F496219

General Info

Members Datasets Scaffolds Average Seq Length
1994 1328 1098 270

Family's Representative Sequence

Representative Sequence 3300049571|Ga0501034_0060256|Ga0501034_0060256_503_1333
Length 276
Sequence MAMNGNGKSNGAQSDVIIGVRDLVVGFGAANVLDHLDLDVYRGEILGFVGASGAGKSVLMRTIIGLLPRRAGEITVLGVELSKATEKERRAVERRWGVLFQHGALFSSLTVAENIQFPMREYLKLSQQLMDEIAVAKLEMVGLDPSVRGKYPSELSGGMIKRLARALALDPDILFLDEPTSGLDPIGAGDFDELIATMQRTLGLTVFMVTHDLDSLHTVCDRIAVLAEGKVIAAGTMDVMLASQHPWLKAYFHGKRARAVGAAASGQTAGAIAPGR

Samples

Sample ID Description Type Environment
1 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
2 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
3 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
4 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
5 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
6 2509276019 Ensifer aridi TW10 Isolate Nodule
7 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
8 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
9 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
10 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
11 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
12 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
13 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
14 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
15 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
16 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
17 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
18 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
19 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
20 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
21 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
22 2512875024 Mesorhizobium loti R88b Isolate Nodule
23 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
24 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
25 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
26 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
27 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
28 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
29 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
30 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
31 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
32 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
33 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
34 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
35 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
36 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
37 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
38 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
39 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
40 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
41 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
42 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
43 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
44 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
45 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
46 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
47 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
48 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
49 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
50 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
51 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
52 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
53 2516143018 Ensifer sp. BR816 Isolate Nodule
54 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
55 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
56 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
57 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
58 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
59 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
60 2519899620 Rhizobium sp. Pop5 Isolate Nodule
61 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
62 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
63 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
64 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
65 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
66 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
67 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
68 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
69 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
70 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
71 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
72 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
73 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
74 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
75 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
76 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
77 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
78 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
79 2558860983 Allorhizobium undicola ATCC 700741 Isolate Rhizoplane
80 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
81 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
82 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
83 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
84 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
85 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
86 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
87 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
88 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
89 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
90 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
91 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
92 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
93 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
94 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
95 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
96 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
97 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
98 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
99 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
100 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
101 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
102 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
103 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
104 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
105 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
106 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
107 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
108 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
109 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
110 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
111 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
112 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
113 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
114 2600254933 Rhizobium sp. NFR12 Isolate Rhizoplane
115 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
116 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
117 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
118 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
119 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
120 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
121 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
122 2643221550 Mesorhizobium sp. Root552 Isolate Unclassified
123 2643221551 Mesorhizobium sp. Root1471 Isolate Unclassified
124 2643221555 Mesorhizobium sp. Root554 Isolate Unclassified
125 2643221557 Ensifer sp. Root558 Isolate Unclassified
126 2643221558 Rhizobium sp. Root149 Isolate Unclassified
127 2643221564 Mesorhizobium sp. Root157 Isolate Unclassified
128 2643221568 Rhizobium sp. Root564 Isolate Unclassified
129 2643221582 Rhizobium sp. Root651 Isolate Unclassified
130 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
131 2643221599 Rhizobium sp. Root708 Isolate Unclassified
132 2643221607 Rhizobium sp. Root73 Isolate Unclassified
133 2643221610 Ensifer sp. Root74 Isolate Unclassified
134 2643221618 Ensifer sp. Root231 Isolate Unclassified
135 2643221623 Aminobacter sp. DSM 101952 Root100 Isolate Unclassified
136 2643221626 Ensifer sp. Root31 Isolate Unclassified
137 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
138 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
139 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
140 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
141 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
142 2643221651 Afipia sp. Root123D2 Isolate Unclassified
143 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
144 2643221655 Ensifer sp. Root1252 Isolate Unclassified
145 2643221659 Ensifer sp. Root127 Isolate Unclassified
146 2643221668 Ensifer sp. Root423 Isolate Unclassified
147 2643221675 Ensifer sp. Root1298 Isolate Unclassified
148 2643221680 Ensifer sp. Root1312 Isolate Unclassified
149 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
150 2643221688 Rhizobium sp. Root482 Isolate Unclassified
151 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
152 2643221693 Rhizobium sp. Root491 Isolate Unclassified
153 2643221698 Ensifer sp. Root142 Isolate Unclassified
154 2643221712 Ensifer sp. Root258 Isolate Unclassified
155 2643221718 Rhizobium sp. Root268 Isolate Unclassified
156 2643221719 Rhizobium sp. Root274 Isolate Unclassified
157 2643221723 Ensifer sp. Root278 Isolate Unclassified
158 2643221726 Ensifer sp. Root954 Isolate Unclassified
159 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
160 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
161 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
162 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
163 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
164 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
165 2718217882 Rhizobium sp. N741 Isolate Nodule
166 2718217927 Rhizobium sp. N324 Isolate Nodule
167 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
168 2718218009 Rhizobium sp. N561 Isolate Nodule
169 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
170 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
171 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
172 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
173 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
174 2718218363 Rhizobium sp. N113 Isolate Nodule
175 2718218365 Rhizobium sp. N731 Isolate Nodule
176 2718218366 Rhizobium sp. N621 Isolate Nodule
177 2718218423 Rhizobium sp. N941 Isolate Nodule
178 2721755514 Rhizobium sp. N6212 Isolate Nodule
179 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
180 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
181 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
182 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
183 2721755809 Rhizobium sp. N541 Isolate Nodule
184 2721755810 Rhizobium sp. N871 Isolate Nodule
185 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
186 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
187 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
188 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
189 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
190 2728369365 Rhizobium sp. N1341 Isolate Nodule
191 2728369397 Rhizobium sp. N1314 Isolate Nodule
192 2738541293 Rhizobium sp. GV031 Isolate Unclassified
193 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
194 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
195 2738543024 Aminobacter sp. AP02 Isolate Unclassified
196 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
197 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
198 2757320392 Phyllobacterium leguminum ORS 1419 Isolate Nodule
199 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
200 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
201 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
202 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
203 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
204 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
205 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
206 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
207 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
208 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
209 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
210 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
211 2791355253 Rhizobium rhizosphaerae RD15 Isolate Rhizosphere
212 2791355256 Rhizobium sp. M10 Isolate Nodule
213 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
214 2791355260 Rhizobium sp. L9 Isolate Nodule
