101201960 3300007076 Bacteria 663
590 Ga0099794_10389217 3300007265 Bacteria 727
591 Ga0105251_10526457 3300009011 Bacteria 555
592 Ga0105240_10027830 3300009093 Bacteria 7396
593 Ga0105240_10034606 3300009093 Bacteria 6515
594 Ga0105240_10323513 3300009093 Bacteria 1757
595 Ga0105240_11261509 3300009093 Bacteria 781
596 Ga0105240_11364229 3300009093 Archaea 746
597 Ga0111539_10006386 3300009094 Bacteria 15202
598 Ga0111539_10211901 3300009094 Bacteria 2257
599 Ga0111539_10262583 3300009094 Bacteria 2010
600 Ga0111539_10403399 3300009094 Bacteria 1592
601 Ga0111539_10481257 3300009094 Bacteria 1446
602 Ga0111539_10677991 3300009094 Bacteria 1200
603 Ga0111539_10711784 3300009094 Bacteria 1169
604 Ga0111539_10790177 3300009094 Bacteria 1105
605 Ga0111539_10962314 3300009094 Unclassified 993
606 Ga0111539_11007432 3300009094 Unclassified 968
607 Ga0105245_10005774 3300009098 Bacteria 10857
608 Ga0105245_10014739 3300009098 Bacteria 6808
609 Ga0105245_10022281 3300009098 Bacteria 5560
610 Ga0105245_10058267 3300009098 Bacteria 3476
611 Ga0105245_10063372 3300009098 Bacteria 3338
612 Ga0105245_10073696 3300009098 Bacteria 3105
613 Ga0105245_10093389 3300009098 Bacteria 2772
614 Ga0105245_10121333 3300009098 Bacteria 2442
615 Ga0105245_10141889 3300009098 Bacteria 2263
616 Ga0105245_10143484 3300009098 Bacteria 2251
617 Ga0105245_10158544 3300009098 Bacteria 2146
618 Ga0105245_10177838 3300009098 Bacteria 2031
619 Ga0105245_10218382 3300009098 Bacteria 1838
620 Ga0105245_10408029 3300009098 Unclassified 1359
621 Ga0105245_10740445 3300009098 Bacteria 1018
622 Ga0105245_11051355 3300009098 Bacteria 859
623 Ga0105245_11705227 3300009098 Bacteria 682
624 Ga0105245_12062126 3300009098 Bacteria 624
625 Ga0105245_13206893 3300009098 Bacteria 507
626 Ga0114129_10001661 3300009147 Bacteria 30289
627 Ga0114129_10002630 3300009147 Bacteria 24990
628 Ga0114129_10009322 3300009147 Bacteria 14006
629 Ga0114129_10046347 3300009147 Bacteria 6110
630 Ga0114129_10049638 3300009147 Bacteria 5895
631 Ga0114129_10058422 3300009147 Bacteria 5395
632 Ga0114129_10138743 3300009147 Bacteria 3335
633 Ga0114129_10147376 3300009147 Bacteria 3223
634 Ga0114129_10209029 3300009147 Bacteria 2639
635 Ga0114129_10222314 3300009147 Bacteria 2547
636 Ga0114129_10224533 3300009147 Bacteria 2532
637 Ga0114129_10231150 3300009147 Bacteria 2491
638 Ga0114129_10258249 3300009147 Bacteria 2337
639 Ga0114129_10331070 3300009147 Unclassified 2022
640 Ga0114129_10409792 3300009147 Bacteria 1785
641 Ga0114129_10703391 3300009147 Bacteria 1298
642 Ga0114129_11041925 3300009147 Bacteria 1028
643 Ga0114129_11387101 3300009147 Unclassified 868
644 Ga0114129_11407702 3300009147 Unclassified 860
645 Ga0114129_11530116 3300009147 Bacteria 819
646 Ga0114129_11852855 3300009147 Bacteria 732
647 Ga0114129_11869643 3300009147 Bacteria 729
648 Ga0114129_11983613 3300009147 Bacteria 704
649 Ga0114129_13113902 3300009147 Bacteria 542
650 Ga0105243_10007160 3300009148 Bacteria 8576
651 Ga0105243_10028590 3300009148 Bacteria 4280
652 Ga0105243_10034858 3300009148 Bacteria 3900
653 Ga0105243_10041356 3300009148 Bacteria 3605
654 Ga0105243_10041997 3300009148 Bacteria 3578
655 Ga0105243_10046896 3300009148 Bacteria 3401
656 Ga0105243_10070734 3300009148 Bacteria 2818
657 Ga0105243_10118046 3300009148 Bacteria 2231
658 Ga0105243_10156255 3300009148 Bacteria 1961
659 Ga0105243_10222893 3300009148 Bacteria 1668
660 Ga0105243_10224218 3300009148 Bacteria 1663
661 Ga0105243_10826219 3300009148 Bacteria 915
662 Ga0105243_11580132 3300009148 Unclassified 682
663 Ga0105241_10023664 3300009174 Bacteria 4556
664 Ga0105241_10081484 3300009174 Bacteria 2535
665 Ga0105241_10089090 3300009174 Bacteria 2431
666 Ga0105241_10714059 3300009174 Bacteria 916
667 Ga0105242_10022488 3300009176 Bacteria 4959
668 Ga0105242_10046034 3300009176 Bacteria 3538
669 Ga0105242_10050771 3300009176 Bacteria 3378
670 Ga0105242_10093405 3300009176 Bacteria 2536
671 Ga0105242_10095161 3300009176 Bacteria 2514
672 Ga0105242_10445443 3300009176 Bacteria 1219
673 Ga0105242_10478106 3300009176 Unclassified 1180
674 Ga0105242_10483818 3300009176 Bacteria 1174
675 Ga0105242_10523369 3300009176 Unclassified 1132
676 Ga0105242_11107908 3300009176 Bacteria 806
677 Ga0105242_11907799 3300009176 Bacteria 635
678 Ga0105242_12446470 3300009176 Bacteria 570
679 Ga0105242_12954149 3300009176 Unclassified 526
680 Ga0105248_10089715 3300009177 Bacteria 3461
681 Ga0105248_10091316 3300009177 Bacteria 3430
682 Ga0105248_10173539 3300009177 Bacteria 2430
683 Ga0105248_10193285 3300009177 Unclassified 2293
684 Ga0105248_10232460 3300009177 Unclassified 2075
685 Ga0105248_10235571 3300009177 Bacteria 2061
686 Ga0105248_10327535 3300009177 Bacteria 1725
687 Ga0105248_10977108 3300009177 Unclassified 956
688 Ga0105248_11269132 3300009177 Bacteria 833
689 Ga0105248_11334158 3300009177 Unclassified 811
690 Ga0105248_11768073 3300009177 Bacteria 701
691 Ga0105248_12399857 3300009177 Unclassified 601
692 Ga0105237_10429031 3300009545 Bacteria 1327
693 Ga0105237_11093507 3300009545 Bacteria 804
694 Ga0105237_11199058 3300009545 Unclassified 766
695 Ga0105238_10034534 3300009551 Bacteria 5144
696 Ga0105238_10201435 3300009551 Bacteria 1966
697 Ga0105238_11442251 3300009551 Unclassified 716
698 Ga0105238_11594846 3300009551 Bacteria 683
699 Ga0105238_11801124 3300009551 Bacteria 644
700 Ga0105249_10006238 3300009553 Bacteria 10353
701 Ga0105249_10064819 3300009553 Bacteria 3360
702 Ga0105249_10069205 3300009553 Bacteria 3257
703 Ga0105249_10097333 3300009553 Bacteria 2762
704 Ga0105249_10418034 3300009553 Bacteria 1374
705 Ga0105249_10520361 3300009553 Unclassified 1237
706 Ga0105249_11058057 3300009553 Bacteria 881
707 Ga0105249_12180856 3300009553 Unclassified 627
708 Ga0105239_10106979 3300010375 Bacteria 3099
709 Ga0105239_10127962 3300010375 Bacteria 2824
710 Ga0105239_10174546 3300010375 Bacteria 2404
711 Ga0105239_10185912 3300010375 Bacteria 2325
712 Ga0105239_10278926 3300010375 Unclassified 1881
713 Ga0105239_10358220 3300010375 Bacteria 1647
714 Ga0105239_10368019 3300010375 Bacteria 1624
715 Ga0105239_10458912 3300010375 Unclassified 1446
716 Ga0105239_10512250 3300010375 Bacteria 1365
717 Ga0105239_10530240 3300010375 Bacteria 1340
718 Ga0105239_10655238 3300010375 Bacteria 1199
719 Ga0105239_10770699 3300010375 Bacteria 1101
720 Ga0105239_11074337 3300010375 Bacteria 926
721 Ga0105246_10010274 3300011119 Bacteria 5784
722 Ga0105246_10071693 3300011119 Bacteria 2440
723 Ga0105246_10108637 3300011119 Bacteria 2033
724 Ga0105246_10151571 3300011119 Bacteria 1755
725 Ga0105246_10524451 3300011119 Unclassified 1010
726 Ga0105246_10833174 3300011119 Bacteria 821
727 Ga0157373_10093686 3300013100 Bacteria 2115
728 Ga0157373_10134950 3300013100 Bacteria 1735
729 Ga0157373_10568339 3300013100 Bacteria 823
730 Ga0157371_10673274 3300013102 Bacteria 773
731 Ga0157371_11424977 3300013102 Bacteria 539
732 Ga0157370_10010689 3300013104 Bacteria 9656
733 Ga0157370_10034654 3300013104 Bacteria 4912
734 Ga0157370_10052375 3300013104 Bacteria 3897
735 Ga0157370_10609964 3300013104 Unclassified 999
736 Ga0157369_10008456 3300013105 Bacteria 11805
737 Ga0157369_10065997 3300013105 Bacteria 3894
738 Ga0157369_10093513 3300013105 Bacteria 3209
739 Ga0157369_10263397 3300013105 Bacteria 1797
740 Ga0157369_10744392 3300013105 Bacteria 1009
741 Ga0157369_10938459 3300013105 Unclassified 887
742 Ga0157369_11727437 3300013105 Bacteria 636
743 Ga0157374_10014406 3300013296 Bacteria 6921
744 Ga0157374_10077705 3300013296 Bacteria 3142
745 Ga0157374_10173304 3300013296 Bacteria 2105
746 Ga0157374_11525336 3300013296 Bacteria 692
747 Ga0157378_10010768 3300013297 Bacteria 7994
748 Ga0157378_10617205 3300013297 Bacteria 1097
749 Ga0157378_10764948 3300013297 Unclassified 989
750 Ga0157378_12475883 3300013297 Archaea 571
751 Ga0157378_12533198 3300013297 Unclassified 565
752 Ga0163162_10014772 3300013306 Bacteria 7628
753 Ga0163162_10071384 3300013306 Bacteria 3525
754 Ga0163162_10079601 3300013306 Bacteria 3343
755 Ga0163162_10321919 3300013306 Unclassified 1679
756 Ga0163162_10531033 3300013306 Bacteria 1306
757 Ga0163162_10732642 3300013306 Bacteria 1109
758 Ga0157372_10444232 3300013307 Bacteria 1512
759 Ga0157372_10620261 3300013307 Bacteria 1260
760 Ga0157372_10716535 3300013307 Bacteria 1164
761 Ga0157372_10743710 3300013307 Bacteria 1140
762 Ga0157372_10940449 3300013307 Unclassified 1002
763 Ga0157372_11029246 3300013307 Unclassified 953
764 Ga0157372_11616158 3300013307 Unclassified 746
765 Ga0157372_12709305 3300013307 Bacteria 569
766 Ga0157375_10003176 3300013308 Bacteria 14277
767 Ga0157375_10007010 3300013308 Bacteria 9841
768 Ga0157375_10083968 3300013308 Bacteria 3231
769 Ga0157375_10140245 3300013308 Bacteria 2544
770 Ga0157375_10204638 3300013308 Bacteria 2130
771 Ga0157375_10242501 3300013308 Bacteria 1962
772 Ga0157375_10256648 3300013308 Bacteria 1910
773 Ga0157375_10261155 3300013308 Bacteria 1893
774 Ga0157375_10290189 3300013308 Bacteria 1799
775 Ga0157375_10588148 3300013308 Bacteria 1273
776 Ga0157375_10977938 3300013308 Unclassified 987
777 Ga0157375_11760459 3300013308 Unclassified 734
778 Ga0163163_10210895 3300014325 Bacteria 1992
779 Ga0163163_10232488 3300014325 Bacteria 1893
780 Ga0163163_10267856 3300014325 Bacteria 1759
781 Ga0157380_10011802 3300014326 Bacteria 6319
782 Ga0157380_10297446 3300014326 Bacteria 1485
783 Ga0157380_10322759 3300014326 Bacteria 1432
784 Ga0157380_12241248 3300014326 Bacteria 610
785 Ga0182008_10002973 3300014497 Bacteria 10433
786 Ga0182008_10029228 3300014497 Bacteria 2786
787 Ga0182008_10123107 3300014497 Bacteria 1289
788 Ga0182008_10127951 3300014497 Unclassified 1265
789 Ga0182008_10129893 3300014497 Bacteria 1256
790 Ga0157377_10004230 3300014745 Bacteria 6571
791 Ga0157377_10011708 3300014745 Bacteria 4387
792 Ga0157377_10062720 3300014745 Bacteria 2127
793 Ga0157377_10152568 3300014745 Bacteria 1429
794 Ga0157377_10415182 3300014745 Unclassified 920
795 Ga0157377_10932385 3300014745 Bacteria 652
796 Ga0157379_10524994 3300014968 Unclassified 1099
797 Ga0157379_10545386 3300014968 Bacteria 1078
798 Ga0157379_10557710 3300014968 Bacteria 1066
799 Ga0157379_10597213 3300014968 Unclassified 1030
800 Ga0157379_10690976 3300014968 Unclassified 957
801 Ga0157379_11157302 3300014968 Bacteria 743
802 Ga0157376_10030988 3300014969 Bacteria 4277
803 Ga0157376_10037956 3300014969 Bacteria 3917
804 Ga0157376_10787645 3300014969 Bacteria 962
805 Ga0182006_1119659 3300015261 Bacteria 916
806 Ga0182007_10006035 3300015262 Bacteria 5240
807 Ga0163161_10056955 3300017792 Bacteria 2839
808 Ga0197907_10946403 3300020069 Archaea 1640
809 Ga0206356_10190868 3300020070 Bacteria 671
810 Ga0206356_10775309 3300020070 Bacteria 2571
811 Ga0206356_11271291 3300020070 Bacteria 1108
812 Ga0206354_11322551 3300020081 Bacteria 2646
813 Ga0206353_11170205 3300020082 Bacteria 6143
814 Ga0206353_11257401 3300020082 Bacteria 17170
815 Ga0206353_11275272 3300020082 Bacteria 1551
816 Ga0206353_11747572 3300020082 Bacteria 2161
817 Ga0213871_10014622 3300021441 Bacteria 1865
818 Ga0224712_10060922 3300022467 Bacteria 1503
819 Ga0224712_10131454 3300022467 Bacteria 1094
820 Ga0207653_10000444 3300025885 Bacteria 16893
821 Ga0207653_10065752 3300025885 Bacteria 1231
822 Ga0207653_10077407 3300025885 Unclassified 1146
823 Ga0207692_10002750 3300025898 Bacteria 6778
824 Ga0207692_10042517 3300025898 Bacteria 2256
825 Ga0207692_10102726 3300025898 Bacteria 1572
826 Ga0207692_10237543 3300025898 Unclassified 1087
827 Ga0207692_10265596 3300025898 Unclassified 1033
828 Ga0207642_10022504 3300025899 Bacteria 2501
829 Ga0207642_10051944 3300025899 Bacteria 1857
830 Ga0207642_10458625 3300025899 Bacteria 773
831 Ga0207642_10781101 3300025899 Bacteria 606
832 Ga0207642_11020672 3300025899 Bacteria 533
833 Ga0207688_10003610 3300025901 Bacteria 8447
834 Ga0207688_10129848 3300025901 Bacteria 1476
835 Ga0207688_10156409 3300025901 Bacteria 1349
836 Ga0207688_10176672 3300025901 Unclassified 1272
837 Ga0207688_10749262 3300025901 Unclassified 618
838 Ga0207680_10148306 3300025903 Bacteria 1562
839 Ga0207685_10006220 3300025905 Bacteria 3232
840 Ga0207685_10040486 3300025905 Bacteria 1737
841 Ga0207685_10096800 3300025905 Bacteria 1254
842 Ga0207699_10023919 3300025906 Bacteria 3332
843 Ga0207699_10033574 3300025906 Bacteria 2901
844 Ga0207699_10089942 3300025906 Bacteria 1925
845 Ga0207699_10101130 3300025906 Bacteria 1829
846 Ga0207699_10120809 3300025906 Bacteria 1694
847 Ga0207699_10125084 3300025906 Bacteria 1668
848 Ga0207699_10482892 3300025906 Unclassified 892
849 Ga0207645_10497317 3300025907 Bacteria 825
850 Ga0207643_10002185 3300025908 Bacteria 10674
851 Ga0207643_10382034 3300025908 Bacteria 888
852 Ga0207705_10045329 3300025909 Bacteria 3160
853 Ga0207705_10046663 3300025909 Bacteria 3114
854 Ga0207705_10056430 3300025909 Bacteria 2832
855 Ga0207705_10218139 3300025909 Bacteria 1448
856 Ga0207684_10067280 3300025910 Bacteria 3044
857 Ga0207684_10210455 3300025910 Bacteria 1677
858 Ga0207684_10319943 3300025910 Bacteria 1337
859 Ga0207684_10459914 3300025910 Bacteria 1092
860 Ga0207684_10486133 3300025910 Bacteria 1059
861 Ga0207684_11258891 3300025910 Bacteria 610
862 Ga0207654_10005891 3300025911 Bacteria 6172
863 Ga0207654_10253179 3300025911 Bacteria 1181
864 Ga0207707_10016885 3300025912 Bacteria 6358
865 Ga0207707_10059662 3300025912 Bacteria 3319
866 Ga0207707_10114030 3300025912 Bacteria 2362
867 Ga0207707_10124998 3300025912 Bacteria 2250
868 Ga0207707_10268495 3300025912 Bacteria 1479
869 Ga0207707_10748981 3300025912 Bacteria 817
870 Ga0207707_11023275 3300025912 Unclassified 677
871 Ga0207707_11104245 3300025912 Bacteria 646
872 Ga0207695_10011260 3300025913 Bacteria 10845
873 Ga0207695_10260370 3300025913 Bacteria 1632
874 Ga0207695_10707666 3300025913 Bacteria 888
875 Ga0207695_11308935 3300025913 Bacteria 605
876 Ga0207671_10203412 3300025914 Bacteria 1547
877 Ga0207671_10456245 3300025914 Bacteria 1018
878 Ga0207671_10514921 3300025914 Unclassified 954
879 Ga0207693_10000319 3300025915 Bacteria 44749
880 Ga0207693_10000873 3300025915 Bacteria 26975
881 Ga0207693_10002750 3300025915 Bacteria 15234
882 Ga0207693_10014815 3300025915 Bacteria 6264
883 Ga0207693_10076123 3300025915 Bacteria 2628
884 Ga0207693_10140031 3300025915 Bacteria 1903
885 Ga0207693_10262833 3300025915 Bacteria 1353
886 Ga0207693_10509434 3300025915 Bacteria 939
887 Ga0207693_10514017 3300025915 Bacteria 935
888 Ga0207693_10851983 3300025915 Bacteria 701
889 Ga0207663_10004662 3300025916 Bacteria 6840
890 Ga0207663_10012568 3300025916 Bacteria 4581
891 Ga0207663_10014506 3300025916 Bacteria 4316
892 Ga0207663_10033310 3300025916 Bacteria 3068
893 Ga0207660_10050845 3300025917 Bacteria 2944
894 Ga0207660_10072386 3300025917 Bacteria 2510
895 Ga0207660_10073926 3300025917 Bacteria 2486
896 Ga0207660_10092387 3300025917 Bacteria 2246
897 Ga0207660_10140912 3300025917 Bacteria 1843
898 Ga0207660_10377853 3300025917 Bacteria 1139
899 Ga0207660_10416490 3300025917 Bacteria 1083
900 Ga0207662_10061176 3300025918 Bacteria 2260
901 Ga0207662_10082257 3300025918 Unclassified 1967
902 Ga0207662_10824979 3300025918 Bacteria 654
903 Ga0207657_10016396 3300025919 Bacteria 7147
904 Ga0207657_10018647 3300025919 Bacteria 6615
905 Ga0207657_10035890 3300025919 Bacteria 4441
906 Ga0207657_10052886 3300025919 Bacteria 3522
907 Ga0207657_10114411 3300025919 Bacteria 2225
908 Ga0207657_10150458 3300025919 Bacteria 1896
909 Ga0207657_10301661 3300025919 Bacteria 1269
910 Ga0207649_10014392 3300025920 Bacteria 4429
911 Ga0207649_10198867 3300025920 Bacteria 1414
912 Ga0207649_10237672 3300025920 Bacteria 1306
913 Ga0207649_10602840 3300025920 Unclassified 845
914 Ga0207649_10720547 3300025920 Bacteria 775
915 Ga0207652_10111205 3300025921 Bacteria 2429
916 Ga0207652_10117995 3300025921 Bacteria 2358
917 Ga0207652_10189191 3300025921 Bacteria 1851
918 Ga0207652_10513578 3300025921 Bacteria 1078
919 Ga0207652_10581142 3300025921 Bacteria 1006
920 Ga0207652_10581980 3300025921 Bacteria 1005
921 Ga0207652_10603102 3300025921 Bacteria 984
922 Ga0207652_11423324 3300025921 Bacteria 597
923 Ga0207646_10002219 3300025922 Bacteria 23119
924 Ga0207646_10004521 3300025922 Bacteria 15061
925 Ga0207646_10004655 3300025922 Bacteria 14797
926 Ga0207646_10389862 3300025922 Bacteria 1258
927 Ga0207646_10529184 3300025922 Bacteria 1061
928 Ga0207646_10729200 3300025922 Bacteria 885
929 Ga0207646_10898723 3300025922 Unclassified 786
930 Ga0207646_11506019 3300025922 Bacteria 583
931 Ga0207681_10074265 3300025923 Bacteria 2382
932 Ga0207681_10801326 3300025923 Bacteria 787
933 Ga0207681_11091154 3300025923 Bacteria 670
934 Ga0207694_10223170 3300025924 Bacteria 1538
935 Ga0207694_11705133 3300025924 Bacteria 530
936 Ga0207650_10087162 3300025925 Bacteria 2378
937 Ga0207650_10437248 3300025925 Bacteria 1087
938 Ga0207659_10245661 3300025926 Unclassified 1450
939 Ga0207659_10955930 3300025926 Bacteria 737
940 Ga0207687_10012356 3300025927 Bacteria 5583
941 Ga0207687_10052761 3300025927 Bacteria 2839
942 Ga0207687_10054673 3300025927 Bacteria 2794
943 Ga0207687_10067387 3300025927 Bacteria 2546
944 Ga0207687_10111674 3300025927 Bacteria 2030
945 Ga0207687_10124484 3300025927 Bacteria 1933
946 Ga0207687_10156559 3300025927 Bacteria 1744
947 Ga0207687_10195611 3300025927 Bacteria 1577
948 Ga0207687_10343612 3300025927 Bacteria 1214
949 Ga0207687_10496140 3300025927 Bacteria 1018
950 Ga0207687_10836738 3300025927 Bacteria 786
951 Ga0207687_11051689 3300025927 Bacteria 699
952 Ga0207687_11137319 3300025927 Bacteria 671
953 Ga0207687_11280453 3300025927 Bacteria 630
954 Ga0207700_10000006 3300025928 Bacteria 348187
955 Ga0207700_10251063 3300025928 Bacteria 1511
956 Ga0207700_10270096 3300025928 Bacteria 1459
957 Ga0207700_10491246 3300025928 Bacteria 1085
958 Ga0207700_11761642 3300025928 Bacteria 545
959 Ga0207664_10003508 3300025929 Bacteria 10474
960 Ga0207664_10019721 3300025929 Bacteria 4989
961 Ga0207664_10062624 3300025929 Bacteria 2971
962 Ga0207664_10136108 3300025929 Bacteria 2073
963 Ga0207664_10167275 3300025929 Bacteria 1879
964 Ga0207664_10170918 3300025929 Bacteria 1860
965 Ga0207664_10245161 3300025929 Bacteria 1562
966 Ga0207664_10348297 3300025929 Unclassified 1311
967 Ga0207664_10350218 3300025929 Bacteria 1307
968 Ga0207664_10391562 3300025929 Bacteria 1235
969 Ga0207664_10484775 3300025929 Bacteria 1106
970 Ga0207664_10582250 3300025929 Bacteria 1005
971 Ga0207664_10582998 3300025929 Bacteria 1004
972 Ga0207664_10979173 3300025929 Unclassified 758
973 Ga0207664_11103586 3300025929 Archaea 709
974 Ga0207664_11171782 3300025929 Bacteria 686
975 Ga0207644_10021037 3300025931 Bacteria 4442
976 Ga0207644_10760410 3300025931 Unclassified 810
977 Ga0207644_11112199 3300025931 Unclassified 664
978 Ga0207690_10068677 3300025932 Bacteria 2436
979 Ga0207690_10173447 3300025932 Bacteria 1617
980 Ga0207690_10527711 3300025932 Bacteria 957
981 Ga0207690_10730351 3300025932 Bacteria 815
982 Ga0207690_10741728 3300025932 Bacteria 809
983 Ga0207690_10750591 3300025932 Bacteria 804
984 Ga0207690_11451040 3300025932 Unclassified 574
985 Ga0207706_10011285 3300025933 Bacteria 8142
986 Ga0207706_10015865 3300025933 Bacteria 6810
987 Ga0207706_10039583 3300025933 Bacteria 4180
988 Ga0207706_10045134 3300025933 Bacteria 3905
989 Ga0207706_10222631 3300025933 Bacteria 1652
990 Ga0207706_10502889 3300025933 Bacteria 1046
991 Ga0207706_10693184 3300025933 Bacteria 870
992 Ga0207686_10074388 3300025934 Bacteria 2195
993 Ga0207686_10101571 3300025934 Bacteria 1921
994 Ga0207686_10162624 3300025934 Bacteria 1566
995 Ga0207686_10226615 3300025934 Bacteria 1353
996 Ga0207686_10255608 3300025934 Bacteria 1282
997 Ga0207686_10280074 3300025934 Bacteria 1230
998 Ga0207686_10407898 3300025934 Bacteria 1037
999 Ga0207686_10577641 3300025934 Bacteria 882
1000 Ga0207709_10002442 3300025935 Bacteria 11670
1001 Ga0207709_10035276 3300025935 Bacteria 2956
1002 Ga0207709_10078658 3300025935 Bacteria 2118
1003 Ga0207709_10114369 3300025935 Bacteria 1811
1004 Ga0207709_10209936 3300025935 Bacteria 1397
1005 Ga0207709_10489221 3300025935 Bacteria 958
1006 Ga0207709_10718747 3300025935 Bacteria 801
1007 Ga0207670_10244305 3300025936 Unclassified 1384
1008 Ga0207670_10602402 3300025936 Bacteria 902
1009 Ga0207670_10671152 3300025936 Bacteria 856
1010 Ga0207669_10056928 3300025937 Unclassified 2377
1011 Ga0207669_10125249 3300025937 Bacteria 1754
1012 Ga0207669_10297106 3300025937 Unclassified 1226
1013 Ga0207669_10335197 3300025937 Unclassified 1163
1014 Ga0207669_10426984 3300025937 Bacteria 1045
1015 Ga0207669_11457146 3300025937 Bacteria 583
1016 Ga0207704_10190562 3300025938 Bacteria 1491
1017 Ga0207704_10251443 3300025938 Bacteria 1327
1018 Ga0207704_10389775 3300025938 Bacteria 1096
1019 Ga0207704_10395042 3300025938 Bacteria 1089
1020 Ga0207704_11394087 3300025938 Bacteria 600
1021 Ga0207704_11689751 3300025938 Bacteria 544
1022 Ga0207665_10000197 3300025939 Bacteria 40246
1023 Ga0207665_10006025 3300025939 Bacteria 8052
1024 Ga0207665_10033154 3300025939 Bacteria 3422
1025 Ga0207665_10407519 3300025939 Bacteria 1036
1026 Ga0207665_10664316 3300025939 Unclassified 818
1027 Ga0207691_10053561 3300025940 Bacteria 3683
1028 Ga0207691_10055535 3300025940 Bacteria 3608
1029 Ga0207691_10518451 3300025940 Unclassified 1012
1030 Ga0207711_10120937 3300025941 Bacteria 2337
1031 Ga0207711_10326463 3300025941 Bacteria 1419
1032 Ga0207711_10398559 3300025941 Bacteria 1278
1033 Ga0207711_10455350 3300025941 Unclassified 1191
1034 Ga0207711_11089102 3300025941 Bacteria 740
1035 Ga0207711_11745545 3300025941 Bacteria 566
1036 Ga0207689_10016326 3300025942 Bacteria 6289
1037 Ga0207689_10090667 3300025942 Bacteria 2512
1038 Ga0207689_10129560 3300025942 Bacteria 2076
1039 Ga0207689_10629365 3300025942 Unclassified 903
1040 Ga0207689_10799473 3300025942 Unclassified 796
1041 Ga0207689_11171737 3300025942 Bacteria 647
1042 Ga0207661_10016534 3300025944 Bacteria 5445
1043 Ga0207661_10022521 3300025944 Bacteria 4747
1044 Ga0207661_10037285 3300025944 Bacteria 3801
1045 Ga0207661_10090941 3300025944 Bacteria 2542
1046 Ga0207661_10114578 3300025944 Bacteria 2286
1047 Ga0207661_10123448 3300025944 Bacteria 2208
1048 Ga0207661_10145999 3300025944 Bacteria 2041
1049 Ga0207661_10203425 3300025944 Bacteria 1742
1050 Ga0207661_10209865 3300025944 Bacteria 1716
1051 Ga0207661_10577653 3300025944 Unclassified 1031
1052 Ga0207661_10660401 3300025944 Bacteria 961
1053 Ga0207661_10998619 3300025944 Unclassified 771
1054 Ga0207661_11045233 3300025944 Unclassified 752
1055 Ga0207661_11738745 3300025944 Unclassified 569
1056 Ga0207679_10034116 3300025945 Bacteria 3588
1057 Ga0207679_10138872 3300025945 Bacteria 1961
1058 Ga0207679_10225220 3300025945 Bacteria 1580
1059 Ga0207679_10283602 3300025945 Bacteria 1421
1060 Ga0207679_10559135 3300025945 Bacteria 1027
1061 Ga0207667_10041146 3300025949 Bacteria 4917
1062 Ga0207667_10087456 3300025949 Bacteria 3223
1063 Ga0207667_10485008 3300025949 Bacteria 1254
1064 Ga0207667_10540927 3300025949 Bacteria 1179
1065 Ga0207667_10945269 3300025949 Unclassified 852
1066 Ga0207667_11738249 3300025949 Bacteria 589
1067 Ga0207651_10265850 3300025960 Bacteria 1410
1068 Ga0207651_10521139 3300025960 Bacteria 1030
1069 Ga0207651_11339724 3300025960 Unclassified 644
1070 Ga0207712_10007608 3300025961 Bacteria 6846
1071 Ga0207712_10075216 3300025961 Bacteria 2441
1072 Ga0207712_10096620 3300025961 Bacteria 2187
1073 Ga0207712_10334524 3300025961 Bacteria 1254
1074 Ga0207712_10419866 3300025961 Bacteria 1128
1075 Ga0207712_11268873 3300025961 Unclassified 658
1076 Ga0207668_10013062 3300025972 Bacteria 5103
1077 Ga0207668_10138569 3300025972 Bacteria 1868
1078 Ga0207668_10141492 3300025972 Bacteria 1851
1079 Ga0207668_10147884 3300025972 Bacteria 1815
1080 Ga0207668_10463281 3300025972 Unclassified 1084
1081 Ga0207668_10652392 3300025972 Unclassified 921
1082 Ga0207668_10662912 3300025972 Bacteria 914
1083 Ga0207668_10851427 3300025972 Bacteria 809
1084 Ga0207640_10062770 3300025981 Bacteria 2466
1085 Ga0207640_10067583 3300025981 Bacteria 2392
1086 Ga0207640_10342946 3300025981 Bacteria 1197
1087 Ga0207640_10528249 3300025981 Unclassified 987
1088 Ga0207640_10548140 3300025981 Bacteria 971
1089 Ga0207640_10826153 3300025981 Unclassified 805
1090 Ga0207658_10325307 3300025986 Unclassified 1332
1091 Ga0207677_10116178 3300026023 Bacteria 2003
1092 Ga0207677_10131983 3300026023 Bacteria 1898
1093 Ga0207677_10161246 3300026023 Bacteria 1742
1094 Ga0207677_10242523 3300026023 Bacteria 1459
1095 Ga0207677_10307271 3300026023 Bacteria 1312
1096 Ga0207677_10394832 3300026023 Unclassified 1171
1097 Ga0207677_10467026 3300026023 Bacteria 1084
1098 Ga0207703_10245788 3300026035 Bacteria 1610
1099 Ga0207703_10848880 3300026035 Bacteria 873
1100 Ga0207703_11194626 3300026035 Bacteria 731
1101 Ga0207639_10149558 3300026041 Bacteria 1954
1102 Ga0207639_10310379 3300026041 Unclassified 1397
1103 Ga0207639_10544394 3300026041 Bacteria 1065
1104 Ga0207678_10004701 3300026067 Bacteria 12252
1105 Ga0207708_10000361 3300026075 Bacteria 35671
1106 Ga0207708_10000401 3300026075 Bacteria 34234
1107 Ga0207708_10009298 3300026075 Bacteria 7276
1108 Ga0207708_10033775 3300026075 Bacteria 3889
1109 Ga0207708_10438841 3300026075 Bacteria 1085
1110 Ga0207708_10596700 3300026075 Bacteria 935
1111 Ga0207708_10790412 3300026075 Bacteria 816
1112 Ga0207702_10006207 3300026078 Bacteria 10334
1113 Ga0207702_10045317 3300026078 Bacteria 3700
1114 Ga0207702_10164508 3300026078 Unclassified 2028
1115 Ga0207702_10175004 3300026078 Bacteria 1971
1116 Ga0207702_10254434 3300026078 Bacteria 1651
1117 Ga0207702_10292140 3300026078 Unclassified 1544
1118 Ga0207702_10339861 3300026078 Bacteria 1434
1119 Ga0207702_10637615 3300026078 Unclassified 1047
1120 Ga0207702_11119713 3300026078 Bacteria 781
1121 Ga0207702_11228694 3300026078 Bacteria 743
1122 Ga0207702_11866370 3300026078 Bacteria 592
1123 Ga0207702_12026453 3300026078 Bacteria 566
1124 Ga0207641_10143930 3300026088 Bacteria 2154
1125 Ga0207641_11035690 3300026088 Bacteria 818
1126 Ga0207641_11424824 3300026088 Bacteria 694
1127 Ga0207648_10000504 3300026089 Bacteria 43569
1128 Ga0207648_10012905 3300026089 Bacteria 7802
1129 Ga0207648_10056981 3300026089 Bacteria 3410
1130 Ga0207648_10105299 3300026089 Bacteria 2474
1131 Ga0207648_10202256 3300026089 Unclassified 1762
1132 Ga0207648_10211915 3300026089 Bacteria 1720
1133 Ga0207648_10391656 3300026089 Bacteria 1258
1134 Ga0207648_10459361 3300026089 Bacteria 1160
1135 Ga0207676_10051555 3300026095 Bacteria 3213
1136 Ga0207676_10106149 3300026095 Bacteria 2340
1137 Ga0207676_10128618 3300026095 Bacteria 2150
1138 Ga0207676_10983666 3300026095 Bacteria 831
1139 Ga0207674_10005249 3300026116 Bacteria 15421
1140 Ga0207674_10021255 3300026116 Bacteria 6995
1141 Ga0207674_10059933 3300026116 Bacteria 3851
1142 Ga0207674_10099265 3300026116 Bacteria 2894
1143 Ga0207674_10494146 3300026116 Bacteria 1182
1144 Ga0207674_10734600 3300026116 Bacteria 953
1145 Ga0207675_100001474 3300026118 Bacteria 23625
1146 Ga0207675_100004186 3300026118 Bacteria 13960
1147 Ga0207675_100006263 3300026118 Bacteria 11293
1148 Ga0207675_100031122 3300026118 Bacteria 4969
1149 Ga0207675_100031924 3300026118 Bacteria 4907
1150 Ga0207675_100129136 3300026118 Bacteria 2396
1151 Ga0207675_100206077 3300026118 Bacteria 1890
1152 Ga0207675_100338051 3300026118 Unclassified 1473
1153 Ga0207675_100563856 3300026118 Unclassified 1139
1154 Ga0207675_100692011 3300026118 Bacteria 1028
1155 Ga0207683_10008067 3300026121 Bacteria 9005
1156 Ga0207683_10009086 3300026121 Bacteria 8470
1157 Ga0207683_10014871 3300026121 Bacteria 6627
1158 Ga0207683_10023772 3300026121 Bacteria 5271
1159 Ga0207683_10041315 3300026121 Bacteria 4027
1160 Ga0207683_10252175 3300026121 Bacteria 1611
1161 Ga0207683_10486546 3300026121 Bacteria 1139
1162 Ga0207683_10549203 3300026121 Bacteria 1068
1163 Ga0207698_10121799 3300026142 Unclassified 2209
1164 Ga0207698_10138311 3300026142 Bacteria 2093
1165 Ga0207698_10152746 3300026142 Bacteria 2006
1166 Ga0207698_11782938 3300026142 Bacteria 631
1167 Ga0209998_10004454 3300027717 Bacteria 2974
1168 Ga0207428_10022261 3300027907 Bacteria 5352
1169 Ga0207428_10058290 3300027907 Bacteria 3065
1170 Ga0207428_10067117 3300027907 Bacteria 2825
1171 Ga0207428_10575349 3300027907 Bacteria 813
1172 Ga0207428_10602878 3300027907 Unclassified 791
1173 Ga0207428_10849008 3300027907 Bacteria 647
1174 Ga0268266_10515811 3300028379 Bacteria 1142
1175 Ga0268266_12328963 3300028379 Unclassified 507
1176 Ga0268265_10131489 3300028380 Bacteria 2081
1177 Ga0268265_10887929 3300028380 Bacteria 874
1178 Ga0268264_10054982 3300028381 Bacteria 3326
1179 Ga0268264_10065651 3300028381 Unclassified 3058
1180 Ga0268264_10281664 3300028381 Bacteria 1558
1181 Ga0268264_10328597 3300028381 Bacteria 1448
1182 Ga0268264_10378617 3300028381 Bacteria 1355
1183 Ga0265319_1001059 3300028563 Bacteria 17170
1184 Ga0265319_1046722 3300028563 Bacteria 1442
1185 Ga0265319_1068859 3300028563 Bacteria 1136
1186 Ga0265319_1107092 3300028563 Unclassified 875
1187 Ga0265319_1186469 3300028563 Bacteria 638
1188 Ga0265334_10030125 3300028573 Bacteria 2173
1189 Ga0265334_10044209 3300028573 Bacteria 1731
1190 Ga0265334_10139130 3300028573 Bacteria 860
1191 Ga0265318_10001637 3300028577 Bacteria 12919
1192 Ga0265318_10002583 3300028577 Bacteria 9593
1193 Ga0265318_10112586 3300028577 Unclassified 1000
1194 Ga0265318_10203673 3300028577 Bacteria 723
1195 Ga0265323_10064516 3300028653 Bacteria 1266
1196 Ga0265322_10027633 3300028654 Bacteria 1621
1197 Ga0265336_10007899 3300028666 Bacteria 3758
1198 Ga0265336_10047880 3300028666 Unclassified 1297
1199 Ga0265336_10135878 3300028666 Unclassified 732
1200 Ga0265338_10004619 3300028800 Bacteria 18512
1201 Ga0265338_10005076 3300028800 Bacteria 17375
1202 Ga0265338_10007729 3300028800 Bacteria 13232
1203 Ga0265338_10011477 3300028800 Bacteria 10227
1204 Ga0265338_10012586 3300028800 Bacteria 9638
1205 Ga0265338_10125041 3300028800 Bacteria 2042
1206 Ga0265338_10218913 3300028800 Bacteria 1423
1207 Ga0265338_10614343 3300028800 Bacteria 756
1208 Ga0265338_10786629 3300028800 Unclassified 652
1209 Ga0265324_10023436 3300029957 Bacteria 2199
1210 Ga0265324_10172168 3300029957 Bacteria 735
1211 Ga0265330_10010770 3300031235 Bacteria 4302
1212 Ga0265330_10044722 3300031235 Bacteria 1954
1213 Ga0265330_10079347 3300031235 Bacteria 1415
1214 Ga0265330_10343947 3300031235 Bacteria 630
1215 Ga0265332_10002507 3300031238 Bacteria 9330
1216 Ga0265332_10267615 3300031238 Archaea 707
1217 Ga0265328_10060096 3300031239 Bacteria 1395
1218 Ga0265328_10157820 3300031239 Bacteria 855
1219 Ga0265320_10036181 3300031240 Bacteria 2496
1220 Ga0265320_10041508 3300031240 Bacteria 2286
1221 Ga0265320_10073454 3300031240 Bacteria 1607
1222 Ga0265320_10295396 3300031240 Unclassified 717
1223 Ga0265325_10007247 3300031241 Bacteria 6666
1224 Ga0265329_10010286 3300031242 Bacteria 3441
1225 Ga0265329_10060500 3300031242 Bacteria 1199
1226 Ga0265340_10055474 3300031247 Bacteria 1908
1227 Ga0265339_10004983 3300031249 Bacteria 8940
1228 Ga0265339_10043155 3300031249 Bacteria 2494
1229 Ga0265339_10125156 3300031249 Bacteria 1318
1230 Ga0265331_10047939 3300031250 Bacteria 2056
1231 Ga0265331_10266340 3300031250 Unclassified 768
1232 Ga0265327_10010961 3300031251 Bacteria 6307
1233 Ga0265327_10036784 3300031251 Bacteria 2687
1234 Ga0265327_10051034 3300031251 Bacteria 2161
1235 Ga0265327_10331420 3300031251 Unclassified 666
1236 Ga0265316_10025187 3300031344 Bacteria 4968
1237 Ga0265316_10028229 3300031344 Bacteria 4631
1238 Ga0265316_10165600 3300031344 Bacteria 1651
1239 Ga0265316_10459239 3300031344 Bacteria 913
1240 Ga0307408_100108292 3300031548 Bacteria 2130
1241 Ga0307408_100658927 3300031548 Unclassified 937
1242 Ga0307408_100774110 3300031548 Bacteria 869
1243 Ga0307408_100909912 3300031548 Bacteria 806
1244 Ga0265313_10023769 3300031595 Bacteria 3294
1245 Ga0265313_10025024 3300031595 Bacteria 3174
1246 Ga0265314_10005893 3300031711 Bacteria 10961
1247 Ga0265314_10081502 3300031711 Bacteria 2131
1248 Ga0265314_10457056 3300031711 Unclassified 679
1249 Ga0265342_10009581 3300031712 Bacteria 6806
1250 Ga0265342_10244166 3300031712 Unclassified 960
1251 Ga0307405_10074679 3300031731 Bacteria 2193
1252 Ga0307405_10207673 3300031731 Bacteria 1427
1253 Ga0307413_10062908 3300031824 Bacteria 2298
1254 Ga0307413_10140239 3300031824 Bacteria 1669
1255 Ga0307413_11488416 3300031824 Bacteria 598
1256 Ga0307410_10150437 3300031852 Bacteria 1732
1257 Ga0307410_10284284 3300031852 Bacteria 1299
1258 Ga0307410_10541313 3300031852 Unclassified 964
1259 Ga0307406_10034862 3300031901 Bacteria 3090
1260 Ga0307406_10041002 3300031901 Bacteria 2882
1261 Ga0307406_10109323 3300031901 Unclassified 1900
1262 Ga0307406_10344463 3300031901 Bacteria 1162
1263 Ga0307407_10136768 3300031903 Bacteria 1575
1264 Ga0307412_10143193 3300031911 Bacteria 1754
1265 Ga0307409_100047213 3300031995 Bacteria 3266
1266 Ga0307409_100188654 3300031995 Bacteria 1833
1267 Ga0307409_100342012 3300031995 Bacteria 1408
1268 Ga0307409_100588128 3300031995 Unclassified 1098
1269 Ga0307409_100724811 3300031995 Unclassified 996
1270 Ga0307416_100001649 3300032002 Bacteria 12310
1271 Ga0307416_100045351 3300032002 Bacteria 3461
1272 Ga0307416_100064873 3300032002 Bacteria 2998
1273 Ga0307416_100067528 3300032002 Bacteria 2950
1274 Ga0307416_100138014 3300032002 Bacteria 2210
1275 Ga0307416_100237760 3300032002 Bacteria 1762
1276 Ga0307416_100417648 3300032002 Bacteria 1384
1277 Ga0307416_100770743 3300032002 Bacteria 1056
1278 Ga0307416_102642623 3300032002 Bacteria 599
1279 Ga0307414_10537101 3300032004 Bacteria 1040
1280 Ga0307411_11617103 3300032005 Bacteria 598
1281 Ga0307415_100027955 3300032126 Bacteria 3581
1282 Ga0307415_100061759 3300032126 Bacteria 2596
1283 Ga0307415_100377198 3300032126 Bacteria 1203
1284 Ga0307415_100397820 3300032126 Bacteria 1175
1285 Ga0307415_100899723 3300032126 Bacteria 816
1286 Ga0316583_10019863 3300032133 Bacteria 2409
1287 Ga0316583_10134198 3300032133 Bacteria 862
1288 Ga0373930_0111454 3300034816 Bacteria 659
1289 Ga0373948_0026222 3300034817 Bacteria 1147
1290 Ga0373950_0015614 3300034818 Bacteria 1290
1291 Ga0373958_0064218 3300034819 Bacteria 802
1292 Ga0373958_0212373 3300034819 Bacteria 511
1293 Ga0373959_0166047 3300034820 Bacteria 566
1294 Ga0373926_0017042 3300035083 Bacteria 2490
1295 Ga0373928_0009325 3300035084 Unclassified 1916
1296 Ga0373928_0018520 3300035084 Bacteria 1444
1297 Ga0373929_0095370 3300035085 Bacteria 744
1298 Ga0373929_0105365 3300035085 Bacteria 715
1299 Ga0373940_0005004 3300035088 Bacteria 2843
1300 Ga0373940_0057792 3300035088 Bacteria 1103
1301 Ga0373944_0000745 3300035089 Bacteria 7920
1302 Ga0373949_0005758 3300035090 Bacteria 2757
1303 Ga0373949_0006396 3300035090 Bacteria 2592
1304 Ga0373949_0018814 3300035090 Bacteria 1569
1305 Ga0373951_0032073 3300035091 Unclassified 1241
1306 Ga0373951_0046247 3300035091 Bacteria 1061
1307 Ga0373952_0021926 3300035092 Bacteria 1353
1308 Ga0373932_0011109 3300035112 Bacteria 2193
1309 Ga0373936_0045862 3300035113 Unclassified 1761
1310 Ga0373936_0399718 3300035113 Bacteria 631
1311 Ga0373939_0000399 3300035114 Bacteria 10937
1312 Ga0373941_0096503 3300035115 Bacteria 1023
1313 Ga0373945_0008312 3300035116 Bacteria 3376
1314 Ga0373945_0022073 3300035116 Bacteria 2190
1315 Ga0373954_0222090 3300035118 Bacteria 929
1316 Ga0373956_0143291 3300035119 Bacteria 1123
1317 Ga0373957_0234103 3300035120 Bacteria 771
1318 Ga0373960_0003233 3300035121 Bacteria 3687
1319 Ga0373960_0003469 3300035121 Bacteria 3574
1320 Ga0373960_0108813 3300035121 Archaea 907
1321 Ga0373943_0003173 3300035170 Bacteria 7463
1322 Ga0373943_0008965 3300035170 Bacteria 4484
1323 Ga0373943_0320992 3300035170 Bacteria 883
1324 Ga0373943_0359775 3300035170 Bacteria 835
1325 Ga0373946_0009349 3300035171 Bacteria 3609
1326 Ga0373946_0026243 3300035171 Bacteria 2296
1327 Ga0373955_0224472 3300035172 Bacteria 1123
1328 Ga0373955_0749001 3300035172 Bacteria 600
1329 Ga0373942_0293390 3300035207 Unclassified 563
1330 Ga0373961_0131613 3300035241 Bacteria 838
1331 Ga0373961_0161275 3300035241 Unclassified 770
1332 Ga0373962_0003959 3300035242 Bacteria 3566
1333 Ga0373962_0316759 3300035242 Unclassified 557
1334 Ga0373924_0049442 3300035410 Bacteria 1740
1335 Ga0373931_0005648 3300035691 Bacteria 5804
1336 Ga0373931_0081587 3300035691 Bacteria 1786
1337 Ga0373931_0392084 3300035691 Bacteria 878
1338 Ga0373931_0692109 3300035691 Bacteria 673
1339 Ga0373931_0901756 3300035691 Unclassified 594
1340 Ga0373931_1017946 3300035691 Bacteria 561
1341 Ga0373935_0028679 3300035692 Bacteria 3440
1342 Ga0373933_0122520 3300035724 Bacteria 1629
1343 Ga0373933_0399993 3300035724 Bacteria 896
1344 Ga0373947_0001279 3300035725 Bacteria 15509
1345 Ga0373947_0006134 3300035725 Bacteria 6992
1346 Ga0373947_0618722 3300035725 Bacteria 738
1347 Ga0373947_0669029 3300035725 Bacteria 708
1348 Ga0373947_0718619 3300035725 Bacteria 682
1349 Ga0373947_0748445 3300035725 Unclassified 667
1350 Ga0373947_0992766 3300035725 Unclassified 573
1351 Ga0373937_0006653 3300036401 Bacteria 9974
1352 Ga0373937_0007353 3300036401 Bacteria 9536
1353 Ga0373937_0018081 3300036401 Bacteria 6288
1354 Ga0373925_0001456 3300037068 Bacteria 20442
1355 Ga0373925_0046597 3300037068 Bacteria 3224
1356 Ga0373925_0396519 3300037068 Bacteria 1125
1357 Ga0373925_0633992 3300037068 Bacteria 881
1358 Ga0395899_0002677 3300037312 Bacteria 14365
1359 Ga0395899_0004041 3300037312 Bacteria 11571
1360 Ga0395899_0004144 3300037312 Bacteria 11391
1361 Ga0395899_0005165 3300037312 Bacteria 10157
1362 Ga0395899_0005908 3300037312 Bacteria 9500
1363 Ga0395899_0016240 3300037312 Bacteria 5675
1364 Ga0395899_0020333 3300037312 Bacteria 5036
1365 Ga0395899_0021913 3300037312 Bacteria 4846
1366 Ga0395899_0022068 3300037312 Bacteria 4827
1367 Ga0395899_0064730 3300037312 Bacteria 2687
1368 Ga0395899_0088804 3300037312 Bacteria 2242
1369 Ga0395899_0089078 3300037312 Bacteria 2239
1370 Ga0395899_0090976 3300037312 Bacteria 2211
1371 Ga0395899_0102546 3300037312 Bacteria 2064
1372 Ga0395899_0113784 3300037312 Bacteria 1943
1373 Ga0395899_0166630 3300037312 Bacteria 1554
1374 Ga0395899_0166757 3300037312 Bacteria 1553
1375 Ga0395899_0225085 3300037312 Bacteria 1298
1376 Ga0395899_0276892 3300037312 Bacteria 1143
1377 Ga0395899_0296443 3300037312 Bacteria 1096
1378 Ga0395899_0299366 3300037312 Bacteria 1089
1379 Ga0395899_0323072 3300037312 Unclassified 1039
1380 Ga0395899_0341860 3300037312 Bacteria 1003
1381 Ga0395899_0796852 3300037312 Unclassified 584
1382 Ga0395899_0948246 3300037312 Bacteria 522
1383 Ga0395899_0984486 3300037312 Unclassified 509
1384 Ga0395900_0002083 3300037418 Bacteria 22427
1385 Ga0395900_0002314 3300037418 Bacteria 21122
1386 Ga0395900_0004683 3300037418 Bacteria 14422
1387 Ga0395900_0005017 3300037418 Bacteria 13883
1388 Ga0395900_0005410 3300037418 Bacteria 13376
1389 Ga0395900_0009778 3300037418 Bacteria 9829
1390 Ga0395900_0011172 3300037418 Bacteria 9180
1391 Ga0395900_0015616 3300037418 Bacteria 7740
1392 Ga0395900_0016527 3300037418 Bacteria 7527
1393 Ga0395900_0026887 3300037418 Bacteria 5888
1394 Ga0395900_0030387 3300037418 Bacteria 5548
1395 Ga0395900_0038986 3300037418 Bacteria 4897
1396 Ga0395900_0054857 3300037418 Bacteria 4103
1397 Ga0395900_0057375 3300037418 Bacteria 4008
1398 Ga0395900_0060361 3300037418 Bacteria 3902
1399 Ga0395900_0067125 3300037418 Bacteria 3685
1400 Ga0395900_0074153 3300037418 Bacteria 3499
1401 Ga0395900_0110888 3300037418 Bacteria 2818
1402 Ga0395900_0145181 3300037418 Bacteria 2426
1403 Ga0395900_0253277 3300037418 Bacteria 1761
1404 Ga0395900_0313222 3300037418 Bacteria 1552
1405 Ga0395900_0322795 3300037418 Bacteria 1524
1406 Ga0395900_0368436 3300037418 Bacteria 1407
1407 Ga0395900_0414645 3300037418 Bacteria 1308
1408 Ga0395900_0437702 3300037418 Bacteria 1266
1409 Ga0395900_0479444 3300037418 Bacteria 1196
1410 Ga0395900_0562978 3300037418 Bacteria 1083
1411 Ga0395900_0564491 3300037418 Bacteria 1081
1412 Ga0395900_0567737 3300037418 Bacteria 1078
1413 Ga0395900_0705801 3300037418 Unclassified 942
1414 Ga0395900_0707715 3300037418 Unclassified 940
1415 Ga0395900_0748419 3300037418 Bacteria 908
1416 Ga0395900_0792315 3300037418 Bacteria 876
1417 Ga0395900_0809613 3300037418 Bacteria 864
1418 Ga0395900_0939404 3300037418 Bacteria 787
1419 Ga0395900_1045940 3300037418 Bacteria 735
1420 Ga0395900_1182500 3300037418 Unclassified 680
1421 Ga0395900_1184534 3300037418 Bacteria 680
1422 Ga0395900_1456310 3300037418 Bacteria 597
1423 Ga0395900_1638993 3300037418 Unclassified 554
1424 Ga0395898_0004803 3300037466 Bacteria 14710
1425 Ga0395898_0006611 3300037466 Bacteria 12357
1426 Ga0395898_0006932 3300037466 Bacteria 12043
1427 Ga0395898_0008288 3300037466 Bacteria 10989
1428 Ga0395898_0008305 3300037466 Bacteria 10977
1429 Ga0395898_0010279 3300037466 Bacteria 9794
1430 Ga0395898_0015998 3300037466 Bacteria 7684
1431 Ga0395898_0025784 3300037466 Bacteria 5920
1432 Ga0395898_0027985 3300037466 Bacteria 5652
1433 Ga0395898_0028887 3300037466 Bacteria 5558
1434 Ga0395898_0029726 3300037466 Bacteria 5469
1435 Ga0395898_0029830 3300037466 Bacteria 5459
1436 Ga0395898_0031871 3300037466 Bacteria 5264
1437 Ga0395898_0032953 3300037466 Bacteria 5171
1438 Ga0395898_0033072 3300037466 Bacteria 5162
1439 Ga0395898_0042055 3300037466 Bacteria 4511
1440 Ga0395898_0060783 3300037466 Bacteria 3671
1441 Ga0395898_0078678 3300037466 Bacteria 3181
1442 Ga0395898_0155342 3300037466 Bacteria 2188
1443 Ga0395898_0160303 3300037466 Bacteria 2151
1444 Ga0395898_0166643 3300037466 Bacteria 2107
1445 Ga0395898_0186222 3300037466 Bacteria 1984
1446 Ga0395898_0206388 3300037466 Unclassified 1875
1447 Ga0395898_0221528 3300037466 Bacteria 1804
1448 Ga0395898_0257396 3300037466 Bacteria 1664
1449 Ga0395898_0323986 3300037466 Bacteria 1470
1450 Ga0395898_0414294 3300037466 Unclassified 1284
1451 Ga0395898_0491821 3300037466 Bacteria 1167
1452 Ga0395898_0526941 3300037466 Bacteria 1123
1453 Ga0395898_0585818 3300037466 Unclassified 1058
1454 Ga0395898_0722468 3300037466 Unclassified 938
1455 Ga0395898_1501567 3300037466 Unclassified 600
1456 Ga0395898_1566421 3300037466 Bacteria 584
1457 Ga0395905_0001594 3300037471 Bacteria 26980
1458 Ga0395905_0002067 3300037471 Bacteria 22867
1459 Ga0395905_0006934 3300037471 Bacteria 11329
1460 Ga0395905_0008879 3300037471 Bacteria 9873
1461 Ga0395905_0011264 3300037471 Bacteria 8646
1462 Ga0395905_0012413 3300037471 Bacteria 8200
1463 Ga0395905_0014166 3300037471 Bacteria 7620
1464 Ga0395905_0016030 3300037471 Bacteria 7123
1465 Ga0395905_0057187 3300037471 Bacteria 3648
1466 Ga0395905_0072300 3300037471 Bacteria 3233
1467 Ga0395905_0076164 3300037471 Bacteria 3144
1468 Ga0395905_0083812 3300037471 Bacteria 2986
1469 Ga0395905_0084704 3300037471 Bacteria 2970
1470 Ga0395905_0088030 3300037471 Bacteria 2911
1471 Ga0395905_0089447 3300037471 Bacteria 2886
1472 Ga0395905_0118658 3300037471 Bacteria 2486
1473 Ga0395905_0121500 3300037471 Bacteria 2455
1474 Ga0395905_0147766 3300037471 Bacteria 2211
1475 Ga0395905_0178754 3300037471 Bacteria 1992
1476 Ga0395905_0215311 3300037471 Bacteria 1799
1477 Ga0395905_0268845 3300037471 Bacteria 1591
1478 Ga0395905_0292225 3300037471 Unclassified 1516
1479 Ga0395905_0425000 3300037471 Unclassified 1225
1480 Ga0395905_0426025 3300037471 Bacteria 1223
1481 Ga0395905_0441870 3300037471 Bacteria 1198
1482 Ga0395905_0757418 3300037471 Bacteria 873
1483 Ga0395905_0820500 3300037471 Bacteria 833
1484 Ga0395905_0911438 3300037471 Bacteria 782
1485 Ga0395905_1085209 3300037471 Bacteria 704
1486 Ga0395905_1292650 3300037471 Bacteria 633
1487 Ga0395905_1832365 3300037471 Bacteria 513
1488 Ga0395901_0000793 3300038443 Bacteria 35158
1489 Ga0395901_0004478 3300038443 Bacteria 14095
1490 Ga0395901_0008234 3300038443 Bacteria 10534
1491 Ga0395901_0009150 3300038443 Bacteria 10032
1492 Ga0395901_0010539 3300038443 Bacteria 9363
1493 Ga0395901_0011611 3300038443 Bacteria 8920
1494 Ga0395901_0016092 3300038443 Bacteria 7620
1495 Ga0395901_0017354 3300038443 Bacteria 7348
1496 Ga0395901_0026300 3300038443 Bacteria 5975
1497 Ga0395901_0044094 3300038443 Bacteria 4626
1498 Ga0395901_0052696 3300038443 Bacteria 4228
1499 Ga0395901_0066791 3300038443 Bacteria 3745
1500 Ga0395901_0068691 3300038443 Bacteria 3691
1501 Ga0395901_0069501 3300038443 Bacteria 3667
1502 Ga0395901_0070458 3300038443 Bacteria 3642
1503 Ga0395901_0070697 3300038443 Bacteria 3636
1504 Ga0395901_0096258 3300038443 Bacteria 3102
1505 Ga0395901_0104667 3300038443 Bacteria 2970
1506 Ga0395901_0110790 3300038443 Bacteria 2882
1507 Ga0395901_0117972 3300038443 Bacteria 2788
1508 Ga0395901_0132049 3300038443 Bacteria 2624
1509 Ga0395901_0264774 3300038443 Bacteria 1788
1510 Ga0395901_0313051 3300038443 Bacteria 1625
1511 Ga0395901_0318532 3300038443 Bacteria 1609
1512 Ga0395901_0327041 3300038443 Bacteria 1585
1513 Ga0395901_0445022 3300038443 Bacteria 1326
1514 Ga0395901_0456570 3300038443 Bacteria 1306
1515 Ga0395901_0482776 3300038443 Bacteria 1264
1516 Ga0395901_0547206 3300038443 Bacteria 1173
1517 Ga0395901_0548828 3300038443 Bacteria 1171
1518 Ga0395901_0570974 3300038443 Bacteria 1144
1519 Ga0395901_0617688 3300038443 Unclassified 1091
1520 Ga0395901_0690598 3300038443 Bacteria 1019
1521 Ga0395901_0767111 3300038443 Bacteria 956
1522 Ga0395901_1014155 3300038443 Unclassified 805
1523 Ga0395901_1046317 3300038443 Bacteria 789
1524 Ga0395901_1092544 3300038443 Bacteria 768
1525 Ga0395901_1372862 3300038443 Unclassified 666
1526 Ga0395901_1422656 3300038443 Bacteria 651
1527 Ga0395901_1670188 3300038443 Bacteria 589
1528 Ga0395901_2064079 3300038443 Unclassified 515
1529 Ga0436360_1167324 3300039438 Bacteria 2047
1530 Ga0436362_0026661 3300039453 Bacteria 548
1531 Ga0439436_0157115 3300041404 Bacteria 642
1532 Ga0439439_0004354 3300041406 Bacteria 3184
1533 Ga0439461_0007396 3300041410 Bacteria 1944
1534 Ga0439466_0088489 3300041411 Bacteria 972
1535 Ga0451800_1502259 3300041459 Unclassified 563
1536 Ga0451807_2359858 3300041486 Bacteria 557
1537 Ga0451835_0082155 3300041492 Bacteria 581
1538 Ga0451845_0891764 3300041501 Unclassified 532
1539 Ga0451855_0430449 3300041511 Bacteria 1025
1540 Ga0451853_0630862 3300041512 Unclassified 1065
1541 Ga0451853_1116739 3300041512 Bacteria 1260
1542 Ga0451853_1943804 3300041512 Bacteria 1259
1543 Ga0439433_0023177 3300041999 Bacteria 1395
1544 Ga0439442_026948 3300042002 Bacteria 1197
1545 Ga0439448_0005987 3300042005 Bacteria 3484
1546 Ga0439448_0044482 3300042005 Bacteria 1444
1547 Ga0439448_0227881 3300042005 Unclassified 656
1548 Ga0439449_0116451 3300042007 Bacteria 991
1549 Ga0439450_081408 3300042008 Bacteria 806
1550 Ga0439451_001220 3300042009 Bacteria 5070
1551 Ga0439454_007866 3300042011 Bacteria 1347
1552 Ga0439457_036664 3300042014 Bacteria 1091
1553 Ga0439462_0108257 3300042015 Bacteria 769
1554 Ga0439463_192348 3300042016 Unclassified 530
1555 Ga0450914_039156 3300042118 Bacteria 597
1556 Ga0450923_098142 3300042125 Bacteria 674
1557 Ga0450923_185270 3300042125 Unclassified 514
1558 Ga0450910_034289 3300042147 Bacteria 805
1559 Ga0439446_0001521 3300042156 Bacteria 5320
1560 Ga0439446_0018458 3300042156 Bacteria 1954
1561 Ga0439458_0019663 3300042157 Bacteria 1555
1562 Ga0439440_0161005 3300042993 Bacteria 648
1563 Ga0439440_0172005 3300042993 Unclassified 630
1564 Ga0466969_0001820 3300044656 Bacteria 11388
1565 Ga0466972_0048222 3300044658 Unclassified 2058
1566 Ga0466972_0176459 3300044658 Bacteria 1002
1567 Ga0466966_0032230 3300044684 Bacteria 3398
1568 Ga0466966_0034581 3300044684 Bacteria 3267
1569 Ga0466966_0091299 3300044684 Bacteria 1890
1570 Ga0466966_0439330 3300044684 Bacteria 784
1571 Ga0466961_0006902 3300044693 Bacteria 7223
1572 Ga0466961_0103728 3300044693 Bacteria 1790
1573 Ga0466961_0131414 3300044693 Bacteria 1569
1574 Ga0466961_0619934 3300044693 Bacteria 650
1575 Ga0466961_0714462 3300044693 Bacteria 600
1576 Ga0466963_0000263 3300044694 Bacteria 23137
1577 Ga0466963_0000518 3300044694 Bacteria 18034
1578 Ga0466963_0006212 3300044694 Bacteria 7054
1579 Ga0466963_0009095 3300044694 Bacteria 5971
1580 Ga0466963_0010487 3300044694 Bacteria 5610
1581 Ga0466963_0024102 3300044694 Bacteria 3871
1582 Ga0466963_0029137 3300044694 Bacteria 3550
1583 Ga0466963_0053273 3300044694 Bacteria 2686
1584 Ga0466963_0054477 3300044694 Bacteria 2658
1585 Ga0466963_0203915 3300044694 Bacteria 1383
1586 Ga0466963_0243073 3300044694 Bacteria 1262
1587 Ga0466963_0352208 3300044694 Unclassified 1037
1588 Ga0466963_0462349 3300044694 Bacteria 895
1589 Ga0466963_1094722 3300044694 Bacteria 560
1590 Ga0466963_1138189 3300044694 Bacteria 549
1591 Ga0466964_0001506 3300044706 Bacteria 8002
1592 Ga0466964_0003774 3300044706 Bacteria 5556
1593 Ga0466964_0004479 3300044706 Bacteria 5161
1594 Ga0466964_0005622 3300044706 Bacteria 4658
1595 Ga0466964_0111577 3300044706 Bacteria 1220
1596 Ga0466964_0138114 3300044706 Bacteria 1117
1597 Ga0466964_0173822 3300044706 Bacteria 1016
1598 Ga0466971_0039230 3300044719 Bacteria 2125
1599 Ga0466971_0113162 3300044719 Unclassified 1253
1600 Ga0466971_0132686 3300044719 Bacteria 1157
1601 Ga0466971_0159258 3300044719 Bacteria 1056
1602 Ga0466971_0285981 3300044719 Bacteria 790
1603 Ga0466968_0011483 3300044735 Bacteria 3451
1604 Ga0466968_0012530 3300044735 Bacteria 3322
1605 Ga0466968_0030579 3300044735 Bacteria 2231
1606 Ga0466968_0036551 3300044735 Bacteria 2058
1607 Ga0466968_0082497 3300044735 Bacteria 1415
1608 Ga0466970_0005115 3300044765 Bacteria 6477
1609 Ga0466970_0183895 3300044765 Bacteria 1160
1610 Ga0466970_0305978 3300044765 Bacteria 897
1611 Ga0466970_0630873 3300044765 Unclassified 623
1612 Ga0466957_0025050 3300044842 Bacteria 3534
1613 Ga0466957_0035217 3300044842 Bacteria 3004
1614 Ga0466957_0052988 3300044842 Bacteria 2472
1615 Ga0466957_0076729 3300044842 Bacteria 2075
1616 Ga0466957_0112564 3300044842 Bacteria 1727
1617 Ga0466957_0187506 3300044842 Bacteria 1353
1618 Ga0466957_0543403 3300044842 Bacteria 809
1619 Ga0466957_0668660 3300044842 Bacteria 731
1620 Ga0466957_1351809 3300044842 Bacteria 518
1621 Ga0466960_0002920 3300044901 Bacteria 6505
1622 Ga0466960_0050369 3300044901 Bacteria 2008
1623 Ga0466960_0206439 3300044901 Bacteria 1075
1624 Ga0466960_0300422 3300044901 Bacteria 904
1625 Ga0466960_0600756 3300044901 Unclassified 653
1626 Ga0466959_0009634 3300045049 Bacteria 6873
1627 Ga0466959_0018185 3300045049 Bacteria 5159
1628 Ga0466959_0032823 3300045049 Bacteria 3842
1629 Ga0451576_0026465 3300045051 Bacteria 6240
1630 Ga0466958_0016400 3300045836 Bacteria 4265
1631 Ga0466958_0046849 3300045836 Bacteria 2609
1632 Ga0466958_0054700 3300045836 Bacteria 2421
1633 Ga0466958_0064819 3300045836 Bacteria 2229
1634 Ga0466958_0114370 3300045836 Bacteria 1685
1635 Ga0466958_0149939 3300045836 Bacteria 1471
1636 Ga0466958_0184486 3300045836 Unclassified 1324
1637 Ga0466958_0198116 3300045836 Bacteria 1278
1638 Ga0466958_0261874 3300045836 Bacteria 1107
1639 Ga0466958_0314816 3300045836 Bacteria 1005
1640 Ga0466958_0350136 3300045836 Unclassified 951
1641 Ga0466958_0980623 3300045836 Bacteria 551
1642 Ga0466967_0000215 3300045976 Bacteria 24572
1643 Ga0466967_0000318 3300045976 Bacteria 21830
1644 Ga0466967_0003534 3300045976 Bacteria 10229
1645 Ga0466967_0012538 3300045976 Bacteria 6490
1646 Ga0466967_0021821 3300045976 Bacteria 5210
1647 Ga0466967_0023035 3300045976 Bacteria 5096
1648 Ga0466967_0038892 3300045976 Bacteria 4083
1649 Ga0466967_0048323 3300045976 Bacteria 3714
1650 Ga0466967_0050125 3300045976 Bacteria 3655
1651 Ga0466967_0082996 3300045976 Bacteria 2897
1652 Ga0466967_0094207 3300045976 Bacteria 2726
1653 Ga0466967_0098545 3300045976 Bacteria 2669
1654 Ga0466967_0131348 3300045976 Bacteria 2325
1655 Ga0466967_0208616 3300045976 Bacteria 1852
1656 Ga0466967_0237546 3300045976 Bacteria 1737
1657 Ga0466967_0239672 3300045976 Bacteria 1730
1658 Ga0466967_0247010 3300045976 Bacteria 1703
1659 Ga0466967_0275510 3300045976 Bacteria 1613
1660 Ga0466967_0348918 3300045976 Bacteria 1432
1661 Ga0466967_0355559 3300045976 Bacteria 1418
1662 Ga0466967_0369390 3300045976 Bacteria 1391
1663 Ga0466967_0426393 3300045976 Bacteria 1293
1664 Ga0466967_0481545 3300045976 Bacteria 1216
1665 Ga0466967_0806354 3300045976 Bacteria 932
1666 Ga0466967_1351928 3300045976 Bacteria 709
1667 Ga0466967_1517853 3300045976 Bacteria 667
1668 Ga0466967_2119790 3300045976 Bacteria 558
1669 Ga0495592_0000597 3300046454 Bacteria 25448
1670 Ga0495592_0005696 3300046454 Bacteria 9216
1671 Ga0495592_0046693 3300046454 Bacteria 3228
1672 Ga0495592_0130775 3300046454 Bacteria 1756
1673 Ga0495592_0420722 3300046454 Bacteria 843
1674 Ga0495603_0000450 3300046455 Bacteria 22609
1675 Ga0495603_0013278 3300046455 Bacteria 4980
1676 Ga0495603_0048230 3300046455 Bacteria 2536
1677 Ga0495603_0381581 3300046455 Bacteria 808
1678 Ga0495590_0116513 3300046457 Bacteria 956
1679 Ga0495629_0003233 3300046459 Bacteria 12343
1680 Ga0495629_0007112 3300046459 Bacteria 8244
1681 Ga0495629_0214931 3300046459 Unclassified 1327
1682 Ga0495629_0998062 3300046459 Bacteria 545
1683 Ga0495641_0001513 3300046461 Bacteria 19794
1684 Ga0495641_0005148 3300046461 Bacteria 8947
1685 Ga0495641_0020692 3300046461 Bacteria 3328
1686 Ga0495641_0059752 3300046461 Bacteria 1723
1687 Ga0495641_0139679 3300046461 Bacteria 1082
1688 Ga0495641_0153710 3300046461 Unclassified 1029
1689 Ga0495641_0158171 3300046461 Bacteria 1013
1690 Ga0495641_0174446 3300046461 Bacteria 962
1691 Ga0495641_0241207 3300046461 Bacteria 812
1692 Ga0495651_0000008 3300046462 Bacteria 156989
1693 Ga0495651_0022741 3300046462 Bacteria 4873
1694 Ga0495651_0028448 3300046462 Bacteria 4355
1695 Ga0495653_0000725 3300046463 Bacteria 25130
1696 Ga0495653_0018297 3300046463 Bacteria 5693
1697 Ga0495653_0087395 3300046463 Bacteria 2290
1698 Ga0495653_0110501 3300046463 Bacteria 1976
1699 Ga0495653_0146754 3300046463 Bacteria 1652
1700 Ga0495580_0006863 3300046472 Bacteria 9209
1701 Ga0495580_0454092 3300046472 Unclassified 860
1702 Ga0495580_1008683 3300046472 Bacteria 530
1703 Ga0495582_0000711 3300046473 Bacteria 18383
1704 Ga0495582_0006254 3300046473 Bacteria 6636
1705 Ga0495582_0010487 3300046473 Bacteria 5097
1706 Ga0495582_0054854 3300046473 Unclassified 2197
1707 Ga0495582_0113289 3300046473 Bacteria 1524
1708 Ga0495582_0187405 3300046473 Unclassified 1180
1709 Ga0495582_0817904 3300046473 Bacteria 539
1710 Ga0495605_0016394 3300046474 Bacteria 4010
1711 Ga0495605_0128192 3300046474 Unclassified 1146
1712 Ga0495605_0131005 3300046474 Bacteria 1131
1713 Ga0495605_0134421 3300046474 Bacteria 1113
1714 Ga0495605_0169453 3300046474 Bacteria 965
1715 Ga0495639_0000520 3300046475 Bacteria 18060
1716 Ga0495639_0018584 3300046475 Bacteria 3028
1717 Ga0495639_0029734 3300046475 Bacteria 2425
1718 Ga0495639_0087680 3300046475 Unclassified 1457
1719 Ga0495662_0006328 3300046476 Bacteria 5918
1720 Ga0495662_0031185 3300046476 Bacteria 2575
1721 Ga0495664_0002367 3300046477 Bacteria 10105
1722 Ga0495664_0154579 3300046477 Bacteria 1391
1723 Ga0495584_0031793 3300046491 Bacteria 2671
1724 Ga0495584_0063867 3300046491 Bacteria 1851
1725 Ga0495584_0069770 3300046491 Bacteria 1766
1726 Ga0495584_0086267 3300046491 Bacteria 1582
1727 Ga0495584_0200937 3300046491 Bacteria 1013
1728 Ga0495584_0378151 3300046491 Bacteria 719
1729 Ga0495584_0387787 3300046491 Bacteria 710
1730 Ga0495584_0515900 3300046491 Bacteria 609
1731 Ga0495585_0017067 3300046492 Bacteria 4201
1732 Ga0495585_0068828 3300046492 Bacteria 1933
1733 Ga0495585_0088515 3300046492 Bacteria 1670
1734 Ga0495585_0434987 3300046492 Unclassified 629
1735 Ga0495594_0001436 3300046499 Bacteria 12355
1736 Ga0495594_0019684 3300046499 Bacteria 3590
1737 Ga0495594_0400628 3300046499 Bacteria 781
1738 Ga0495596_0138807 3300046500 Bacteria 944
1739 Ga0495596_0156249 3300046500 Bacteria 886
1740 Ga0495596_0325474 3300046500 Unclassified 598
1741 Ga0495607_0072230 3300046501 Bacteria 1922
1742 Ga0495607_0251417 3300046501 Bacteria 851
1743 Ga0495608_0000957 3300046511 Bacteria 20357
1744 Ga0495608_0008651 3300046511 Bacteria 7122
1745 Ga0495608_0021667 3300046511 Bacteria 4411
1746 Ga0495608_0260082 3300046511 Unclassified 1081
1747 Ga0495608_0624621 3300046511 Unclassified 645
1748 Ga0495616_0204705 3300046513 Bacteria 866
1749 Ga0495618_0218526 3300046514 Bacteria 1203
1750 Ga0495618_0224197 3300046514 Unclassified 1185
1751 Ga0495618_0246571 3300046514 Bacteria 1121
1752 Ga0495628_0000105 3300046516 Bacteria 68159
1753 Ga0495628_0030882 3300046516 Bacteria 4335
1754 Ga0495628_0129031 3300046516 Bacteria 1935
1755 Ga0495628_0194383 3300046516 Bacteria 1531
1756 Ga0495628_0229586 3300046516 Bacteria 1392
1757 Ga0495628_0421896 3300046516 Bacteria 972
1758 Ga0495628_0938032 3300046516 Bacteria 599
1759 Ga0495630_0001692 3300046517 Bacteria 15385
1760 Ga0495630_0028880 3300046517 Bacteria 4122
1761 Ga0495630_0154549 3300046517 Bacteria 1746
1762 Ga0495630_0309354 3300046517 Bacteria 1208
1763 Ga0495630_0960762 3300046517 Bacteria 650
1764 Ga0495631_0052677 3300046518 Bacteria 1777
1765 Ga0495631_0143877 3300046518 Bacteria 1024
1766 Ga0495631_0176074 3300046518 Bacteria 917
1767 Ga0495632_0488661 3300046519 Bacteria 532
1768 Ga0495637_0284060 3300046520 Bacteria 590
1769 Ga0495643_0110411 3300046522 Bacteria 1399
1770 Ga0495644_0003055 3300046523 Bacteria 6626
1771 Ga0495644_0071739 3300046523 Bacteria 1302
1772 Ga0495644_0128930 3300046523 Bacteria 964
1773 Ga0495644_0129081 3300046523 Bacteria 963
1774 Ga0495644_0323783 3300046523 Bacteria 605
1775 Ga0495644_0330386 3300046523 Bacteria 599
1776 Ga0495644_0354634 3300046523 Unclassified 578
1777 Ga0495663_0011353 3300046525 Bacteria 2480
1778 Ga0495663_0011608 3300046525 Bacteria 2451
1779 Ga0495663_0033145 3300046525 Bacteria 1541
1780 Ga0495663_0053064 3300046525 Bacteria 1260
1781 Ga0495666_0000272 3300046526 Bacteria 22361
1782 Ga0495666_0015797 3300046526 Bacteria 3761
1783 Ga0495666_0311503 3300046526 Unclassified 711
1784 Ga0495642_0028858 3300046528 Bacteria 2212
1785 Ga0495642_0141062 3300046528 Unclassified 1040
1786 Ga0495642_0150006 3300046528 Unclassified 1008
1787 Ga0495642_0303275 3300046528 Bacteria 700
1788 Ga0495652_0001221 3300046529 Bacteria 28813
1789 Ga0495652_0035808 3300046529 Bacteria 4318
1790 Ga0495652_0052130 3300046529 Bacteria 3491
1791 Ga0495652_0249973 3300046529 Bacteria 1314
1792 Ga0495652_0512561 3300046529 Bacteria 830
1793 Ga0495652_0758721 3300046529 Bacteria 649
1794 Ga0495665_0001436 3300046531 Bacteria 12777
1795 Ga0495640_0023975 3300046533 Bacteria 4439
1796 Ga0495640_0028193 3300046533 Bacteria 4044
1797 Ga0495586_0006708 3300046535 Bacteria 6148
1798 Ga0495587_0000048 3300046536 Bacteria 105358
1799 Ga0495587_0039817 3300046536 Bacteria 2811
1800 Ga0495587_0285081 3300046536 Bacteria 925
1801 Ga0495609_0131354 3300046538 Bacteria 1072
1802 Ga0495609_0162145 3300046538 Bacteria 947
1803 Ga0495609_0392872 3300046538 Bacteria 556
1804 Ga0495621_0007874 3300046539 Bacteria 3170
1805 Ga0495621_0165408 3300046539 Bacteria 877
1806 Ga0495621_0398962 3300046539 Bacteria 583
1807 Ga0495621_0421876 3300046539 Bacteria 568
1808 Ga0495597_0037372 3300046542 Bacteria 2181
1809 Ga0495597_0102071 3300046542 Bacteria 1209
1810 Ga0495645_0000029 3300046543 Bacteria 113119
1811 Ga0495645_0131449 3300046543 Bacteria 1753
1812 Ga0495633_0081195 3300046558 Bacteria 1509
1813 Ga0495633_0483864 3300046558 Bacteria 558
1814 Ga0495667_0066033 3300046559 Bacteria 2366
1815 Ga0495667_0108761 3300046559 Bacteria 1791
1816 Ga0495667_0217753 3300046559 Bacteria 1219
1817 Ga0495667_0302390 3300046559 Bacteria 1013
1818 Ga0495667_0307918 3300046559 Bacteria 1003
1819 Ga0495667_0424752 3300046559 Bacteria 836
1820 Ga0495667_0880139 3300046559 Unclassified 550
1821 Ga0495667_0984166 3300046559 Bacteria 515
1822 Ga0495656_0072590 3300046615 Bacteria 1532
1823 Ga0495656_0120815 3300046615 Unclassified 1236
1824 Ga0495656_0169279 3300046615 Unclassified 1067
1825 Ga0495656_0179173 3300046615 Bacteria 1041
1826 Ga0495656_0579955 3300046615 Unclassified 599
1827 Ga0495656_0663453 3300046615 Bacteria 560
1828 Ga0495656_0824271 3300046615 Unclassified 502
1829 Ga0495668_0116491 3300046616 Bacteria 1461
1830 Ga0495668_0271586 3300046616 Bacteria 929
1831 Ga0495668_0681690 3300046616 Bacteria 568
1832 Ga0495634_0014004 3300046642 Bacteria 5790
1833 Ga0495634_0242676 3300046642 Bacteria 1104
1834 Ga0495634_0436372 3300046642 Bacteria 774
1835 Ga0495611_0073600 3300046648 Bacteria 1564
1836 Ga0495611_0253405 3300046648 Bacteria 816
1837 Ga0495611_0408547 3300046648 Bacteria 620
1838 Ga0495611_0475971 3300046648 Unclassified 568
1839 Ga0495635_0012512 3300046663 Bacteria 5944
1840 Ga0495635_0033068 3300046663 Bacteria 3588
1841 Ga0495635_0158161 3300046663 Bacteria 1542
1842 Ga0495635_0286444 3300046663 Unclassified 1106
1843 Ga0495659_0029557 3300046664 Bacteria 1903
1844 Ga0495659_0061690 3300046664 Bacteria 1386
1845 Ga0495659_0341468 3300046664 Unclassified 638
1846 Ga0495661_0069750 3300046665 Bacteria 2059
1847 Ga0495661_0511175 3300046665 Unclassified 572
1848 Ga0495661_0540157 3300046665 Bacteria 552
1849 Ga0495588_0000857 3300046674 Bacteria 13453
1850 Ga0495588_0032981 3300046674 Bacteria 2613
1851 Ga0495657_0016620 3300046675 Bacteria 5359
1852 Ga0495657_0044787 3300046675 Bacteria 3007
1853 Ga0495657_0605798 3300046675 Unclassified 634
1854 Ga0495599_0000110 3300046678 Bacteria 55240
1855 Ga0495599_0003982 3300046678 Bacteria 8700
1856 Ga0495599_0104400 3300046678 Bacteria 1765
1857 Ga0495599_0747782 3300046678 Bacteria 561
1858 Ga0495623_0000379 3300046679 Bacteria 29118
1859 Ga0495646_0002891 3300046680 Bacteria 10637
1860 Ga0495646_0021855 3300046680 Bacteria 4041
1861 Ga0495647_0000245 3300046681 Bacteria 14888
1862 Ga0495647_0008243 3300046681 Bacteria 3501
1863 Ga0495647_0137926 3300046681 Unclassified 1038
1864 Ga0495658_0000675 3300046683 Bacteria 18488
1865 Ga0495658_0005244 3300046683 Bacteria 6380
1866 Ga0495658_0044590 3300046683 Bacteria 2486
1867 Ga0495658_0130024 3300046683 Unclassified 1532
1868 Ga0495658_0143821 3300046683 Bacteria 1460
1869 Ga0495658_0180331 3300046683 Bacteria 1310
1870 Ga0495613_0006283 3300046689 Bacteria 8885
1871 Ga0495613_0007635 3300046689 Bacteria 8045
1872 Ga0495613_0043580 3300046689 Bacteria 3319
1873 Ga0495613_0073212 3300046689 Bacteria 2497
1874 Ga0495613_0100821 3300046689 Unclassified 2085
1875 Ga0495613_0637682 3300046689 Unclassified 706
1876 Ga0495624_0008345 3300046690 Bacteria 7232
1877 Ga0495624_0287470 3300046690 Unclassified 992
1878 Ga0495624_0371590 3300046690 Bacteria 859
1879 Ga0495624_0425834 3300046690 Bacteria 796
1880 Ga0495624_0577208 3300046690 Bacteria 671
1881 Ga0495624_0752658 3300046690 Unclassified 577
1882 Ga0495624_0818820 3300046690 Bacteria 550
1883 Ga0495670_0230034 3300046691 Bacteria 986
1884 Ga0495670_0341683 3300046691 Bacteria 805
1885 Ga0495670_0771147 3300046691 Bacteria 525
1886 Ga0495671_0056512 3300046692 Bacteria 1943
1887 Ga0495671_0058342 3300046692 Bacteria 1910
1888 Ga0495671_0133012 3300046692 Bacteria 1213
1889 Ga0495589_0034703 3300046794 Bacteria 2531
1890 Ga0495589_0049909 3300046794 Bacteria 2071
1891 Ga0495589_0369902 3300046794 Bacteria 659
1892 Ga0495600_0062619 3300046809 Bacteria 2430
1893 Ga0495600_0092702 3300046809 Bacteria 1970
1894 Ga0495600_0115302 3300046809 Bacteria 1749
1895 Ga0495600_0156692 3300046809 Unclassified 1473
1896 Ga0495600_0385074 3300046809 Bacteria 874
1897 Ga0495600_0858672 3300046809 Bacteria 538
1898 Ga0495581_0000297 3300047315 Bacteria 24170
1899 Ga0495581_0000598 3300047315 Bacteria 18892
1900 Ga0495581_0002214 3300047315 Bacteria 10948
1901 Ga0495581_0146970 3300047315 Bacteria 1376
1902 Ga0495581_0298879 3300047315 Bacteria 941
1903 Ga0495581_0673649 3300047315 Bacteria 597
1904 Ga0495604_0000687 3300047317 Bacteria 28670
1905 Ga0495604_0204119 3300047317 Bacteria 1369
1906 Ga0495674_0019362 3300047319 Bacteria 6316
1907 Ga0495674_0042000 3300047319 Bacteria 4082
1908 Ga0495674_0186156 3300047319 Bacteria 1727
1909 Ga0495676_0000602 3300047321 Bacteria 29783
1910 Ga0495676_0019704 3300047321 Bacteria 5930
1911 Ga0495676_0021995 3300047321 Bacteria 5557
1912 Ga0495676_0052541 3300047321 Bacteria 3252
1913 Ga0495676_0098246 3300047321 Bacteria 2173
1914 Ga0495676_0219113 3300047321 Bacteria 1312
1915 Ga0495676_0741832 3300047321 Unclassified 634
1916 Ga0495676_0843795 3300047321 Unclassified 588
1917 Ga0495680_0013112 3300047322 Bacteria 7244
1918 Ga0495680_0016904 3300047322 Bacteria 6247
1919 Ga0495680_0033372 3300047322 Bacteria 4168
1920 Ga0495680_0070988 3300047322 Bacteria 2653
1921 Ga0495680_0082261 3300047322 Bacteria 2430
1922 Ga0495680_0252541 3300047322 Bacteria 1249
1923 Ga0495680_1038008 3300047322 Unclassified 521
1924 Ga0495683_0050698 3300047323 Bacteria 2077
1925 Ga0495675_0000419 3300047444 Bacteria 28791
1926 Ga0495675_0586130 3300047444 Bacteria 633
1927 Ga0495677_0037077 3300047445 Bacteria 1781
1928 Ga0495677_0157117 3300047445 Bacteria 877
1929 Ga0495681_0079155 3300047470 Bacteria 1471
1930 Ga0495681_0270214 3300047470 Bacteria 666
1931 Ga0495684_0033445 3300047471 Bacteria 3942
1932 Ga0495684_0046293 3300047471 Bacteria 3328
1933 Ga0495684_0072923 3300047471 Bacteria 2608
1934 Ga0495684_0073985 3300047471 Bacteria 2588
1935 Ga0495684_0104783 3300047471 Bacteria 2137
1936 Ga0495684_0283064 3300047471 Bacteria 1196
1937 Ga0495684_0496711 3300047471 Bacteria 840
1938 Ga0495593_0000863 3300047673 Bacteria 17564
1939 Ga0495593_0269515 3300047673 Bacteria 852
1940 Ga0495602_0001409 3300048088 Bacteria 23791
1941 Ga0495602_0213075 3300048088 Unclassified 1464
1942 Ga0495602_0244323 3300048088 Bacteria 1341