215 2791355261 Rhizobium sp. J15 Isolate Nodule
216 2791355262 Rhizobium sp. M1 Isolate Nodule
217 2791355263 Rhizobium chutanense C5 Isolate Nodule
218 2791355264 Rhizobium sp. S9 Isolate Nodule
219 2791355265 Rhizobium sp. H4 Isolate Nodule
220 2791355266 Rhizobium sp. L43 Isolate Nodule
221 2791355267 Rhizobium sp. L18 Isolate Nodule
222 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
223 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
224 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
225 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
226 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
227 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
228 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
229 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
230 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
231 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
232 2802429633 Rhizobium anhuiense J3 Isolate Nodule
233 2802429634 Rhizobium anhuiense S10 Isolate Nodule
234 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
235 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
236 2802429637 Rhizobium anhuiense C15 Isolate Nodule
237 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
238 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
239 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
240 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
241 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
242 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
243 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
244 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
245 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
246 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
247 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
248 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
249 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
250 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
251 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
252 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
253 2838048938 Rhizobium pisi 27/80 Isolate Nodule
254 2838061910 Rhizobium phaseoli L15 Isolate Nodule
255 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
256 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
257 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
258 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
259 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
260 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
261 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
262 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
263 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
264 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
265 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
266 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
267 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
268 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
269 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
270 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
271 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
272 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
273 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
274 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
275 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
276 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
277 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
278 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
279 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
280 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
281 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
282 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
283 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
284 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
285 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
286 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
287 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
288 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
289 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
290 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
291 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
292 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
293 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
294 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
295 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
296 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
297 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
298 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
299 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
300 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
301 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
302 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
303 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
304 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
305 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
306 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
307 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
308 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
309 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
310 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
311 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
312 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
313 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
314 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
315 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
316 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
317 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
318 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
319 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
320 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
321 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
322 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
323 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
324 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
325 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
326 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
327 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
328 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
329 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
330 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
331 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
332 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
333 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
334 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
335 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
336 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
337 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
338 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
339 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
340 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
341 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
342 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
343 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
344 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
345 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
346 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
347 2844163670 Ensifer sp. 1H6 Isolate Unclassified
348 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
349 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
350 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
351 2847686936 Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 Isolate Nodule
352 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
353 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
354 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
355 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
356 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
357 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
358 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
359 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
360 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
361 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
362 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
363 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
364 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
365 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
366 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
367 2856349417 Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 Isolate Nodule
368 2856356410 Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 Isolate Nodule
369 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
370 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
371 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
372 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
373 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
374 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
375 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
376 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
377 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
378 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
379 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
380 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
381 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
382 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
383 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
384 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
385 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
386 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
387 2871444079 Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 Isolate Nodule
388 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
389 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
390 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
391 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
392 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
393 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
394 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
395 2874102143 Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 Isolate Nodule
396 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
397 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
398 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
399 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
400 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
401 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
402 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
403 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
404 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
405 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
406 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
407 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
408 2876369609 Mesorhizobium sp. USDA-HM6 Isolate Unclassified
409 2876377896 Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 Isolate Nodule
410 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
411 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
412 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
413 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
414 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
415 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
416 2878730984 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 Isolate Nodule
417 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
418 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
419 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
420 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
421 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
422 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
423 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
424 2878788777 Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 Isolate Nodule
425 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
426 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
427 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
428 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
429 2881853255 Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 Isolate Nodule
430 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
431 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