1943 Ga0495614_0000132 3300048089 Bacteria 26286
1944 Ga0495626_0121233 3300048091 Bacteria 1124
1945 Ga0495626_0146798 3300048091 Bacteria 997
1946 Ga0495626_0246558 3300048091 Bacteria 718
1947 Ga0495626_0330093 3300048091 Bacteria 598
1948 Ga0496100_0001414 3300048903 Bacteria 11740
1949 Ga0496100_0014145 3300048903 Bacteria 4625
1950 Ga0496100_0015416 3300048903 Bacteria 4463
1951 Ga0496100_0017829 3300048903 Bacteria 4199
1952 Ga0496100_0112039 3300048903 Bacteria 1897
1953 Ga0496100_0132628 3300048903 Bacteria 1756
1954 Ga0496100_0388522 3300048903 Bacteria 1061
1955 Ga0496100_0392486 3300048903 Bacteria 1055
1956 Ga0496100_0393839 3300048903 Bacteria 1054
1957 Ga0496100_0697018 3300048903 Bacteria 792
1958 Ga0496100_0868820 3300048903 Bacteria 708
1959 Ga0496100_1357425 3300048903 Unclassified 561
1960 Ga0496100_1538655 3300048903 Bacteria 525
1961 Ga0496101_0013810 3300048904 Bacteria 5420
1962 Ga0496101_0013867 3300048904 Bacteria 5408
1963 Ga0496101_0016094 3300048904 Bacteria 5049
1964 Ga0496101_0017689 3300048904 Bacteria 4834
1965 Ga0496101_0023909 3300048904 Bacteria 4224
1966 Ga0496101_0055023 3300048904 Bacteria 2873
1967 Ga0496101_0076021 3300048904 Bacteria 2473
1968 Ga0496101_0085940 3300048904 Bacteria 2332
1969 Ga0496101_0087703 3300048904 Bacteria 2310
1970 Ga0496101_0136966 3300048904 Bacteria 1864
1971 Ga0496101_0149097 3300048904 Bacteria 1788
1972 Ga0496101_0157476 3300048904 Bacteria 1740
1973 Ga0496101_0192851 3300048904 Bacteria 1573
1974 Ga0496101_0315318 3300048904 Bacteria 1226
1975 Ga0496101_0319684 3300048904 Bacteria 1218
1976 Ga0496101_0371169 3300048904 Bacteria 1125
1977 Ga0496101_0627147 3300048904 Bacteria 850
1978 Ga0496101_0667874 3300048904 Unclassified 821
1979 Ga0496101_1137930 3300048904 Unclassified 612
1980 Ga0496101_1357291 3300048904 Bacteria 555
1981 Ga0496102_0005223 3300048905 Bacteria 11027
1982 Ga0496102_0006436 3300048905 Bacteria 10014
1983 Ga0496102_0021074 3300048905 Bacteria 5765
1984 Ga0496102_0056521 3300048905 Bacteria 3580
1985 Ga0496102_0057586 3300048905 Bacteria 3549
1986 Ga0496102_0214137 3300048905 Unclassified 1816
1987 Ga0496102_0218004 3300048905 Bacteria 1798
1988 Ga0496102_0357591 3300048905 Bacteria 1375
1989 Ga0496102_0387720 3300048905 Bacteria 1314
1990 Ga0496102_0482860 3300048905 Bacteria 1161
1991 Ga0496102_0547381 3300048905 Unclassified 1080
1992 Ga0496102_0586641 3300048905 Bacteria 1037
1993 Ga0496102_0590471 3300048905 Bacteria 1033
1994 Ga0496102_0916695 3300048905 Bacteria 798
1995 Ga0496102_1019694 3300048905 Bacteria 748
1996 Ga0496103_0005916 3300048906 Bacteria 7310
1997 Ga0496103_0011456 3300048906 Bacteria 5256
1998 Ga0496103_0016207 3300048906 Bacteria 4446
1999 Ga0496103_0023606 3300048906 Bacteria 3710
2000 Ga0496103_0041682 3300048906 Bacteria 2823
2001 Ga0496103_0082527 3300048906 Bacteria 2023
2002 Ga0496103_0086280 3300048906 Unclassified 1978
2003 Ga0496103_0201954 3300048906 Bacteria 1278
2004 Ga0496103_0741431 3300048906 Bacteria 621
2005 Ga0496104_0000699 3300048907 Bacteria 28859
2006 Ga0496104_0000977 3300048907 Bacteria 24462
2007 Ga0496104_0036334 3300048907 Bacteria 4605
2008 Ga0496104_0061738 3300048907 Bacteria 3553
2009 Ga0496104_0100133 3300048907 Bacteria 2774
2010 Ga0496104_0106602 3300048907 Bacteria 2685
2011 Ga0496104_0130144 3300048907 Bacteria 2417
2012 Ga0496104_0143747 3300048907 Bacteria 2291
2013 Ga0496104_0168760 3300048907 Bacteria 2099
2014 Ga0496104_0183359 3300048907 Bacteria 2003
2015 Ga0496104_0207547 3300048907 Bacteria 1871
2016 Ga0496104_0675208 3300048907 Bacteria 941
2017 Ga0496104_0703619 3300048907 Bacteria 918
2018 Ga0496104_0792816 3300048907 Unclassified 854
2019 Ga0496104_1097208 3300048907 Unclassified 699
2020 Ga0496104_1184520 3300048907 Archaea 667
2021 Ga0496105_0000148 3300048908 Bacteria 46239
2022 Ga0496105_0000926 3300048908 Bacteria 19982
2023 Ga0496105_0005915 3300048908 Bacteria 9332
2024 Ga0496105_0006724 3300048908 Bacteria 8845
2025 Ga0496105_0022506 3300048908 Bacteria 5104
2026 Ga0496105_0032128 3300048908 Bacteria 4306
2027 Ga0496105_0116738 3300048908 Bacteria 2201
2028 Ga0496105_0123903 3300048908 Bacteria 2130
2029 Ga0496105_0130404 3300048908 Bacteria 2073
2030 Ga0496105_0142625 3300048908 Bacteria 1971
2031 Ga0496105_0250294 3300048908 Bacteria 1436
2032 Ga0496105_0274875 3300048908 Bacteria 1360
2033 Ga0496105_0473846 3300048908 Unclassified 986
2034 Ga0496105_0960179 3300048908 Bacteria 641
2035 Ga0496106_0007627 3300048909 Bacteria 8002
2036 Ga0496106_0007848 3300048909 Bacteria 7897
2037 Ga0496106_0008728 3300048909 Bacteria 7495
2038 Ga0496106_0015040 3300048909 Bacteria 5726
2039 Ga0496106_0056058 3300048909 Bacteria 2979
2040 Ga0496106_0069904 3300048909 Bacteria 2681
2041 Ga0496106_0083820 3300048909 Bacteria 2452
2042 Ga0496106_0088349 3300048909 Bacteria 2389
2043 Ga0496106_0180007 3300048909 Bacteria 1678
2044 Ga0496106_0206389 3300048909 Bacteria 1564
2045 Ga0496106_0484397 3300048909 Unclassified 994
2046 Ga0496106_0498796 3300048909 Bacteria 978
2047 Ga0496106_1049285 3300048909 Unclassified 640
2048 Ga0496106_1494898 3300048909 Bacteria 520
2049 Ga0496107_0002059 3300048910 Bacteria 12861
2050 Ga0496107_0011521 3300048910 Bacteria 6160
2051 Ga0496107_0022045 3300048910 Bacteria 4499
2052 Ga0496107_0036862 3300048910 Bacteria 3508
2053 Ga0496107_0147560 3300048910 Bacteria 1739
2054 Ga0496107_0155304 3300048910 Bacteria 1694
2055 Ga0496107_0185118 3300048910 Bacteria 1547
2056 Ga0496107_0211686 3300048910 Bacteria 1441
2057 Ga0496107_0226203 3300048910 Bacteria 1392
2058 Ga0496107_0342225 3300048910 Bacteria 1113
2059 Ga0496107_0442359 3300048910 Bacteria 966
2060 Ga0496107_1114322 3300048910 Unclassified 570
2061 Ga0496108_0001132 3300048911 Bacteria 20832
2062 Ga0496108_0001586 3300048911 Bacteria 18012
2063 Ga0496108_0007929 3300048911 Bacteria 8608
2064 Ga0496108_0009090 3300048911 Bacteria 8046
2065 Ga0496108_0019843 3300048911 Bacteria 5522
2066 Ga0496108_0026913 3300048911 Bacteria 4746
2067 Ga0496108_0043087 3300048911 Bacteria 3769
2068 Ga0496108_0070533 3300048911 Bacteria 2949
2069 Ga0496108_0091836 3300048911 Bacteria 2581
2070 Ga0496108_0122159 3300048911 Bacteria 2234
2071 Ga0496108_0158529 3300048911 Bacteria 1955
2072 Ga0496108_0185021 3300048911 Unclassified 1804
2073 Ga0496108_0191554 3300048911 Unclassified 1772
2074 Ga0496108_0210935 3300048911 Bacteria 1686
2075 Ga0496108_0221778 3300048911 Bacteria 1643
2076 Ga0496108_0308794 3300048911 Bacteria 1378
2077 Ga0496108_0638372 3300048911 Bacteria 926
2078 Ga0496108_1334941 3300048911 Bacteria 602
2079 Ga0496109_0001789 3300048912 Bacteria 17869
2080 Ga0496109_0001891 3300048912 Bacteria 17380
2081 Ga0496109_0004954 3300048912 Bacteria 11123
2082 Ga0496109_0011154 3300048912 Bacteria 7708
2083 Ga0496109_0016975 3300048912 Bacteria 6372
2084 Ga0496109_0030974 3300048912 Bacteria 4796
2085 Ga0496109_0033432 3300048912 Bacteria 4626
2086 Ga0496109_0041406 3300048912 Bacteria 4172
2087 Ga0496109_0042673 3300048912 Bacteria 4109
2088 Ga0496109_0071612 3300048912 Bacteria 3183
2089 Ga0496109_0096345 3300048912 Bacteria 2741
2090 Ga0496109_0101175 3300048912 Bacteria 2674
2091 Ga0496109_0129525 3300048912 Bacteria 2354
2092 Ga0496109_0164918 3300048912 Bacteria 2077
2093 Ga0496109_0191015 3300048912 Bacteria 1924
2094 Ga0496109_0234154 3300048912 Bacteria 1728
2095 Ga0496109_0312906 3300048912 Bacteria 1481
2096 Ga0496109_0350589 3300048912 Bacteria 1394
2097 Ga0496109_1780243 3300048912 Bacteria 549
2098 Ga0496110_0000707 3300048913 Bacteria 23061
2099 Ga0496110_0000862 3300048913 Bacteria 21421
2100 Ga0496110_0001277 3300048913 Bacteria 18022
2101 Ga0496110_0003632 3300048913 Bacteria 11862
2102 Ga0496110_0005568 3300048913 Bacteria 9887
2103 Ga0496110_0020639 3300048913 Bacteria 5565
2104 Ga0496110_0034029 3300048913 Bacteria 4411
2105 Ga0496110_0034638 3300048913 Bacteria 4375
2106 Ga0496110_0034788 3300048913 Bacteria 4367
2107 Ga0496110_0040997 3300048913 Bacteria 4038
2108 Ga0496110_0043887 3300048913 Bacteria 3904
2109 Ga0496110_0105268 3300048913 Bacteria 2531
2110 Ga0496110_0113280 3300048913 Bacteria 2439
2111 Ga0496110_0136621 3300048913 Unclassified 2216
2112 Ga0496110_0181871 3300048913 Bacteria 1909
2113 Ga0496110_0234659 3300048913 Bacteria 1669
2114 Ga0496110_0349283 3300048913 Bacteria 1347
2115 Ga0496110_0434889 3300048913 Bacteria 1196
2116 Ga0496110_0476318 3300048913 Bacteria 1137
2117 Ga0496110_0683453 3300048913 Bacteria 927
2118 Ga0496110_0698285 3300048913 Unclassified 916
2119 Ga0496110_0760485 3300048913 Unclassified 872
2120 Ga0496110_0945757 3300048913 Unclassified 768
2121 Ga0496110_1072879 3300048913 Bacteria 713
2122 Ga0496110_1627197 3300048913 Bacteria 556
2123 Ga0496111_0002493 3300048914 Bacteria 11100
2124 Ga0496111_0005116 3300048914 Bacteria 8350
2125 Ga0496111_0019214 3300048914 Bacteria 4742
2126 Ga0496111_0020783 3300048914 Bacteria 4576
2127 Ga0496111_0021718 3300048914 Bacteria 4484
2128 Ga0496111_0024919 3300048914 Bacteria 4219
2129 Ga0496111_0028943 3300048914 Bacteria 3929
2130 Ga0496111_0035320 3300048914 Bacteria 3572
2131 Ga0496111_0036168 3300048914 Bacteria 3530
2132 Ga0496111_0047910 3300048914 Bacteria 3078
2133 Ga0496111_0070480 3300048914 Bacteria 2543
2134 Ga0496111_0075380 3300048914 Bacteria 2458
2135 Ga0496111_0077819 3300048914 Bacteria 2418
2136 Ga0496111_0082830 3300048914 Bacteria 2343
2137 Ga0496111_0090762 3300048914 Bacteria 2238
2138 Ga0496111_0127649 3300048914 Bacteria 1881
2139 Ga0496111_0404237 3300048914 Unclassified 1009
2140 Ga0496111_0579155 3300048914 Bacteria 823
2141 Ga0496111_0818990 3300048914 Bacteria 673
2142 Ga0496111_0974526 3300048914 Bacteria 608
2143 Ga0496112_0013792 3300048915 Bacteria 7475
2144 Ga0496112_0014155 3300048915 Bacteria 7390
2145 Ga0496112_0018653 3300048915 Bacteria 6538
2146 Ga0496112_0049295 3300048915 Bacteria 4128
2147 Ga0496112_0052704 3300048915 Bacteria 3994
2148 Ga0496112_0093452 3300048915 Bacteria 2978
2149 Ga0496112_0115287 3300048915 Bacteria 2657
2150 Ga0496112_0115773 3300048915 Bacteria 2651
2151 Ga0496112_0128073 3300048915 Bacteria 2509
2152 Ga0496112_0157197 3300048915 Bacteria 2240
2153 Ga0496112_0196058 3300048915 Unclassified 1980
2154 Ga0496112_0284581 3300048915 Bacteria 1600
2155 Ga0496112_0353765 3300048915 Bacteria 1411
2156 Ga0496112_0480954 3300048915 Unclassified 1178
2157 Ga0496112_0574212 3300048915 Unclassified 1060
2158 Ga0496112_0614535 3300048915 Unclassified 1018
2159 Ga0496112_0817280 3300048915 Bacteria 856
2160 Ga0496112_0885686 3300048915 Unclassified 815
2161 Ga0496112_0925738 3300048915 Bacteria 793
2162 Ga0496112_1139787 3300048915 Bacteria 697
2163 Ga0496112_1198955 3300048915 Bacteria 676
2164 Ga0496112_1881736 3300048915 Unclassified 510
2165 Ga0496112_1904338 3300048915 Unclassified 506
2166 Ga0496113_0024226 3300048916 Bacteria 4310
2167 Ga0496113_0024406 3300048916 Bacteria 4298
2168 Ga0496113_0038498 3300048916 Bacteria 3516
2169 Ga0496113_0048987 3300048916 Bacteria 3145
2170 Ga0496113_0051987 3300048916 Bacteria 3059
2171 Ga0496113_0066840 3300048916 Bacteria 2724
2172 Ga0496113_0081830 3300048916 Bacteria 2475
2173 Ga0496113_0138861 3300048916 Unclassified 1911
2174 Ga0496113_0170373 3300048916 Bacteria 1724
2175 Ga0496113_0225194 3300048916 Bacteria 1495
2176 Ga0496113_0291824 3300048916 Bacteria 1305
2177 Ga0496113_0342797 3300048916 Bacteria 1198
2178 Ga0496113_0450835 3300048916 Bacteria 1034
2179 Ga0496113_0779585 3300048916 Unclassified 760
2180 Ga0496113_0802321 3300048916 Bacteria 748
2181 Ga0496113_0865204 3300048916 Bacteria 716
2182 Ga0496114_0000385 3300048917 Bacteria 32591
2183 Ga0496114_0005938 3300048917 Bacteria 9598
2184 Ga0496114_0027761 3300048917 Bacteria 4639
2185 Ga0496114_0045607 3300048917 Bacteria 3642
2186 Ga0496114_0064892 3300048917 Bacteria 3059
2187 Ga0496114_0093650 3300048917 Unclassified 2554
2188 Ga0496114_0112784 3300048917 Unclassified 2330
2189 Ga0496114_0114928 3300048917 Bacteria 2308
2190 Ga0496114_0181749 3300048917 Bacteria 1837
2191 Ga0496114_0219333 3300048917 Bacteria 1669
2192 Ga0496114_0222818 3300048917 Bacteria 1656
2193 Ga0496114_0402554 3300048917 Bacteria 1212
2194 Ga0496114_0418977 3300048917 Bacteria 1186
2195 Ga0496114_0436510 3300048917 Bacteria 1160
2196 Ga0496114_0622442 3300048917 Unclassified 951
2197 Ga0496114_0657692 3300048917 Bacteria 921
2198 Ga0496114_0688472 3300048917 Bacteria 897
2199 Ga0496114_1381347 3300048917 Bacteria 592
2200 Ga0496114_1575103 3300048917 Unclassified 545
2201 Ga0496115_0010558 3300048918 Bacteria 6905
2202 Ga0496115_0032267 3300048918 Bacteria 4131
2203 Ga0496115_0081570 3300048918 Bacteria 2634
2204 Ga0496115_0105138 3300048918 Bacteria 2317
2205 Ga0496115_0179905 3300048918 Bacteria 1748
2206 Ga0496115_0328691 3300048918 Bacteria 1249
2207 Ga0496115_0563343 3300048918 Unclassified 909
2208 Ga0496115_0646084 3300048918 Unclassified 837
2209 Ga0496115_0862115 3300048918 Unclassified 701
2210 Ga0501031_0000073 3300049568 Bacteria 53081
2211 Ga0501031_0002630 3300049568 Bacteria 11425
2212 Ga0501031_0006601 3300049568 Bacteria 7570
2213 Ga0501031_0029076 3300049568 Bacteria 3604
2214 Ga0501031_0139486 3300049568 Bacteria 1584
2215 Ga0501031_0528992 3300049568 Bacteria 760
2216 Ga0501032_0002296 3300049569 Bacteria 15020
2217 Ga0501032_0006820 3300049569 Bacteria 8379
2218 Ga0501032_0064254 3300049569 Bacteria 2457
2219 Ga0501032_0096441 3300049569 Bacteria 1960
2220 Ga0501032_0107287 3300049569 Bacteria 1849
2221 Ga0501033_0000257 3300049570 Bacteria 50975
2222 Ga0501033_0002443 3300049570 Bacteria 15780
2223 Ga0501033_0016360 3300049570 Bacteria 5616
2224 Ga0501033_0251364 3300049570 Bacteria 1253
2225 Ga0501033_0506697 3300049570 Bacteria 834
2226 Ga0501034_0005355 3300049571 Bacteria 14048
2227 Ga0501034_0125759 3300049571 Bacteria 2549
2228 Ga0501034_0217575 3300049571 Bacteria 1864
2229 Ga0501034_0300705 3300049571 Bacteria 1541
2230 Ga0501034_0613955 3300049571 Bacteria 992
2231 Ga0501034_0685566 3300049571 Bacteria 924
2232 Ga0501036_0000089 3300049572 Bacteria 57499
2233 Ga0501036_0002139 3300049572 Bacteria 15413
2234 Ga0501036_0003155 3300049572 Bacteria 13148
2235 Ga0501036_0022969 3300049572 Bacteria 5251
2236 Ga0501036_0081681 3300049572 Bacteria 2731
2237 Ga0501036_0219010 3300049572 Bacteria 1598
2238 Ga0501037_0000070 3300049573 Bacteria 94985
2239 Ga0501037_0006306 3300049573 Bacteria 8674
2240 Ga0501037_0110948 3300049573 Bacteria 1976
2241 Ga0501037_0157598 3300049573 Bacteria 1619
2242 Ga0501037_0219746 3300049573 Bacteria 1337
2243 Ga0501038_0000082 3300049574 Bacteria 80551
2244 Ga0501038_0004637 3300049574 Bacteria 12792
2245 Ga0501038_0031009 3300049574 Bacteria 4726
2246 Ga0501038_0037792 3300049574 Bacteria 4232
2247 Ga0501038_0202017 3300049574 Bacteria 1594
2248 Ga0501038_0253360 3300049574 Bacteria 1393
2249 Ga0501038_0590624 3300049574 Unclassified 841
2250 Ga0501039_0000077 3300049575 Bacteria 74065
2251 Ga0501039_0004453 3300049575 Bacteria 10571
2252 Ga0501039_0008753 3300049575 Bacteria 7709
2253 Ga0501039_0022195 3300049575 Bacteria 4872
2254 Ga0501039_0036740 3300049575 Bacteria 3780
2255 Ga0501039_0144921 3300049575 Bacteria 1866
2256 Ga0501039_0308197 3300049575 Bacteria 1244
2257 Ga0501039_1514398 3300049575 Unclassified 516
2258 Ga0501040_0000048 3300049576 Bacteria 55371
2259 Ga0501040_0000749 3300049576 Bacteria 20128
2260 Ga0501040_0005765 3300049576 Bacteria 8016
2261 Ga0501040_0014595 3300049576 Bacteria 5180
2262 Ga0501040_0019147 3300049576 Bacteria 4551
2263 Ga0501040_0083189 3300049576 Bacteria 2220
2264 Ga0501040_0115221 3300049576 Bacteria 1882
2265 Ga0501040_0160014 3300049576 Bacteria 1591
2266 Ga0501040_0269224 3300049576 Bacteria 1216
2267 Ga0501040_0424515 3300049576 Bacteria 956
2268 Ga0501041_0000007 3300049577 Bacteria 64272
2269 Ga0501041_0004133 3300049577 Bacteria 8396
2270 Ga0501041_0006117 3300049577 Bacteria 7036
2271 Ga0501041_0007293 3300049577 Bacteria 6491
2272 Ga0501041_0010789 3300049577 Bacteria 5390
2273 Ga0501041_0121638 3300049577 Bacteria 1622
2274 Ga0501041_0209079 3300049577 Unclassified 1224
2275 Ga0501042_0000329 3300049578 Bacteria 23679
2276 Ga0501042_0002201 3300049578 Bacteria 11888
2277 Ga0501042_0009161 3300049578 Bacteria 6583
2278 Ga0501042_0010467 3300049578 Bacteria 6222
2279 Ga0501042_0011968 3300049578 Bacteria 5863
2280 Ga0501042_0024297 3300049578 Bacteria 4250
2281 Ga0501042_0109159 3300049578 Bacteria 1992
2282 Ga0501042_0174777 3300049578 Bacteria 1549
2283 Ga0501042_0367498 3300049578 Bacteria 1041
2284 Ga0501042_0452490 3300049578 Unclassified 931
2285 Ga0501043_0000208 3300049579 Bacteria 53881
2286 Ga0501043_0010002 3300049579 Bacteria 7439
2287 Ga0501043_0035843 3300049579 Bacteria 3904
2288 Ga0501043_0073758 3300049579 Bacteria 2680
2289 Ga0501043_0293164 3300049579 Bacteria 1245
2290 Ga0501043_0812609 3300049579 Bacteria 675
2291 Ga0501046_0000089 3300049580 Bacteria 99031
2292 Ga0501046_0001637 3300049580 Bacteria 21444
2293 Ga0501046_0023622 3300049580 Bacteria 5053
2294 Ga0501046_0070065 3300049580 Bacteria 2727
2295 Ga0501046_0071413 3300049580 Bacteria 2697
2296 Ga0501046_0084519 3300049580 Bacteria 2447
2297 Ga0501046_0436544 3300049580 Bacteria 943
2298 Ga0501047_0000237 3300049581 Bacteria 65237
2299 Ga0501047_0303384 3300049581 Bacteria 1439
2300 Ga0501047_0326913 3300049581 Bacteria 1372
2301 Ga0501047_0944300 3300049581 Bacteria 675
2302 Ga0501048_0001295 3300049582 Bacteria 18970
2303 Ga0501048_0001477 3300049582 Bacteria 17834
2304 Ga0501048_0003497 3300049582 Bacteria 11940
2305 Ga0501048_0008743 3300049582 Bacteria 7631
2306 Ga0501048_0020342 3300049582 Bacteria 4864
2307 Ga0501048_0026679 3300049582 Bacteria 4204
2308 Ga0501048_0209983 3300049582 Bacteria 1381
2309 Ga0501067_0002683 3300049583 Bacteria 9827
2310 Ga0501067_0023435 3300049583 Bacteria 3421
2311 Ga0501067_0035648 3300049583 Bacteria 2763
2312 Ga0501067_0043622 3300049583 Bacteria 2491
2313 Ga0501067_0046253 3300049583 Bacteria 2415
2314 Ga0501067_0052247 3300049583 Bacteria 2264
2315 Ga0501067_0062108 3300049583 Bacteria 2068
2316 Ga0501067_0083985 3300049583 Bacteria 1766
2317 Ga0501067_0500985 3300049583 Bacteria 679
2318 Ga0501068_0000588 3300049584 Bacteria 18470
2319 Ga0501068_0000736 3300049584 Bacteria 16780
2320 Ga0501068_0006359 3300049584 Bacteria 6508
2321 Ga0501068_0088470 3300049584 Bacteria 1908
2322 Ga0501068_0095025 3300049584 Bacteria 1843
2323 Ga0501068_0108749 3300049584 Bacteria 1722
2324 Ga0501068_0737359 3300049584 Bacteria 645
2325 Ga0501069_0000139 3300049585 Bacteria 31998
2326 Ga0501069_0002155 3300049585 Bacteria 9906
2327 Ga0501069_0012330 3300049585 Bacteria 4542
2328 Ga0501069_0025198 3300049585 Bacteria 3249
2329 Ga0501069_0030264 3300049585 Bacteria 2972
2330 Ga0501069_0030406 3300049585 Bacteria 2965
2331 Ga0501069_0034070 3300049585 Bacteria 2805
2332 Ga0501069_0037865 3300049585 Bacteria 2661
2333 Ga0501069_0086386 3300049585 Unclassified 1771
2334 Ga0501069_0136646 3300049585 Bacteria 1405
2335 Ga0501069_0415468 3300049585 Bacteria 797
2336 Ga0501070_0005427 3300049586 Bacteria 10884
2337 Ga0501070_0005438 3300049586 Bacteria 10873
2338 Ga0501070_0017668 3300049586 Bacteria 5988
2339 Ga0501070_0023773 3300049586 Bacteria 5136
2340 Ga0501070_0064144 3300049586 Bacteria 3043
2341 Ga0501070_0083056 3300049586 Bacteria 2651
2342 Ga0501070_0116297 3300049586 Bacteria 2209
2343 Ga0501070_1176744 3300049586 Bacteria 589
2344 Ga0501071_0000004 3300049587 Bacteria 79181
2345 Ga0501071_0003480 3300049587 Bacteria 9834
2346 Ga0501071_0003995 3300049587 Bacteria 9309
2347 Ga0501071_0015297 3300049587 Bacteria 5266
2348 Ga0501071_0017019 3300049587 Bacteria 5006
2349 Ga0501071_0018584 3300049587 Bacteria 4815
2350 Ga0501071_0149697 3300049587 Bacteria 1741
2351 Ga0501071_0594376 3300049587 Unclassified 851
2352 Ga0501071_0924787 3300049587 Unclassified 673
2353 Ga0501072_0000805 3300049588 Bacteria 23084
2354 Ga0501072_0001596 3300049588 Bacteria 16941
2355 Ga0501072_0002135 3300049588 Bacteria 14738
2356 Ga0501072_0020426 3300049588 Bacteria 5132
2357 Ga0501072_0021676 3300049588 Bacteria 4983
2358 Ga0501072_0027769 3300049588 Bacteria 4415
2359 Ga0501072_0094242 3300049588 Bacteria 2378
2360 Ga0501072_0095706 3300049588 Bacteria 2360
2361 Ga0501072_0123521 3300049588 Bacteria 2062
2362 Ga0501072_0733182 3300049588 Unclassified 776
2363 Ga0501073_0001338 3300049589 Bacteria 18161
2364 Ga0501073_0065332 3300049589 Bacteria 2537
2365 Ga0501073_0183431 3300049589 Bacteria 1448
2366 Ga0501073_0231320 3300049589 Bacteria 1277
2367 Ga0501073_0705076 3300049589 Bacteria 696
2368 Ga0501073_1114680 3300049589 Bacteria 542
2369 Ga0501073_1240842 3300049589 Bacteria 511
2370 Ga0501074_0000002 3300049590 Bacteria 121767
2371 Ga0501074_0001058 3300049590 Bacteria 17977
2372 Ga0501074_0001932 3300049590 Bacteria 14241
2373 Ga0501074_0025930 3300049590 Bacteria 4252
2374 Ga0501074_0028709 3300049590 Bacteria 4032
2375 Ga0501074_0035039 3300049590 Bacteria 3637
2376 Ga0501074_0036902 3300049590 Bacteria 3541
2377 Ga0501074_0133508 3300049590 Bacteria 1775
2378 Ga0501074_0318577 3300049590 Bacteria 1104
2379 Ga0501074_0698481 3300049590 Bacteria 716
2380 Ga0501074_0729608 3300049590 Bacteria 699
2381 Ga0501075_0001346 3300049591 Bacteria 15950
2382 Ga0501075_0009137 3300049591 Bacteria 6927
2383 Ga0501075_0013626 3300049591 Bacteria 5806
2384 Ga0501075_0018873 3300049591 Bacteria 4997
2385 Ga0501075_0029400 3300049591 Bacteria 4064
2386 Ga0501075_0403187 3300049591 Bacteria 1042
2387 Ga0501075_0573386 3300049591 Bacteria 861
2388 Ga0501076_0000246 3300049592 Bacteria 33219
2389 Ga0501076_0000835 3300049592 Bacteria 20024
2390 Ga0501076_0000918 3300049592 Bacteria 19216
2391 Ga0501076_0002323 3300049592 Bacteria 13027
2392 Ga0501076_0058011 3300049592 Bacteria 3075
2393 Ga0501076_0091513 3300049592 Bacteria 2447
2394 Ga0501076_0271618 3300049592 Bacteria 1388
2395 Ga0501076_0575234 3300049592 Bacteria 929
2396 Ga0501077_0000090 3300049593 Bacteria 46393
2397 Ga0501077_0000235 3300049593 Bacteria 32729
2398 Ga0501077_0007842 3300049593 Bacteria 6591
2399 Ga0501077_0033211 3300049593 Bacteria 3284
2400 Ga0501077_0113917 3300049593 Bacteria 1714
2401 Ga0501077_0136515 3300049593 Bacteria 1555
2402 Ga0501077_0527308 3300049593 Bacteria 758
2403 Ga0501079_0000679 3300049741 Bacteria 22874
2404 Ga0501079_0005129 3300049741 Bacteria 9736
2405 Ga0501079_0012020 3300049741 Bacteria 6608
2406 Ga0501079_0024759 3300049741 Bacteria 4605
2407 Ga0501079_0027160 3300049741 Bacteria 4388
2408 Ga0501079_0035594 3300049741 Bacteria 3833
2409 Ga0501079_0094508 3300049741 Bacteria 2316
2410 Ga0501079_0168835 3300049741 Bacteria 1706
2411 Ga0501079_0786610 3300049741 Bacteria 749
2412 Ga0501079_1149040 3300049741 Bacteria 612
2413 Ga0501080_0001053 3300049742 Bacteria 22707
2414 Ga0501080_0007990 3300049742 Bacteria 9585
2415 Ga0501080_0024351 3300049742 Bacteria 5612
2416 Ga0501080_0033082 3300049742 Bacteria 4825
2417 Ga0501080_0162440 3300049742 Bacteria 2062
2418 Ga0501080_0199453 3300049742 Bacteria 1837
2419 Ga0501080_0267478 3300049742 Bacteria 1556
2420 Ga0501080_0362719 3300049742 Bacteria 1307
2421 Ga0501080_0413440 3300049742 Bacteria 1212
2422 Ga0501080_0632807 3300049742 Bacteria 948
2423 Ga0501081_0000112 3300049743 Bacteria 34866
2424 Ga0501081_0000598 3300049743 Bacteria 20594
2425 Ga0501081_0002712 3300049743 Bacteria 11205
2426 Ga0501081_0020553 3300049743 Bacteria 4400
2427 Ga0501081_0124168 3300049743 Bacteria 1841
2428 Ga0501081_0258725 3300049743 Bacteria 1271
2429 Ga0501081_0594977 3300049743 Unclassified 828
2430 Ga0501081_0625292 3300049743 Unclassified 807
2431 Ga0501081_0718213 3300049743 Bacteria 750
2432 Ga0501081_1394395 3300049743 Bacteria 532
2433 Ga0501083_0000183 3300049744 Bacteria 40280
2434 Ga0501083_0003161 3300049744 Bacteria 11461
2435 Ga0501083_0018569 3300049744 Bacteria 4846
2436 Ga0501083_0044254 3300049744 Bacteria 3013
2437 Ga0501035_0001595 3300049822 Bacteria 22950
2438 Ga0501035_0009407 3300049822 Bacteria 9085
2439 Ga0501035_0023178 3300049822 Bacteria 5695
2440 Ga0501035_0254067 3300049822 Bacteria 1491
2441 Ga0501044_0008307 3300049823 Bacteria 11375
2442 Ga0501044_0046956 3300049823 Bacteria 4468
2443 Ga0501044_0081866 3300049823 Bacteria 3267
2444 Ga0501044_1423496 3300049823 Bacteria 559
2445 Ga0501045_0000014 3300049824 Bacteria 73464
2446 Ga0501045_0004724 3300049824 Bacteria 9399
2447 Ga0501045_0008138 3300049824 Bacteria 7304
2448 Ga0501045_0010297 3300049824 Bacteria 6551
2449 Ga0501045_0017934 3300049824 Bacteria 5026
2450 Ga0501045_0054887 3300049824 Bacteria 2913
2451 Ga0501045_0071003 3300049824 Bacteria 2562
2452 Ga0501045_0125125 3300049824 Unclassified 1909
2453 Ga0501045_0149617 3300049824 Unclassified 1737
2454 Ga0501045_0267204 3300049824 Bacteria 1274
2455 nmdc:mga0yw44_373202_c1 3300050492 Bacteria 962
2456 nmdc:mga0yw44_37882_c1 3300050492 Bacteria 2850
2457 nmdc:mga05p37_1051_c1 3300050507 Bacteria 25770
2458 nmdc:mga05p37_1053002_c1 3300050507 Unclassified 858
2459 nmdc:mga05p37_117732_c1 3300050507 Bacteria 3264
2460 nmdc:mga05p37_1212807_c1 3300050507 Bacteria 778
2461 nmdc:mga05p37_1573555_c1 3300050507 Bacteria 649
2462 nmdc:mga05p37_1648_c1 3300050507 Bacteria 25906
2463 nmdc:mga05p37_164914_c1 3300050507 Bacteria 2704
2464 nmdc:mga05p37_17988_c1 3300050507 Bacteria 8535
2465 nmdc:mga05p37_20642_c1 3300050507 Bacteria 7970
2466 nmdc:mga05p37_229239_c1 3300050507 Bacteria 2239
2467 nmdc:mga05p37_2406_c1 3300050507 Bacteria 21776
2468 nmdc:mga05p37_258345_c1 3300050507 Bacteria 2086
2469 nmdc:mga05p37_271712_c1 3300050507 Unclassified 2025
2470 nmdc:mga05p37_281376_c1 3300050507 Bacteria 1984
2471 nmdc:mga05p37_33951_c1 3300050507 Bacteria 6249
2472 nmdc:mga05p37_372652_c1 3300050507 Unclassified 1675
2473 nmdc:mga05p37_39375_c1 3300050507 Bacteria 5803
2474 nmdc:mga05p37_405113_c1 3300050507 Bacteria 1295
2475 nmdc:mga05p37_566683_c1 3300050507 Bacteria 1289
2476 nmdc:mga05p37_698884_c1 3300050507 Bacteria 1127
2477 nmdc:mga05p37_702131_c1 3300050507 Unclassified 1123
2478 nmdc:mga05p37_800643_c1 3300050507 Bacteria 1031
2479 nmdc:mga09592_1802_c1 3300050508 Bacteria 17187
2480 nmdc:mga09592_262171_c1 3300050508 Bacteria 1499
2481 nmdc:mga09592_265124_c1 3300050508 Bacteria 1490
2482 nmdc:mga09592_998787_c1 3300050508 Bacteria 700
2483 nmdc:mga0qj67_240458_c1 3300050509 Bacteria 1469
2484 nmdc:mga0qj67_2704_c1 3300050509 Bacteria 12711
2485 nmdc:mga0qj67_316860_c1 3300050509 Unclassified 1263
2486 nmdc:mga06r32_24535_c1 3300050510 Bacteria 5599
2487 nmdc:mga06r32_588245_c1 3300050510 Bacteria 1085
2488 nmdc:mga06r32_59082_c1 3300050510 Bacteria 3686
2489 nmdc:mga06r32_721383_c1 3300050510 Bacteria 961
2490 nmdc:mga06r32_828176_c1 3300050510 Archaea 885
2491 nmdc:mga08y16_1192955_c1 3300050511 Unclassified 732
2492 nmdc:mga08y16_191133_c1 3300050511 Bacteria 2123
2493 nmdc:mga08y16_1969635_c1 3300050511 Unclassified 534
2494 nmdc:mga08y16_200788_c1 3300050511 Unclassified 2066
2495 nmdc:mga08y16_232970_c1 3300050511 Bacteria 1904
2496 nmdc:mga08y16_24862_c1 3300050511 Bacteria 6318
2497 nmdc:mga08y16_399205_c1 3300050511 Bacteria 1407
2498 nmdc:mga08y16_703195_c1 3300050511 Unclassified 1010
2499 nmdc:mga08y16_893054_c1 3300050511 Unclassified 875
2500 nmdc:mga08y16_93267_c1 3300050511 Bacteria 3137
2501 nmdc:mga0n895_106457_c1 3300050512 Bacteria 2817
2502 nmdc:mga0n895_1178088_c1 3300050512 Unclassified 741
2503 nmdc:mga0n895_146450_c1 3300050512 Bacteria 2391
2504 nmdc:mga0n895_2104630_c1 3300050512 Unclassified 521
2505 nmdc:mga0n895_221126_c1 3300050512 Bacteria 1923
2506 nmdc:mga0n895_334046_c1 3300050512 Bacteria 1535
2507 nmdc:mga0n895_3549_c1 3300050512 Bacteria 12624
2508 nmdc:mga0n895_375224_c1 3300050512 Bacteria 1439
2509 nmdc:mga0n895_45003_c1 3300050512 Bacteria 4305
2510 nmdc:mga0n895_62844_c1 3300050512 Bacteria 3671
2511 nmdc:mga0n895_724212_c1 3300050512 Bacteria 989
2512 nmdc:mga0n895_75310_c1 3300050512 Bacteria 3355
2513 nmdc:mga0n895_7957_c1 3300050512 Bacteria 9142
2514 nmdc:mga0n895_92204_c1 3300050512 Bacteria 3032
2515 nmdc:mga0n895_991513_c1 3300050512 Bacteria 822
2516 nmdc:mga0rr50_108472_c1 3300050513 Bacteria 2193
2517 nmdc:mga0rr50_111797_c1 3300050513 Unclassified 2163
2518 nmdc:mga0rr50_175187_c1 3300050513 Bacteria 1750
2519 nmdc:mga0rr50_214349_c1 3300050513 Bacteria 1587
2520 nmdc:mga0rr50_239272_c1 3300050513 Bacteria 1504
2521 nmdc:mga0rr50_291706_c1 3300050513 Bacteria 1363
2522 nmdc:mga0rr50_64615_c1 3300050513 Bacteria 2769
2523 nmdc:mga0rr50_81622_c1 3300050513 Bacteria 2495
2524 nmdc:mga0rr50_99956_c1 3300050513 Bacteria 2277
2525 nmdc:mga08x19_1143777_c1 3300050514 Bacteria 552
2526 nmdc:mga08x19_200699_c1 3300050514 Bacteria 1367
2527 nmdc:mga08x19_271148_c1 3300050514 Bacteria 1174
2528 nmdc:mga08x19_39900_c1 3300050514 Bacteria 2986
2529 nmdc:mga08x19_576849_c1 3300050514 Bacteria 797
2530 nmdc:mga08x19_83293_c1 3300050514 Bacteria 2103
2531 nmdc:mga0a205_125353_c1 3300050515 Bacteria 2468
2532 nmdc:mga0a205_188204_c1 3300050515 Bacteria 1957
2533 nmdc:mga0a205_190057_c1 3300050515 Unclassified 1946
2534 nmdc:mga0a205_223848_c1 3300050515 Bacteria 1766
2535 nmdc:mga0a205_243635_c1 3300050515 Bacteria 1679
2536 nmdc:mga0a205_322294_c1 3300050515 Bacteria 1416
2537 nmdc:mga0a205_337659_c1 3300050515 Bacteria 1375
2538 nmdc:mga0a205_434337_c1 3300050515 Bacteria 1174
2539 nmdc:mga0a205_755016_c1 3300050515 Unclassified 821
2540 nmdc:mga0a205_910137_c1 3300050515 Bacteria 726
2541 Ga0495601_0000340 3300053077 Bacteria 24567
2542 Ga0495601_0021067 3300053077 Bacteria 3988
2543 Ga0495601_0045008 3300053077 Bacteria 2774
2544 Ga0495601_0450210 3300053077 Unclassified 833
2545 Ga0495601_0689946 3300053077 Bacteria 652
2546 Ga0495612_0010731 3300053078 Bacteria 3699
2547 Ga0495612_0026566 3300053078 Unclassified 2326
2548 Ga0495612_0385343 3300053078 Unclassified 636
2549 Ga0495655_0003652 3300053083 Bacteria 2557
2550 Ga0495655_0027689 3300053083 Bacteria 1347
2551 Ga0495655_0151980 3300053083 Unclassified 729
2552 Ga0495595_0008985 3300053084 Bacteria 4123
2553 Ga0495595_0025438 3300053084 Bacteria 2624
2554 Ga0495595_0109964 3300053084 Bacteria 1335
2555 Ga0495595_0167419 3300053084 Bacteria 1086
2556 Ga0495595_0302915 3300053084 Bacteria 804
2557 Ga0495619_0001752 3300053085 Bacteria 14426
2558 Ga0495619_0009906 3300053085 Bacteria 6004
2559 Ga0495619_0030804 3300053085 Bacteria 3473
2560 Ga0495619_0094765 3300053085 Unclassified 2025
2561 Ga0495619_0225211 3300053085 Bacteria 1299
2562 Ga0495619_0262440 3300053085 Bacteria 1197
2563 Ga0495619_0287627 3300053085 Bacteria 1139
2564 Ga0495619_0369575 3300053085 Bacteria 991
2565 Ga0501084_0000332 3300054114 Bacteria 36149
2566 Ga0501084_0002377 3300054114 Bacteria 15134
2567 Ga0501084_0002602 3300054114 Bacteria 14534
2568 Ga0501084_0030854 3300054114 Bacteria 4481
2569 Ga0501084_0153653 3300054114 Bacteria 1940
2570 Ga0501084_0203854 3300054114 Bacteria 1669
2571 Ga0501084_0336734 3300054114 Bacteria 1274
2572 Ga0501084_0504241 3300054114 Unclassified 1023
2573 Ga0501084_0528896 3300054114 Bacteria 997
2574 Ga0501084_0980126 3300054114 Bacteria 710
2575 Ga0501084_1058165 3300054114 Bacteria 681
2576 Ga0501084_1752400 3300054114 Bacteria 519
2577 Ga0590075_021938 3300059424 Bacteria 1596
2578 Ga0501082_0000241 3300060353 Bacteria 47793
2579 Ga0501082_0003201 3300060353 Bacteria 14267
2580 Ga0501082_0006933 3300060353 Bacteria 9792
2581 Ga0501082_0028640 3300060353 Bacteria 4798
2582 Ga0501082_0042024 3300060353 Bacteria 3941
2583 Ga0501082_0071859 3300060353 Bacteria 2980
2584 Ga0501082_0094066 3300060353 Bacteria 2589
2585 Ga0501082_0179627 3300060353 Bacteria 1840
2586 Ga0501082_0431387 3300060353 Bacteria 1151
2587 Ga0501082_1210714 3300060353 Bacteria 660
2588 Ga0501082_1441278 3300060353 Bacteria 601
2589 Ga0466962_0003363 3300061719 Bacteria 7608
2590 Ga0466962_0008111 3300061719 Bacteria 5037
2591 Ga0466962_0028718 3300061719 Bacteria 2664
2592 Ga0466962_0064286 3300061719 Bacteria 1752
2593 Ga0466962_0081444 3300061719 Bacteria 1548
2594 Ga0466962_0347324 3300061719 Bacteria 739
2595 Ga0530510_0000299 3300061734 Bacteria 31454
2596 Ga0530510_0003188 3300061734 Bacteria 11276
2597 Ga0530510_0003553 3300061734 Bacteria 10735
2598 Ga0530510_0005142 3300061734 Bacteria 9027
2599 Ga0530510_0012303 3300061734 Bacteria 6010
2600 Ga0530510_0033146 3300061734 Bacteria 3718
2601 Ga0530510_0143932 3300061734 Bacteria 1757
2602 Ga0530510_0236135 3300061734 Bacteria 1360
2603 Ga0530510_0239274 3300061734 Bacteria 1351
2604 Ga0530510_1207054 3300061734 Bacteria 580
2605 Ga0530510_1544570 3300061734 Bacteria 510

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049591 Ga0501075_0403187 Ga0501075_0403187_15_359 114
2 3300042005 Ga0439448_0227881 Ga0439448_0227881_166_549 118
3 3300005578 Ga0068854_100916416 Ga0068854_1009164162 119
4 3300009147 Ga0114129_10058422 Ga0114129_100584225 119
5 3300026075 Ga0207708_10438841 Ga0207708_104388412 119
6 3300045976 Ga0466967_0098545 Ga0466967_0098545_217_600 120
7 3300006175 Ga0070712_101936633 Ga0070712_1019366331 121
8 3300035242 Ga0373962_0316759 Ga0373962_0316759_134_517 122
9 3300047315 Ga0495581_0673649 Ga0495581_0673649_149_532 122
10 3300009098 Ga0105245_12062126 Ga0105245_120621262 123
11 3300035113 Ga0373936_0045862 Ga0373936_0045862_549_968 123
12 3300035116 Ga0373945_0008312 Ga0373945_0008312_621_1016 123
13 3300035170 Ga0373943_0003173 Ga0373943_0003173_6143_6538 123
14 3300035171 Ga0373946_0026243 Ga0373946_0026243_1053_1448 123
15 3300035692 Ga0373935_0028679 Ga0373935_0028679_2386_2781 123
16 3300035725 Ga0373947_0001279 Ga0373947_0001279_10322_10717 123
17 3300037068 Ga0373925_0001456 Ga0373925_0001456_7551_7946 123
18 3300045836 Ga0466958_0314816 Ga0466958_0314816_570_962 123
19 3300046454 Ga0495592_0130775 Ga0495592_0130775_870_1265 123
20 3300046459 Ga0495629_0007112 Ga0495629_0007112_7647_8042 123
21 3300046461 Ga0495641_0001513 Ga0495641_0001513_14048_14443 123
22 3300046462 Ga0495651_0028448 Ga0495651_0028448_3327_3722 123
23 3300046463 Ga0495653_0018297 Ga0495653_0018297_2951_3346 123
24 3300046472 Ga0495580_0006863 Ga0495580_0006863_4342_4737 123
25 3300046473 Ga0495582_0000711 Ga0495582_0000711_7952_8347 123
26 3300046475 Ga0495639_0000520 Ga0495639_0000520_8377_8772 123
27 3300046476 Ga0495662_0006328 Ga0495662_0006328_3735_4130 123
28 3300046477 Ga0495664_0002367 Ga0495664_0002367_7922_8317 123
29 3300046499 Ga0495594_0019684 Ga0495594_0019684_531_926 123
30 3300046516 Ga0495628_0129031 Ga0495628_0129031_471_866 123
31 3300046517 Ga0495630_0001692 Ga0495630_0001692_4972_5367 123
32 3300046526 Ga0495666_0000272 Ga0495666_0000272_11609_12004 123
33 3300046529 Ga0495652_0035808 Ga0495652_0035808_3342_3737 123
34 3300046531 Ga0495665_0001436 Ga0495665_0001436_7238_7633 123
35 3300046533 Ga0495640_0028193 Ga0495640_0028193_530_925 123
36 3300046535 Ga0495586_0006708 Ga0495586_0006708_5224_5619 123
37 3300046642 Ga0495634_0014004 Ga0495634_0014004_3607_4002 123
38 3300046663 Ga0495635_0012512 Ga0495635_0012512_1917_2312 123
39 3300046678 Ga0495599_0104400 Ga0495599_0104400_1315_1710 123
40 3300046681 Ga0495647_0000245 Ga0495647_0000245_10922_11317 123
41 3300046683 Ga0495658_0000675 Ga0495658_0000675_6781_7176 123
42 3300046689 Ga0495613_0006283 Ga0495613_0006283_3735_4130 123
43 3300046690 Ga0495624_0008345 Ga0495624_0008345_1917_2312 123
44 3300046809 Ga0495600_0062619 Ga0495600_0062619_1990_2385 123
45 3300047315 Ga0495581_0002214 Ga0495581_0002214_1917_2312 123
46 3300047319 Ga0495674_0019362 Ga0495674_0019362_3166_3561 123
47 3300047321 Ga0495676_0019704 Ga0495676_0019704_926_1321 123
48 3300047322 Ga0495680_0016904 Ga0495680_0016904_3891_4286 123
49 3300047471 Ga0495684_0072923 Ga0495684_0072923_1632_2027 123
50 3300047673 Ga0495593_0000863 Ga0495593_0000863_9887_10282 123
51 3300048089 Ga0495614_0000132 Ga0495614_0000132_15420_15815 123
52 3300053077 Ga0495601_0045008 Ga0495601_0045008_530_925 123
53 3300053078 Ga0495612_0026566 Ga0495612_0026566_1891_2286 123
54 3300053085 Ga0495619_0009906 Ga0495619_0009906_2259_2654 123
55 3300006058 Ga0075432_10254846 Ga0075432_102548462 124
56 3300006178 Ga0075367_10218403 Ga0075367_102184031 124
57 3300006844 Ga0075428_100946272 Ga0075428_1009462722 124
58 3300006852 Ga0075433_10007908 Ga0075433_100079082 124
59 3300006852 Ga0075433_10588396 Ga0075433_105883962 124
60 3300006871 Ga0075434_100153433 Ga0075434_1001534333 124
61 3300006914 Ga0075436_100002736 Ga0075436_10000273612 124
62 3300009147 Ga0114129_11983613 Ga0114129_119836132 124
63 3300027907 Ga0207428_10849008 Ga0207428_108490081 124
64 3300037471 Ga0395905_0757418 Ga0395905_0757418_176_589 124
65 3300041512 Ga0451853_1943804 Ga0451853_1943804_668_1042 124
66 3300045976 Ga0466967_0050125 Ga0466967_0050125_793_1188 124
67 3300048905 Ga0496102_0586641 Ga0496102_0586641_607_984 124
68 3300050507 nmdc:mga05p37_2406_c1 nmdc:mga05p37_2406_c1_16870_17247 124
69 3300050511 nmdc:mga08y16_232970_c1 nmdc:mga08y16_232970_c1_996_1391 124
70 3300050513 nmdc:mga0rr50_111797_c1 nmdc:mga0rr50_111797_c1_620_997 124
71 3300050514 nmdc:mga08x19_39900_c1 nmdc:mga08x19_39900_c1_1234_1611 124
72 3300050515 nmdc:mga0a205_125353_c1 nmdc:mga0a205_125353_c1_1155_1532 124
73 3300050515 nmdc:mga0a205_910137_c1 nmdc:mga0a205_910137_c1_99_494 124
74 3300005328 Ga0070676_10352535 Ga0070676_103525352 125
75 3300005339 Ga0070660_100247328 Ga0070660_1002473282 125
76 3300005435 Ga0070714_100081112 Ga0070714_1000811122 125
77 3300006844 Ga0075428_100000381 Ga0075428_10000038124 125
78 3300009098 Ga0105245_11705227 Ga0105245_117052272 125
79 3300009147 Ga0114129_10001661 Ga0114129_100016617 125
80 3300011119 Ga0105246_10833174 Ga0105246_108331742 125
81 3300037312 Ga0395899_0064730 Ga0395899_0064730_275_688 125
82 3300037418 Ga0395900_1638993 Ga0395900_1638993_14_427 125
83 3300037466 Ga0395898_0031871 Ga0395898_0031871_2231_2644 125
84 3300037466 Ga0395898_0323986 Ga0395898_0323986_861_1244 125
85 3300038443 Ga0395901_0096258 Ga0395901_0096258_2326_2739 125
86 3300038443 Ga0395901_1372862 Ga0395901_1372862_118_501 125
87 3300045976 Ga0466967_0239672 Ga0466967_0239672_221_604 125
88 3300045976 Ga0466967_0247010 Ga0466967_0247010_804_1187 125
89 3300045976 Ga0466967_0481545 Ga0466967_0481545_351_734 125
90 3300046616 Ga0495668_0681690 Ga0495668_0681690_168_551 125
91 3300048908 Ga0496105_0274875 Ga0496105_0274875_612_995 125
92 3300048911 Ga0496108_0221778 Ga0496108_0221778_1145_1528 125
93 3300048913 Ga0496110_1072879 Ga0496110_1072879_63_446 125
94 3300048915 Ga0496112_1904338 Ga0496112_1904338_17_400 125
95 3300048917 Ga0496114_0622442 Ga0496114_0622442_148_531 125
96 3300048918 Ga0496115_0862115 Ga0496115_0862115_10_393 125
97 3300049743 Ga0501081_0625292 Ga0501081_0625292_340_723 125
98 3300050507 nmdc:mga05p37_1648_c1 nmdc:mga05p37_1648_c1_23674_24057 125
99 3300005327 Ga0070658_10007519 Ga0070658_100075195 126
100 3300005327 Ga0070658_10072865 Ga0070658_100728652 126
101 3300005329 Ga0070683_100001832 Ga0070683_10000183213 126
102 3300005334 Ga0068869_101241562 Ga0068869_1012415621 126
103 3300005339 Ga0070660_100008515 Ga0070660_1000085152 126
104 3300005339 Ga0070660_100073397 Ga0070660_1000733974 126
105 3300005340 Ga0070689_100106658 Ga0070689_1001066582 126
106 3300005340 Ga0070689_100983338 Ga0070689_1009833382 126
107 3300005344 Ga0070661_100035578 Ga0070661_1000355782 126
108 3300005345 Ga0070692_10112154 Ga0070692_101121542 126
109 3300005353 Ga0070669_100602169 Ga0070669_1006021692 126
110 3300005355 Ga0070671_100149487 Ga0070671_1001494873 126
111 3300005355 Ga0070671_100640069 Ga0070671_1006400692 126
112 3300005356 Ga0070674_100979137 Ga0070674_1009791371 126
113 3300005364 Ga0070673_100444588 Ga0070673_1004445882 126
114 3300005435 Ga0070714_100034451 Ga0070714_1000344515 126
115 3300005435 Ga0070714_100291076 Ga0070714_1002910762 126
116 3300005435 Ga0070714_100449104 Ga0070714_1004491042 126
117 3300005435 Ga0070714_100824544 Ga0070714_1008245441 126
118 3300005435 Ga0070714_102173834 Ga0070714_1021738341 126
119 3300005437 Ga0070710_10108234 Ga0070710_101082342 126
120 3300005438 Ga0070701_10303893 Ga0070701_103038932 126
121 3300005444 Ga0070694_100102647 Ga0070694_1001026472 126
122 3300005445 Ga0070708_100145484 Ga0070708_1001454842 126
123 3300005456 Ga0070678_100255702 Ga0070678_1002557022 126
124 3300005458 Ga0070681_10407144 Ga0070681_104071442 126
125 3300005459 Ga0068867_100125030 Ga0068867_1001250302 126
126 3300005459 Ga0068867_100202456 Ga0068867_1002024562 126
127 3300005459 Ga0068867_101383057 Ga0068867_1013830571 126
128 3300005468 Ga0070707_100182658 Ga0070707_1001826582 126
129 3300005471 Ga0070698_100173341 Ga0070698_1001733412 126
130 3300005471 Ga0070698_101336993 Ga0070698_1013369932 126
131 3300005518 Ga0070699_101964065 Ga0070699_1019640651 126
132 3300005530 Ga0070679_100030645 Ga0070679_1000306452 126
133 3300005530 Ga0070679_100571664 Ga0070679_1005716642 126
134 3300005535 Ga0070684_100000559 Ga0070684_1000005596 126
135 3300005535 Ga0070684_100384536 Ga0070684_1003845362 126
136 3300005535 Ga0070684_101434425 Ga0070684_1014344251 126
137 3300005539 Ga0068853_100310723 Ga0068853_1003107232 126
138 3300005539 Ga0068853_101295737 Ga0068853_1012957371 126
139 3300005544 Ga0070686_100301851 Ga0070686_1003018512 126
140 3300005544 Ga0070686_100655035 Ga0070686_1006550351 126
141 3300005545 Ga0070695_100000023 Ga0070695_1000000239 126
142 3300005545 Ga0070695_100402575 Ga0070695_1004025752 126
143 3300005547 Ga0070693_100913236 Ga0070693_1009132362 126
144 3300005548 Ga0070665_100580851 Ga0070665_1005808512 126
145 3300005549 Ga0070704_100401775 Ga0070704_1004017752 126
146 3300005549 Ga0070704_100887663 Ga0070704_1008876631 126
147 3300005563 Ga0068855_100021414 Ga0068855_1000214145 126
148 3300005563 Ga0068855_100435705 Ga0068855_1004357052 126
149 3300005564 Ga0070664_100047292 Ga0070664_1000472922 126
150 3300005564 Ga0070664_100438277 Ga0070664_1004382772 126
151 3300005577 Ga0068857_100020730 Ga0068857_1000207306 126
152 3300005615 Ga0070702_100394667 Ga0070702_1003946672 126
153 3300005616 Ga0068852_101976630 Ga0068852_1019766302 126
154 3300005617 Ga0068859_100766075 Ga0068859_1007660752 126
155 3300005618 Ga0068864_100130470 Ga0068864_1001304702 126
156 3300005718 Ga0068866_10106583 Ga0068866_101065831 126
157 3300005718 Ga0068866_10164511 Ga0068866_101645112 126
158 3300005718 Ga0068866_10203160 Ga0068866_102031602 126
159 3300005719 Ga0068861_100323507 Ga0068861_1003235072 126
160 3300005840 Ga0068870_10185903 Ga0068870_101859032 126
161 3300005981 Ga0081538_10044531 Ga0081538_100445314 126
162 3300006028 Ga0070717_10088244 Ga0070717_100882442 126
163 3300006028 Ga0070717_10136404 Ga0070717_101364042 126
164 3300006028 Ga0070717_10481405 Ga0070717_104814052 126
165 3300006173 Ga0070716_101189387 Ga0070716_1011893871 126
166 3300006844 Ga0075428_100161388 Ga0075428_1001613882 126
167 3300006844 Ga0075428_101073592 Ga0075428_1010735921 126
168 3300006844 Ga0075428_101601668 Ga0075428_1016016681 126
169 3300006846 Ga0075430_100165628 Ga0075430_1001656282 126
170 3300006852 Ga0075433_10177239 Ga0075433_101772392 126
171 3300006871 Ga0075434_100468536 Ga0075434_1004685362 126
172 3300006871 Ga0075434_102460035 Ga0075434_1024600351 126
173 3300006880 Ga0075429_100286978 Ga0075429_1002869782 126
174 3300006931 Ga0097620_100766044 Ga0097620_1007660442 126
175 3300009094 Ga0111539_10211901 Ga0111539_102119011 126
176 3300009094 Ga0111539_10481257 Ga0111539_104812572 126
177 3300009098 Ga0105245_10063372 Ga0105245_100633722 126
178 3300009098 Ga0105245_10141889 Ga0105245_101418892 126
179 3300009147 Ga0114129_10002630 Ga0114129_1000263018 126
180 3300009147 Ga0114129_10046347 Ga0114129_100463476 126
181 3300009147 Ga0114129_10209029 Ga0114129_102090292 126
182 3300009148 Ga0105243_10028590 Ga0105243_100285902 126
183 3300009148 Ga0105243_10041356 Ga0105243_100413563 126
184 3300009148 Ga0105243_10826219 Ga0105243_108262192 126
185 3300009177 Ga0105248_11334158 Ga0105248_113341582 126
186 3300009545 Ga0105237_11199058 Ga0105237_111990582 126
187 3300009553 Ga0105249_10097333 Ga0105249_100973334 126
188 3300009553 Ga0105249_10520361 Ga0105249_105203612 126
189 3300010375 Ga0105239_10185912 Ga0105239_101859122 126
190 3300013105 Ga0157369_10744392 Ga0157369_107443922 126
191 3300013306 Ga0163162_10321919 Ga0163162_103219192 126
192 3300013308 Ga0157375_10204638 Ga0157375_102046382 126
193 3300013308 Ga0157375_10588148 Ga0157375_105881482 126
194 3300014326 Ga0157380_10297446 Ga0157380_102974462 126
195 3300014745 Ga0157377_10152568 Ga0157377_101525681 126
196 3300020082 Ga0206353_11747572 Ga0206353_117475722 126
197 3300022467 Ga0224712_10131454 Ga0224712_101314542 126
198 3300025898 Ga0207692_10237543 Ga0207692_102375432 126
199 3300025899 Ga0207642_11020672 Ga0207642_110206721 126
200 3300025901 Ga0207688_10129848 Ga0207688_101298482 126
201 3300025908 Ga0207643_10382034 Ga0207643_103820342 126
202 3300025909 Ga0207705_10046663 Ga0207705_100466632 126
203 3300025909 Ga0207705_10056430 Ga0207705_100564302 126
204 3300025909 Ga0207705_10218139 Ga0207705_102181392 126
205 3300025910 Ga0207684_11258891 Ga0207684_112588912 126
206 3300025912 Ga0207707_10268495 Ga0207707_102684952 126
207 3300025913 Ga0207695_10011260 Ga0207695_100112609 126
208 3300025913 Ga0207695_10707666 Ga0207695_107076662 126
209 3300025913 Ga0207695_11308935 Ga0207695_113089352 126
210 3300025914 Ga0207671_10514921 Ga0207671_105149213 126
211 3300025919 Ga0207657_10035890 Ga0207657_100358902 126
212 3300025920 Ga0207649_10014392 Ga0207649_100143924 126
213 3300025921 Ga0207652_10111205 Ga0207652_101112053 126
214 3300025921 Ga0207652_10581142 Ga0207652_105811422 126
215 3300025921 Ga0207652_11423324 Ga0207652_114233242 126
216 3300025922 Ga0207646_10729200 Ga0207646_107292001 126
217 3300025926 Ga0207659_10955930 Ga0207659_109559301 126
218 3300025927 Ga0207687_10067387 Ga0207687_100673872 126
219 3300025927 Ga0207687_10111674 Ga0207687_101116742 126
220 3300025928 Ga0207700_10270096 Ga0207700_102700962 126
221 3300025929 Ga0207664_10167275 Ga0207664_101672752 126
222 3300025929 Ga0207664_10245161 Ga0207664_102451612 126
223 3300025929 Ga0207664_10484775 Ga0207664_104847752 126
224 3300025929 Ga0207664_10582998 Ga0207664_105829982 126
225 3300025932 Ga0207690_10730351 Ga0207690_107303512 126
226 3300025932 Ga0207690_11451040 Ga0207690_114510401 126
227 3300025934 Ga0207686_10280074 Ga0207686_102800742 126
228 3300025935 Ga0207709_10035276 Ga0207709_100352762 126
229 3300025935 Ga0207709_10209936 Ga0207709_102099362 126
230 3300025939 Ga0207665_10407519 Ga0207665_104075192 126
231 3300025941 Ga0207711_10455350 Ga0207711_104553502 126
232 3300025942 Ga0207689_11171737 Ga0207689_111717372 126
233 3300025944 Ga0207661_10123448 Ga0207661_101234482 126
234 3300025944 Ga0207661_10660401 Ga0207661_106604012 126
235 3300025945 Ga0207679_10283602 Ga0207679_102836022 126
236 3300025960 Ga0207651_10521139 Ga0207651_105211392 126
237 3300025961 Ga0207712_10419866 Ga0207712_104198662 126
238 3300025972 Ga0207668_10147884 Ga0207668_101478842 126
239 3300025972 Ga0207668_10851427 Ga0207668_108514272 126
240 3300025981 Ga0207640_10342946 Ga0207640_103429462 126
241 3300026078 Ga0207702_10339861 Ga0207702_103398612 126
242 3300026089 Ga0207648_10105299 Ga0207648_101052992 126
243 3300026089 Ga0207648_10391656 Ga0207648_103916562 126
244 3300026095 Ga0207676_10106149 Ga0207676_101061493 126
245 3300026116 Ga0207674_10021255 Ga0207674_100212558 126
246 3300026118 Ga0207675_100206077 Ga0207675_1002060772 126
247 3300026121 Ga0207683_10252175 Ga0207683_102521752 126
248 3300026142 Ga0207698_10152746 Ga0207698_101527462 126
249 3300026142 Ga0207698_11782938 Ga0207698_117829382 126
250 3300027907 Ga0207428_10575349 Ga0207428_105753492 126
251 3300028800 Ga0265338_10004619 Ga0265338_1000461913 126
252 3300028800 Ga0265338_10005076 Ga0265338_100050765 126
253 3300028800 Ga0265338_10218913 Ga0265338_102189132 126
254 3300035172 Ga0373955_0749001 Ga0373955_0749001_201_584 126
255 3300036401 Ga0373937_0006653 Ga0373937_0006653_3465_3851 126
256 3300037312 Ga0395899_0088804 Ga0395899_0088804_1131_1517 126
257 3300037418 Ga0395900_0004683 Ga0395900_0004683_8969_9352 126
258 3300037418 Ga0395900_0705801 Ga0395900_0705801_116_502 126
259 3300037466 Ga0395898_0008305 Ga0395898_0008305_4719_5102 126
260 3300037466 Ga0395898_0029830 Ga0395898_0029830_2346_2732 126
261 3300037471 Ga0395905_0008879 Ga0395905_0008879_4110_4493 126
262 3300037471 Ga0395905_0121500 Ga0395905_0121500_210_596 126
263 3300038443 Ga0395901_0004478 Ga0395901_0004478_6547_6930 126
264 3300038443 Ga0395901_0066791 Ga0395901_0066791_2281_2667 126
265 3300039453 Ga0436362_0026661 Ga0436362_0026661_113_496 126
266 3300042016 Ga0439463_192348 Ga0439463_192348_89_472 126
267 3300044684 Ga0466966_0439330 Ga0466966_0439330_35_421 126
268 3300044694 Ga0466963_0000263 Ga0466963_0000263_22711_23097 126
269 3300044694 Ga0466963_0009095 Ga0466963_0009095_5300_5686 126
270 3300044694 Ga0466963_0024102 Ga0466963_0024102_2101_2484 126
271 3300044694 Ga0466963_0203915 Ga0466963_0203915_273_659 126
272 3300044842 Ga0466957_0187506 Ga0466957_0187506_904_1287 126
273 3300044842 Ga0466957_0543403 Ga0466957_0543403_362_748 126
274 3300045836 Ga0466958_0046849 Ga0466958_0046849_297_683 126
275 3300045976 Ga0466967_0082996 Ga0466967_0082996_1473_1859 126
276 3300045976 Ga0466967_0348918 Ga0466967_0348918_837_1223 126
277 3300045976 Ga0466967_0355559 Ga0466967_0355559_726_1112 126
278 3300046454 Ga0495592_0000597 Ga0495592_0000597_16340_16726 126
279 3300046459 Ga0495629_0998062 Ga0495629_0998062_126_509 126
280 3300046462 Ga0495651_0000008 Ga0495651_0000008_147860_148246 126
281 3300046463 Ga0495653_0000725 Ga0495653_0000725_16283_16669 126
282 3300046511 Ga0495608_0000957 Ga0495608_0000957_11554_11940 126
283 3300046511 Ga0495608_0260082 Ga0495608_0260082_228_611 126
284 3300046516 Ga0495628_0000105 Ga0495628_0000105_9098_9484 126
285 3300046516 Ga0495628_0030882 Ga0495628_0030882_2687_3073 126
286 3300046516 Ga0495628_0938032 Ga0495628_0938032_105_488 126
287 3300046529 Ga0495652_0001221 Ga0495652_0001221_12097_12483 126
288 3300046536 Ga0495587_0000048 Ga0495587_0000048_12098_12484 126
289 3300046543 Ga0495645_0000029 Ga0495645_0000029_100636_101022 126
290 3300046559 Ga0495667_0302390 Ga0495667_0302390_52_438 126
291 3300046559 Ga0495667_0424752 Ga0495667_0424752_155_541 126
292 3300046615 Ga0495656_0120815 Ga0495656_0120815_297_680 126
293 3300046663 Ga0495635_0033068 Ga0495635_0033068_2709_3095 126
294 3300046675 Ga0495657_0016620 Ga0495657_0016620_4450_4836 126
295 3300046678 Ga0495599_0000110 Ga0495599_0000110_12097_12483 126
296 3300046679 Ga0495623_0000379 Ga0495623_0000379_16668_17054 126
297 3300046680 Ga0495646_0002891 Ga0495646_0002891_6502_6888 126
298 3300046680 Ga0495646_0021855 Ga0495646_0021855_1428_1814 126
299 3300047317 Ga0495604_0000687 Ga0495604_0000687_16206_16592 126
300 3300047322 Ga0495680_0033372 Ga0495680_0033372_3313_3699 126
301 3300047444 Ga0495675_0000419 Ga0495675_0000419_12083_12469 126
302 3300048088 Ga0495602_0001409 Ga0495602_0001409_8440_8826 126
303 3300048088 Ga0495602_0213075 Ga0495602_0213075_376_759 126
304 3300048903 Ga0496100_0017829 Ga0496100_0017829_1180_1569 126
305 3300048903 Ga0496100_1357425 Ga0496100_1357425_33_416 126
306 3300048904 Ga0496101_0013810 Ga0496101_0013810_3075_3464 126
307 3300048904 Ga0496101_0087703 Ga0496101_0087703_1315_1698 126
308 3300048904 Ga0496101_0149097 Ga0496101_0149097_155_538 126
309 3300048905 Ga0496102_0006436 Ga0496102_0006436_6561_6950 126
310 3300048905 Ga0496102_0482860 Ga0496102_0482860_13_402 126
311 3300048906 Ga0496103_0005916 Ga0496103_0005916_2440_2823 126
312 3300048907 Ga0496104_0207547 Ga0496104_0207547_852_1235 126
313 3300048907 Ga0496104_0675208 Ga0496104_0675208_175_564 126
314 3300048909 Ga0496106_0007627 Ga0496106_0007627_2746_3135 126
315 3300048909 Ga0496106_0484397 Ga0496106_0484397_273_662 126
316 3300048910 Ga0496107_0011521 Ga0496107_0011521_4640_5029 126
317 3300048911 Ga0496108_0122159 Ga0496108_0122159_129_512 126
318 3300048911 Ga0496108_0210935 Ga0496108_0210935_1274_1663 126
319 3300048912 Ga0496109_0042673 Ga0496109_0042673_3373_3756 126
320 3300048912 Ga0496109_0096345 Ga0496109_0096345_1815_2198 126
321 3300048913 Ga0496110_0034788 Ga0496110_0034788_1871_2254 126
322 3300048913 Ga0496110_0105268 Ga0496110_0105268_2069_2452 126
323 3300048913 Ga0496110_0181871 Ga0496110_0181871_1291_1680 126
324 3300048913 Ga0496110_0945757 Ga0496110_0945757_211_591 126
325 3300048914 Ga0496111_0035320 Ga0496111_0035320_1339_1722 126
326 3300048914 Ga0496111_0077819 Ga0496111_0077819_592_975 126
327 3300048914 Ga0496111_0579155 Ga0496111_0579155_414_794 126
328 3300048915 Ga0496112_0049295 Ga0496112_0049295_3539_3922 126
329 3300048915 Ga0496112_0353765 Ga0496112_0353765_660_1049 126
330 3300048915 Ga0496112_0817280 Ga0496112_0817280_307_690 126
331 3300048915 Ga0496112_1881736 Ga0496112_1881736_60_449 126
332 3300048916 Ga0496113_0225194 Ga0496113_0225194_386_766 126
333 3300048916 Ga0496113_0865204 Ga0496113_0865204_196_585 126
334 3300048917 Ga0496114_0005938 Ga0496114_0005938_6563_6952 126
335 3300048917 Ga0496114_0219333 Ga0496114_0219333_826_1209 126
336 3300048917 Ga0496114_1575103 Ga0496114_1575103_62_445 126
337 3300048918 Ga0496115_0105138 Ga0496115_0105138_740_1129 126
338 3300049574 Ga0501038_0590624 Ga0501038_0590624_45_440 126
339 3300049575 Ga0501039_1514398 Ga0501039_1514398_108_497 126
340 3300049577 Ga0501041_0209079 Ga0501041_0209079_589_984 126
341 3300049583 Ga0501067_0023435 Ga0501067_0023435_1650_2039 126
342 3300049583 Ga0501067_0052247 Ga0501067_0052247_1777_2163 126
343 3300049584 Ga0501068_0737359 Ga0501068_0737359_235_624 126
344 3300049585 Ga0501069_0025198 Ga0501069_0025198_1540_1926 126
345 3300049587 Ga0501071_0149697 Ga0501071_0149697_519_905 126
346 3300049587 Ga0501071_0594376 Ga0501071_0594376_135_530 126
347 3300049588 Ga0501072_0733182 Ga0501072_0733182_140_535 126
348 3300049591 Ga0501075_0573386 Ga0501075_0573386_188_583 126
349 3300049743 Ga0501081_0594977 Ga0501081_0594977_156_551 126
350 3300049824 Ga0501045_0149617 Ga0501045_0149617_826_1221 126
351 3300050507 nmdc:mga05p37_1053002_c1 nmdc:mga05p37_1053002_c1_132_521 126
352 3300050507 nmdc:mga05p37_39375_c1 nmdc:mga05p37_39375_c1_1872_2255 126
353 3300050511 nmdc:mga08y16_191133_c1 nmdc:mga08y16_191133_c1_1680_2066 126
354 3300050511 nmdc:mga08y16_200788_c1 nmdc:mga08y16_200788_c1_309_698 126
355 3300050511 nmdc:mga08y16_93267_c1 nmdc:mga08y16_93267_c1_187_570 126
356 3300050512 nmdc:mga0n895_2104630_c1 nmdc:mga0n895_2104630_c1_81_470 126
357 3300050512 nmdc:mga0n895_334046_c1 nmdc:mga0n895_334046_c1_1099_1482 126
358 3300050512 nmdc:mga0n895_991513_c1 nmdc:mga0n895_991513_c1_53_439 126
359 3300050513 nmdc:mga0rr50_214349_c1 nmdc:mga0rr50_214349_c1_1174_1563 126
360 3300050513 nmdc:mga0rr50_291706_c1 nmdc:mga0rr50_291706_c1_251_634 126
361 3300053077 Ga0495601_0000340 Ga0495601_0000340_15459_15845 126
362 3300053077 Ga0495601_0450210 Ga0495601_0450210_299_682 126
363 3300053078 Ga0495612_0010731 Ga0495612_0010731_904_1290 126
364 3300053084 Ga0495595_0008985 Ga0495595_0008985_868_1254 126
365 3300053085 Ga0495619_0001752 Ga0495619_0001752_8608_8994 126
366 3300061734 Ga0530510_0239274 Ga0530510_0239274_265_651 126
367 3300061734 Ga0530510_1544570 Ga0530510_1544570_49_444 126
368 3300003323 rootH1_10353615 rootH1_103536152 127
369 3300005327 Ga0070658_10344550 Ga0070658_103445502 127
370 3300005327 Ga0070658_11825187 Ga0070658_118251871 127
371 3300005329 Ga0070683_100741587 Ga0070683_1007415872 127
372 3300005329 Ga0070683_101414154 Ga0070683_1014141541 127
373 3300005331 Ga0070670_100031063 Ga0070670_1000310635 127
374 3300005334 Ga0068869_100010268 Ga0068869_1000102684 127
375 3300005337 Ga0070682_100007524 Ga0070682_1000075244 127
376 3300005337 Ga0070682_100703178 Ga0070682_1007031782 127
377 3300005338 Ga0068868_100038831 Ga0068868_1000388312 127
378 3300005338 Ga0068868_100393157 Ga0068868_1003931572 127
379 3300005338 Ga0068868_100713706 Ga0068868_1007137062 127
380 3300005338 Ga0068868_100857904 Ga0068868_1008579042 127
381 3300005339 Ga0070660_100004247 Ga0070660_1000042476 127
382 3300005340 Ga0070689_100096706 Ga0070689_1000967063 127
383 3300005340 Ga0070689_100184064 Ga0070689_1001840642 127
384 3300005341 Ga0070691_10193445 Ga0070691_101934452 127
385 3300005344 Ga0070661_101646531 Ga0070661_1016465311 127
386 3300005354 Ga0070675_100020843 Ga0070675_1000208435 127
387 3300005354 Ga0070675_101376100 Ga0070675_1013761002 127
388 3300005355 Ga0070671_100043764 Ga0070671_1000437644 127
389 3300005356 Ga0070674_100001343 Ga0070674_10000134314 127
390 3300005356 Ga0070674_100409178 Ga0070674_1004091782 127
391 3300005364 Ga0070673_100029717 Ga0070673_1000297172 127
392 3300005435 Ga0070714_100517970 Ga0070714_1005179702 127
393 3300005438 Ga0070701_10087635 Ga0070701_100876352 127
394 3300005440 Ga0070705_101379595 Ga0070705_1013795951 127
395 3300005441 Ga0070700_100033754 Ga0070700_1000337544 127
396 3300005456 Ga0070678_100019338 Ga0070678_1000193382 127
397 3300005456 Ga0070678_100628747 Ga0070678_1006287472 127
398 3300005456 Ga0070678_101352260 Ga0070678_1013522602 127
399 3300005457 Ga0070662_100068275 Ga0070662_1000682752 127
400 3300005457 Ga0070662_100158412 Ga0070662_1001584122 127
401 3300005457 Ga0070662_101319562 Ga0070662_1013195621 127
402 3300005458 Ga0070681_10095218 Ga0070681_100952182 127
403 3300005458 Ga0070681_10355606 Ga0070681_103556062 127
404 3300005471 Ga0070698_100129731 Ga0070698_1001297312 127
405 3300005518 Ga0070699_100616428 Ga0070699_1006164282 127
406 3300005530 Ga0070679_100785267 Ga0070679_1007852672 127
407 3300005535 Ga0070684_100005143 Ga0070684_1000051435 127
408 3300005535 Ga0070684_101318131 Ga0070684_1013181312 127
409 3300005535 Ga0070684_101366341 Ga0070684_1013663412 127
410 3300005536 Ga0070697_100245147 Ga0070697_1002451472 127
411 3300005543 Ga0070672_100045887 Ga0070672_1000458872 127
412 3300005544 Ga0070686_100013904 Ga0070686_1000139045 127
413 3300005544 Ga0070686_100222186 Ga0070686_1002221862 127
414 3300005546 Ga0070696_100070263 Ga0070696_1000702633 127
415 3300005546 Ga0070696_101228716 Ga0070696_1012287161 127
416 3300005563 Ga0068855_100223805 Ga0068855_1002238052 127
417 3300005564 Ga0070664_100048012 Ga0070664_1000480122 127
418 3300005614 Ga0068856_100054577 Ga0068856_1000545773 127
419 3300005614 Ga0068856_100203834 Ga0068856_1002038342 127
420 3300005614 Ga0068856_100650042 Ga0068856_1006500421 127
421 3300005615 Ga0070702_100174825 Ga0070702_1001748251 127
422 3300005615 Ga0070702_100329946 Ga0070702_1003299462 127
423 3300005615 Ga0070702_100596822 Ga0070702_1005968221 127
424 3300005615 Ga0070702_101514902 Ga0070702_1015149021 127
425 3300005719 Ga0068861_100090477 Ga0068861_1000904773 127
426 3300005719 Ga0068861_100169161 Ga0068861_1001691613 127
427 3300005719 Ga0068861_100375107 Ga0068861_1003751072 127
428 3300005719 Ga0068861_100561173 Ga0068861_1005611732 127
429 3300005840 Ga0068870_10001663 Ga0068870_1000166310 127
430 3300005841 Ga0068863_100141650 Ga0068863_1001416503 127
431 3300005937 Ga0081455_10026030 Ga0081455_100260302 127
432 3300006163 Ga0070715_10173682 Ga0070715_101736822 127
433 3300006175 Ga0070712_100321191 Ga0070712_1003211912 127
434 3300006852 Ga0075433_10025878 Ga0075433_100258783 127
435 3300006852 Ga0075433_10115499 Ga0075433_101154992 127
436 3300006871 Ga0075434_100013194 Ga0075434_1000131949 127
437 3300006871 Ga0075434_100046551 Ga0075434_1000465512 127
438 3300006881 Ga0068865_100008018 Ga0068865_1000080182 127
439 3300006914 Ga0075436_100351918 Ga0075436_1003519182 127
440 3300006914 Ga0075436_100431101 Ga0075436_1004311012 127
441 3300007076 Ga0075435_100001676 Ga0075435_1000016767 127
442 3300007076 Ga0075435_100260441 Ga0075435_1002604412 127
443 3300009011 Ga0105251_10526457 Ga0105251_105264572 127
444 3300009094 Ga0111539_10962314 Ga0111539_109623142 127
445 3300009098 Ga0105245_10073696 Ga0105245_100736964 127
446 3300009098 Ga0105245_10143484 Ga0105245_101434842 127
447 3300009098 Ga0105245_10218382 Ga0105245_102183822 127
448 3300009098 Ga0105245_10408029 Ga0105245_104080292 127
449 3300009147 Ga0114129_10331070 Ga0114129_103310702 127
450 3300009148 Ga0105243_10007160 Ga0105243_100071609 127
451 3300009176 Ga0105242_10445443 Ga0105242_104454433 127
452 3300009177 Ga0105248_10327535 Ga0105248_103275352 127
453 3300009177 Ga0105248_11768073 Ga0105248_117680732 127
454 3300009177 Ga0105248_12399857 Ga0105248_123998572 127
455 3300010375 Ga0105239_10278926 Ga0105239_102789263 127
456 3300010375 Ga0105239_10458912 Ga0105239_104589122 127
457 3300010375 Ga0105239_10530240 Ga0105239_105302402 127
458 3300010375 Ga0105239_10655238 Ga0105239_106552381 127
459 3300010375 Ga0105239_11074337 Ga0105239_110743372 127
460 3300011119 Ga0105246_10010274 Ga0105246_100102743 127
461 3300013307 Ga0157372_10743710 Ga0157372_107437102 127
462 3300013307 Ga0157372_10940449 Ga0157372_109404492 127
463 3300013308 Ga0157375_10007010 Ga0157375_100070102 127
464 3300013308 Ga0157375_10256648 Ga0157375_102566482 127
465 3300013308 Ga0157375_11760459 Ga0157375_117604591 127
466 3300014325 Ga0163163_10210895 Ga0163163_102108952 127
467 3300014325 Ga0163163_10232488 Ga0163163_102324882 127
468 3300014326 Ga0157380_12241248 Ga0157380_122412482 127
469 3300014745 Ga0157377_10011708 Ga0157377_100117082 127
470 3300014745 Ga0157377_10932385 Ga0157377_109323851 127
471 3300020082 Ga0206353_11170205 Ga0206353_111702054 127
472 3300025901 Ga0207688_10003610 Ga0207688_100036108 127
473 3300025908 Ga0207643_10002185 Ga0207643_1000218510 127
474 3300025912 Ga0207707_10114030 Ga0207707_101140302 127
475 3300025917 Ga0207660_10073926 Ga0207660_100739262 127
476 3300025918 Ga0207662_10824979 Ga0207662_108249792 127
477 3300025919 Ga0207657_10016396 Ga0207657_100163967 127
478 3300025919 Ga0207657_10114411 Ga0207657_101144114 127
479 3300025920 Ga0207649_10198867 Ga0207649_101988672 127
480 3300025925 Ga0207650_10437248 Ga0207650_104372482 127
481 3300025927 Ga0207687_10012356 Ga0207687_100123563 127
482 3300025927 Ga0207687_10195611 Ga0207687_101956112 127
483 3300025929 Ga0207664_10391562 Ga0207664_103915622 127
484 3300025931 Ga0207644_10021037 Ga0207644_100210375 127
485 3300025933 Ga0207706_10045134 Ga0207706_100451343 127
486 3300025933 Ga0207706_10222631 Ga0207706_102226312 127
487 3300025936 Ga0207670_10602402 Ga0207670_106024022 127
488 3300025938 Ga0207704_10389775 Ga0207704_103897752 127
489 3300025938 Ga0207704_10395042 Ga0207704_103950422 127
490 3300025940 Ga0207691_10053561 Ga0207691_100535612 127
491 3300025941 Ga0207711_10326463 Ga0207711_103264632 127
492 3300025942 Ga0207689_10016326 Ga0207689_100163265 127
493 3300025944 Ga0207661_10090941 Ga0207661_100909412 127
494 3300025944 Ga0207661_10577653 Ga0207661_105776532 127
495 3300025945 Ga0207679_10138872 Ga0207679_101388722 127
496 3300025949 Ga0207667_10041146 Ga0207667_100411465 127
497 3300026023 Ga0207677_10467026 Ga0207677_104670262 127
498 3300026041 Ga0207639_10544394 Ga0207639_105443942 127
499 3300026075 Ga0207708_10033775 Ga0207708_100337754 127
500 3300026078 Ga0207702_10045317 Ga0207702_100453173 127
501 3300026078 Ga0207702_10254434 Ga0207702_102544342 127
502 3300026078 Ga0207702_10292140 Ga0207702_102921402 127
503 3300026078 Ga0207702_11228694 Ga0207702_112286942 127
504 3300026088 Ga0207641_10143930 Ga0207641_101439302 127
505 3300026089 Ga0207648_10211915 Ga0207648_102119152 127
506 3300026095 Ga0207676_10051555 Ga0207676_100515552 127
507 3300026118 Ga0207675_100129136 Ga0207675_1001291363 127
508 3300026118 Ga0207675_100338051 Ga0207675_1003380512 127
509 3300026121 Ga0207683_10023772 Ga0207683_100237722 127
510 3300028800 Ga0265338_10007729 Ga0265338_100077297 127
511 3300031548 Ga0307408_100108292 Ga0307408_1001082922 127
512 3300031731 Ga0307405_10207673 Ga0307405_102076732 127
513 3300031824 Ga0307413_10062908 Ga0307413_100629082 127
514 3300031852 Ga0307410_10150437 Ga0307410_101504372 127
515 3300031852 Ga0307410_10541313 Ga0307410_105413132 127
516 3300031903 Ga0307407_10136768 Ga0307407_101367682 127
517 3300031995 Ga0307409_100724811 Ga0307409_1007248112 127
518 3300032002 Ga0307416_100417648 Ga0307416_1004176482 127
519 3300032004 Ga0307414_10537101 Ga0307414_105371011 127
520 3300035691 Ga0373931_0692109 Ga0373931_0692109_53_436 127
521 3300035691 Ga0373931_0901756 Ga0373931_0901756_42_425 127
522 3300037312 Ga0395899_0022068 Ga0395899_0022068_1018_1407 127
523 3300037418 Ga0395900_0026887 Ga0395900_0026887_20_409 127
524 3300037418 Ga0395900_0939404 Ga0395900_0939404_175_564 127
525 3300037466 Ga0395898_0006932 Ga0395898_0006932_7548_7937 127
526 3300037471 Ga0395905_0083812 Ga0395905_0083812_1386_1775 127
527 3300038443 Ga0395901_0264774 Ga0395901_0264774_389_778 127
528 3300042993 Ga0439440_0172005 Ga0439440_0172005_30_413 127
529 3300044694 Ga0466963_0053273 Ga0466963_0053273_1220_1609 127
530 3300044735 Ga0466968_0011483 Ga0466968_0011483_1220_1609 127
531 3300045976 Ga0466967_1517853 Ga0466967_1517853_165_554 127
532 3300046455 Ga0495603_0048230 Ga0495603_0048230_238_621 127
533 3300046472 Ga0495580_0454092 Ga0495580_0454092_358_741 127
534 3300046492 Ga0495585_0434987 Ga0495585_0434987_97_480 127
535 3300046523 Ga0495644_0354634 Ga0495644_0354634_96_479 127
536 3300046525 Ga0495663_0011353 Ga0495663_0011353_726_1109 127
537 3300046528 Ga0495642_0141062 Ga0495642_0141062_219_602 127
538 3300046529 Ga0495652_0512561 Ga0495652_0512561_141_527 127
539 3300046538 Ga0495609_0392872 Ga0495609_0392872_16_405 127
540 3300046615 Ga0495656_0169279 Ga0495656_0169279_609_992 127
541 3300046683 Ga0495658_0143821 Ga0495658_0143821_224_607 127
542 3300046689 Ga0495613_0043580 Ga0495613_0043580_1282_1665 127