432 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
433 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
434 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
435 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
436 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
437 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
438 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
439 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
440 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
441 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
442 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
443 2889790730 Chelativorans xinjiangense lm93 Isolate Rhizosphere
444 2889914905 Chelativorans alearense UJN715 Isolate Rhizosphere
445 2891048133 Martelella lutilitoris GH2-6 Isolate Rhizosphere
446 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
447 2894652903 Phyllobacterium sp. SYP-B3895 Isolate Rhizosphere
448 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
449 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
450 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
451 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
452 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
453 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
454 2903513507 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 Isolate Nodule
455 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
456 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
457 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
458 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
459 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
460 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
461 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
462 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
463 2906354277 Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 Isolate Nodule
464 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
465 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
466 2906378014 Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 Isolate Nodule
467 2906386501 Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 Isolate Nodule
468 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
469 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
470 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
471 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
472 2906427513 Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 Isolate Nodule
473 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
474 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
475 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
476 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
477 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
478 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
479 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
480 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
481 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
482 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
483 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
484 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
485 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
486 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
487 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
488 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
489 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
490 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
491 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
492 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
493 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
494 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
495 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
496 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
497 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
498 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
499 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
500 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
501 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
502 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
503 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
504 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
505 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
506 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
507 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
508 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
509 2922158528 Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 Isolate Nodule
510 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
511 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
512 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
513 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
514 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
515 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
516 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
517 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
518 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
519 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
520 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
521 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
522 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
523 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
524 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
525 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
526 2924726620 Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 Isolate Nodule
527 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
528 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
529 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
530 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
531 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
532 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
533 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
534 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
535 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
536 2928521798 Phyllobacterium ifriqiyense 1451 Isolate Rhizosphere
537 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
538 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
539 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
540 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
541 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
542 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
543 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
544 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
545 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
546 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
547 2933599457 Rhizobium phaseoli M3 Isolate Nodule
548 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
549 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
550 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
551 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
552 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
553 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
554 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
555 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
556 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
557 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
558 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
559 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
560 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
561 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
562 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
563 2936381700 Rhizobium chutanense C16 Isolate Unclassified
564 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
565 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
566 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
567 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
568 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
569 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
570 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
571 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
572 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
573 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
574 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
575 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
576 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
577 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
578 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
579 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
580 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
581 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
582 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
583 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
584 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
585 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
586 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
587 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere
588 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
589 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
590 2937868953 Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 Isolate Nodule
591 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
592 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule
593 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
594 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
595 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
596 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
597 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
598 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
599 2954011201 Phyllobacterium ifrigiyense W4I11 Isolate Rhizosphere
600 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
601 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
602 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
603 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
604 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
605 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
606 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
607 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
608 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
609 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
610 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
611 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
612 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
613 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
614 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
615 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
616 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
617 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
618 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
619 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
620 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
621 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
622 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
623 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
624 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
625 2958092219 Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 Isolate Nodule
626 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
627 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
628 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
629 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
630 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
631 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
632 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
633 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
634 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
635 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
636 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
637 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
638 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
639 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
640 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
641 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
642 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
643 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
644 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
645 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
646 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