543 3300047471 Ga0495684_0496711 Ga0495684_0496711_55_438 127
544 3300048903 Ga0496100_0014145 Ga0496100_0014145_4096_4515 127
545 3300048903 Ga0496100_0697018 Ga0496100_0697018_233_616 127
546 3300048903 Ga0496100_0868820 Ga0496100_0868820_53_436 127
547 3300048904 Ga0496101_0016094 Ga0496101_0016094_1861_2244 127
548 3300048904 Ga0496101_0055023 Ga0496101_0055023_216_599 127
549 3300048905 Ga0496102_0057586 Ga0496102_0057586_2684_3067 127
550 3300048905 Ga0496102_0214137 Ga0496102_0214137_1378_1761 127
551 3300048905 Ga0496102_0357591 Ga0496102_0357591_549_932 127
552 3300048906 Ga0496103_0041682 Ga0496103_0041682_118_501 127
553 3300048907 Ga0496104_0000699 Ga0496104_0000699_5137_5556 127
554 3300048907 Ga0496104_0143747 Ga0496104_0143747_517_900 127
555 3300048907 Ga0496104_0792816 Ga0496104_0792816_273_659 127
556 3300048907 Ga0496104_1097208 Ga0496104_1097208_232_615 127
557 3300048908 Ga0496105_0000148 Ga0496105_0000148_23406_23825 127
558 3300048908 Ga0496105_0022506 Ga0496105_0022506_1681_2064 127
559 3300048908 Ga0496105_0473846 Ga0496105_0473846_520_903 127
560 3300048909 Ga0496106_0083820 Ga0496106_0083820_986_1369 127
561 3300048909 Ga0496106_0180007 Ga0496106_0180007_28_447 127
562 3300048909 Ga0496106_0498796 Ga0496106_0498796_301_690 127
563 3300048909 Ga0496106_1494898 Ga0496106_1494898_76_468 127
564 3300048911 Ga0496108_0001132 Ga0496108_0001132_17747_18130 127
565 3300048911 Ga0496108_0070533 Ga0496108_0070533_2261_2644 127
566 3300048911 Ga0496108_0185021 Ga0496108_0185021_1294_1680 127
567 3300048911 Ga0496108_0638372 Ga0496108_0638372_275_658 127
568 3300048912 Ga0496109_0001891 Ga0496109_0001891_5765_6148 127
569 3300048912 Ga0496109_0004954 Ga0496109_0004954_6373_6792 127
570 3300048912 Ga0496109_0030974 Ga0496109_0030974_3880_4263 127
571 3300048912 Ga0496109_0191015 Ga0496109_0191015_817_1206 127
572 3300048912 Ga0496109_1780243 Ga0496109_1780243_49_438 127
573 3300048913 Ga0496110_0000707 Ga0496110_0000707_14399_14818 127
574 3300048913 Ga0496110_0001277 Ga0496110_0001277_2786_3169 127
575 3300048913 Ga0496110_0005568 Ga0496110_0005568_2891_3274 127
576 3300048913 Ga0496110_0040997 Ga0496110_0040997_132_521 127
577 3300048913 Ga0496110_0234659 Ga0496110_0234659_323_715 127
578 3300048913 Ga0496110_0476318 Ga0496110_0476318_343_732 127
579 3300048913 Ga0496110_0683453 Ga0496110_0683453_524_907 127
580 3300048914 Ga0496111_0002493 Ga0496111_0002493_1982_2401 127
581 3300048914 Ga0496111_0005116 Ga0496111_0005116_1127_1510 127
582 3300048914 Ga0496111_0021718 Ga0496111_0021718_726_1109 127
583 3300048914 Ga0496111_0070480 Ga0496111_0070480_1189_1572 127
584 3300048914 Ga0496111_0974526 Ga0496111_0974526_189_578 127
585 3300048915 Ga0496112_0196058 Ga0496112_0196058_582_965 127
586 3300048915 Ga0496112_0284581 Ga0496112_0284581_675_1067 127
587 3300048915 Ga0496112_0480954 Ga0496112_0480954_102_491 127
588 3300048915 Ga0496112_0614535 Ga0496112_0614535_600_983 127
589 3300048916 Ga0496113_0051987 Ga0496113_0051987_2207_2626 127
590 3300048916 Ga0496113_0138861 Ga0496113_0138861_901_1284 127
591 3300048916 Ga0496113_0170373 Ga0496113_0170373_256_639 127
592 3300048916 Ga0496113_0802321 Ga0496113_0802321_260_643 127
593 3300048917 Ga0496114_0000385 Ga0496114_0000385_4011_4430 127
594 3300048917 Ga0496114_0064892 Ga0496114_0064892_1044_1427 127
595 3300048917 Ga0496114_0112784 Ga0496114_0112784_87_470 127
596 3300048917 Ga0496114_1381347 Ga0496114_1381347_119_502 127
597 3300048918 Ga0496115_0646084 Ga0496115_0646084_375_758 127
598 3300049570 Ga0501033_0251364 Ga0501033_0251364_712_1101 127
599 3300049578 Ga0501042_0452490 Ga0501042_0452490_237_626 127
600 3300049583 Ga0501067_0002683 Ga0501067_0002683_6998_7387 127
601 3300049583 Ga0501067_0062108 Ga0501067_0062108_571_954 127
602 3300049585 Ga0501069_0034070 Ga0501069_0034070_1085_1474 127
603 3300049586 Ga0501070_0064144 Ga0501070_0064144_2069_2458 127
604 3300049589 Ga0501073_1114680 Ga0501073_1114680_51_437 127
605 3300049592 Ga0501076_0091513 Ga0501076_0091513_1062_1445 127
606 3300049592 Ga0501076_0575234 Ga0501076_0575234_405_794 127
607 3300049741 Ga0501079_0168835 Ga0501079_0168835_35_418 127
608 3300049824 Ga0501045_0125125 Ga0501045_0125125_451_834 127
609 3300050507 nmdc:mga05p37_566683_c1 nmdc:mga05p37_566683_c1_673_1065 127
610 3300050511 nmdc:mga08y16_1192955_c1 nmdc:mga08y16_1192955_c1_231_614 127
611 3300050511 nmdc:mga08y16_1969635_c1 nmdc:mga08y16_1969635_c1_111_503 127
612 3300050512 nmdc:mga0n895_106457_c1 nmdc:mga0n895_106457_c1_1285_1677 127
613 3300050512 nmdc:mga0n895_62844_c1 nmdc:mga0n895_62844_c1_3051_3443 127
614 3300050512 nmdc:mga0n895_724212_c1 nmdc:mga0n895_724212_c1_163_552 127
615 3300050512 nmdc:mga0n895_92204_c1 nmdc:mga0n895_92204_c1_1731_2114 127
616 3300050513 nmdc:mga0rr50_175187_c1 nmdc:mga0rr50_175187_c1_827_1216 127
617 3300050513 nmdc:mga0rr50_64615_c1 nmdc:mga0rr50_64615_c1_2149_2541 127
618 3300050514 nmdc:mga08x19_1143777_c1 nmdc:mga08x19_1143777_c1_144_536 127
619 3300050515 nmdc:mga0a205_188204_c1 nmdc:mga0a205_188204_c1_1226_1618 127
620 3300050515 nmdc:mga0a205_322294_c1 nmdc:mga0a205_322294_c1_223_615 127
621 3300050515 nmdc:mga0a205_434337_c1 nmdc:mga0a205_434337_c1_370_753 127
622 3300050515 nmdc:mga0a205_755016_c1 nmdc:mga0a205_755016_c1_362_745 127
623 3300060353 Ga0501082_0071859 Ga0501082_0071859_465_848 127
624 3300061734 Ga0530510_0005142 Ga0530510_0005142_896_1285 127
625 3300003373 JGI25407J50210_10000981 JGI25407J50210_100009814 128
626 3300003373 JGI25407J50210_10055418 JGI25407J50210_100554181 128
627 3300005331 Ga0070670_100257154 Ga0070670_1002571542 128
628 3300005435 Ga0070714_101755904 Ga0070714_1017559042 128
629 3300005440 Ga0070705_100007340 Ga0070705_1000073405 128
630 3300005445 Ga0070708_100560855 Ga0070708_1005608551 128
631 3300005445 Ga0070708_100761550 Ga0070708_1007615502 128
632 3300005467 Ga0070706_100082223 Ga0070706_1000822232 128
633 3300005468 Ga0070707_100554989 Ga0070707_1005549891 128
634 3300005471 Ga0070698_100010276 Ga0070698_1000102765 128
635 3300005471 Ga0070698_100309827 Ga0070698_1003098272 128
636 3300005518 Ga0070699_100069518 Ga0070699_1000695182 128
637 3300005518 Ga0070699_100116535 Ga0070699_1001165352 128
638 3300005614 Ga0068856_100004494 Ga0068856_1000044948 128
639 3300005937 Ga0081455_10040533 Ga0081455_100405332 128
640 3300005937 Ga0081455_10107546 Ga0081455_101075463 128
641 3300005937 Ga0081455_10336345 Ga0081455_103363452 128
642 3300005981 Ga0081538_10000331 Ga0081538_1000033150 128
643 3300005981 Ga0081538_10000451 Ga0081538_1000045138 128
644 3300005981 Ga0081538_10015452 Ga0081538_100154522 128
645 3300005983 Ga0081540_1001173 Ga0081540_100117314 128
646 3300005983 Ga0081540_1030028 Ga0081540_10300282 128
647 3300005985 Ga0081539_10000639 Ga0081539_1000063910 128
648 3300005985 Ga0081539_10002903 Ga0081539_100029037 128
649 3300006038 Ga0075365_10337729 Ga0075365_103377291 128
650 3300006051 Ga0075364_10840519 Ga0075364_108405192 128
651 3300006058 Ga0075432_10116059 Ga0075432_101160592 128
652 3300006844 Ga0075428_100205341 Ga0075428_1002053412 128
653 3300006844 Ga0075428_100471432 Ga0075428_1004714322 128
654 3300006846 Ga0075430_100774821 Ga0075430_1007748212 128
655 3300006847 Ga0075431_100514815 Ga0075431_1005148152 128
656 3300006852 Ga0075433_10584070 Ga0075433_105840702 128
657 3300006871 Ga0075434_100196681 Ga0075434_1001966812 128
658 3300006880 Ga0075429_100259138 Ga0075429_1002591382 128
659 3300009094 Ga0111539_10262583 Ga0111539_102625832 128
660 3300009147 Ga0114129_10009322 Ga0114129_100093222 128
661 3300009147 Ga0114129_10147376 Ga0114129_101473762 128
662 3300009147 Ga0114129_10703391 Ga0114129_107033912 128
663 3300009147 Ga0114129_11530116 Ga0114129_115301162 128
664 3300009147 Ga0114129_11869643 Ga0114129_118696431 128
665 3300009147 Ga0114129_13113902 Ga0114129_131139021 128
666 3300014497 Ga0182008_10127951 Ga0182008_101279512 128
667 3300025910 Ga0207684_10319943 Ga0207684_103199432 128
668 3300025922 Ga0207646_10529184 Ga0207646_105291842 128
669 3300025925 Ga0207650_10087162 Ga0207650_100871622 128
670 3300026078 Ga0207702_10006207 Ga0207702_100062072 128
671 3300027907 Ga0207428_10022261 Ga0207428_100222615 128
672 3300031548 Ga0307408_100774110 Ga0307408_1007741102 128
673 3300032002 Ga0307416_100138014 Ga0307416_1001380143 128
674 3300032002 Ga0307416_100237760 Ga0307416_1002377602 128
675 3300032002 Ga0307416_102642623 Ga0307416_1026426232 128
676 3300032126 Ga0307415_100377198 Ga0307415_1003771982 128
677 3300032126 Ga0307415_100899723 Ga0307415_1008997232 128
678 3300037312 Ga0395899_0021913 Ga0395899_0021913_1988_2374 128
679 3300037312 Ga0395899_0090976 Ga0395899_0090976_554_949 128
680 3300037312 Ga0395899_0323072 Ga0395899_0323072_360_752 128
681 3300037312 Ga0395899_0984486 Ga0395899_0984486_54_449 128
682 3300037418 Ga0395900_0060361 Ga0395900_0060361_1407_1793 128
683 3300037418 Ga0395900_0074153 Ga0395900_0074153_969_1358 128
684 3300037418 Ga0395900_0110888 Ga0395900_0110888_1631_2026 128
685 3300037418 Ga0395900_0748419 Ga0395900_0748419_174_563 128
686 3300037418 Ga0395900_0792315 Ga0395900_0792315_462_851 128
687 3300037466 Ga0395898_0027985 Ga0395898_0027985_2571_2957 128
688 3300037466 Ga0395898_0078678 Ga0395898_0078678_2218_2613 128
689 3300037466 Ga0395898_0526941 Ga0395898_0526941_577_966 128
690 3300037471 Ga0395905_0072300 Ga0395905_0072300_1488_1874 128
691 3300037471 Ga0395905_0089447 Ga0395905_0089447_749_1138 128
692 3300037471 Ga0395905_0147766 Ga0395905_0147766_176_571 128
693 3300037471 Ga0395905_1292650 Ga0395905_1292650_116_508 128
694 3300038443 Ga0395901_0026300 Ga0395901_0026300_1428_1823 128
695 3300038443 Ga0395901_0069501 Ga0395901_0069501_785_1171 128
696 3300038443 Ga0395901_0482776 Ga0395901_0482776_839_1228 128
697 3300038443 Ga0395901_1014155 Ga0395901_1014155_258_650 128
698 3300041512 Ga0451853_0630862 Ga0451853_0630862_126_515 128
699 3300042993 Ga0439440_0161005 Ga0439440_0161005_70_456 128
700 3300044694 Ga0466963_0352208 Ga0466963_0352208_405_797 128
701 3300046461 Ga0495641_0139679 Ga0495641_0139679_647_1039 128
702 3300046523 Ga0495644_0129081 Ga0495644_0129081_466_858 128
703 3300048909 Ga0496106_1049285 Ga0496106_1049285_175_567 128
704 3300048910 Ga0496107_1114322 Ga0496107_1114322_51_443 128
705 3300048913 Ga0496110_1627197 Ga0496110_1627197_137_529 128
706 3300049568 Ga0501031_0006601 Ga0501031_0006601_1870_2256 128
707 3300049569 Ga0501032_0006820 Ga0501032_0006820_4747_5133 128
708 3300049570 Ga0501033_0002443 Ga0501033_0002443_14007_14393 128
709 3300049571 Ga0501034_0685566 Ga0501034_0685566_225_611 128
710 3300049573 Ga0501037_0006306 Ga0501037_0006306_6957_7343 128
711 3300049574 Ga0501038_0004637 Ga0501038_0004637_10937_11323 128
712 3300049575 Ga0501039_0004453 Ga0501039_0004453_3461_3847 128
713 3300049576 Ga0501040_0014595 Ga0501040_0014595_1334_1720 128
714 3300049576 Ga0501040_0269224 Ga0501040_0269224_645_1076 128
715 3300049576 Ga0501040_0424515 Ga0501040_0424515_515_907 128
716 3300049577 Ga0501041_0006117 Ga0501041_0006117_5651_6037 128
717 3300049578 Ga0501042_0002201 Ga0501042_0002201_4483_4869 128
718 3300049578 Ga0501042_0367498 Ga0501042_0367498_123_554 128
719 3300049579 Ga0501043_0010002 Ga0501043_0010002_6918_7304 128
720 3300049580 Ga0501046_0084519 Ga0501046_0084519_1000_1386 128
721 3300049581 Ga0501047_0326913 Ga0501047_0326913_288_674 128
722 3300049582 Ga0501048_0020342 Ga0501048_0020342_1907_2293 128
723 3300049583 Ga0501067_0046253 Ga0501067_0046253_994_1389 128
724 3300049584 Ga0501068_0006359 Ga0501068_0006359_5777_6163 128
725 3300049584 Ga0501068_0095025 Ga0501068_0095025_252_647 128
726 3300049585 Ga0501069_0002155 Ga0501069_0002155_5271_5666 128
727 3300049585 Ga0501069_0037865 Ga0501069_0037865_1081_1467 128
728 3300049586 Ga0501070_0017668 Ga0501070_0017668_288_674 128
729 3300049587 Ga0501071_0017019 Ga0501071_0017019_1160_1546 128
730 3300049588 Ga0501072_0094242 Ga0501072_0094242_1323_1709 128
731 3300049590 Ga0501074_0001058 Ga0501074_0001058_684_1070 128
732 3300049593 Ga0501077_0007842 Ga0501077_0007842_2700_3086 128
733 3300049742 Ga0501080_0007990 Ga0501080_0007990_2185_2571 128
734 3300049743 Ga0501081_0124168 Ga0501081_0124168_830_1261 128
735 3300049743 Ga0501081_0258725 Ga0501081_0258725_404_790 128
736 3300049744 Ga0501083_0018569 Ga0501083_0018569_4024_4410 128
737 3300049824 Ga0501045_0010297 Ga0501045_0010297_5847_6233 128
738 3300050492 nmdc:mga0yw44_373202_c1 nmdc:mga0yw44_373202_c1_468_854 128
739 3300050507 nmdc:mga05p37_1573555_c1 nmdc:mga05p37_1573555_c1_240_629 128
740 3300050507 nmdc:mga05p37_20642_c1 nmdc:mga05p37_20642_c1_5307_5696 128
741 3300050507 nmdc:mga05p37_229239_c1 nmdc:mga05p37_229239_c1_1769_2158 128
742 3300050507 nmdc:mga05p37_281376_c1 nmdc:mga05p37_281376_c1_384_770 128
743 3300050507 nmdc:mga05p37_33951_c1 nmdc:mga05p37_33951_c1_3249_3638 128
744 3300050507 nmdc:mga05p37_405113_c1 nmdc:mga05p37_405113_c1_876_1262 128
745 3300050508 nmdc:mga09592_262171_c1 nmdc:mga09592_262171_c1_774_1178 128
746 3300050508 nmdc:mga09592_998787_c1 nmdc:mga09592_998787_c1_68_454 128
747 3300050509 nmdc:mga0qj67_240458_c1 nmdc:mga0qj67_240458_c1_944_1348 128
748 3300050510 nmdc:mga06r32_588245_c1 nmdc:mga06r32_588245_c1_379_765 128
749 3300050512 nmdc:mga0n895_146450_c1 nmdc:mga0n895_146450_c1_1869_2258 128
750 3300050515 nmdc:mga0a205_337659_c1 nmdc:mga0a205_337659_c1_371_760 128
751 3300054114 Ga0501084_0153653 Ga0501084_0153653_404_790 128
752 3300060353 Ga0501082_0431387 Ga0501082_0431387_39_431 128
753 3300060353 Ga0501082_1210714 Ga0501082_1210714_83_514 128
754 3300061734 Ga0530510_0012303 Ga0530510_0012303_3109_3504 128
755 3300061734 Ga0530510_0143932 Ga0530510_0143932_532_918 128
756 3300003203 JGI25406J46586_10099668 JGI25406J46586_100996682 129
757 3300005327 Ga0070658_10058099 Ga0070658_100580992 129
758 3300005327 Ga0070658_10179413 Ga0070658_101794132 129
759 3300005329 Ga0070683_100002787 Ga0070683_1000027874 129
760 3300005329 Ga0070683_100092821 Ga0070683_1000928212 129
761 3300005329 Ga0070683_100170355 Ga0070683_1001703552 129
762 3300005329 Ga0070683_100507787 Ga0070683_1005077871 129
763 3300005329 Ga0070683_101919322 Ga0070683_1019193221 129
764 3300005334 Ga0068869_100343046 Ga0068869_1003430461 129
765 3300005336 Ga0070680_100074347 Ga0070680_1000743475 129
766 3300005336 Ga0070680_100120437 Ga0070680_1001204372 129
767 3300005336 Ga0070680_100582390 Ga0070680_1005823901 129
768 3300005339 Ga0070660_100246358 Ga0070660_1002463582 129
769 3300005339 Ga0070660_100522402 Ga0070660_1005224022 129
770 3300005341 Ga0070691_10022623 Ga0070691_100226232 129
771 3300005341 Ga0070691_10096474 Ga0070691_100964742 129
772 3300005344 Ga0070661_100017193 Ga0070661_1000171933 129
773 3300005347 Ga0070668_100410495 Ga0070668_1004104951 129
774 3300005347 Ga0070668_100495748 Ga0070668_1004957482 129
775 3300005353 Ga0070669_101658492 Ga0070669_1016584921 129
776 3300005354 Ga0070675_100544715 Ga0070675_1005447152 129
777 3300005356 Ga0070674_100150317 Ga0070674_1001503172 129
778 3300005356 Ga0070674_100487995 Ga0070674_1004879952 129
779 3300005366 Ga0070659_100140528 Ga0070659_1001405282 129
780 3300005366 Ga0070659_100466601 Ga0070659_1004666012 129
781 3300005366 Ga0070659_100485453 Ga0070659_1004854532 129
782 3300005434 Ga0070709_10074672 Ga0070709_100746722 129
783 3300005435 Ga0070714_100022365 Ga0070714_1000223652 129
784 3300005435 Ga0070714_100095648 Ga0070714_1000956482 129
785 3300005435 Ga0070714_100774771 Ga0070714_1007747712 129
786 3300005436 Ga0070713_100010281 Ga0070713_1000102812 129
787 3300005436 Ga0070713_100041335 Ga0070713_1000413353 129
788 3300005438 Ga0070701_11034059 Ga0070701_110340591 129
789 3300005438 Ga0070701_11038322 Ga0070701_110383221 129
790 3300005439 Ga0070711_100077703 Ga0070711_1000777033 129
791 3300005440 Ga0070705_100272150 Ga0070705_1002721502 129
792 3300005440 Ga0070705_100457251 Ga0070705_1004572512 129
793 3300005441 Ga0070700_100173339 Ga0070700_1001733392 129
794 3300005444 Ga0070694_100240712 Ga0070694_1002407122 129
795 3300005445 Ga0070708_100382510 Ga0070708_1003825102 129
796 3300005445 Ga0070708_100415485 Ga0070708_1004154852 129
797 3300005455 Ga0070663_100489957 Ga0070663_1004899571 129
798 3300005456 Ga0070678_100542969 Ga0070678_1005429691 129
799 3300005457 Ga0070662_100032084 Ga0070662_1000320843 129
800 3300005457 Ga0070662_100408917 Ga0070662_1004089172 129
801 3300005458 Ga0070681_10106407 Ga0070681_101064072 129
802 3300005458 Ga0070681_10340567 Ga0070681_103405672 129
803 3300005458 Ga0070681_10953723 Ga0070681_109537232 129
804 3300005459 Ga0068867_100825894 Ga0068867_1008258942 129
805 3300005466 Ga0070685_10075075 Ga0070685_100750752 129
806 3300005468 Ga0070707_100001273 Ga0070707_1000012732 129
807 3300005468 Ga0070707_100229384 Ga0070707_1002293842 129
808 3300005468 Ga0070707_100614955 Ga0070707_1006149552 129
809 3300005471 Ga0070698_100080693 Ga0070698_1000806931 129
810 3300005471 Ga0070698_100369945 Ga0070698_1003699452 129
811 3300005518 Ga0070699_100017340 Ga0070699_1000173407 129
812 3300005518 Ga0070699_100202651 Ga0070699_1002026512 129
813 3300005530 Ga0070679_100257226 Ga0070679_1002572263 129
814 3300005530 Ga0070679_100669022 Ga0070679_1006690222 129
815 3300005535 Ga0070684_100022436 Ga0070684_1000224363 129
816 3300005535 Ga0070684_100060992 Ga0070684_1000609922 129
817 3300005535 Ga0070684_100096502 Ga0070684_1000965022 129
818 3300005535 Ga0070684_100345260 Ga0070684_1003452602 129
819 3300005535 Ga0070684_101461788 Ga0070684_1014617881 129
820 3300005536 Ga0070697_100724611 Ga0070697_1007246112 129
821 3300005544 Ga0070686_100054962 Ga0070686_1000549622 129
822 3300005547 Ga0070693_100117597 Ga0070693_1001175972 129
823 3300005549 Ga0070704_100068675 Ga0070704_1000686753 129
824 3300005549 Ga0070704_100119001 Ga0070704_1001190013 129
825 3300005549 Ga0070704_101907819 Ga0070704_1019078191 129
826 3300005563 Ga0068855_100303314 Ga0068855_1003033142 129
827 3300005563 Ga0068855_100489373 Ga0068855_1004893731 129
828 3300005564 Ga0070664_100043775 Ga0070664_1000437753 129
829 3300005564 Ga0070664_101199042 Ga0070664_1011990422 129
830 3300005578 Ga0068854_100161151 Ga0068854_1001611513 129
831 3300005614 Ga0068856_100032829 Ga0068856_1000328292 129
832 3300005614 Ga0068856_100471326 Ga0068856_1004713262 129
833 3300005615 Ga0070702_100070325 Ga0070702_1000703252 129
834 3300005616 Ga0068852_100167134 Ga0068852_1001671341 129
835 3300005616 Ga0068852_100205689 Ga0068852_1002056892 129
836 3300005616 Ga0068852_100270589 Ga0068852_1002705892 129
837 3300005616 Ga0068852_100499749 Ga0068852_1004997492 129
838 3300005616 Ga0068852_100750985 Ga0068852_1007509852 129
839 3300005618 Ga0068864_100109160 Ga0068864_1001091601 129
840 3300005718 Ga0068866_10312987 Ga0068866_103129872 129
841 3300005718 Ga0068866_10390669 Ga0068866_103906691 129
842 3300005719 Ga0068861_100512278 Ga0068861_1005122782 129
843 3300005719 Ga0068861_100754712 Ga0068861_1007547122 129
844 3300005841 Ga0068863_100267834 Ga0068863_1002678342 129
845 3300005842 Ga0068858_100935786 Ga0068858_1009357862 129
846 3300005842 Ga0068858_101861045 Ga0068858_1018610451 129
847 3300005843 Ga0068860_100680659 Ga0068860_1006806592 129
848 3300005844 Ga0068862_100110596 Ga0068862_1001105962 129
849 3300005844 Ga0068862_100374309 Ga0068862_1003743092 129
850 3300005937 Ga0081455_10018043 Ga0081455_100180433 129
851 3300005937 Ga0081455_10035626 Ga0081455_100356268 129
852 3300005937 Ga0081455_10051210 Ga0081455_100512105 129
853 3300005981 Ga0081538_10009368 Ga0081538_100093684 129
854 3300005985 Ga0081539_10000041 Ga0081539_10000041167 129
855 3300005985 Ga0081539_10001492 Ga0081539_100014928 129
856 3300006028 Ga0070717_10068031 Ga0070717_100680312 129
857 3300006028 Ga0070717_11224238 Ga0070717_112242382 129
858 3300006038 Ga0075365_10641154 Ga0075365_106411542 129
859 3300006058 Ga0075432_10046823 Ga0075432_100468232 129
860 3300006163 Ga0070715_10001412 Ga0070715_100014125 129
861 3300006173 Ga0070716_100008206 Ga0070716_1000082062 129
862 3300006173 Ga0070716_100039655 Ga0070716_1000396552 129
863 3300006175 Ga0070712_100168592 Ga0070712_1001685922 129
864 3300006844 Ga0075428_100140630 Ga0075428_1001406302 129
865 3300006844 Ga0075428_100382459 Ga0075428_1003824592 129
866 3300006852 Ga0075433_10154539 Ga0075433_101545392 129
867 3300006852 Ga0075433_10994577 Ga0075433_109945771 129
868 3300006871 Ga0075434_100000658 Ga0075434_1000006583 129
869 3300006914 Ga0075436_100246696 Ga0075436_1002466962 129
870 3300006914 Ga0075436_100310183 Ga0075436_1003101831 129
871 3300007076 Ga0075435_101201960 Ga0075435_1012019602 129
872 3300009093 Ga0105240_10027830 Ga0105240_100278303 129
873 3300009093 Ga0105240_10034606 Ga0105240_100346065 129
874 3300009093 Ga0105240_11261509 Ga0105240_112615092 129
875 3300009094 Ga0111539_10006386 Ga0111539_100063868 129
876 3300009098 Ga0105245_10058267 Ga0105245_100582672 129
877 3300009098 Ga0105245_10121333 Ga0105245_101213332 129
878 3300009098 Ga0105245_10740445 Ga0105245_107404452 129
879 3300009098 Ga0105245_13206893 Ga0105245_132068931 129
880 3300009147 Ga0114129_10224533 Ga0114129_102245332 129
881 3300009147 Ga0114129_10409792 Ga0114129_104097921 129
882 3300009148 Ga0105243_10034858 Ga0105243_100348582 129
883 3300009148 Ga0105243_10156255 Ga0105243_101562552 129
884 3300009176 Ga0105242_10093405 Ga0105242_100934052 129
885 3300009176 Ga0105242_12954149 Ga0105242_129541491 129
886 3300009177 Ga0105248_10089715 Ga0105248_100897152 129
887 3300009177 Ga0105248_10091316 Ga0105248_100913163 129
888 3300009177 Ga0105248_10173539 Ga0105248_101735392 129
889 3300009177 Ga0105248_10193285 Ga0105248_101932854 129
890 3300009177 Ga0105248_11269132 Ga0105248_112691322 129
891 3300009545 Ga0105237_10429031 Ga0105237_104290312 129
892 3300009551 Ga0105238_10201435 Ga0105238_102014353 129
893 3300009551 Ga0105238_11594846 Ga0105238_115948462 129
894 3300009551 Ga0105238_11801124 Ga0105238_118011242 129
895 3300009553 Ga0105249_10064819 Ga0105249_100648194 129
896 3300009553 Ga0105249_12180856 Ga0105249_121808562 129
897 3300010375 Ga0105239_10368019 Ga0105239_103680192 129
898 3300010375 Ga0105239_10512250 Ga0105239_105122502 129
899 3300011119 Ga0105246_10071693 Ga0105246_100716932 129
900 3300011119 Ga0105246_10524451 Ga0105246_105244512 129
901 3300013100 Ga0157373_10134950 Ga0157373_101349502 129
902 3300013102 Ga0157371_11424977 Ga0157371_114249771 129
903 3300013104 Ga0157370_10010689 Ga0157370_100106894 129
904 3300013104 Ga0157370_10034654 Ga0157370_100346544 129
905 3300013104 Ga0157370_10609964 Ga0157370_106099642 129
906 3300013105 Ga0157369_10008456 Ga0157369_100084562 129
907 3300013105 Ga0157369_10065997 Ga0157369_100659972 129
908 3300013105 Ga0157369_10093513 Ga0157369_100935134 129
909 3300013105 Ga0157369_10263397 Ga0157369_102633972 129
910 3300013105 Ga0157369_10938459 Ga0157369_109384592 129
911 3300013105 Ga0157369_11727437 Ga0157369_117274372 129
912 3300013296 Ga0157374_10077705 Ga0157374_100777051 129
913 3300013297 Ga0157378_10764948 Ga0157378_107649482 129
914 3300013297 Ga0157378_12533198 Ga0157378_125331981 129
915 3300013306 Ga0163162_10531033 Ga0163162_105310332 129
916 3300013306 Ga0163162_10732642 Ga0163162_107326422 129
917 3300013307 Ga0157372_10620261 Ga0157372_106202612 129
918 3300013307 Ga0157372_11029246 Ga0157372_110292462 129
919 3300013307 Ga0157372_12709305 Ga0157372_127093052 129
920 3300013308 Ga0157375_10261155 Ga0157375_102611553 129
921 3300013308 Ga0157375_10977938 Ga0157375_109779382 129
922 3300014326 Ga0157380_10322759 Ga0157380_103227592 129
923 3300014497 Ga0182008_10002973 Ga0182008_100029732 129
924 3300014968 Ga0157379_10545386 Ga0157379_105453862 129
925 3300014968 Ga0157379_10597213 Ga0157379_105972132 129
926 3300014968 Ga0157379_10690976 Ga0157379_106909762 129
927 3300015261 Ga0182006_1119659 Ga0182006_11196592 129
928 3300015262 Ga0182007_10006035 Ga0182007_100060353 129
929 3300020069 Ga0197907_10946403 Ga0197907_109464033 129
930 3300020070 Ga0206356_10190868 Ga0206356_101908682 129
931 3300020070 Ga0206356_10775309 Ga0206356_107753092 129
932 3300020081 Ga0206354_11322551 Ga0206354_113225513 129
933 3300020082 Ga0206353_11257401 Ga0206353_112574012 129
934 3300020082 Ga0206353_11275272 Ga0206353_112752722 129
935 3300022467 Ga0224712_10060922 Ga0224712_100609222 129
936 3300025898 Ga0207692_10002750 Ga0207692_100027505 129
937 3300025899 Ga0207642_10781101 Ga0207642_107811012 129
938 3300025901 Ga0207688_10156409 Ga0207688_101564092 129
939 3300025901 Ga0207688_10749262 Ga0207688_107492622 129
940 3300025905 Ga0207685_10006220 Ga0207685_100062202 129
941 3300025905 Ga0207685_10096800 Ga0207685_100968002 129
942 3300025906 Ga0207699_10023919 Ga0207699_100239192 129
943 3300025906 Ga0207699_10033574 Ga0207699_100335742 129
944 3300025907 Ga0207645_10497317 Ga0207645_104973171 129
945 3300025912 Ga0207707_10016885 Ga0207707_100168855 129
946 3300025912 Ga0207707_10059662 Ga0207707_100596624 129
947 3300025912 Ga0207707_11104245 Ga0207707_111042452 129
948 3300025913 Ga0207695_10260370 Ga0207695_102603701 129
949 3300025915 Ga0207693_10002750 Ga0207693_1000275017 129
950 3300025915 Ga0207693_10262833 Ga0207693_102628332 129
951 3300025915 Ga0207693_10509434 Ga0207693_105094342 129
952 3300025916 Ga0207663_10012568 Ga0207663_100125682 129
953 3300025917 Ga0207660_10072386 Ga0207660_100723862 129
954 3300025917 Ga0207660_10092387 Ga0207660_100923872 129
955 3300025917 Ga0207660_10416490 Ga0207660_104164902 129
956 3300025919 Ga0207657_10018647 Ga0207657_100186471 129
957 3300025920 Ga0207649_10237672 Ga0207649_102376722 129
958 3300025920 Ga0207649_10720547 Ga0207649_107205472 129
959 3300025921 Ga0207652_10189191 Ga0207652_101891912 129
960 3300025921 Ga0207652_10603102 Ga0207652_106031022 129
961 3300025922 Ga0207646_10004655 Ga0207646_100046557 129
962 3300025922 Ga0207646_10389862 Ga0207646_103898622 129
963 3300025922 Ga0207646_11506019 Ga0207646_115060191 129
964 3300025923 Ga0207681_10801326 Ga0207681_108013262 129
965 3300025923 Ga0207681_11091154 Ga0207681_110911542 129
966 3300025924 Ga0207694_10223170 Ga0207694_102231702 129
967 3300025924 Ga0207694_11705133 Ga0207694_117051331 129
968 3300025927 Ga0207687_10343612 Ga0207687_103436122 129
969 3300025927 Ga0207687_10496140 Ga0207687_104961402 129
970 3300025927 Ga0207687_10836738 Ga0207687_108367382 129
971 3300025927 Ga0207687_11137319 Ga0207687_111373192 129
972 3300025928 Ga0207700_10000006 Ga0207700_100000068 129
973 3300025928 Ga0207700_10251063 Ga0207700_102510633 129
974 3300025929 Ga0207664_10019721 Ga0207664_100197212 129
975 3300025929 Ga0207664_10062624 Ga0207664_100626242 129
976 3300025929 Ga0207664_10136108 Ga0207664_101361083 129
977 3300025929 Ga0207664_10348297 Ga0207664_103482972 129
978 3300025929 Ga0207664_10350218 Ga0207664_103502182 129
979 3300025929 Ga0207664_10582250 Ga0207664_105822502 129
980 3300025929 Ga0207664_10979173 Ga0207664_109791731 129
981 3300025931 Ga0207644_11112199 Ga0207644_111121992 129
982 3300025932 Ga0207690_10068677 Ga0207690_100686772 129
983 3300025932 Ga0207690_10173447 Ga0207690_101734472 129
984 3300025932 Ga0207690_10527711 Ga0207690_105277112 129
985 3300025933 Ga0207706_10039583 Ga0207706_100395832 129
986 3300025933 Ga0207706_10693184 Ga0207706_106931841 129
987 3300025934 Ga0207686_10407898 Ga0207686_104078982 129
988 3300025935 Ga0207709_10718747 Ga0207709_107187471 129
989 3300025936 Ga0207670_10671152 Ga0207670_106711522 129
990 3300025937 Ga0207669_10335197 Ga0207669_103351972 129
991 3300025938 Ga0207704_11394087 Ga0207704_113940872 129
992 3300025939 Ga0207665_10000197 Ga0207665_1000019736 129
993 3300025939 Ga0207665_10006025 Ga0207665_100060257 129
994 3300025941 Ga0207711_10398559 Ga0207711_103985591 129
995 3300025941 Ga0207711_11745545 Ga0207711_117455452 129
996 3300025942 Ga0207689_10090667 Ga0207689_100906673 129
997 3300025942 Ga0207689_10799473 Ga0207689_107994731 129
998 3300025944 Ga0207661_10016534 Ga0207661_100165347 129
999 3300025944 Ga0207661_10203425 Ga0207661_102034252 129
1000 3300025945 Ga0207679_10225220 Ga0207679_102252202 129
1001 3300025945 Ga0207679_10559135 Ga0207679_105591352 129
1002 3300025949 Ga0207667_10087456 Ga0207667_100874564 129
1003 3300025949 Ga0207667_10945269 Ga0207667_109452691 129
1004 3300025961 Ga0207712_10096620 Ga0207712_100966202 129
1005 3300025961 Ga0207712_11268873 Ga0207712_112688732 129
1006 3300025972 Ga0207668_10141492 Ga0207668_101414922 129
1007 3300025972 Ga0207668_10463281 Ga0207668_104632812 129
1008 3300026023 Ga0207677_10242523 Ga0207677_102425232 129
1009 3300026023 Ga0207677_10307271 Ga0207677_103072712 129
1010 3300026035 Ga0207703_10848880 Ga0207703_108488802 129
1011 3300026035 Ga0207703_11194626 Ga0207703_111946262 129
1012 3300026041 Ga0207639_10310379 Ga0207639_103103792 129
1013 3300026075 Ga0207708_10000401 Ga0207708_1000040124 129
1014 3300026078 Ga0207702_10175004 Ga0207702_101750043 129
1015 3300026078 Ga0207702_12026453 Ga0207702_120264531 129
1016 3300026088 Ga0207641_11424824 Ga0207641_114248242 129
1017 3300026089 Ga0207648_10056981 Ga0207648_100569812 129
1018 3300026089 Ga0207648_10202256 Ga0207648_102022562 129
1019 3300026095 Ga0207676_10128618 Ga0207676_101286182 129
1020 3300026095 Ga0207676_10983666 Ga0207676_109836662 129
1021 3300026116 Ga0207674_10059933 Ga0207674_100599331 129
1022 3300026118 Ga0207675_100031122 Ga0207675_1000311222 129
1023 3300026118 Ga0207675_100692011 Ga0207675_1006920112 129
1024 3300026142 Ga0207698_10138311 Ga0207698_101383113 129
1025 3300027907 Ga0207428_10058290 Ga0207428_100582903 129
1026 3300028379 Ga0268266_12328963 Ga0268266_123289631 129
1027 3300028380 Ga0268265_10887929 Ga0268265_108879292 129
1028 3300028381 Ga0268264_10281664 Ga0268264_102816642 129
1029 3300028381 Ga0268264_10378617 Ga0268264_103786172 129
1030 3300028573 Ga0265334_10030125 Ga0265334_100301252 129
1031 3300028800 Ga0265338_10012586 Ga0265338_100125867 129
1032 3300031235 Ga0265330_10343947 Ga0265330_103439472 129
1033 3300031251 Ga0265327_10036784 Ga0265327_100367842 129
1034 3300031548 Ga0307408_100909912 Ga0307408_1009099122 129
1035 3300031595 Ga0265313_10023769 Ga0265313_100237692 129
1036 3300031731 Ga0307405_10074679 Ga0307405_100746792 129
1037 3300031824 Ga0307413_10140239 Ga0307413_101402392 129
1038 3300031824 Ga0307413_11488416 Ga0307413_114884162 129
1039 3300031852 Ga0307410_10284284 Ga0307410_102842841 129
1040 3300031901 Ga0307406_10034862 Ga0307406_100348622 129
1041 3300031901 Ga0307406_10041002 Ga0307406_100410022 129
1042 3300031901 Ga0307406_10109323 Ga0307406_101093231 129
1043 3300031911 Ga0307412_10143193 Ga0307412_101431933 129
1044 3300031995 Ga0307409_100047213 Ga0307409_1000472133 129
1045 3300031995 Ga0307409_100588128 Ga0307409_1005881282 129
1046 3300032002 Ga0307416_100001649 Ga0307416_1000016495 129
1047 3300032002 Ga0307416_100045351 Ga0307416_1000453514 129
1048 3300032002 Ga0307416_100064873 Ga0307416_1000648733 129
1049 3300032002 Ga0307416_100067528 Ga0307416_1000675284 129
1050 3300032002 Ga0307416_100770743 Ga0307416_1007707432 129
1051 3300032005 Ga0307411_11617103 Ga0307411_116171032 129
1052 3300032126 Ga0307415_100027955 Ga0307415_1000279552 129
1053 3300034816 Ga0373930_0111454 Ga0373930_0111454_69_461 129
1054 3300035084 Ga0373928_0018520 Ga0373928_0018520_340_735 129
1055 3300035085 Ga0373929_0095370 Ga0373929_0095370_330_725 129
1056 3300035090 Ga0373949_0018814 Ga0373949_0018814_555_950 129
1057 3300035115 Ga0373941_0096503 Ga0373941_0096503_12_407 129
1058 3300035121 Ga0373960_0108813 Ga0373960_0108813_217_612 129
1059 3300035170 Ga0373943_0320992 Ga0373943_0320992_395_787 129
1060 3300035207 Ga0373942_0293390 Ga0373942_0293390_40_435 129
1061 3300035241 Ga0373961_0131613 Ga0373961_0131613_399_794 129
1062 3300035241 Ga0373961_0161275 Ga0373961_0161275_166_561 129
1063 3300035691 Ga0373931_1017946 Ga0373931_1017946_105_500 129
1064 3300035725 Ga0373947_0718619 Ga0373947_0718619_61_453 129
1065 3300037068 Ga0373925_0633992 Ga0373925_0633992_337_729 129
1066 3300037312 Ga0395899_0089078 Ga0395899_0089078_1510_1905 129
1067 3300037312 Ga0395899_0276892 Ga0395899_0276892_575_970 129
1068 3300037312 Ga0395899_0948246 Ga0395899_0948246_78_473 129
1069 3300037418 Ga0395900_0009778 Ga0395900_0009778_1419_1814 129
1070 3300037418 Ga0395900_0253277 Ga0395900_0253277_1279_1671 129
1071 3300037418 Ga0395900_0313222 Ga0395900_0313222_820_1215 129
1072 3300037418 Ga0395900_0368436 Ga0395900_0368436_94_489 129
1073 3300037418 Ga0395900_0809613 Ga0395900_0809613_103_498 129
1074 3300037418 Ga0395900_1045940 Ga0395900_1045940_53_451 129
1075 3300037418 Ga0395900_1456310 Ga0395900_1456310_92_487 129
1076 3300037466 Ga0395898_0060783 Ga0395898_0060783_687_1079 129
1077 3300037466 Ga0395898_0186222 Ga0395898_0186222_384_779 129
1078 3300037471 Ga0395905_0292225 Ga0395905_0292225_1011_1406 129
1079 3300037471 Ga0395905_0441870 Ga0395905_0441870_232_627 129
1080 3300037471 Ga0395905_0911438 Ga0395905_0911438_160_558 129
1081 3300037471 Ga0395905_1085209 Ga0395905_1085209_289_684 129
1082 3300038443 Ga0395901_0008234 Ga0395901_0008234_7842_8237 129
1083 3300038443 Ga0395901_0548828 Ga0395901_0548828_564_956 129
1084 3300038443 Ga0395901_0570974 Ga0395901_0570974_577_972 129
1085 3300038443 Ga0395901_0617688 Ga0395901_0617688_260_655 129
1086 3300038443 Ga0395901_0690598 Ga0395901_0690598_451_846 129
1087 3300038443 Ga0395901_1422656 Ga0395901_1422656_140_538 129
1088 3300041410 Ga0439461_0007396 Ga0439461_0007396_661_1056 129
1089 3300041411 Ga0439466_0088489 Ga0439466_0088489_17_412 129
1090 3300042008 Ga0439450_081408 Ga0439450_081408_294_689 129
1091 3300042118 Ga0450914_039156 Ga0450914_039156_73_468 129
1092 3300042125 Ga0450923_098142 Ga0450923_098142_92_487 129
1093 3300042125 Ga0450923_185270 Ga0450923_185270_57_452 129
1094 3300042147 Ga0450910_034289 Ga0450910_034289_161_556 129
1095 3300042156 Ga0439446_0018458 Ga0439446_0018458_609_1004 129
1096 3300044656 Ga0466969_0001820 Ga0466969_0001820_5717_6112 129
1097 3300044684 Ga0466966_0032230 Ga0466966_0032230_2353_2745 129
1098 3300044684 Ga0466966_0034581 Ga0466966_0034581_1481_1876 129
1099 3300044693 Ga0466961_0006902 Ga0466961_0006902_1626_2018 129
1100 3300044693 Ga0466961_0619934 Ga0466961_0619934_84_479 129
1101 3300044694 Ga0466963_0000518 Ga0466963_0000518_17200_17595 129
1102 3300044694 Ga0466963_0006212 Ga0466963_0006212_6402_6794 129
1103 3300044694 Ga0466963_0029137 Ga0466963_0029137_294_689 129
1104 3300044694 Ga0466963_0054477 Ga0466963_0054477_1804_2196 129
1105 3300044694 Ga0466963_0243073 Ga0466963_0243073_123_518 129
1106 3300044694 Ga0466963_1138189 Ga0466963_1138189_26_421 129
1107 3300044706 Ga0466964_0004479 Ga0466964_0004479_2088_2480 129
1108 3300044706 Ga0466964_0111577 Ga0466964_0111577_397_789 129
1109 3300044706 Ga0466964_0138114 Ga0466964_0138114_567_962 129
1110 3300044706 Ga0466964_0173822 Ga0466964_0173822_397_789 129
1111 3300044719 Ga0466971_0113162 Ga0466971_0113162_238_630 129
1112 3300044719 Ga0466971_0159258 Ga0466971_0159258_202_597 129
1113 3300044735 Ga0466968_0012530 Ga0466968_0012530_2360_2755 129
1114 3300044735 Ga0466968_0030579 Ga0466968_0030579_460_852 129
1115 3300044735 Ga0466968_0036551 Ga0466968_0036551_10_402 129
1116 3300044765 Ga0466970_0005115 Ga0466970_0005115_1392_1787 129
1117 3300044765 Ga0466970_0305978 Ga0466970_0305978_416_811 129
1118 3300044765 Ga0466970_0630873 Ga0466970_0630873_121_513 129
1119 3300044842 Ga0466957_0025050 Ga0466957_0025050_1826_2218 129
1120 3300044842 Ga0466957_0052988 Ga0466957_0052988_67_462 129
1121 3300044842 Ga0466957_0076729 Ga0466957_0076729_1455_1850 129
1122 3300044842 Ga0466957_0112564 Ga0466957_0112564_77_472 129
1123 3300044842 Ga0466957_1351809 Ga0466957_1351809_95_490 129
1124 3300044901 Ga0466960_0300422 Ga0466960_0300422_462_857 129
1125 3300045049 Ga0466959_0009634 Ga0466959_0009634_5286_5678 129
1126 3300045049 Ga0466959_0018185 Ga0466959_0018185_2901_3296 129
1127 3300045836 Ga0466958_0054700 Ga0466958_0054700_383_775 129
1128 3300045836 Ga0466958_0064819 Ga0466958_0064819_1423_1815 129
1129 3300045836 Ga0466958_0149939 Ga0466958_0149939_1068_1460 129
1130 3300045836 Ga0466958_0184486 Ga0466958_0184486_736_1128 129
1131 3300045836 Ga0466958_0198116 Ga0466958_0198116_422_817 129
1132 3300045836 Ga0466958_0261874 Ga0466958_0261874_438_833 129
1133 3300045976 Ga0466967_0012538 Ga0466967_0012538_311_703 129
1134 3300045976 Ga0466967_0021821 Ga0466967_0021821_4358_4750 129
1135 3300045976 Ga0466967_0023035 Ga0466967_0023035_2143_2538 129
1136 3300045976 Ga0466967_0131348 Ga0466967_0131348_694_1107 129
1137 3300045976 Ga0466967_0208616 Ga0466967_0208616_1055_1447 129
1138 3300045976 Ga0466967_0275510 Ga0466967_0275510_1053_1448 129
1139 3300045976 Ga0466967_0369390 Ga0466967_0369390_721_1116 129
1140 3300045976 Ga0466967_0426393 Ga0466967_0426393_297_692 129
1141 3300045976 Ga0466967_0806354 Ga0466967_0806354_496_891 129
1142 3300045976 Ga0466967_1351928 Ga0466967_1351928_260_652 129
1143 3300045976 Ga0466967_2119790 Ga0466967_2119790_65_457 129
1144 3300046454 Ga0495592_0005696 Ga0495592_0005696_6974_7369 129
1145 3300046454 Ga0495592_0046693 Ga0495592_0046693_2669_3061 129
1146 3300046455 Ga0495603_0013278 Ga0495603_0013278_2425_2817 129
1147 3300046457 Ga0495590_0116513 Ga0495590_0116513_531_926 129
1148 3300046459 Ga0495629_0003233 Ga0495629_0003233_515_910 129
1149 3300046461 Ga0495641_0174446 Ga0495641_0174446_558_950 129
1150 3300046462 Ga0495651_0022741 Ga0495651_0022741_1367_1762 129
1151 3300046463 Ga0495653_0146754 Ga0495653_0146754_152_547 129
1152 3300046473 Ga0495582_0010487 Ga0495582_0010487_3105_3500 129
1153 3300046473 Ga0495582_0054854 Ga0495582_0054854_1580_1972 129
1154 3300046473 Ga0495582_0817904 Ga0495582_0817904_27_419 129
1155 3300046474 Ga0495605_0016394 Ga0495605_0016394_661_1056 129
1156 3300046474 Ga0495605_0169453 Ga0495605_0169453_375_767 129
1157 3300046477 Ga0495664_0154579 Ga0495664_0154579_878_1273 129
1158 3300046491 Ga0495584_0031793 Ga0495584_0031793_1647_2039 129
1159 3300046491 Ga0495584_0200937 Ga0495584_0200937_23_418 129
1160 3300046491 Ga0495584_0378151 Ga0495584_0378151_16_411 129
1161 3300046492 Ga0495585_0017067 Ga0495585_0017067_2128_2520 129
1162 3300046499 Ga0495594_0400628 Ga0495594_0400628_337_729 129
1163 3300046500 Ga0495596_0138807 Ga0495596_0138807_295_690 129
1164 3300046500 Ga0495596_0325474 Ga0495596_0325474_99_491 129
1165 3300046501 Ga0495607_0251417 Ga0495607_0251417_225_620 129
1166 3300046511 Ga0495608_0021667 Ga0495608_0021667_1164_1556 129
1167 3300046511 Ga0495608_0624621 Ga0495608_0624621_83_478 129
1168 3300046514 Ga0495618_0246571 Ga0495618_0246571_149_544 129
1169 3300046516 Ga0495628_0421896 Ga0495628_0421896_328_720 129
1170 3300046517 Ga0495630_0154549 Ga0495630_0154549_1215_1610 129
1171 3300046518 Ga0495631_0143877 Ga0495631_0143877_47_442 129
1172 3300046518 Ga0495631_0176074 Ga0495631_0176074_264_659 129
1173 3300046520 Ga0495637_0284060 Ga0495637_0284060_82_477 129
1174 3300046522 Ga0495643_0110411 Ga0495643_0110411_970_1365 129
1175 3300046523 Ga0495644_0003055 Ga0495644_0003055_1666_2058 129
1176 3300046523 Ga0495644_0330386 Ga0495644_0330386_103_498 129
1177 3300046525 Ga0495663_0011608 Ga0495663_0011608_847_1239 129
1178 3300046525 Ga0495663_0053064 Ga0495663_0053064_797_1192 129
1179 3300046528 Ga0495642_0028858 Ga0495642_0028858_1741_2133 129
1180 3300046529 Ga0495652_0052130 Ga0495652_0052130_893_1285 129
1181 3300046529 Ga0495652_0249973 Ga0495652_0249973_276_671 129
1182 3300046533 Ga0495640_0023975 Ga0495640_0023975_741_1136 129
1183 3300046536 Ga0495587_0039817 Ga0495587_0039817_825_1220 129
1184 3300046539 Ga0495621_0007874 Ga0495621_0007874_1220_1615 129
1185 3300046539 Ga0495621_0165408 Ga0495621_0165408_324_716 129
1186 3300046542 Ga0495597_0037372 Ga0495597_0037372_1176_1571 129
1187 3300046543 Ga0495645_0131449 Ga0495645_0131449_1344_1739 129
1188 3300046559 Ga0495667_0217753 Ga0495667_0217753_684_1076 129
1189 3300046559 Ga0495667_0307918 Ga0495667_0307918_34_429 129
1190 3300046559 Ga0495667_0880139 Ga0495667_0880139_145_540 129
1191 3300046615 Ga0495656_0072590 Ga0495656_0072590_1122_1514 129
1192 3300046615 Ga0495656_0579955 Ga0495656_0579955_74_466 129
1193 3300046615 Ga0495656_0824271 Ga0495656_0824271_77_487 129
1194 3300046642 Ga0495634_0242676 Ga0495634_0242676_109_504 129
1195 3300046648 Ga0495611_0073600 Ga0495611_0073600_442_837 129
1196 3300046648 Ga0495611_0475971 Ga0495611_0475971_111_503 129
1197 3300046663 Ga0495635_0158161 Ga0495635_0158161_993_1385 129
1198 3300046664 Ga0495659_0029557 Ga0495659_0029557_352_747 129
1199 3300046664 Ga0495659_0061690 Ga0495659_0061690_474_866 129
1200 3300046664 Ga0495659_0341468 Ga0495659_0341468_38_430 129
1201 3300046665 Ga0495661_0069750 Ga0495661_0069750_410_802 129
1202 3300046675 Ga0495657_0605798 Ga0495657_0605798_49_444 129
1203 3300046678 Ga0495599_0003982 Ga0495599_0003982_4016_4411 129
1204 3300046678 Ga0495599_0747782 Ga0495599_0747782_129_524 129
1205 3300046689 Ga0495613_0007635 Ga0495613_0007635_460_855 129
1206 3300046689 Ga0495613_0637682 Ga0495613_0637682_261_653 129
1207 3300046690 Ga0495624_0371590 Ga0495624_0371590_415_810 129
1208 3300046690 Ga0495624_0577208 Ga0495624_0577208_109_501 129
1209 3300046690 Ga0495624_0818820 Ga0495624_0818820_112_504 129
1210 3300046691 Ga0495670_0771147 Ga0495670_0771147_94_489 129
1211 3300046692 Ga0495671_0056512 Ga0495671_0056512_767_1162 129
1212 3300046794 Ga0495589_0369902 Ga0495589_0369902_218_613 129
1213 3300046809 Ga0495600_0092702 Ga0495600_0092702_1396_1791 129
1214 3300046809 Ga0495600_0115302 Ga0495600_0115302_46_441 129
1215 3300046809 Ga0495600_0385074 Ga0495600_0385074_121_513 129
1216 3300046809 Ga0495600_0858672 Ga0495600_0858672_65_460 129
1217 3300047317 Ga0495604_0204119 Ga0495604_0204119_126_521 129
1218 3300047319 Ga0495674_0186156 Ga0495674_0186156_861_1256 129
1219 3300047321 Ga0495676_0098246 Ga0495676_0098246_1330_1722 129
1220 3300047322 Ga0495680_0082261 Ga0495680_0082261_1692_2087 129
1221 3300047322 Ga0495680_1038008 Ga0495680_1038008_26_469 129
1222 3300047323 Ga0495683_0050698 Ga0495683_0050698_1250_1645 129
1223 3300047444 Ga0495675_0586130 Ga0495675_0586130_228_623 129
1224 3300047445 Ga0495677_0157117 Ga0495677_0157117_218_613 129
1225 3300047470 Ga0495681_0079155 Ga0495681_0079155_871_1266 129
1226 3300047471 Ga0495684_0033445 Ga0495684_0033445_1715_2110 129
1227 3300047471 Ga0495684_0073985 Ga0495684_0073985_121_516 129
1228 3300047471 Ga0495684_0104783 Ga0495684_0104783_516_908 129
1229 3300047471 Ga0495684_0283064 Ga0495684_0283064_297_692 129
1230 3300048088 Ga0495602_0244323 Ga0495602_0244323_934_1326 129
1231 3300048091 Ga0495626_0121233 Ga0495626_0121233_248_643 129
1232 3300048091 Ga0495626_0146798 Ga0495626_0146798_229_621 129
1233 3300048091 Ga0495626_0246558 Ga0495626_0246558_300_695 129
1234 3300048903 Ga0496100_0015416 Ga0496100_0015416_1230_1625 129
1235 3300048904 Ga0496101_0023909 Ga0496101_0023909_1699_2094 129
1236 3300048904 Ga0496101_0076021 Ga0496101_0076021_1174_1566 129
1237 3300048904 Ga0496101_0371169 Ga0496101_0371169_451_843 129
1238 3300048904 Ga0496101_0627147 Ga0496101_0627147_168_590 129
1239 3300048905 Ga0496102_0005223 Ga0496102_0005223_9429_9824 129
1240 3300048905 Ga0496102_0590471 Ga0496102_0590471_425_820 129
1241 3300048905 Ga0496102_0916695 Ga0496102_0916695_222_644 129
1242 3300048905 Ga0496102_1019694 Ga0496102_1019694_234_626 129
1243 3300048906 Ga0496103_0011456 Ga0496103_0011456_2307_2702 129
1244 3300048907 Ga0496104_0000977 Ga0496104_0000977_18069_18461 129
1245 3300048907 Ga0496104_0183359 Ga0496104_0183359_464_859 129
1246 3300048907 Ga0496104_0703619 Ga0496104_0703619_335_727 129
1247 3300048908 Ga0496105_0000926 Ga0496105_0000926_2003_2395 129
1248 3300048908 Ga0496105_0006724 Ga0496105_0006724_4337_4732 129
1249 3300048908 Ga0496105_0250294 Ga0496105_0250294_174_608 129
1250 3300048908 Ga0496105_0960179 Ga0496105_0960179_131_526 129
1251 3300048909 Ga0496106_0015040 Ga0496106_0015040_2698_3093 129
1252 3300048909 Ga0496106_0069904 Ga0496106_0069904_404_796 129
1253 3300048910 Ga0496107_0002059 Ga0496107_0002059_10542_10937 129
1254 3300048910 Ga0496107_0155304 Ga0496107_0155304_1075_1467 129
1255 3300048910 Ga0496107_0185118 Ga0496107_0185118_522_944 129
1256 3300048910 Ga0496107_0342225 Ga0496107_0342225_625_1020 129
1257 3300048911 Ga0496108_0007929 Ga0496108_0007929_7022_7417 129
1258 3300048911 Ga0496108_0009090 Ga0496108_0009090_2581_2976 129
1259 3300048911 Ga0496108_0019843 Ga0496108_0019843_4973_5365 129
1260 3300048911 Ga0496108_0026913 Ga0496108_0026913_28_420 129
1261 3300048911 Ga0496108_0158529 Ga0496108_0158529_843_1277 129
1262 3300048911 Ga0496108_1334941 Ga0496108_1334941_24_416 129
1263 3300048912 Ga0496109_0001789 Ga0496109_0001789_1058_1450 129
1264 3300048912 Ga0496109_0011154 Ga0496109_0011154_2504_2899 129
1265 3300048912 Ga0496109_0033432 Ga0496109_0033432_2806_3198 129
1266 3300048912 Ga0496109_0101175 Ga0496109_0101175_1939_2334 129
1267 3300048912 Ga0496109_0164918 Ga0496109_0164918_1401_1793 129
1268 3300048912 Ga0496109_0350589 Ga0496109_0350589_69_503 129
1269 3300048913 Ga0496110_0000862 Ga0496110_0000862_10701_11096 129
1270 3300048913 Ga0496110_0043887 Ga0496110_0043887_2477_2872 129
1271 3300048913 Ga0496110_0136621 Ga0496110_0136621_1728_2120 129
1272 3300048914 Ga0496111_0019214 Ga0496111_0019214_717_1112 129
1273 3300048914 Ga0496111_0036168 Ga0496111_0036168_489_884 129
1274 3300048914 Ga0496111_0090762 Ga0496111_0090762_1822_2214 129
1275 3300048915 Ga0496112_0574212 Ga0496112_0574212_159_551 129
1276 3300048915 Ga0496112_1139787 Ga0496112_1139787_152_574 129
1277 3300048916 Ga0496113_0024226 Ga0496113_0024226_2738_3133 129
1278 3300048916 Ga0496113_0024406 Ga0496113_0024406_79_471 129
1279 3300048916 Ga0496113_0450835 Ga0496113_0450835_53_448 129
1280 3300048917 Ga0496114_0045607 Ga0496114_0045607_2165_2560 129
1281 3300048917 Ga0496114_0418977 Ga0496114_0418977_573_965 129
1282 3300048917 Ga0496114_0657692 Ga0496114_0657692_127_519 129
1283 3300048918 Ga0496115_0010558 Ga0496115_0010558_4353_4748 129
1284 3300048918 Ga0496115_0328691 Ga0496115_0328691_137_529 129
1285 3300048918 Ga0496115_0563343 Ga0496115_0563343_144_536 129
1286 3300049568 Ga0501031_0000073 Ga0501031_0000073_7469_7867 129
1287 3300049569 Ga0501032_0002296 Ga0501032_0002296_9164_9562 129
1288 3300049569 Ga0501032_0107287 Ga0501032_0107287_484_882 129
1289 3300049570 Ga0501033_0000257 Ga0501033_0000257_1312_1710 129
1290 3300049570 Ga0501033_0506697 Ga0501033_0506697_24_422 129
1291 3300049571 Ga0501034_0005355 Ga0501034_0005355_1808_2206 129
1292 3300049571 Ga0501034_0125759 Ga0501034_0125759_1850_2245 129
1293 3300049571 Ga0501034_0217575 Ga0501034_0217575_1150_1542 129
1294 3300049571 Ga0501034_0300705 Ga0501034_0300705_794_1192 129
1295 3300049572 Ga0501036_0000089 Ga0501036_0000089_8088_8486 129
1296 3300049572 Ga0501036_0002139 Ga0501036_0002139_663_1061 129
1297 3300049572 Ga0501036_0219010 Ga0501036_0219010_812_1210 129
1298 3300049573 Ga0501037_0000070 Ga0501037_0000070_13794_14192 129
1299 3300049573 Ga0501037_0157598 Ga0501037_0157598_254_652 129
1300 3300049573 Ga0501037_0219746 Ga0501037_0219746_17_415 129
1301 3300049574 Ga0501038_0000082 Ga0501038_0000082_63807_64205 129
1302 3300049574 Ga0501038_0202017 Ga0501038_0202017_357_755 129
1303 3300049575 Ga0501039_0000077 Ga0501039_0000077_37268_37666 129
1304 3300049575 Ga0501039_0036740 Ga0501039_0036740_152_550 129
1305 3300049575 Ga0501039_0308197 Ga0501039_0308197_689_1087 129
1306 3300049576 Ga0501040_0000048 Ga0501040_0000048_19471_19869 129
1307 3300049576 Ga0501040_0000749 Ga0501040_0000749_5602_6000 129
1308 3300049576 Ga0501040_0083189 Ga0501040_0083189_145_543 129
1309 3300049576 Ga0501040_0115221 Ga0501040_0115221_329_724 129
1310 3300049576 Ga0501040_0160014 Ga0501040_0160014_301_699 129
1311 3300049577 Ga0501041_0000007 Ga0501041_0000007_9116_9514 129
1312 3300049577 Ga0501041_0004133 Ga0501041_0004133_1331_1729 129
1313 3300049577 Ga0501041_0121638 Ga0501041_0121638_397_795 129
1314 3300049578 Ga0501042_0000329 Ga0501042_0000329_17661_18059 129
1315 3300049578 Ga0501042_0011968 Ga0501042_0011968_557_955 129
1316 3300049578 Ga0501042_0109159 Ga0501042_0109159_224_622 129
1317 3300049578 Ga0501042_0174777 Ga0501042_0174777_767_1165 129
1318 3300049579 Ga0501043_0000208 Ga0501043_0000208_37660_38058 129
1319 3300049579 Ga0501043_0293164 Ga0501043_0293164_103_495 129
1320 3300049579 Ga0501043_0812609 Ga0501043_0812609_24_422 129
1321 3300049580 Ga0501046_0000089 Ga0501046_0000089_63747_64145 129
1322 3300049580 Ga0501046_0001637 Ga0501046_0001637_12271_12669 129
1323 3300049580 Ga0501046_0436544 Ga0501046_0436544_348_746 129
1324 3300049581 Ga0501047_0000237 Ga0501047_0000237_24687_25085 129
1325 3300049581 Ga0501047_0303384 Ga0501047_0303384_631_1023 129
1326 3300049581 Ga0501047_0944300 Ga0501047_0944300_24_422 129
1327 3300049582 Ga0501048_0001295 Ga0501048_0001295_9620_10018 129
1328 3300049582 Ga0501048_0001477 Ga0501048_0001477_9723_10121 129
1329 3300049582 Ga0501048_0209983 Ga0501048_0209983_660_1058 129
1330 3300049583 Ga0501067_0083985 Ga0501067_0083985_1093_1491 129
1331 3300049583 Ga0501067_0500985 Ga0501067_0500985_125_520 129
1332 3300049584 Ga0501068_0000736 Ga0501068_0000736_6049_6447 129
1333 3300049584 Ga0501068_0108749 Ga0501068_0108749_968_1366 129
1334 3300049585 Ga0501069_0000139 Ga0501069_0000139_6962_7360 129
1335 3300049585 Ga0501069_0030264 Ga0501069_0030264_1970_2368 129
1336 3300049585 Ga0501069_0086386 Ga0501069_0086386_871_1263 129
1337 3300049585 Ga0501069_0415468 Ga0501069_0415468_92_484 129
1338 3300049586 Ga0501070_0005427 Ga0501070_0005427_945_1343 129
1339 3300049586 Ga0501070_0005438 Ga0501070_0005438_5161_5556 129
1340 3300049586 Ga0501070_0083056 Ga0501070_0083056_724_1122 129
1341 3300049587 Ga0501071_0000004 Ga0501071_0000004_8105_8503 129
1342 3300049587 Ga0501071_0003480 Ga0501071_0003480_709_1107 129
1343 3300049588 Ga0501072_0000805 Ga0501072_0000805_7988_8386 129
1344 3300049588 Ga0501072_0002135 Ga0501072_0002135_249_647 129
1345 3300049588 Ga0501072_0020426 Ga0501072_0020426_64_459 129
1346 3300049589 Ga0501073_0001338 Ga0501073_0001338_6431_6829 129
1347 3300049589 Ga0501073_0065332 Ga0501073_0065332_1675_2070 129
1348 3300049589 Ga0501073_0183431 Ga0501073_0183431_83_481 129
1349 3300049589 Ga0501073_0231320 Ga0501073_0231320_66_458 129
1350 3300049589 Ga0501073_1240842 Ga0501073_1240842_42_437 129
1351 3300049590 Ga0501074_0000002 Ga0501074_0000002_47549_47947 129
1352 3300049590 Ga0501074_0001932 Ga0501074_0001932_5110_5508 129
1353 3300049590 Ga0501074_0028709 Ga0501074_0028709_1198_1593 129
1354 3300049590 Ga0501074_0036902 Ga0501074_0036902_2514_2909 129
1355 3300049590 Ga0501074_0133508 Ga0501074_0133508_37_435 129
1356 3300049590 Ga0501074_0729608 Ga0501074_0729608_88_486 129
1357 3300049591 Ga0501075_0001346 Ga0501075_0001346_9887_10285 129
1358 3300049591 Ga0501075_0013626 Ga0501075_0013626_2995_3393 129
1359 3300049592 Ga0501076_0000246 Ga0501076_0000246_17325_17723 129
1360 3300049592 Ga0501076_0000918 Ga0501076_0000918_13153_13551 129
1361 3300049592 Ga0501076_0271618 Ga0501076_0271618_648_1046 129
1362 3300049593 Ga0501077_0000090 Ga0501077_0000090_9041_9439 129
1363 3300049593 Ga0501077_0113917 Ga0501077_0113917_1063_1461 129
1364 3300049741 Ga0501079_0000679 Ga0501079_0000679_16856_17254 129
1365 3300049741 Ga0501079_0005129 Ga0501079_0005129_557_955 129
1366 3300049741 Ga0501079_0027160 Ga0501079_0027160_1883_2278 129
1367 3300049741 Ga0501079_0035594 Ga0501079_0035594_3397_3795 129
1368 3300049741 Ga0501079_1149040 Ga0501079_1149040_80_475 129
1369 3300049742 Ga0501080_0001053 Ga0501080_0001053_937_1335 129
1370 3300049742 Ga0501080_0024351 Ga0501080_0024351_3170_3565 129
1371 3300049742 Ga0501080_0199453 Ga0501080_0199453_1269_1661 129
1372 3300049742 Ga0501080_0267478 Ga0501080_0267478_798_1193 129
1373 3300049742 Ga0501080_0362719 Ga0501080_0362719_835_1227 129
1374 3300049742 Ga0501080_0413440 Ga0501080_0413440_24_422 129
1375 3300049743 Ga0501081_0000112 Ga0501081_0000112_19320_19718 129
1376 3300049743 Ga0501081_0000598 Ga0501081_0000598_9116_9514 129
1377 3300049743 Ga0501081_0020553 Ga0501081_0020553_3685_4083 129
1378 3300049744 Ga0501083_0000183 Ga0501083_0000183_31869_32267 129
1379 3300049744 Ga0501083_0044254 Ga0501083_0044254_968_1366 129
1380 3300049822 Ga0501035_0001595 Ga0501035_0001595_14565_14963 129
1381 3300049822 Ga0501035_0254067 Ga0501035_0254067_254_652 129
1382 3300049823 Ga0501044_0008307 Ga0501044_0008307_3843_4241 129
1383 3300049823 Ga0501044_0046956 Ga0501044_0046956_3103_3501 129
1384 3300049823 Ga0501044_1423496 Ga0501044_1423496_33_425 129
1385 3300049824 Ga0501045_0000014 Ga0501045_0000014_64986_65384 129
1386 3300049824 Ga0501045_0017934 Ga0501045_0017934_3612_4010 129
1387 3300049824 Ga0501045_0071003 Ga0501045_0071003_485_883 129
1388 3300050507 nmdc:mga05p37_1212807_c1 nmdc:mga05p37_1212807_c1_34_429 129
1389 3300050511 nmdc:mga08y16_24862_c1 nmdc:mga08y16_24862_c1_1522_1917 129
1390 3300050511 nmdc:mga08y16_399205_c1 nmdc:mga08y16_399205_c1_657_1049 129
1391 3300050512 nmdc:mga0n895_375224_c1 nmdc:mga0n895_375224_c1_599_994 129
1392 3300050512 nmdc:mga0n895_7957_c1 nmdc:mga0n895_7957_c1_899_1291 129
1393 3300050513 nmdc:mga0rr50_108472_c1 nmdc:mga0rr50_108472_c1_1777_2169 129
1394 3300050514 nmdc:mga08x19_200699_c1 nmdc:mga08x19_200699_c1_721_1113 129
1395 3300050514 nmdc:mga08x19_271148_c1 nmdc:mga08x19_271148_c1_49_447 129
1396 3300050515 nmdc:mga0a205_190057_c1 nmdc:mga0a205_190057_c1_1169_1561 129
1397 3300053077 Ga0495601_0021067 Ga0495601_0021067_2612_3007 129
1398 3300053083 Ga0495655_0003652 Ga0495655_0003652_1410_1805 129
1399 3300053084 Ga0495595_0167419 Ga0495595_0167419_636_1031 129
1400 3300053085 Ga0495619_0262440 Ga0495619_0262440_20_415 129
1401 3300053085 Ga0495619_0287627 Ga0495619_0287627_189_584 129
1402 3300053085 Ga0495619_0369575 Ga0495619_0369575_155_547 129
1403 3300054114 Ga0501084_0000332 Ga0501084_0000332_14764_15162 129
1404 3300054114 Ga0501084_0002377 Ga0501084_0002377_5621_6019 129
1405 3300054114 Ga0501084_0336734 Ga0501084_0336734_847_1245 129
1406 3300054114 Ga0501084_0528896 Ga0501084_0528896_294_689 129
1407 3300054114 Ga0501084_1058165 Ga0501084_1058165_103_501 129
1408 3300054114 Ga0501084_1752400 Ga0501084_1752400_42_437 129
1409 3300059424 Ga0590075_021938 Ga0590075_021938_867_1265 129
1410 3300060353 Ga0501082_0000241 Ga0501082_0000241_36400_36798 129
1411 3300060353 Ga0501082_0006933 Ga0501082_0006933_5037_5435 129
1412 3300060353 Ga0501082_0094066 Ga0501082_0094066_496_894 129
1413 3300060353 Ga0501082_0179627 Ga0501082_0179627_467_865 129
1414 3300060353 Ga0501082_1441278 Ga0501082_1441278_143_538 129
1415 3300061719 Ga0466962_0008111 Ga0466962_0008111_4413_4805 129
1416 3300061719 Ga0466962_0028718 Ga0466962_0028718_1882_2277 129
1417 3300061719 Ga0466962_0081444 Ga0466962_0081444_985_1380 129
1418 3300061719 Ga0466962_0347324 Ga0466962_0347324_117_509 129
1419 3300061734 Ga0530510_0000299 Ga0530510_0000299_22411_22809 129
1420 3300061734 Ga0530510_0003553 Ga0530510_0003553_616_1014 129
1421 3300005329 Ga0070683_100011298 Ga0070683_1000112987 130
1422 3300005329 Ga0070683_100457846 Ga0070683_1004578462 130
1423 3300005330 Ga0070690_100063794 Ga0070690_1000637942 130
1424 3300005334 Ga0068869_100712624 Ga0068869_1007126242 130
1425 3300005335 Ga0070666_10538123 Ga0070666_105381231 130
1426 3300005336 Ga0070680_100079913 Ga0070680_1000799133 130
1427 3300005338 Ga0068868_100150429 Ga0068868_1001504292 130
1428 3300005338 Ga0068868_100353712 Ga0068868_1003537122 130
1429 3300005339 Ga0070660_100110648 Ga0070660_1001106482 130
1430 3300005339 Ga0070660_100335750 Ga0070660_1003357502 130
1431 3300005341 Ga0070691_10076600 Ga0070691_100766002 130
1432 3300005341 Ga0070691_10090806 Ga0070691_100908063 130
1433 3300005345 Ga0070692_10024902 Ga0070692_100249023 130
1434 3300005347 Ga0070668_100035438 Ga0070668_1000354383 130
1435 3300005347 Ga0070668_100166121 Ga0070668_1001661212 130
1436 3300005353 Ga0070669_100571015 Ga0070669_1005710152 130
1437 3300005355 Ga0070671_100145151 Ga0070671_1001451512 130
1438 3300005356 Ga0070674_100119027 Ga0070674_1001190272 130
1439 3300005364 Ga0070673_100418319 Ga0070673_1004183192 130
1440 3300005365 Ga0070688_100207580 Ga0070688_1002075802 130
1441 3300005366 Ga0070659_100650693 Ga0070659_1006506932 130
1442 3300005406 Ga0070703_10255015 Ga0070703_102550152 130
1443 3300005434 Ga0070709_10486002 Ga0070709_104860022 130
1444 3300005435 Ga0070714_100010799 Ga0070714_1000107995 130
1445 3300005436 Ga0070713_100083973 Ga0070713_1000839732 130
1446 3300005436 Ga0070713_100318403 Ga0070713_1003184032 130
1447 3300005436 Ga0070713_101029493 Ga0070713_1010294932 130
1448 3300005436 Ga0070713_102050525 Ga0070713_1020505252 130
1449 3300005438 Ga0070701_10058334 Ga0070701_100583342 130
1450 3300005439 Ga0070711_100911684 Ga0070711_1009116841 130
1451 3300005439 Ga0070711_101882211 Ga0070711_1018822111 130
1452 3300005440 Ga0070705_100111064 Ga0070705_1001110642 130
1453 3300005440 Ga0070705_100325299 Ga0070705_1003252992 130
1454 3300005441 Ga0070700_100028676 Ga0070700_1000286764 130
1455 3300005441 Ga0070700_100126864 Ga0070700_1001268642 130
1456 3300005444 Ga0070694_100239386 Ga0070694_1002393862 130
1457 3300005444 Ga0070694_100936444 Ga0070694_1009364441 130
1458 3300005445 Ga0070708_100128736 Ga0070708_1001287362 130
1459 3300005455 Ga0070663_100229809 Ga0070663_1002298092 130
1460 3300005455 Ga0070663_100432212 Ga0070663_1004322122 130
1461 3300005456 Ga0070678_100096193 Ga0070678_1000961932 130
1462 3300005456 Ga0070678_100193290 Ga0070678_1001932902 130
1463 3300005457 Ga0070662_100106745 Ga0070662_1001067452 130
1464 3300005459 Ga0068867_100103695 Ga0068867_1001036953 130
1465 3300005459 Ga0068867_101364309 Ga0068867_1013643092 130
1466 3300005466 Ga0070685_10472968 Ga0070685_104729681 130
1467 3300005466 Ga0070685_10657041 Ga0070685_106570412 130
1468 3300005466 Ga0070685_10689976 Ga0070685_106899761 130
1469 3300005467 Ga0070706_100512377 Ga0070706_1005123772 130
1470 3300005468 Ga0070707_100437297 Ga0070707_1004372972 130
1471 3300005471 Ga0070698_100156087 Ga0070698_1001560871 130
1472 3300005471 Ga0070698_100530590 Ga0070698_1005305902 130
1473 3300005507 Ga0074259_11481910 Ga0074259_114819101 130
1474 3300005530 Ga0070679_100065408 Ga0070679_1000654084 130
1475 3300005530 Ga0070679_100138666 Ga0070679_1001386662 130
1476 3300005535 Ga0070684_100006202 Ga0070684_1000062025 130
1477 3300005535 Ga0070684_100025050 Ga0070684_1000250502 130
1478 3300005535 Ga0070684_100138225 Ga0070684_1001382252 130
1479 3300005535 Ga0070684_100212833 Ga0070684_1002128332 130
1480 3300005535 Ga0070684_100374474 Ga0070684_1003744742 130
1481 3300005535 Ga0070684_101072542 Ga0070684_1010725422 130
1482 3300005535 Ga0070684_101219401 Ga0070684_1012194012 130
1483 3300005539 Ga0068853_100884215 Ga0068853_1008842152 130
1484 3300005543 Ga0070672_101116513 Ga0070672_1011165132 130
1485 3300005543 Ga0070672_101129491 Ga0070672_1011294911 130
1486 3300005544 Ga0070686_100024493 Ga0070686_1000244932 130
1487 3300005544 Ga0070686_100047379 Ga0070686_1000473792 130
1488 3300005545 Ga0070695_100077299 Ga0070695_1000772992 130
1489 3300005546 Ga0070696_100037181 Ga0070696_1000371812 130
1490 3300005546 Ga0070696_100353278 Ga0070696_1003532782 130
1491 3300005547 Ga0070693_100015619 Ga0070693_1000156192 130
1492 3300005547 Ga0070693_100060263 Ga0070693_1000602632 130
1493 3300005547 Ga0070693_100104049 Ga0070693_1001040492 130
1494 3300005549 Ga0070704_100293172 Ga0070704_1002931722 130
1495 3300005549 Ga0070704_100583497 Ga0070704_1005834972 130
1496 3300005549 Ga0070704_100680066 Ga0070704_1006800662 130
1497 3300005563 Ga0068855_100052773 Ga0068855_1000527732 130
1498 3300005563 Ga0068855_100238533 Ga0068855_1002385332 130
1499 3300005563 Ga0068855_101094849 Ga0068855_1010948492 130
1500 3300005564 Ga0070664_100290073 Ga0070664_1002900732 130
1501 3300005564 Ga0070664_100628822 Ga0070664_1006288222 130
1502 3300005577 Ga0068857_100031768 Ga0068857_1000317683 130
1503 3300005577 Ga0068857_100103593 Ga0068857_1001035932 130
1504 3300005577 Ga0068857_100592916 Ga0068857_1005929162 130
1505 3300005578 Ga0068854_100055808 Ga0068854_1000558082 130
1506 3300005578 Ga0068854_100484175 Ga0068854_1004841752 130
1507 3300005578 Ga0068854_100636377 Ga0068854_1006363772 130
1508 3300005578 Ga0068854_101322859 Ga0068854_1013228592 130
1509 3300005614 Ga0068856_100139561 Ga0068856_1001395612 130
1510 3300005614 Ga0068856_101505028 Ga0068856_1015050282 130
1511 3300005615 Ga0070702_100012665 Ga0070702_1000126654 130
1512 3300005615 Ga0070702_100097792 Ga0070702_1000977922 130
1513 3300005615 Ga0070702_101289641 Ga0070702_1012896411 130
1514 3300005616 Ga0068852_100136315 Ga0068852_1001363152 130
1515 3300005617 Ga0068859_100740385 Ga0068859_1007403852 130
1516 3300005718 Ga0068866_10038763 Ga0068866_100387634 130
1517 3300005718 Ga0068866_10495477 Ga0068866_104954772 130
1518 3300005719 Ga0068861_100018373 Ga0068861_1000183732 130
1519 3300005719 Ga0068861_100114884 Ga0068861_1001148842 130
1520 3300005841 Ga0068863_100464533 Ga0068863_1004645332 130
1521 3300005843 Ga0068860_100635758 Ga0068860_1006357582 130
1522 3300005844 Ga0068862_100701044 Ga0068862_1007010442 130
1523 3300005937 Ga0081455_10010156 Ga0081455_1001015610 130
1524 3300005937 Ga0081455_10114326 Ga0081455_101143263 130
1525 3300005981 Ga0081538_10000196 Ga0081538_1000019629 130
1526 3300005981 Ga0081538_10000778 Ga0081538_1000077831 130
1527 3300005981 Ga0081538_10001466 Ga0081538_100014667 130
1528 3300005981 Ga0081538_10016496 Ga0081538_100164962 130
1529 3300005983 Ga0081540_1024966 Ga0081540_10249663 130
1530 3300006058 Ga0075432_10057554 Ga0075432_100575542 130
1531 3300006173 Ga0070716_100092640 Ga0070716_1000926402 130
1532 3300006173 Ga0070716_100790255 Ga0070716_1007902551 130
1533 3300006175 Ga0070712_100029937 Ga0070712_1000299372 130
1534 3300006175 Ga0070712_100418293 Ga0070712_1004182932 130
1535 3300006175 Ga0070712_101118727 Ga0070712_1011187272 130
1536 3300006237 Ga0097621_101833772 Ga0097621_1018337721 130
1537 3300006358 Ga0068871_100325896 Ga0068871_1003258962 130
1538 3300006358 Ga0068871_100843801 Ga0068871_1008438012 130
1539 3300006844 Ga0075428_101104403 Ga0075428_1011044032 130
1540 3300006846 Ga0075430_100080209 Ga0075430_1000802092 130
1541 3300006846 Ga0075430_100265478 Ga0075430_1002654782 130
1542 3300006847 Ga0075431_100342428 Ga0075431_1003424282 130
1543 3300006852 Ga0075433_10381013 Ga0075433_103810132 130
1544 3300006880 Ga0075429_100006626 Ga0075429_1000066266 130
1545 3300006881 Ga0068865_100076856 Ga0068865_1000768562 130
1546 3300006881 Ga0068865_100205487 Ga0068865_1002054872 130
1547 3300006881 Ga0068865_100571100 Ga0068865_1005711002 130
1548 3300006931 Ga0097620_100740403 Ga0097620_1007404032 130
1549 3300007076 Ga0075435_100959562 Ga0075435_1009595622 130
1550 3300009093 Ga0105240_10323513 Ga0105240_103235132 130
1551 3300009093 Ga0105240_11364229 Ga0105240_113642292 130
1552 3300009094 Ga0111539_10403399 Ga0111539_104033992 130
1553 3300009094 Ga0111539_10677991 Ga0111539_106779911 130
1554 3300009094 Ga0111539_10790177 Ga0111539_107901772 130
1555 3300009094 Ga0111539_11007432 Ga0111539_110074322 130
1556 3300009098 Ga0105245_10014739 Ga0105245_100147397 130
1557 3300009098 Ga0105245_10093389 Ga0105245_100933893 130
1558 3300009098 Ga0105245_10158544 Ga0105245_101585442 130
1559 3300009098 Ga0105245_11051355 Ga0105245_110513552 130
1560 3300009147 Ga0114129_10049638 Ga0114129_100496382 130
1561 3300009147 Ga0114129_10231150 Ga0114129_102311502 130
1562 3300009147 Ga0114129_10258249 Ga0114129_102582492 130
1563 3300009147 Ga0114129_11041925 Ga0114129_110419251 130
1564 3300009148 Ga0105243_10041997 Ga0105243_100419972 130
1565 3300009148 Ga0105243_10046896 Ga0105243_100468962 130
1566 3300009148 Ga0105243_10118046 Ga0105243_101180462 130
1567 3300009148 Ga0105243_10222893 Ga0105243_102228932 130
1568 3300009148 Ga0105243_11580132 Ga0105243_115801321 130
1569 3300009174 Ga0105241_10081484 Ga0105241_100814842 130
1570 3300009174 Ga0105241_10089090 Ga0105241_100890902 130
1571 3300009176 Ga0105242_10046034 Ga0105242_100460343 130
1572 3300009176 Ga0105242_10050771 Ga0105242_100507713 130
1573 3300009176 Ga0105242_10478106 Ga0105242_104781062 130
1574 3300009176 Ga0105242_10483818 Ga0105242_104838182 130
1575 3300009177 Ga0105248_10235571 Ga0105248_102355713 130
1576 3300009177 Ga0105248_10977108 Ga0105248_109771082 130
1577 3300009545 Ga0105237_11093507 Ga0105237_110935072 130
1578 3300009551 Ga0105238_11442251 Ga0105238_114422512 130
1579 3300009553 Ga0105249_10006238 Ga0105249_100062386 130
1580 3300009553 Ga0105249_10418034 Ga0105249_104180341 130
1581 3300010375 Ga0105239_10106979 Ga0105239_101069794 130
1582 3300010375 Ga0105239_10127962 Ga0105239_101279622 130
1583 3300010375 Ga0105239_10358220 Ga0105239_103582202 130
1584 3300011119 Ga0105246_10151571 Ga0105246_101515712 130
1585 3300013100 Ga0157373_10093686 Ga0157373_100936863 130
1586 3300013102 Ga0157371_10673274 Ga0157371_106732742 130
1587 3300013104 Ga0157370_10052375 Ga0157370_100523752 130
1588 3300013296 Ga0157374_11525336 Ga0157374_115253361 130
1589 3300013297 Ga0157378_12475883 Ga0157378_124758832 130
1590 3300013306 Ga0163162_10014772 Ga0163162_100147729 130
1591 3300013307 Ga0157372_10444232 Ga0157372_104442322 130
1592 3300013307 Ga0157372_10716535 Ga0157372_107165352 130
1593 3300013308 Ga0157375_10140245 Ga0157375_101402452 130
1594 3300013308 Ga0157375_10242501 Ga0157375_102425012 130
1595 3300014497 Ga0182008_10029228 Ga0182008_100292284 130
1596 3300014497 Ga0182008_10123107 Ga0182008_101231072 130
1597 3300014497 Ga0182008_10129893 Ga0182008_101298932 130
1598 3300014745 Ga0157377_10062720 Ga0157377_100627202 130
1599 3300014968 Ga0157379_10524994 Ga0157379_105249942 130
1600 3300014968 Ga0157379_10557710 Ga0157379_105577102 130
1601 3300014969 Ga0157376_10037956 Ga0157376_100379564 130
1602 3300014969 Ga0157376_10787645 Ga0157376_107876452 130
1603 3300017792 Ga0163161_10056955 Ga0163161_100569551 130
1604 3300020070 Ga0206356_11271291 Ga0206356_112712912 130
1605 3300021441 Ga0213871_10014622 Ga0213871_100146222 130
1606 3300025885 Ga0207653_10065752 Ga0207653_100657522 130
1607 3300025898 Ga0207692_10042517 Ga0207692_100425174 130
1608 3300025899 Ga0207642_10051944 Ga0207642_100519443 130
1609 3300025899 Ga0207642_10458625 Ga0207642_104586252 130
1610 3300025903 Ga0207680_10148306 Ga0207680_101483063 130
1611 3300025906 Ga0207699_10101130 Ga0207699_101011303 130
1612 3300025906 Ga0207699_10120809 Ga0207699_101208092 130
1613 3300025910 Ga0207684_10459914 Ga0207684_104599142 130
1614 3300025910 Ga0207684_10486133 Ga0207684_104861331 130
1615 3300025911 Ga0207654_10253179 Ga0207654_102531792 130
1616 3300025912 Ga0207707_10124998 Ga0207707_101249982 130
1617 3300025912 Ga0207707_10748981 Ga0207707_107489812 130
1618 3300025912 Ga0207707_11023275 Ga0207707_110232752 130
1619 3300025914 Ga0207671_10456245 Ga0207671_104562452 130
1620 3300025915 Ga0207693_10140031 Ga0207693_101400312 130
1621 3300025915 Ga0207693_10514017 Ga0207693_105140172 130
1622 3300025916 Ga0207663_10014506 Ga0207663_100145065 130
1623 3300025917 Ga0207660_10140912 Ga0207660_101409122 130
1624 3300025918 Ga0207662_10061176 Ga0207662_100611762 130
1625 3300025919 Ga0207657_10301661 Ga0207657_103016612 130
1626 3300025921 Ga0207652_10117995 Ga0207652_101179952 130
1627 3300025921 Ga0207652_10513578 Ga0207652_105135782 130
1628 3300025923 Ga0207681_10074265 Ga0207681_100742652 130
1629 3300025926 Ga0207659_10245661 Ga0207659_102456612 130
1630 3300025927 Ga0207687_10052761 Ga0207687_100527613 130
1631 3300025927 Ga0207687_10054673 Ga0207687_100546733 130
1632 3300025927 Ga0207687_10156559 Ga0207687_101565592 130
1633 3300025927 Ga0207687_11051689 Ga0207687_110516892 130
1634 3300025928 Ga0207700_10491246 Ga0207700_104912462 130
1635 3300025928 Ga0207700_11761642 Ga0207700_117616421 130
1636 3300025929 Ga0207664_10003508 Ga0207664_100035085 130
1637 3300025929 Ga0207664_11103586 Ga0207664_111035862 130
1638 3300025929 Ga0207664_11171782 Ga0207664_111717822 130
1639 3300025931 Ga0207644_10760410 Ga0207644_107604102 130
1640 3300025932 Ga0207690_10741728 Ga0207690_107417282 130
1641 3300025933 Ga0207706_10011285 Ga0207706_100112852 130
1642 3300025933 Ga0207706_10015865 Ga0207706_100158654 130
1643 3300025934 Ga0207686_10101571 Ga0207686_101015712 130
1644 3300025934 Ga0207686_10226615 Ga0207686_102266152 130
1645 3300025935 Ga0207709_10078658 Ga0207709_100786582 130
1646 3300025935 Ga0207709_10489221 Ga0207709_104892212 130
1647 3300025937 Ga0207669_10125249 Ga0207669_101252492 130
1648 3300025937 Ga0207669_11457146 Ga0207669_114571461 130
1649 3300025938 Ga0207704_10251443 Ga0207704_102514432 130
1650 3300025938 Ga0207704_11689751 Ga0207704_116897511 130
1651 3300025940 Ga0207691_10518451 Ga0207691_105184512 130
1652 3300025941 Ga0207711_11089102 Ga0207711_110891022 130
1653 3300025944 Ga0207661_10022521 Ga0207661_100225212 130
1654 3300025944 Ga0207661_10037285 Ga0207661_100372852 130
1655 3300025944 Ga0207661_10209865 Ga0207661_102098652 130
1656 3300025944 Ga0207661_11045233 Ga0207661_110452332 130
1657 3300025944 Ga0207661_11738745 Ga0207661_117387451 130
1658 3300025945 Ga0207679_10034116 Ga0207679_100341162 130
1659 3300025949 Ga0207667_11738249 Ga0207667_117382492 130
1660 3300025960 Ga0207651_11339724 Ga0207651_113397241 130
1661 3300025961 Ga0207712_10334524 Ga0207712_103345242 130
1662 3300025972 Ga0207668_10662912 Ga0207668_106629122 130
1663 3300025981 Ga0207640_10062770 Ga0207640_100627702 130
1664 3300025981 Ga0207640_10067583 Ga0207640_100675833 130
1665 3300025981 Ga0207640_10528249 Ga0207640_105282492 130
1666 3300025981 Ga0207640_10826153 Ga0207640_108261532 130
1667 3300026023 Ga0207677_10116178 Ga0207677_101161782 130
1668 3300026023 Ga0207677_10161246 Ga0207677_101612463 130
1669 3300026035 Ga0207703_10245788 Ga0207703_102457882 130
1670 3300026041 Ga0207639_10149558 Ga0207639_101495582 130
1671 3300026075 Ga0207708_10009298 Ga0207708_100092982 130
1672 3300026075 Ga0207708_10790412 Ga0207708_107904122 130
1673 3300026078 Ga0207702_10637615 Ga0207702_106376152 130
1674 3300026078 Ga0207702_11119713 Ga0207702_111197132 130
1675 3300026078 Ga0207702_11866370 Ga0207702_118663702 130
1676 3300026088 Ga0207641_11035690 Ga0207641_110356902 130
1677 3300026089 Ga0207648_10012905 Ga0207648_100129059 130
1678 3300026089 Ga0207648_10459361 Ga0207648_104593612 130
1679 3300026116 Ga0207674_10005249 Ga0207674_1000524911 130
1680 3300026116 Ga0207674_10099265 Ga0207674_100992652 130
1681 3300026116 Ga0207674_10494146 Ga0207674_104941462 130
1682 3300026116 Ga0207674_10734600 Ga0207674_107346002 130
1683 3300026118 Ga0207675_100001474 Ga0207675_10000147422 130
1684 3300026118 Ga0207675_100031924 Ga0207675_1000319244 130
1685 3300026118 Ga0207675_100563856 Ga0207675_1005638562 130
1686 3300026121 Ga0207683_10014871 Ga0207683_100148713 130
1687 3300026121 Ga0207683_10041315 Ga0207683_100413152 130
1688 3300027717 Ga0209998_10004454 Ga0209998_100044542 130
1689 3300027907 Ga0207428_10067117 Ga0207428_100671172 130
1690 3300027907 Ga0207428_10602878 Ga0207428_106028781 130
1691 3300028380 Ga0268265_10131489 Ga0268265_101314893 130
1692 3300028381 Ga0268264_10054982 Ga0268264_100549823 130
1693 3300028563 Ga0265319_1001059 Ga0265319_10010598 130
1694 3300028563 Ga0265319_1046722 Ga0265319_10467222 130
1695 3300028563 Ga0265319_1068859 Ga0265319_10688592 130
1696 3300028563 Ga0265319_1107092 Ga0265319_11070922 130
1697 3300028563 Ga0265319_1186469 Ga0265319_11864692 130
1698 3300028573 Ga0265334_10044209 Ga0265334_100442092 130
1699 3300028573 Ga0265334_10139130 Ga0265334_101391302 130
1700 3300028577 Ga0265318_10001637 Ga0265318_100016378 130
1701 3300028577 Ga0265318_10002583 Ga0265318_100025838 130
1702 3300028577 Ga0265318_10112586 Ga0265318_101125862 130
1703 3300028577 Ga0265318_10203673 Ga0265318_102036732 130
1704 3300028653 Ga0265323_10064516 Ga0265323_100645162 130
1705 3300028654 Ga0265322_10027633 Ga0265322_100276332 130
1706 3300028666 Ga0265336_10007899 Ga0265336_100078995 130
1707 3300028666 Ga0265336_10047880 Ga0265336_100478802 130
1708 3300028666 Ga0265336_10135878 Ga0265336_101358782 130
1709 3300028800 Ga0265338_10011477 Ga0265338_1001147711 130
1710 3300028800 Ga0265338_10125041 Ga0265338_101250412 130
1711 3300028800 Ga0265338_10614343 Ga0265338_106143432 130
1712 3300028800 Ga0265338_10786629 Ga0265338_107866291 130
1713 3300029957 Ga0265324_10023436 Ga0265324_100234362 130
1714 3300029957 Ga0265324_10172168 Ga0265324_101721682 130
1715 3300031235 Ga0265330_10010770 Ga0265330_100107702 130
1716 3300031235 Ga0265330_10044722 Ga0265330_100447222 130
1717 3300031235 Ga0265330_10079347 Ga0265330_100793472 130
1718 3300031238 Ga0265332_10002507 Ga0265332_100025075 130
1719 3300031238 Ga0265332_10267615 Ga0265332_102676152 130
1720 3300031239 Ga0265328_10060096 Ga0265328_100600962 130
1721 3300031239 Ga0265328_10157820 Ga0265328_101578202 130
1722 3300031240 Ga0265320_10036181 Ga0265320_100361812 130
1723 3300031240 Ga0265320_10041508 Ga0265320_100415082 130
1724 3300031240 Ga0265320_10073454 Ga0265320_100734542 130
1725 3300031240 Ga0265320_10295396 Ga0265320_102953962 130
1726 3300031241 Ga0265325_10007247 Ga0265325_100072475 130
1727 3300031242 Ga0265329_10010286 Ga0265329_100102861 130
1728 3300031242 Ga0265329_10060500 Ga0265329_100605002 130
1729 3300031247 Ga0265340_10055474 Ga0265340_100554743 130
1730 3300031249 Ga0265339_10004983 Ga0265339_1000498310 130
1731 3300031249 Ga0265339_10043155 Ga0265339_100431554 130
1732 3300031249 Ga0265339_10125156 Ga0265339_101251562 130
1733 3300031250 Ga0265331_10047939 Ga0265331_100479392 130
1734 3300031250 Ga0265331_10266340 Ga0265331_102663402 130
1735 3300031251 Ga0265327_10010961 Ga0265327_100109611 130
1736 3300031251 Ga0265327_10051034 Ga0265327_100510342 130
1737 3300031251 Ga0265327_10331420 Ga0265327_103314201 130
1738 3300031344 Ga0265316_10025187 Ga0265316_100251872 130
1739 3300031344 Ga0265316_10028229 Ga0265316_100282293 130
1740 3300031344 Ga0265316_10165600 Ga0265316_101656002 130
1741 3300031344 Ga0265316_10459239 Ga0265316_104592392 130
1742 3300031548 Ga0307408_100658927 Ga0307408_1006589271 130
1743 3300031595 Ga0265313_10025024 Ga0265313_100250242 130
1744 3300031711 Ga0265314_10005893 Ga0265314_1000589310 130
1745 3300031711 Ga0265314_10081502 Ga0265314_100815022 130
1746 3300031711 Ga0265314_10457056 Ga0265314_104570561 130
1747 3300031712 Ga0265342_10009581 Ga0265342_100095814 130
1748 3300031712 Ga0265342_10244166 Ga0265342_102441662 130
1749 3300031995 Ga0307409_100188654 Ga0307409_1001886542 130
1750 3300031995 Ga0307409_100342012 Ga0307409_1003420122 130
1751 3300032126 Ga0307415_100061759 Ga0307415_1000617591 130
1752 3300032126 Ga0307415_100397820 Ga0307415_1003978201 130
1753 3300032133 Ga0316583_10019863 Ga0316583_100198631 130
1754 3300032133 Ga0316583_10134198 Ga0316583_101341982 130
1755 3300034817 Ga0373948_0026222 Ga0373948_0026222_640_1038 130
1756 3300034819 Ga0373958_0064218 Ga0373958_0064218_134_532 130
1757 3300034819 Ga0373958_0212373 Ga0373958_0212373_59_457 130
1758 3300034820 Ga0373959_0166047 Ga0373959_0166047_34_432 130
1759 3300035083 Ga0373926_0017042 Ga0373926_0017042_1945_2343 130
1760 3300035088 Ga0373940_0057792 Ga0373940_0057792_573_971 130
1761 3300035089 Ga0373944_0000745 Ga0373944_0000745_909_1307 130
1762 3300035090 Ga0373949_0005758 Ga0373949_0005758_521_919 130
1763 3300035091 Ga0373951_0046247 Ga0373951_0046247_41_439 130
1764 3300035113 Ga0373936_0399718 Ga0373936_0399718_25_423 130
1765 3300035116 Ga0373945_0022073 Ga0373945_0022073_1055_1453 130
1766 3300035118 Ga0373954_0222090 Ga0373954_0222090_98_493 130
1767 3300035119 Ga0373956_0143291 Ga0373956_0143291_604_999 130
1768 3300035120 Ga0373957_0234103 Ga0373957_0234103_34_429 130
1769 3300035121 Ga0373960_0003469 Ga0373960_0003469_1256_1654 130
1770 3300035170 Ga0373943_0008965 Ga0373943_0008965_3128_3526 130
1771 3300035170 Ga0373943_0359775 Ga0373943_0359775_336_734 130
1772 3300035171 Ga0373946_0009349 Ga0373946_0009349_904_1302 130
1773 3300035172 Ga0373955_0224472 Ga0373955_0224472_279_674 130
1774 3300035410 Ga0373924_0049442 Ga0373924_0049442_1056_1451 130
1775 3300035691 Ga0373931_0081587 Ga0373931_0081587_1115_1513 130
1776 3300035724 Ga0373933_0122520 Ga0373933_0122520_1079_1474 130
1777 3300035724 Ga0373933_0399993 Ga0373933_0399993_102_497 130
1778 3300035725 Ga0373947_0006134 Ga0373947_0006134_4631_5029 130
1779 3300035725 Ga0373947_0618722 Ga0373947_0618722_36_434 130
1780 3300035725 Ga0373947_0992766 Ga0373947_0992766_29_424 130
1781 3300036401 Ga0373937_0007353 Ga0373937_0007353_147_542 130
1782 3300036401 Ga0373937_0018081 Ga0373937_0018081_5672_6067 130
1783 3300037068 Ga0373925_0046597 Ga0373925_0046597_2620_3018 130
1784 3300037312 Ga0395899_0004041 Ga0395899_0004041_7745_8140 130
1785 3300037312 Ga0395899_0004144 Ga0395899_0004144_3722_4120 130
1786 3300037312 Ga0395899_0005908 Ga0395899_0005908_2026_2424 130
1787 3300037312 Ga0395899_0020333 Ga0395899_0020333_1849_2244 130
1788 3300037312 Ga0395899_0102546 Ga0395899_0102546_456_869 130
1789 3300037312 Ga0395899_0113784 Ga0395899_0113784_321_716 130
1790 3300037312 Ga0395899_0166630 Ga0395899_0166630_116_511 130
1791 3300037312 Ga0395899_0225085 Ga0395899_0225085_458_850 130
1792 3300037312 Ga0395899_0299366 Ga0395899_0299366_406_798 130
1793 3300037312 Ga0395899_0796852 Ga0395899_0796852_141_539 130
1794 3300037418 Ga0395900_0002083 Ga0395900_0002083_2849_3247 130
1795 3300037418 Ga0395900_0005017 Ga0395900_0005017_3424_3819 130
1796 3300037418 Ga0395900_0005410 Ga0395900_0005410_12266_12679 130
1797 3300037418 Ga0395900_0038986 Ga0395900_0038986_1411_1809 130
1798 3300037418 Ga0395900_0054857 Ga0395900_0054857_2022_2417 130
1799 3300037418 Ga0395900_0145181 Ga0395900_0145181_387_782 130
1800 3300037418 Ga0395900_0414645 Ga0395900_0414645_768_1181 130
1801 3300037418 Ga0395900_0567737 Ga0395900_0567737_407_802 130
1802 3300037418 Ga0395900_0707715 Ga0395900_0707715_491_886 130
1803 3300037418 Ga0395900_1182500 Ga0395900_1182500_97_489 130
1804 3300037466 Ga0395898_0004803 Ga0395898_0004803_1698_2096 130
1805 3300037466 Ga0395898_0008288 Ga0395898_0008288_5166_5561 130
1806 3300037466 Ga0395898_0010279 Ga0395898_0010279_6918_7316 130
1807 3300037466 Ga0395898_0025784 Ga0395898_0025784_5070_5483 130
1808 3300037466 Ga0395898_0033072 Ga0395898_0033072_1561_1956 130
1809 3300037466 Ga0395898_0042055 Ga0395898_0042055_1211_1609 130
1810 3300037466 Ga0395898_0155342 Ga0395898_0155342_1719_2111 130
1811 3300037466 Ga0395898_0160303 Ga0395898_0160303_1226_1621 130
1812 3300037466 Ga0395898_0206388 Ga0395898_0206388_1088_1483 130
1813 3300037466 Ga0395898_0257396 Ga0395898_0257396_620_1015 130
1814 3300037466 Ga0395898_0491821 Ga0395898_0491821_190_585 130
1815 3300037466 Ga0395898_0585818 Ga0395898_0585818_172_567 130
1816 3300037466 Ga0395898_1566421 Ga0395898_1566421_54_449 130
1817 3300037471 Ga0395905_0001594 Ga0395905_0001594_4774_5187 130
1818 3300037471 Ga0395905_0002067 Ga0395905_0002067_1430_1828 130
1819 3300037471 Ga0395905_0006934 Ga0395905_0006934_6916_7314 130
1820 3300037471 Ga0395905_0016030 Ga0395905_0016030_1391_1786 130
1821 3300037471 Ga0395905_0057187 Ga0395905_0057187_1661_2056 130
1822 3300037471 Ga0395905_0084704 Ga0395905_0084704_1398_1793 130
1823 3300037471 Ga0395905_0178754 Ga0395905_0178754_1421_1816 130
1824 3300037471 Ga0395905_0268845 Ga0395905_0268845_676_1068 130
1825 3300037471 Ga0395905_0425000 Ga0395905_0425000_809_1204 130
1826 3300037471 Ga0395905_0426025 Ga0395905_0426025_479_874 130
1827 3300037471 Ga0395905_1832365 Ga0395905_1832365_34_426 130
1828 3300038443 Ga0395901_0000793 Ga0395901_0000793_4124_4522 130
1829 3300038443 Ga0395901_0010539 Ga0395901_0010539_4317_4712 130
1830 3300038443 Ga0395901_0052696 Ga0395901_0052696_3117_3512 130
1831 3300038443 Ga0395901_0068691 Ga0395901_0068691_679_1074 130
1832 3300038443 Ga0395901_0070458 Ga0395901_0070458_1377_1790 130
1833 3300038443 Ga0395901_0110790 Ga0395901_0110790_1245_1643 130
1834 3300038443 Ga0395901_0117972 Ga0395901_0117972_973_1368 130
1835 3300038443 Ga0395901_0132049 Ga0395901_0132049_579_974 130
1836 3300038443 Ga0395901_0313051 Ga0395901_0313051_104_502 130
1837 3300038443 Ga0395901_0318532 Ga0395901_0318532_905_1297 130
1838 3300038443 Ga0395901_0456570 Ga0395901_0456570_476_868 130
1839 3300038443 Ga0395901_0767111 Ga0395901_0767111_155_550 130
1840 3300038443 Ga0395901_1046317 Ga0395901_1046317_378_773 130
1841 3300038443 Ga0395901_1670188 Ga0395901_1670188_62_457 130
1842 3300038443 Ga0395901_2064079 Ga0395901_2064079_83_496 130
1843 3300039438 Ga0436360_1167324 Ga0436360_1167324_938_1333 130
1844 3300041404 Ga0439436_0157115 Ga0439436_0157115_203_598 130
1845 3300041406 Ga0439439_0004354 Ga0439439_0004354_1442_1837 130
1846 3300041459 Ga0451800_1502259 Ga0451800_1502259_134_529 130
1847 3300041486 Ga0451807_2359858 Ga0451807_2359858_14_409 130
1848 3300041492 Ga0451835_0082155 Ga0451835_0082155_166_561 130
1849 3300041501 Ga0451845_0891764 Ga0451845_0891764_50_445 130
1850 3300041512 Ga0451853_1116739 Ga0451853_1116739_371_766 130
1851 3300041999 Ga0439433_0023177 Ga0439433_0023177_471_866 130
1852 3300042002 Ga0439442_026948 Ga0439442_026948_635_1030 130
1853 3300042005 Ga0439448_0005987 Ga0439448_0005987_1565_1963 130
1854 3300042005 Ga0439448_0044482 Ga0439448_0044482_48_443 130
1855 3300042007 Ga0439449_0116451 Ga0439449_0116451_274_669 130
1856 3300042009 Ga0439451_001220 Ga0439451_001220_2500_2898 130
1857 3300042011 Ga0439454_007866 Ga0439454_007866_807_1205 130
1858 3300042014 Ga0439457_036664 Ga0439457_036664_417_812 130
1859 3300042015 Ga0439462_0108257 Ga0439462_0108257_39_434 130
1860 3300042156 Ga0439446_0001521 Ga0439446_0001521_1825_2220 130
1861 3300042157 Ga0439458_0019663 Ga0439458_0019663_426_824 130
1862 3300044658 Ga0466972_0048222 Ga0466972_0048222_80_475 130
1863 3300044658 Ga0466972_0176459 Ga0466972_0176459_409_804 130
1864 3300044684 Ga0466966_0091299 Ga0466966_0091299_888_1283 130
1865 3300044693 Ga0466961_0103728 Ga0466961_0103728_1016_1411 130
1866 3300044693 Ga0466961_0131414 Ga0466961_0131414_54_449 130
1867 3300044693 Ga0466961_0714462 Ga0466961_0714462_19_420 130
1868 3300044694 Ga0466963_0010487 Ga0466963_0010487_1109_1504 130
1869 3300044694 Ga0466963_0462349 Ga0466963_0462349_483_878 130
1870 3300044694 Ga0466963_1094722 Ga0466963_1094722_114_509 130
1871 3300044706 Ga0466964_0001506 Ga0466964_0001506_4473_4868 130
1872 3300044706 Ga0466964_0003774 Ga0466964_0003774_2097_2495 130
1873 3300044719 Ga0466971_0039230 Ga0466971_0039230_1251_1646 130
1874 3300044719 Ga0466971_0132686 Ga0466971_0132686_629_1024 130
1875 3300044719 Ga0466971_0285981 Ga0466971_0285981_331_726 130
1876 3300044735 Ga0466968_0082497 Ga0466968_0082497_316_711 130
1877 3300044765 Ga0466970_0183895 Ga0466970_0183895_62_457 130
1878 3300044842 Ga0466957_0035217 Ga0466957_0035217_2284_2679 130
1879 3300044842 Ga0466957_0668660 Ga0466957_0668660_289_684 130
1880 3300044901 Ga0466960_0206439 Ga0466960_0206439_602_997 130
1881 3300044901 Ga0466960_0600756 Ga0466960_0600756_183_581 130
1882 3300045049 Ga0466959_0032823 Ga0466959_0032823_2106_2501 130
1883 3300045051 Ga0451576_0026465 Ga0451576_0026465_2181_2579 130
1884 3300045836 Ga0466958_0016400 Ga0466958_0016400_2943_3338 130
1885 3300045836 Ga0466958_0114370 Ga0466958_0114370_987_1385 130
1886 3300045836 Ga0466958_0350136 Ga0466958_0350136_170_565 130
1887 3300045836 Ga0466958_0980623 Ga0466958_0980623_117_512 130
1888 3300045976 Ga0466967_0000215 Ga0466967_0000215_19435_19830 130
1889 3300045976 Ga0466967_0003534 Ga0466967_0003534_5513_5908 130
1890 3300045976 Ga0466967_0038892 Ga0466967_0038892_829_1224 130
1891 3300045976 Ga0466967_0048323 Ga0466967_0048323_2502_2900 130
1892 3300045976 Ga0466967_0094207 Ga0466967_0094207_1360_1755 130
1893 3300045976 Ga0466967_0237546 Ga0466967_0237546_163_561 130
1894 3300046454 Ga0495592_0420722 Ga0495592_0420722_382_777 130
1895 3300046455 Ga0495603_0000450 Ga0495603_0000450_6092_6490 130
1896 3300046459 Ga0495629_0214931 Ga0495629_0214931_539_934 130
1897 3300046461 Ga0495641_0005148 Ga0495641_0005148_5909_6307 130
1898 3300046461 Ga0495641_0020692 Ga0495641_0020692_2142_2540 130
1899 3300046461 Ga0495641_0153710 Ga0495641_0153710_489_884 130
1900 3300046461 Ga0495641_0158171 Ga0495641_0158171_328_726 130
1901 3300046461 Ga0495641_0241207 Ga0495641_0241207_342_740 130
1902 3300046463 Ga0495653_0087395 Ga0495653_0087395_404_802 130
1903 3300046463 Ga0495653_0110501 Ga0495653_0110501_532_927 130
1904 3300046473 Ga0495582_0006254 Ga0495582_0006254_1822_2220 130
1905 3300046474 Ga0495605_0128192 Ga0495605_0128192_253_651 130
1906 3300046474 Ga0495605_0131005 Ga0495605_0131005_406_801 130
1907 3300046475 Ga0495639_0018584 Ga0495639_0018584_1682_2080 130
1908 3300046475 Ga0495639_0087680 Ga0495639_0087680_478_876 130
1909 3300046491 Ga0495584_0069770 Ga0495584_0069770_339_734 130
1910 3300046491 Ga0495584_0387787 Ga0495584_0387787_199_597 130
1911 3300046491 Ga0495584_0515900 Ga0495584_0515900_64_462 130
1912 3300046492 Ga0495585_0088515 Ga0495585_0088515_93_491 130
1913 3300046499 Ga0495594_0001436 Ga0495594_0001436_5757_6155 130
1914 3300046500 Ga0495596_0156249 Ga0495596_0156249_340_738 130
1915 3300046501 Ga0495607_0072230 Ga0495607_0072230_1016_1411 130
1916 3300046511 Ga0495608_0008651 Ga0495608_0008651_2991_3386 130
1917 3300046514 Ga0495618_0218526 Ga0495618_0218526_662_1057 130
1918 3300046514 Ga0495618_0224197 Ga0495618_0224197_339_734 130
1919 3300046516 Ga0495628_0194383 Ga0495628_0194383_404_799 130
1920 3300046516 Ga0495628_0229586 Ga0495628_0229586_907_1302 130
1921 3300046517 Ga0495630_0309354 Ga0495630_0309354_547_942 130
1922 3300046517 Ga0495630_0960762 Ga0495630_0960762_126_524 130
1923 3300046519 Ga0495632_0488661 Ga0495632_0488661_69_464 130
1924 3300046523 Ga0495644_0071739 Ga0495644_0071739_37_432 130
1925 3300046523 Ga0495644_0128930 Ga0495644_0128930_427_822 130
1926 3300046523 Ga0495644_0323783 Ga0495644_0323783_126_524 130
1927 3300046526 Ga0495666_0015797 Ga0495666_0015797_846_1244 130
1928 3300046526 Ga0495666_0311503 Ga0495666_0311503_223_618 130
1929 3300046528 Ga0495642_0303275 Ga0495642_0303275_267_662 130
1930 3300046529 Ga0495652_0758721 Ga0495652_0758721_99_497 130
1931 3300046536 Ga0495587_0285081 Ga0495587_0285081_249_644 130
1932 3300046538 Ga0495609_0131354 Ga0495609_0131354_219_614 130
1933 3300046538 Ga0495609_0162145 Ga0495609_0162145_334_732 130
1934 3300046539 Ga0495621_0421876 Ga0495621_0421876_97_495 130
1935 3300046542 Ga0495597_0102071 Ga0495597_0102071_399_797 130
1936 3300046558 Ga0495633_0081195 Ga0495633_0081195_255_650 130
1937 3300046558 Ga0495633_0483864 Ga0495633_0483864_80_478 130
1938 3300046559 Ga0495667_0066033 Ga0495667_0066033_947_1345 130
1939 3300046559 Ga0495667_0108761 Ga0495667_0108761_1244_1639 130
1940 3300046559 Ga0495667_0984166 Ga0495667_0984166_36_431 130
1941 3300046615 Ga0495656_0179173 Ga0495656_0179173_59_454 130
1942 3300046615 Ga0495656_0663453 Ga0495656_0663453_124_522 130
1943 3300046616 Ga0495668_0271586 Ga0495668_0271586_304_702 130
1944 3300046642 Ga0495634_0436372 Ga0495634_0436372_302_697 130
1945 3300046648 Ga0495611_0253405 Ga0495611_0253405_331_726 130
1946 3300046663 Ga0495635_0286444 Ga0495635_0286444_340_735 130
1947 3300046665 Ga0495661_0540157 Ga0495661_0540157_83_481 130
1948 3300046674 Ga0495588_0000857 Ga0495588_0000857_6034_6432 130
1949 3300046675 Ga0495657_0044787 Ga0495657_0044787_1972_2367 130
1950 3300046681 Ga0495647_0008243 Ga0495647_0008243_688_1086 130
1951 3300046681 Ga0495647_0137926 Ga0495647_0137926_54_449 130
1952 3300046683 Ga0495658_0005244 Ga0495658_0005244_1461_1859 130
1953 3300046683 Ga0495658_0044590 Ga0495658_0044590_674_1069 130
1954 3300046683 Ga0495658_0130024 Ga0495658_0130024_339_737 130
1955 3300046689 Ga0495613_0100821 Ga0495613_0100821_307_705 130
1956 3300046690 Ga0495624_0287470 Ga0495624_0287470_157_555 130
1957 3300046690 Ga0495624_0752658 Ga0495624_0752658_94_489 130
1958 3300046691 Ga0495670_0230034 Ga0495670_0230034_62_460 130
1959 3300046691 Ga0495670_0341683 Ga0495670_0341683_52_447 130
1960 3300046794 Ga0495589_0034703 Ga0495589_0034703_387_785 130
1961 3300046809 Ga0495600_0156692 Ga0495600_0156692_555_953 130
1962 3300047315 Ga0495581_0000598 Ga0495581_0000598_16482_16877 130
1963 3300047315 Ga0495581_0298879 Ga0495581_0298879_137_535 130
1964 3300047319 Ga0495674_0042000 Ga0495674_0042000_313_711 130
1965 3300047321 Ga0495676_0000602 Ga0495676_0000602_6415_6813 130
1966 3300047321 Ga0495676_0021995 Ga0495676_0021995_4846_5241 130
1967 3300047321 Ga0495676_0052541 Ga0495676_0052541_899_1297 130
1968 3300047321 Ga0495676_0741832 Ga0495676_0741832_42_437 130
1969 3300047321 Ga0495676_0843795 Ga0495676_0843795_40_435 130
1970 3300047322 Ga0495680_0013112 Ga0495680_0013112_2601_2999 130
1971 3300047322 Ga0495680_0070988 Ga0495680_0070988_1091_1486 130
1972 3300047322 Ga0495680_0252541 Ga0495680_0252541_750_1145 130
1973 3300047471 Ga0495684_0046293 Ga0495684_0046293_593_991 130
1974 3300047673 Ga0495593_0269515 Ga0495593_0269515_251_649 130
1975 3300048091 Ga0495626_0330093 Ga0495626_0330093_108_506 130
1976 3300048903 Ga0496100_0112039 Ga0496100_0112039_99_497 130
1977 3300048903 Ga0496100_0388522 Ga0496100_0388522_543_941 130
1978 3300048903 Ga0496100_0392486 Ga0496100_0392486_119_517 130
1979 3300048903 Ga0496100_0393839 Ga0496100_0393839_202_600 130
1980 3300048903 Ga0496100_1538655 Ga0496100_1538655_20_418 130
1981 3300048904 Ga0496101_0136966 Ga0496101_0136966_733_1131 130
1982 3300048904 Ga0496101_0157476 Ga0496101_0157476_940_1338 130
1983 3300048904 Ga0496101_0315318 Ga0496101_0315318_666_1064 130
1984 3300048904 Ga0496101_0319684 Ga0496101_0319684_119_514 130
1985 3300048904 Ga0496101_0667874 Ga0496101_0667874_257_652 130
1986 3300048904 Ga0496101_1357291 Ga0496101_1357291_126_524 130
1987 3300048905 Ga0496102_0056521 Ga0496102_0056521_899_1297 130
1988 3300048905 Ga0496102_0218004 Ga0496102_0218004_119_517 130
1989 3300048905 Ga0496102_0387720 Ga0496102_0387720_125_523 130
1990 3300048905 Ga0496102_0547381 Ga0496102_0547381_234_629 130
1991 3300048906 Ga0496103_0023606 Ga0496103_0023606_847_1245 130
1992 3300048906 Ga0496103_0082527 Ga0496103_0082527_960_1358 130
1993 3300048906 Ga0496103_0201954 Ga0496103_0201954_187_585 130
1994 3300048907 Ga0496104_0061738 Ga0496104_0061738_1751_2149 130
1995 3300048907 Ga0496104_0130144 Ga0496104_0130144_1617_2015 130
1996 3300048907 Ga0496104_1184520 Ga0496104_1184520_149_547 130
1997 3300048908 Ga0496105_0116738 Ga0496105_0116738_940_1338 130
1998 3300048908 Ga0496105_0123903 Ga0496105_0123903_1688_2086 130
1999 3300048908 Ga0496105_0142625 Ga0496105_0142625_486_881 130
2000 3300048909 Ga0496106_0008728 Ga0496106_0008728_6666_7061 130
2001 3300048909 Ga0496106_0088349 Ga0496106_0088349_272_670 130
2002 3300048909 Ga0496106_0206389 Ga0496106_0206389_721_1119 130
2003 3300048910 Ga0496107_0022045 Ga0496107_0022045_1423_1818 130
2004 3300048910 Ga0496107_0211686 Ga0496107_0211686_778_1176 130
2005 3300048911 Ga0496108_0043087 Ga0496108_0043087_2991_3389 130
2006 3300048911 Ga0496108_0308794 Ga0496108_0308794_522_920 130
2007 3300048912 Ga0496109_0071612 Ga0496109_0071612_2670_3065 130
2008 3300048912 Ga0496109_0129525 Ga0496109_0129525_1008_1406 130
2009 3300048912 Ga0496109_0312906 Ga0496109_0312906_636_1031 130
2010 3300048913 Ga0496110_0003632 Ga0496110_0003632_494_889 130
2011 3300048913 Ga0496110_0020639 Ga0496110_0020639_2086_2484 130
2012 3300048913 Ga0496110_0034029 Ga0496110_0034029_1966_2364 130
2013 3300048913 Ga0496110_0434889 Ga0496110_0434889_679_1107 130
2014 3300048913 Ga0496110_0760485 Ga0496110_0760485_339_734 130
2015 3300048914 Ga0496111_0020783 Ga0496111_0020783_2727_3122 130
2016 3300048914 Ga0496111_0024919 Ga0496111_0024919_1914_2312 130
2017 3300048914 Ga0496111_0082830 Ga0496111_0082830_439_837 130
2018 3300048914 Ga0496111_0404237 Ga0496111_0404237_308_703 130
2019 3300048914 Ga0496111_0818990 Ga0496111_0818990_42_470 130
2020 3300048915 Ga0496112_0013792 Ga0496112_0013792_1127_1522 130
2021 3300048915 Ga0496112_0014155 Ga0496112_0014155_1289_1684 130
2022 3300048915 Ga0496112_0052704 Ga0496112_0052704_307_702 130
2023 3300048915 Ga0496112_0115773 Ga0496112_0115773_500_898 130
2024 3300048915 Ga0496112_0128073 Ga0496112_0128073_651_1049 130
2025 3300048915 Ga0496112_0925738 Ga0496112_0925738_375_770 130
2026 3300048915 Ga0496112_1198955 Ga0496112_1198955_19_417 130
2027 3300048916 Ga0496113_0038498 Ga0496113_0038498_1377_1775 130
2028 3300048916 Ga0496113_0291824 Ga0496113_0291824_341_739 130
2029 3300048916 Ga0496113_0342797 Ga0496113_0342797_265_663 130
2030 3300048916 Ga0496113_0779585 Ga0496113_0779585_269_664 130
2031 3300048917 Ga0496114_0114928 Ga0496114_0114928_529_927 130
2032 3300048917 Ga0496114_0222818 Ga0496114_0222818_624_1022 130
2033 3300048917 Ga0496114_0402554 Ga0496114_0402554_36_434 130
2034 3300048917 Ga0496114_0436510 Ga0496114_0436510_640_1038 130
2035 3300048918 Ga0496115_0179905 Ga0496115_0179905_69_467 130
2036 3300049568 Ga0501031_0002630 Ga0501031_0002630_1985_2380 130
2037 3300049568 Ga0501031_0029076 Ga0501031_0029076_2197_2598 130
2038 3300049568 Ga0501031_0139486 Ga0501031_0139486_1102_1503 130
2039 3300049568 Ga0501031_0528992 Ga0501031_0528992_301_696 130
2040 3300049569 Ga0501032_0064254 Ga0501032_0064254_423_824 130
2041 3300049569 Ga0501032_0096441 Ga0501032_0096441_561_956 130
2042 3300049570 Ga0501033_0016360 Ga0501033_0016360_1881_2276 130
2043 3300049571 Ga0501034_0613955 Ga0501034_0613955_428_823 130
2044 3300049572 Ga0501036_0003155 Ga0501036_0003155_10364_10765 130
2045 3300049572 Ga0501036_0022969 Ga0501036_0022969_2530_2931 130
2046 3300049572 Ga0501036_0081681 Ga0501036_0081681_401_796 130
2047 3300049573 Ga0501037_0110948 Ga0501037_0110948_152_547 130
2048 3300049574 Ga0501038_0031009 Ga0501038_0031009_1034_1435 130
2049 3300049574 Ga0501038_0037792 Ga0501038_0037792_260_655 130
2050 3300049574 Ga0501038_0253360 Ga0501038_0253360_982_1383 130
2051 3300049575 Ga0501039_0008753 Ga0501039_0008753_3795_4190 130
2052 3300049575 Ga0501039_0022195 Ga0501039_0022195_3083_3484 130
2053 3300049575 Ga0501039_0144921 Ga0501039_0144921_385_786 130
2054 3300049576 Ga0501040_0005765 Ga0501040_0005765_6543_6944 130
2055 3300049576 Ga0501040_0019147 Ga0501040_0019147_1737_2138 130
2056 3300049577 Ga0501041_0007293 Ga0501041_0007293_2871_3272 130
2057 3300049577 Ga0501041_0010789 Ga0501041_0010789_2366_2761 130
2058 3300049578 Ga0501042_0009161 Ga0501042_0009161_2191_2586 130
2059 3300049578 Ga0501042_0010467 Ga0501042_0010467_5555_5956 130
2060 3300049578 Ga0501042_0024297 Ga0501042_0024297_1362_1763 130
2061 3300049579 Ga0501043_0035843 Ga0501043_0035843_1392_1793 130
2062 3300049579 Ga0501043_0073758 Ga0501043_0073758_1665_2060 130
2063 3300049580 Ga0501046_0023622 Ga0501046_0023622_1754_2155 130
2064 3300049580 Ga0501046_0070065 Ga0501046_0070065_1545_1946 130
2065 3300049580 Ga0501046_0071413 Ga0501046_0071413_778_1173 130
2066 3300049582 Ga0501048_0003497 Ga0501048_0003497_6711_7112 130
2067 3300049582 Ga0501048_0008743 Ga0501048_0008743_5131_5526 130
2068 3300049582 Ga0501048_0026679 Ga0501048_0026679_2368_2769 130
2069 3300049583 Ga0501067_0035648 Ga0501067_0035648_707_1102 130
2070 3300049583 Ga0501067_0043622 Ga0501067_0043622_1765_2160 130
2071 3300049584 Ga0501068_0000588 Ga0501068_0000588_1138_1533 130
2072 3300049584 Ga0501068_0088470 Ga0501068_0088470_824_1225 130
2073 3300049585 Ga0501069_0012330 Ga0501069_0012330_3214_3609 130
2074 3300049585 Ga0501069_0030406 Ga0501069_0030406_1034_1429 130
2075 3300049585 Ga0501069_0136646 Ga0501069_0136646_609_1010 130
2076 3300049586 Ga0501070_0023773 Ga0501070_0023773_1225_1620 130
2077 3300049586 Ga0501070_0116297 Ga0501070_0116297_744_1145 130
2078 3300049586 Ga0501070_1176744 Ga0501070_1176744_151_552 130
2079 3300049587 Ga0501071_0003995 Ga0501071_0003995_7181_7582 130
2080 3300049587 Ga0501071_0015297 Ga0501071_0015297_3354_3755 130
2081 3300049587 Ga0501071_0018584 Ga0501071_0018584_3496_3891 130
2082 3300049588 Ga0501072_0001596 Ga0501072_0001596_14057_14458 130
2083 3300049588 Ga0501072_0021676 Ga0501072_0021676_4071_4466 130
2084 3300049588 Ga0501072_0027769 Ga0501072_0027769_2393_2794 130
2085 3300049588 Ga0501072_0095706 Ga0501072_0095706_636_1037 130
2086 3300049588 Ga0501072_0123521 Ga0501072_0123521_808_1209 130
2087 3300049589 Ga0501073_0705076 Ga0501073_0705076_187_588 130
2088 3300049590 Ga0501074_0025930 Ga0501074_0025930_2142_2543 130
2089 3300049590 Ga0501074_0035039 Ga0501074_0035039_2681_3076 130
2090 3300049590 Ga0501074_0318577 Ga0501074_0318577_275_676 130
2091 3300049590 Ga0501074_0698481 Ga0501074_0698481_189_584 130
2092 3300049591 Ga0501075_0009137 Ga0501075_0009137_5580_5981 130
2093 3300049591 Ga0501075_0018873 Ga0501075_0018873_1419_1814 130
2094 3300049591 Ga0501075_0029400 Ga0501075_0029400_1223_1624 130
2095 3300049592 Ga0501076_0000835 Ga0501076_0000835_752_1153 130
2096 3300049592 Ga0501076_0002323 Ga0501076_0002323_7443_7844 130
2097 3300049592 Ga0501076_0058011 Ga0501076_0058011_1010_1405 130
2098 3300049593 Ga0501077_0000235 Ga0501077_0000235_25515_25916 130
2099 3300049593 Ga0501077_0033211 Ga0501077_0033211_1062_1463 130
2100 3300049593 Ga0501077_0136515 Ga0501077_0136515_45_440 130
2101 3300049593 Ga0501077_0527308 Ga0501077_0527308_13_414 130
2102 3300049741 Ga0501079_0012020 Ga0501079_0012020_1226_1627 130
2103 3300049741 Ga0501079_0024759 Ga0501079_0024759_1802_2203 130
2104 3300049741 Ga0501079_0094508 Ga0501079_0094508_164_559 130
2105 3300049741 Ga0501079_0786610 Ga0501079_0786610_223_624 130
2106 3300049742 Ga0501080_0033082 Ga0501080_0033082_4070_4465 130
2107 3300049742 Ga0501080_0162440 Ga0501080_0162440_476_877 130
2108 3300049742 Ga0501080_0632807 Ga0501080_0632807_249_650 130
2109 3300049743 Ga0501081_0002712 Ga0501081_0002712_5650_6051 130
2110 3300049743 Ga0501081_0718213 Ga0501081_0718213_214_609 130
2111 3300049743 Ga0501081_1394395 Ga0501081_1394395_102_500 130
2112 3300049744 Ga0501083_0003161 Ga0501083_0003161_5537_5932 130
2113 3300049822 Ga0501035_0009407 Ga0501035_0009407_8397_8792 130
2114 3300049822 Ga0501035_0023178 Ga0501035_0023178_4746_5147 130
2115 3300049823 Ga0501044_0081866 Ga0501044_0081866_1809_2204 130
2116 3300049824 Ga0501045_0004724 Ga0501045_0004724_3906_4307 130
2117 3300049824 Ga0501045_0008138 Ga0501045_0008138_2444_2845 130
2118 3300049824 Ga0501045_0054887 Ga0501045_0054887_2345_2740 130
2119 3300049824 Ga0501045_0267204 Ga0501045_0267204_170_571 130
2120 3300050507 nmdc:mga05p37_1051_c1 nmdc:mga05p37_1051_c1_11935_12336 130
2121 3300050507 nmdc:mga05p37_117732_c1 nmdc:mga05p37_117732_c1_76_474 130
2122 3300050507 nmdc:mga05p37_164914_c1 nmdc:mga05p37_164914_c1_1063_1458 130
2123 3300050507 nmdc:mga05p37_271712_c1 nmdc:mga05p37_271712_c1_1400_1798 130
2124 3300050507 nmdc:mga05p37_800643_c1 nmdc:mga05p37_800643_c1_594_995 130
2125 3300050508 nmdc:mga09592_1802_c1 nmdc:mga09592_1802_c1_9091_9492 130
2126 3300050508 nmdc:mga09592_265124_c1 nmdc:mga09592_265124_c1_1031_1432 130
2127 3300050509 nmdc:mga0qj67_2704_c1 nmdc:mga0qj67_2704_c1_11761_12162 130
2128 3300050510 nmdc:mga06r32_24535_c1 nmdc:mga06r32_24535_c1_1410_1811 130
2129 3300050510 nmdc:mga06r32_721383_c1 nmdc:mga06r32_721383_c1_244_642 130
2130 3300050511 nmdc:mga08y16_703195_c1 nmdc:mga08y16_703195_c1_44_439 130
2131 3300050511 nmdc:mga08y16_893054_c1 nmdc:mga08y16_893054_c1_86_484 130
2132 3300050512 nmdc:mga0n895_1178088_c1 nmdc:mga0n895_1178088_c1_117_515 130
2133 3300050512 nmdc:mga0n895_45003_c1 nmdc:mga0n895_45003_c1_925_1320 130
2134 3300050512 nmdc:mga0n895_75310_c1 nmdc:mga0n895_75310_c1_2626_3024 130
2135 3300050513 nmdc:mga0rr50_81622_c1 nmdc:mga0rr50_81622_c1_312_707 130
2136 3300050515 nmdc:mga0a205_243635_c1 nmdc:mga0a205_243635_c1_665_1063 130
2137 3300053077 Ga0495601_0689946 Ga0495601_0689946_153_548 130
2138 3300053078 Ga0495612_0385343 Ga0495612_0385343_25_423 130
2139 3300053084 Ga0495595_0025438 Ga0495595_0025438_1754_2152 130
2140 3300053084 Ga0495595_0109964 Ga0495595_0109964_837_1232 130
2141 3300053084 Ga0495595_0302915 Ga0495595_0302915_291_686 130
2142 3300053085 Ga0495619_0030804 Ga0495619_0030804_1979_2374 130
2143 3300053085 Ga0495619_0094765 Ga0495619_0094765_517_912 130
2144 3300053085 Ga0495619_0225211 Ga0495619_0225211_890_1285 130
2145 3300054114 Ga0501084_0002602 Ga0501084_0002602_7284_7685 130
2146 3300054114 Ga0501084_0030854 Ga0501084_0030854_3064_3465 130
2147 3300054114 Ga0501084_0203854 Ga0501084_0203854_395_796 130
2148 3300054114 Ga0501084_0980126 Ga0501084_0980126_174_569 130
2149 3300060353 Ga0501082_0003201 Ga0501082_0003201_7125_7526 130
2150 3300060353 Ga0501082_0028640 Ga0501082_0028640_2829_3230 130
2151 3300060353 Ga0501082_0042024 Ga0501082_0042024_180_575 130
2152 3300061719 Ga0466962_0003363 Ga0466962_0003363_5665_6060 130
2153 3300061719 Ga0466962_0064286 Ga0466962_0064286_719_1114 130
2154 3300061734 Ga0530510_0003188 Ga0530510_0003188_2386_2787 130
2155 3300061734 Ga0530510_0033146 Ga0530510_0033146_2421_2822 130
2156 3300061734 Ga0530510_0236135 Ga0530510_0236135_561_956 130
2157 3300061734 Ga0530510_1207054 Ga0530510_1207054_39_434 130
2158 3300001990 JGI24737J22298_10088119 JGI24737J22298_100881192 131
2159 3300002076 JGI24749J21850_1034484 JGI24749J21850_10344842 131
2160 3300002077 JGI24744J21845_10007629 JGI24744J21845_100076293 131
2161 3300002244 JGI24742J22300_10010854 JGI24742J22300_100108542 131
2162 3300005329 Ga0070683_100121782 Ga0070683_1001217822 131
2163 3300005329 Ga0070683_101275318 Ga0070683_1012753181 131
2164 3300005330 Ga0070690_100027686 Ga0070690_1000276863 131
2165 3300005334 Ga0068869_100251667 Ga0068869_1002516672 131
2166 3300005335 Ga0070666_10052549 Ga0070666_100525492 131
2167 3300005336 Ga0070680_100160776 Ga0070680_1001607762 131
2168 3300005336 Ga0070680_100241847 Ga0070680_1002418472 131
2169 3300005337 Ga0070682_100056900 Ga0070682_1000569003 131
2170 3300005337 Ga0070682_100083992 Ga0070682_1000839922 131
2171 3300005337 Ga0070682_101301044 Ga0070682_1013010441 131
2172 3300005337 Ga0070682_101823976 Ga0070682_1018239761 131
2173 3300005338 Ga0068868_100040437 Ga0068868_1000404372 131
2174 3300005338 Ga0068868_100118688 Ga0068868_1001186883 131
2175 3300005338 Ga0068868_100253416 Ga0068868_1002534162 131
2176 3300005339 Ga0070660_100165983 Ga0070660_1001659832 131
2177 3300005339 Ga0070660_100332757 Ga0070660_1003327572 131
2178 3300005340 Ga0070689_100107963 Ga0070689_1001079633 131
2179 3300005343 Ga0070687_100277072 Ga0070687_1002770722 131
2180 3300005345 Ga0070692_10200976 Ga0070692_102009762 131
2181 3300005347 Ga0070668_100020729 Ga0070668_1000207295 131
2182 3300005354 Ga0070675_100062571 Ga0070675_1000625713 131
2183 3300005354 Ga0070675_100950668 Ga0070675_1009506682 131
2184 3300005355 Ga0070671_100020521 Ga0070671_1000205215 131
2185 3300005356 Ga0070674_100033830 Ga0070674_1000338302 131
2186 3300005356 Ga0070674_101066413 Ga0070674_1010664132 131
2187 3300005356 Ga0070674_101806944 Ga0070674_1018069441 131
2188 3300005364 Ga0070673_100228369 Ga0070673_1002283692 131
2189 3300005366 Ga0070659_100250419 Ga0070659_1002504192 131
2190 3300005406 Ga0070703_10001452 Ga0070703_100014526 131
2191 3300005406 Ga0070703_10077130 Ga0070703_100771302 131
2192 3300005434 Ga0070709_10077456 Ga0070709_100774562 131
2193 3300005434 Ga0070709_10082000 Ga0070709_100820002 131
2194 3300005434 Ga0070709_10109341 Ga0070709_101093412 131
2195 3300005435 Ga0070714_100088901 Ga0070714_1000889012 131
2196 3300005435 Ga0070714_100277832 Ga0070714_1002778322 131
2197 3300005436 Ga0070713_100066447 Ga0070713_1000664473 131
2198 3300005437 Ga0070710_10000963 Ga0070710_100009634 131
2199 3300005437 Ga0070710_10016371 Ga0070710_100163712 131
2200 3300005438 Ga0070701_10087453 Ga0070701_100874532 131
2201 3300005438 Ga0070701_10103662 Ga0070701_101036622 131
2202 3300005439 Ga0070711_100005662 Ga0070711_1000056627 131
2203 3300005439 Ga0070711_100030301 Ga0070711_1000303012 131
2204 3300005439 Ga0070711_100062394 Ga0070711_1000623942 131
2205 3300005439 Ga0070711_100294614 Ga0070711_1002946142 131
2206 3300005440 Ga0070705_100009370 Ga0070705_1000093703 131
2207 3300005440 Ga0070705_100075394 Ga0070705_1000753942 131
2208 3300005440 Ga0070705_100097435 Ga0070705_1000974352 131
2209 3300005441 Ga0070700_100104516 Ga0070700_1001045162 131
2210 3300005444 Ga0070694_100026337 Ga0070694_1000263371 131
2211 3300005444 Ga0070694_100186688 Ga0070694_1001866882 131
2212 3300005444 Ga0070694_100222452 Ga0070694_1002224522 131
2213 3300005445 Ga0070708_100231093 Ga0070708_1002310932 131
2214 3300005445 Ga0070708_100334070 Ga0070708_1003340702 131
2215 3300005445 Ga0070708_100426379 Ga0070708_1004263792 131
2216 3300005455 Ga0070663_100042059 Ga0070663_1000420592 131
2217 3300005456 Ga0070678_100005401 Ga0070678_1000054015 131
2218 3300005456 Ga0070678_100870780 Ga0070678_1008707802 131
2219 3300005457 Ga0070662_100752871 Ga0070662_1007528711 131
2220 3300005458 Ga0070681_10414042 Ga0070681_104140422 131
2221 3300005459 Ga0068867_100567230 Ga0068867_1005672302 131
2222 3300005466 Ga0070685_10031234 Ga0070685_100312342 131
2223 3300005467 Ga0070706_100002089 Ga0070706_1000020893 131
2224 3300005467 Ga0070706_100089835 Ga0070706_1000898353 131
2225 3300005467 Ga0070706_101099516 Ga0070706_1010995162 131
2226 3300005468 Ga0070707_100004087 Ga0070707_1000040879 131
2227 3300005468 Ga0070707_100016944 Ga0070707_1000169444 131
2228 3300005468 Ga0070707_101120201 Ga0070707_1011202012 131
2229 3300005471 Ga0070698_100015668 Ga0070698_1000156687 131
2230 3300005471 Ga0070698_100021402 Ga0070698_1000214026 131
2231 3300005518 Ga0070699_100011697 Ga0070699_1000116975 131
2232 3300005518 Ga0070699_100066789 Ga0070699_1000667892 131
2233 3300005518 Ga0070699_100081125 Ga0070699_1000811252 131
2234 3300005530 Ga0070679_100836656 Ga0070679_1008366561 131
2235 3300005535 Ga0070684_100544986 Ga0070684_1005449862 131
2236 3300005535 Ga0070684_100903042 Ga0070684_1009030421 131
2237 3300005536 Ga0070697_100189350 Ga0070697_1001893502 131
2238 3300005536 Ga0070697_100290997 Ga0070697_1002909972 131
2239 3300005536 Ga0070697_100496554 Ga0070697_1004965541 131
2240 3300005536 Ga0070697_101342646 Ga0070697_1013426462 131
2241 3300005539 Ga0068853_100019256 Ga0068853_1000192562 131
2242 3300005543 Ga0070672_100016196 Ga0070672_1000161965 131
2243 3300005543 Ga0070672_101357534 Ga0070672_1013575342 131
2244 3300005545 Ga0070695_100050461 Ga0070695_1000504612 131
2245 3300005545 Ga0070695_100057760 Ga0070695_1000577602 131
2246 3300005545 Ga0070695_100059806 Ga0070695_1000598062 131
2247 3300005545 Ga0070695_100400787 Ga0070695_1004007872 131
2248 3300005546 Ga0070696_100001718 Ga0070696_1000017182 131
2249 3300005546 Ga0070696_100005194 Ga0070696_1000051944 131
2250 3300005546 Ga0070696_100153553 Ga0070696_1001535532 131
2251 3300005546 Ga0070696_100209747 Ga0070696_1002097472 131
2252 3300005547 Ga0070693_100052108 Ga0070693_1000521082 131
2253 3300005547 Ga0070693_100056598 Ga0070693_1000565982 131
2254 3300005548 Ga0070665_100024645 Ga0070665_1000246453 131
2255 3300005548 Ga0070665_101506232 Ga0070665_1015062321 131
2256 3300005549 Ga0070704_100003463 Ga0070704_1000034639 131
2257 3300005549 Ga0070704_100079795 Ga0070704_1000797952 131
2258 3300005549 Ga0070704_100332473 Ga0070704_1003324732 131
2259 3300005549 Ga0070704_100370391 Ga0070704_1003703912 131
2260 3300005563 Ga0068855_100046318 Ga0068855_1000463183 131
2261 3300005563 Ga0068855_100485980 Ga0068855_1004859802 131
2262 3300005563 Ga0068855_101653698 Ga0068855_1016536982 131
2263 3300005577 Ga0068857_101139131 Ga0068857_1011391312 131
2264 3300005578 Ga0068854_100183278 Ga0068854_1001832782 131
2265 3300005614 Ga0068856_100142028 Ga0068856_1001420282 131
2266 3300005615 Ga0070702_100008309 Ga0070702_1000083095 131
2267 3300005615 Ga0070702_100188724 Ga0070702_1001887242 131
2268 3300005616 Ga0068852_100048012 Ga0068852_1000480122 131
2269 3300005617 Ga0068859_100065487 Ga0068859_1000654874 131
2270 3300005718 Ga0068866_10030576 Ga0068866_100305762 131
2271 3300005719 Ga0068861_100046270 Ga0068861_1000462702 131
2272 3300005719 Ga0068861_100239208 Ga0068861_1002392082 131
2273 3300005840 Ga0068870_11221454 Ga0068870_112214542 131
2274 3300005843 Ga0068860_100203861 Ga0068860_1002038612 131
2275 3300005843 Ga0068860_100439338 Ga0068860_1004393382 131
2276 3300005844 Ga0068862_100270801 Ga0068862_1002708012 131
2277 3300006038 Ga0075365_10007066 Ga0075365_100070665 131
2278 3300006163 Ga0070715_10003209 Ga0070715_100032094 131
2279 3300006173 Ga0070716_100095671 Ga0070716_1000956712 131
2280 3300006173 Ga0070716_100322502 Ga0070716_1003225022 131
2281 3300006173 Ga0070716_100380883 Ga0070716_1003808832 131
2282 3300006175 Ga0070712_100006380 Ga0070712_1000063803 131
2283 3300006175 Ga0070712_100009724 Ga0070712_1000097242 131
2284 3300006175 Ga0070712_100016655 Ga0070712_1000166554 131
2285 3300006175 Ga0070712_100019969 Ga0070712_1000199692 131
2286 3300006175 Ga0070712_100745030 Ga0070712_1007450302 131
2287 3300006237 Ga0097621_100015911 Ga0097621_1000159114 131
2288 3300006237 Ga0097621_100090698 Ga0097621_1000906981 131
2289 3300006358 Ga0068871_100100068 Ga0068871_1001000682 131
2290 3300006358 Ga0068871_100207652 Ga0068871_1002076522 131
2291 3300006844 Ga0075428_100133934 Ga0075428_1001339343 131
2292 3300006846 Ga0075430_100250663 Ga0075430_1002506632 131
2293 3300006847 Ga0075431_100052191 Ga0075431_1000521912 131
2294 3300006852 Ga0075433_10029605 Ga0075433_100296052 131
2295 3300006871 Ga0075434_100001094 Ga0075434_1000010944 131
2296 3300006871 Ga0075434_100956392 Ga0075434_1009563922 131
2297 3300006881 Ga0068865_100042186 Ga0068865_1000421862 131
2298 3300006881 Ga0068865_101204523 Ga0068865_1012045232 131
2299 3300006914 Ga0075436_100140439 Ga0075436_1001404392 131
2300 3300006914 Ga0075436_100682814 Ga0075436_1006828142 131
2301 3300006931 Ga0097620_100065488 Ga0097620_1000654884 131
2302 3300007076 Ga0075435_100084443 Ga0075435_1000844432 131
2303 3300007076 Ga0075435_100541767 Ga0075435_1005417672 131
2304 3300007265 Ga0099794_10389217 Ga0099794_103892172 131
2305 3300009094 Ga0111539_10711784 Ga0111539_107117842 131
2306 3300009098 Ga0105245_10005774 Ga0105245_100057745 131
2307 3300009098 Ga0105245_10022281 Ga0105245_100222815 131
2308 3300009098 Ga0105245_10177838 Ga0105245_101778382 131
2309 3300009147 Ga0114129_10138743 Ga0114129_101387434 131
2310 3300009147 Ga0114129_10222314 Ga0114129_102223142 131
2311 3300009147 Ga0114129_11387101 Ga0114129_113871012 131
2312 3300009147 Ga0114129_11407702 Ga0114129_114077022 131
2313 3300009147 Ga0114129_11852855 Ga0114129_118528552 131
2314 3300009148 Ga0105243_10070734 Ga0105243_100707342 131
2315 3300009148 Ga0105243_10224218 Ga0105243_102242182 131
2316 3300009174 Ga0105241_10023664 Ga0105241_100236645 131
2317 3300009174 Ga0105241_10714059 Ga0105241_107140592 131
2318 3300009176 Ga0105242_10022488 Ga0105242_100224882 131
2319 3300009176 Ga0105242_10095161 Ga0105242_100951614 131
2320 3300009176 Ga0105242_10523369 Ga0105242_105233692 131
2321 3300009176 Ga0105242_11107908 Ga0105242_111079082 131
2322 3300009176 Ga0105242_11907799 Ga0105242_119077991 131
2323 3300009176 Ga0105242_12446470 Ga0105242_124464701 131
2324 3300009177 Ga0105248_10232460 Ga0105248_102324602 131
2325 3300009551 Ga0105238_10034534 Ga0105238_100345345 131
2326 3300009553 Ga0105249_10069205 Ga0105249_100692053 131
2327 3300009553 Ga0105249_11058057 Ga0105249_110580572 131
2328 3300010375 Ga0105239_10174546 Ga0105239_101745461 131
2329 3300010375 Ga0105239_10770699 Ga0105239_107706992 131
2330 3300011119 Ga0105246_10108637 Ga0105246_101086372 131
2331 3300013100 Ga0157373_10568339 Ga0157373_105683391 131
2332 3300013296 Ga0157374_10014406 Ga0157374_100144066 131
2333 3300013296 Ga0157374_10173304 Ga0157374_101733043 131
2334 3300013297 Ga0157378_10010768 Ga0157378_100107688 131
2335 3300013297 Ga0157378_10617205 Ga0157378_106172052 131
2336 3300013306 Ga0163162_10071384 Ga0163162_100713844 131
2337 3300013306 Ga0163162_10079601 Ga0163162_100796012 131
2338 3300013307 Ga0157372_11616158 Ga0157372_116161581 131
2339 3300013308 Ga0157375_10003176 Ga0157375_100031765 131
2340 3300013308 Ga0157375_10083968 Ga0157375_100839682 131
2341 3300013308 Ga0157375_10290189 Ga0157375_102901892 131
2342 3300014325 Ga0163163_10267856 Ga0163163_102678562 131
2343 3300014326 Ga0157380_10011802 Ga0157380_100118022 131
2344 3300014745 Ga0157377_10004230 Ga0157377_100042305 131
2345 3300014745 Ga0157377_10415182 Ga0157377_104151822 131
2346 3300014968 Ga0157379_11157302 Ga0157379_111573022 131
2347 3300014969 Ga0157376_10030988 Ga0157376_100309883 131
2348 3300025885 Ga0207653_10000444 Ga0207653_100004442 131
2349 3300025885 Ga0207653_10077407 Ga0207653_100774072 131
2350 3300025898 Ga0207692_10102726 Ga0207692_101027262 131
2351 3300025898 Ga0207692_10265596 Ga0207692_102655961 131
2352 3300025899 Ga0207642_10022504 Ga0207642_100225042 131
2353 3300025901 Ga0207688_10176672 Ga0207688_101766723 131
2354 3300025905 Ga0207685_10040486 Ga0207685_100404862 131
2355 3300025906 Ga0207699_10089942 Ga0207699_100899422 131
2356 3300025906 Ga0207699_10125084 Ga0207699_101250842 131
2357 3300025906 Ga0207699_10482892 Ga0207699_104828922 131
2358 3300025909 Ga0207705_10045329 Ga0207705_100453294 131
2359 3300025910 Ga0207684_10067280 Ga0207684_100672802 131
2360 3300025910 Ga0207684_10210455 Ga0207684_102104552 131
2361 3300025911 Ga0207654_10005891 Ga0207654_100058912 131
2362 3300025914 Ga0207671_10203412 Ga0207671_102034122 131
2363 3300025915 Ga0207693_10000319 Ga0207693_1000031910 131
2364 3300025915 Ga0207693_10000873 Ga0207693_100008732 131
2365 3300025915 Ga0207693_10014815 Ga0207693_100148154 131
2366 3300025915 Ga0207693_10076123 Ga0207693_100761233 131
2367 3300025915 Ga0207693_10851983 Ga0207693_108519832 131
2368 3300025916 Ga0207663_10004662 Ga0207663_100046622 131
2369 3300025916 Ga0207663_10033310 Ga0207663_100333102 131
2370 3300025917 Ga0207660_10050845 Ga0207660_100508452 131
2371 3300025917 Ga0207660_10377853 Ga0207660_103778532 131
2372 3300025918 Ga0207662_10082257 Ga0207662_100822572 131
2373 3300025919 Ga0207657_10052886 Ga0207657_100528864 131
2374 3300025919 Ga0207657_10150458 Ga0207657_101504582 131
2375 3300025920 Ga0207649_10602840 Ga0207649_106028402 131
2376 3300025921 Ga0207652_10581980 Ga0207652_105819802 131
2377 3300025922 Ga0207646_10002219 Ga0207646_100022194 131
2378 3300025922 Ga0207646_10004521 Ga0207646_1000452114 131
2379 3300025922 Ga0207646_10898723 Ga0207646_108987232 131
2380 3300025927 Ga0207687_10124484 Ga0207687_101244842 131
2381 3300025927 Ga0207687_11280453 Ga0207687_112804532 131
2382 3300025929 Ga0207664_10170918 Ga0207664_101709182 131
2383 3300025932 Ga0207690_10750591 Ga0207690_107505912 131
2384 3300025933 Ga0207706_10502889 Ga0207706_105028892 131
2385 3300025934 Ga0207686_10074388 Ga0207686_100743882 131
2386 3300025934 Ga0207686_10162624 Ga0207686_101626242 131
2387 3300025934 Ga0207686_10255608 Ga0207686_102556082 131
2388 3300025934 Ga0207686_10577641 Ga0207686_105776412 131
2389 3300025935 Ga0207709_10002442 Ga0207709_1000244210 131
2390 3300025935 Ga0207709_10114369 Ga0207709_101143692 131
2391 3300025936 Ga0207670_10244305 Ga0207670_102443052 131
2392 3300025937 Ga0207669_10056928 Ga0207669_100569283 131
2393 3300025937 Ga0207669_10297106 Ga0207669_102971062 131
2394 3300025937 Ga0207669_10426984 Ga0207669_104269842 131
2395 3300025938 Ga0207704_10190562 Ga0207704_101905622 131
2396 3300025939 Ga0207665_10033154 Ga0207665_100331542 131
2397 3300025939 Ga0207665_10664316 Ga0207665_106643162 131
2398 3300025940 Ga0207691_10055535 Ga0207691_100555351 131
2399 3300025941 Ga0207711_10120937 Ga0207711_101209372 131
2400 3300025942 Ga0207689_10129560 Ga0207689_101295602 131
2401 3300025942 Ga0207689_10629365 Ga0207689_106293652 131
2402 3300025944 Ga0207661_10114578 Ga0207661_101145782 131
2403 3300025944 Ga0207661_10145999 Ga0207661_101459992 131
2404 3300025944 Ga0207661_10998619 Ga0207661_109986191 131
2405 3300025949 Ga0207667_10485008 Ga0207667_104850082 131
2406 3300025949 Ga0207667_10540927 Ga0207667_105409272 131
2407 3300025960 Ga0207651_10265850 Ga0207651_102658502 131
2408 3300025961 Ga0207712_10007608 Ga0207712_100076082 131
2409 3300025961 Ga0207712_10075216 Ga0207712_100752162 131
2410 3300025972 Ga0207668_10013062 Ga0207668_100130625 131
2411 3300025972 Ga0207668_10138569 Ga0207668_101385692 131
2412 3300025972 Ga0207668_10652392 Ga0207668_106523922 131
2413 3300025981 Ga0207640_10548140 Ga0207640_105481402 131
2414 3300025986 Ga0207658_10325307 Ga0207658_103253072 131
2415 3300026023 Ga0207677_10131983 Ga0207677_101319832 131
2416 3300026023 Ga0207677_10394832 Ga0207677_103948322 131
2417 3300026067 Ga0207678_10004701 Ga0207678_100047017 131
2418 3300026075 Ga0207708_10000361 Ga0207708_1000036127 131
2419 3300026075 Ga0207708_10596700 Ga0207708_105967002 131
2420 3300026078 Ga0207702_10164508 Ga0207702_101645082 131
2421 3300026089 Ga0207648_10000504 Ga0207648_1000050425 131
2422 3300026118 Ga0207675_100004186 Ga0207675_1000041865 131
2423 3300026118 Ga0207675_100006263 Ga0207675_1000062638 131
2424 3300026121 Ga0207683_10008067 Ga0207683_100080678 131
2425 3300026121 Ga0207683_10009086 Ga0207683_100090863 131
2426 3300026121 Ga0207683_10486546 Ga0207683_104865462 131
2427 3300026121 Ga0207683_10549203 Ga0207683_105492032 131
2428 3300026142 Ga0207698_10121799 Ga0207698_101217993 131
2429 3300028379 Ga0268266_10515811 Ga0268266_105158112 131
2430 3300028381 Ga0268264_10065651 Ga0268264_100656512 131
2431 3300028381 Ga0268264_10328597 Ga0268264_103285972 131
2432 3300031901 Ga0307406_10344463 Ga0307406_103444632 131
2433 3300034818 Ga0373950_0015614 Ga0373950_0015614_781_1182 131
2434 3300035084 Ga0373928_0009325 Ga0373928_0009325_1173_1574 131
2435 3300035085 Ga0373929_0105365 Ga0373929_0105365_54_455 131
2436 3300035088 Ga0373940_0005004 Ga0373940_0005004_108_509 131
2437 3300035090 Ga0373949_0006396 Ga0373949_0006396_781_1182 131
2438 3300035091 Ga0373951_0032073 Ga0373951_0032073_619_1020 131
2439 3300035092 Ga0373952_0021926 Ga0373952_0021926_16_417 131
2440 3300035112 Ga0373932_0011109 Ga0373932_0011109_1303_1704 131
2441 3300035114 Ga0373939_0000399 Ga0373939_0000399_8737_9138 131
2442 3300035121 Ga0373960_0003233 Ga0373960_0003233_2781_3182 131
2443 3300035242 Ga0373962_0003959 Ga0373962_0003959_373_774 131
2444 3300035691 Ga0373931_0005648 Ga0373931_0005648_4904_5305 131
2445 3300035691 Ga0373931_0392084 Ga0373931_0392084_133_534 131
2446 3300035725 Ga0373947_0669029 Ga0373947_0669029_83_478 131
2447 3300035725 Ga0373947_0748445 Ga0373947_0748445_58_453 131
2448 3300037068 Ga0373925_0396519 Ga0373925_0396519_292_687 131
2449 3300037312 Ga0395899_0002677 Ga0395899_0002677_3814_4212 131
2450 3300037312 Ga0395899_0005165 Ga0395899_0005165_3179_3577 131
2451 3300037312 Ga0395899_0016240 Ga0395899_0016240_2152_2547 131
2452 3300037312 Ga0395899_0166757 Ga0395899_0166757_378_776 131
2453 3300037312 Ga0395899_0296443 Ga0395899_0296443_183_581 131
2454 3300037312 Ga0395899_0341860 Ga0395899_0341860_473_871 131
2455 3300037418 Ga0395900_0002314 Ga0395900_0002314_8452_8850 131
2456 3300037418 Ga0395900_0011172 Ga0395900_0011172_6707_7105 131
2457 3300037418 Ga0395900_0015616 Ga0395900_0015616_817_1215 131
2458 3300037418 Ga0395900_0016527 Ga0395900_0016527_113_508 131
2459 3300037418 Ga0395900_0030387 Ga0395900_0030387_3211_3612 131
2460 3300037418 Ga0395900_0057375 Ga0395900_0057375_799_1197 131
2461 3300037418 Ga0395900_0067125 Ga0395900_0067125_2655_3050 131
2462 3300037418 Ga0395900_0322795 Ga0395900_0322795_114_509 131
2463 3300037418 Ga0395900_0437702 Ga0395900_0437702_603_1001 131
2464 3300037418 Ga0395900_0479444 Ga0395900_0479444_499_900 131
2465 3300037418 Ga0395900_0562978 Ga0395900_0562978_38_436 131
2466 3300037418 Ga0395900_0564491 Ga0395900_0564491_417_812 131
2467 3300037418 Ga0395900_1184534 Ga0395900_1184534_72_467 131
2468 3300037466 Ga0395898_0006611 Ga0395898_0006611_10766_11164 131
2469 3300037466 Ga0395898_0015998 Ga0395898_0015998_7020_7415 131
2470 3300037466 Ga0395898_0028887 Ga0395898_0028887_393_794 131
2471 3300037466 Ga0395898_0029726 Ga0395898_0029726_873_1271 131
2472 3300037466 Ga0395898_0032953 Ga0395898_0032953_3274_3672 131
2473 3300037466 Ga0395898_0166643 Ga0395898_0166643_1224_1622 131
2474 3300037466 Ga0395898_0221528 Ga0395898_0221528_1230_1631 131
2475 3300037466 Ga0395898_0414294 Ga0395898_0414294_808_1203 131
2476 3300037466 Ga0395898_0722468 Ga0395898_0722468_532_927 131
2477 3300037466 Ga0395898_1501567 Ga0395898_1501567_125_520 131
2478 3300037471 Ga0395905_0011264 Ga0395905_0011264_6992_7393 131
2479 3300037471 Ga0395905_0012413 Ga0395905_0012413_786_1181 131
2480 3300037471 Ga0395905_0014166 Ga0395905_0014166_501_899 131
2481 3300037471 Ga0395905_0076164 Ga0395905_0076164_1339_1737 131
2482 3300037471 Ga0395905_0088030 Ga0395905_0088030_404_802 131
2483 3300037471 Ga0395905_0118658 Ga0395905_0118658_1919_2317 131
2484 3300037471 Ga0395905_0215311 Ga0395905_0215311_590_988 131
2485 3300037471 Ga0395905_0820500 Ga0395905_0820500_314_709 131
2486 3300038443 Ga0395901_0009150 Ga0395901_0009150_9408_9803 131
2487 3300038443 Ga0395901_0011611 Ga0395901_0011611_1756_2157 131
2488 3300038443 Ga0395901_0016092 Ga0395901_0016092_1468_1866 131
2489 3300038443 Ga0395901_0017354 Ga0395901_0017354_745_1140 131
2490 3300038443 Ga0395901_0044094 Ga0395901_0044094_586_984 131
2491 3300038443 Ga0395901_0070697 Ga0395901_0070697_2544_2942 131
2492 3300038443 Ga0395901_0104667 Ga0395901_0104667_1129_1527 131
2493 3300038443 Ga0395901_0327041 Ga0395901_0327041_798_1196 131
2494 3300038443 Ga0395901_0445022 Ga0395901_0445022_489_884 131
2495 3300038443 Ga0395901_0547206 Ga0395901_0547206_230_625 131
2496 3300038443 Ga0395901_1092544 Ga0395901_1092544_11_409 131
2497 3300041511 Ga0451855_0430449 Ga0451855_0430449_573_974 131
2498 3300044706 Ga0466964_0005622 Ga0466964_0005622_4008_4409 131
2499 3300044901 Ga0466960_0002920 Ga0466960_0002920_4451_4852 131
2500 3300044901 Ga0466960_0050369 Ga0466960_0050369_866_1267 131
2501 3300045976 Ga0466967_0000318 Ga0466967_0000318_19354_19755 131
2502 3300046455 Ga0495603_0381581 Ga0495603_0381581_58_453 131
2503 3300046461 Ga0495641_0059752 Ga0495641_0059752_1273_1668 131
2504 3300046472 Ga0495580_1008683 Ga0495580_1008683_105_500 131
2505 3300046473 Ga0495582_0113289 Ga0495582_0113289_395_790 131
2506 3300046473 Ga0495582_0187405 Ga0495582_0187405_333_728 131
2507 3300046474 Ga0495605_0134421 Ga0495605_0134421_631_1026 131
2508 3300046475 Ga0495639_0029734 Ga0495639_0029734_441_836 131
2509 3300046476 Ga0495662_0031185 Ga0495662_0031185_1843_2238 131
2510 3300046491 Ga0495584_0063867 Ga0495584_0063867_409_804 131
2511 3300046491 Ga0495584_0086267 Ga0495584_0086267_904_1305 131
2512 3300046492 Ga0495585_0068828 Ga0495585_0068828_1438_1833 131
2513 3300046513 Ga0495616_0204705 Ga0495616_0204705_190_585 131
2514 3300046517 Ga0495630_0028880 Ga0495630_0028880_3086_3481 131
2515 3300046518 Ga0495631_0052677 Ga0495631_0052677_951_1346 131
2516 3300046525 Ga0495663_0033145 Ga0495663_0033145_1088_1483 131
2517 3300046528 Ga0495642_0150006 Ga0495642_0150006_248_649 131
2518 3300046539 Ga0495621_0398962 Ga0495621_0398962_154_549 131
2519 3300046616 Ga0495668_0116491 Ga0495668_0116491_643_1038 131
2520 3300046648 Ga0495611_0408547 Ga0495611_0408547_112_507 131
2521 3300046665 Ga0495661_0511175 Ga0495661_0511175_137_532 131
2522 3300046674 Ga0495588_0032981 Ga0495588_0032981_1469_1864 131
2523 3300046683 Ga0495658_0180331 Ga0495658_0180331_735_1130 131
2524 3300046689 Ga0495613_0073212 Ga0495613_0073212_298_693 131
2525 3300046690 Ga0495624_0425834 Ga0495624_0425834_228_623 131
2526 3300046692 Ga0495671_0058342 Ga0495671_0058342_272_667 131
2527 3300046692 Ga0495671_0133012 Ga0495671_0133012_189_584 131
2528 3300046794 Ga0495589_0049909 Ga0495589_0049909_1134_1529 131
2529 3300047315 Ga0495581_0000297 Ga0495581_0000297_7700_8095 131
2530 3300047315 Ga0495581_0146970 Ga0495581_0146970_286_681 131
2531 3300047321 Ga0495676_0219113 Ga0495676_0219113_523_918 131
2532 3300047445 Ga0495677_0037077 Ga0495677_0037077_876_1271 131
2533 3300047470 Ga0495681_0270214 Ga0495681_0270214_88_483 131
2534 3300048903 Ga0496100_0001414 Ga0496100_0001414_7985_8386 131
2535 3300048903 Ga0496100_0132628 Ga0496100_0132628_731_1126 131
2536 3300048904 Ga0496101_0013867 Ga0496101_0013867_2829_3230 131
2537 3300048904 Ga0496101_0017689 Ga0496101_0017689_2135_2530 131
2538 3300048904 Ga0496101_0085940 Ga0496101_0085940_1845_2240 131
2539 3300048904 Ga0496101_0192851 Ga0496101_0192851_1083_1478 131
2540 3300048904 Ga0496101_1137930 Ga0496101_1137930_160_564 131
2541 3300048905 Ga0496102_0021074 Ga0496102_0021074_3927_4328 131
2542 3300048906 Ga0496103_0016207 Ga0496103_0016207_1630_2031 131
2543 3300048906 Ga0496103_0086280 Ga0496103_0086280_546_941 131
2544 3300048906 Ga0496103_0741431 Ga0496103_0741431_186_581 131
2545 3300048907 Ga0496104_0036334 Ga0496104_0036334_3916_4311 131
2546 3300048907 Ga0496104_0100133 Ga0496104_0100133_1483_1878 131
2547 3300048907 Ga0496104_0106602 Ga0496104_0106602_782_1183 131
2548 3300048907 Ga0496104_0168760 Ga0496104_0168760_414_818 131
2549 3300048908 Ga0496105_0005915 Ga0496105_0005915_3404_3805 131
2550 3300048908 Ga0496105_0032128 Ga0496105_0032128_3772_4167 131
2551 3300048908 Ga0496105_0130404 Ga0496105_0130404_420_815 131
2552 3300048909 Ga0496106_0007848 Ga0496106_0007848_3118_3519 131
2553 3300048909 Ga0496106_0056058 Ga0496106_0056058_448_849 131
2554 3300048910 Ga0496107_0036862 Ga0496107_0036862_529_924 131
2555 3300048910 Ga0496107_0147560 Ga0496107_0147560_580_981 131
2556 3300048910 Ga0496107_0226203 Ga0496107_0226203_851_1246 131
2557 3300048910 Ga0496107_0442359 Ga0496107_0442359_540_935 131
2558 3300048911 Ga0496108_0001586 Ga0496108_0001586_6990_7391 131
2559 3300048911 Ga0496108_0091836 Ga0496108_0091836_2047_2451 131
2560 3300048911 Ga0496108_0191554 Ga0496108_0191554_1181_1576 131
2561 3300048912 Ga0496109_0016975 Ga0496109_0016975_2615_3016 131
2562 3300048912 Ga0496109_0041406 Ga0496109_0041406_1529_1924 131
2563 3300048912 Ga0496109_0234154 Ga0496109_0234154_455_859 131
2564 3300048913 Ga0496110_0034638 Ga0496110_0034638_1706_2101 131
2565 3300048913 Ga0496110_0113280 Ga0496110_0113280_972_1373 131
2566 3300048913 Ga0496110_0349283 Ga0496110_0349283_302_703 131
2567 3300048913 Ga0496110_0698285 Ga0496110_0698285_72_476 131
2568 3300048914 Ga0496111_0028943 Ga0496111_0028943_1158_1559 131
2569 3300048914 Ga0496111_0047910 Ga0496111_0047910_2578_2973 131
2570 3300048914 Ga0496111_0075380 Ga0496111_0075380_395_796 131
2571 3300048914 Ga0496111_0127649 Ga0496111_0127649_486_881 131
2572 3300048915 Ga0496112_0018653 Ga0496112_0018653_1114_1509 131
2573 3300048915 Ga0496112_0093452 Ga0496112_0093452_1199_1594 131
2574 3300048915 Ga0496112_0115287 Ga0496112_0115287_1092_1493 131
2575 3300048915 Ga0496112_0157197 Ga0496112_0157197_1343_1741 131
2576 3300048915 Ga0496112_0885686 Ga0496112_0885686_146_541 131
2577 3300048916 Ga0496113_0048987 Ga0496113_0048987_1592_1987 131
2578 3300048916 Ga0496113_0066840 Ga0496113_0066840_1104_1499 131
2579 3300048916 Ga0496113_0081830 Ga0496113_0081830_1503_1904 131
2580 3300048917 Ga0496114_0027761 Ga0496114_0027761_2822_3223 131
2581 3300048917 Ga0496114_0093650 Ga0496114_0093650_84_479 131
2582 3300048917 Ga0496114_0181749 Ga0496114_0181749_154_549 131
2583 3300048917 Ga0496114_0688472 Ga0496114_0688472_283_678 131
2584 3300048918 Ga0496115_0032267 Ga0496115_0032267_2949_3350 131
2585 3300048918 Ga0496115_0081570 Ga0496115_0081570_1510_1905 131
2586 3300049587 Ga0501071_0924787 Ga0501071_0924787_119_517 131
2587 3300050492 nmdc:mga0yw44_37882_c1 nmdc:mga0yw44_37882_c1_928_1323 131
2588 3300050507 nmdc:mga05p37_17988_c1 nmdc:mga05p37_17988_c1_7471_7872 131
2589 3300050507 nmdc:mga05p37_258345_c1 nmdc:mga05p37_258345_c1_1231_1692 131
2590 3300050507 nmdc:mga05p37_372652_c1 nmdc:mga05p37_372652_c1_1266_1664 131
2591 3300050507 nmdc:mga05p37_698884_c1 nmdc:mga05p37_698884_c1_176_577 131
2592 3300050507 nmdc:mga05p37_702131_c1 nmdc:mga05p37_702131_c1_402_797 131
2593 3300050509 nmdc:mga0qj67_316860_c1 nmdc:mga0qj67_316860_c1_12_410 131
2594 3300050510 nmdc:mga06r32_59082_c1 nmdc:mga06r32_59082_c1_736_1134 131
2595 3300050510 nmdc:mga06r32_828176_c1 nmdc:mga06r32_828176_c1_452_850 131
2596 3300050512 nmdc:mga0n895_221126_c1 nmdc:mga0n895_221126_c1_819_1220 131
2597 3300050512 nmdc:mga0n895_3549_c1 nmdc:mga0n895_3549_c1_708_1109 131
2598 3300050513 nmdc:mga0rr50_239272_c1 nmdc:mga0rr50_239272_c1_263_724 131
2599 3300050513 nmdc:mga0rr50_99956_c1 nmdc:mga0rr50_99956_c1_232_633 131
2600 3300050514 nmdc:mga08x19_576849_c1 nmdc:mga08x19_576849_c1_141_542 131
2601 3300050514 nmdc:mga08x19_83293_c1 nmdc:mga08x19_83293_c1_938_1339 131
2602 3300050515 nmdc:mga0a205_223848_c1 nmdc:mga0a205_223848_c1_1165_1581 131
2603 3300053083 Ga0495655_0027689 Ga0495655_0027689_34_429 131
2604 3300053083 Ga0495655_0151980 Ga0495655_0151980_243_638 131
2605 3300054114 Ga0501084_0504241 Ga0501084_0504241_431_829 131

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03652

RuvX

Holliday junction resolvase

1

125

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
7w89-assembly1.cif.gz_A the structure of deinococcus radiodurans yqgf 0.8586 2 124
1nmn-assembly1.cif.gz_A structure of yqgf from escherichia coli, a hypothetical protein 0.8469 2 125
1nmn-assembly2.cif.gz_B structure of yqgf from escherichia coli, a hypothetical protein 0.8468 2 124
7ess-assembly1.cif.gz_B structure-guided studies of the holliday junction resolvase ruvx provide novel insights into atp-stimulated cleavage of branched dna and rna substrates 0.844 2 131
7ess-assembly1.cif.gz_A structure-guided studies of the holliday junction resolvase ruvx provide novel insights into atp-stimulated cleavage of branched dna and rna substrates 0.8418 2 131
ID Description Score Start End Superfamily
af_P9WGV7_22_163_3.30.420.140 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;YqgF/RNase H-like domain 0.8803 1 129 3.30.420.140
af_P9WGV7_22_163_3.30.420.140 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;YqgF/RNase H-like domain 0.8613 1 129 3.30.420.140
af_Q2FXW1_3_142_3.30.420.140 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;YqgF/RNase H-like domain 0.8475 2 126 3.30.420.140
1nu0A00 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;YqgF/RNase H-like domain 0.8061 2 124 3.30.420.140
af_Q2FXW1_3_142_3.30.420.140 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;YqgF/RNase H-like domain 0.8049 2 126 3.30.420.140
ID Description Score Start End GO Terms
AF-X1G2L9-F1-model_v4 YqgF/RNase H-like domain-containing protein 0.959 1 88 GO:0000967
GO:0004518
GO:0005829
AF-A0A833LGW3-F1-model_v4 Holliday junction resolvase RuvX 0.957 2 90 GO:0000967
GO:0004518
GO:0005829
AF-A0A538CFG6-F1-model_v4 Putative pre-16S rRNA nuclease (EC 3.1.-.-) 0.9542 1 126 GO:0000967
GO:0004518
GO:0005829
AF-A0A1W9VMU1-F1-model_v4 YqgF/RNase H-like domain-containing protein 0.9506 2 83 GO:0000967
GO:0004518
GO:0005829
AF-A0A2N3AJ63-F1-model_v4 Holliday junction resolvase RuvX 0.95 1 93 GO:0000967
GO:0004518
GO:0005829

Feature Viewer

pLDDT pTM Quality
86.83 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map