647 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
648 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
649 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
650 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
651 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
652 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
653 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
654 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
655 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
656 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
657 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
658 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
659 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
660 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
661 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
662 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
663 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
664 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
665 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
666 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
667 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
668 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
669 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
670 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
671 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
672 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
673 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
674 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
675 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
676 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
677 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
678 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
679 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
680 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
681 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
682 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
683 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
684 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
685 2965110997 Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 Isolate Nodule
686 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
687 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
688 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
689 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
690 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
691 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
692 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
693 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
694 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
695 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
696 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
697 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
698 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
699 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
700 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
701 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
702 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
703 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
704 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
705 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
706 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
707 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
708 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
709 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
710 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
711 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
712 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
713 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
714 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
715 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
716 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
717 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
718 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
719 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
720 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
721 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
722 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
723 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
724 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
725 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
726 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
727 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
728 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
729 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
730 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
731 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
732 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
733 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
734 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
735 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
736 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
737 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
738 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
739 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
740 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
741 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
742 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
743 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
744 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
745 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
746 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
747 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
748 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
749 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
750 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
751 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
752 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
753 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
754 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
755 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
756 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
757 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
758 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
759 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
760 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
761 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
762 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
763 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
764 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
765 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
766 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
767 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
768 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
769 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
770 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
771 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
772 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
773 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
774 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
775 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
776 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
777 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
778 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
779 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
780 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
781 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
782 2979742915 Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 Isolate Nodule
783 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
784 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
785 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
786 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
787 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
788 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
789 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
790 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
791 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
792 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
793 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
794 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
795 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
796 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
797 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
798 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
799 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
800 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
801 2995392953 Martelella limonii NBRC 109441 Isolate Unclassified
802 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
803 2996336353 Mesorhizobium sp. YM1C-6-2 Isolate Unclassified
804 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
805 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
806 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
807 2996887358 Rhizobium sp. R711 Isolate Nodule
808 2996893221 Rhizobium sp. R635 Isolate Nodule
809 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
810 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
811 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
812 3004167301 Mesorhizobium loti 582 Isolate Unclassified
813 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
814 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
815 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
816 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
817 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
818 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
819 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
820 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
821 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
822 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
823 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
824 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
825 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
826 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
827 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
828 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
829 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
830 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
831 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
832 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
833 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
834 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
835 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
836 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
837 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
838 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
839 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
840 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
841 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
842 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
843 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
844 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
845 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
846 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
847 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
848 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
849 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
850 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
851 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
852 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
853 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
854 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
855 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
856 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
857 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
858 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
859 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
860 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
861 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
862 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
863 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
864 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
865 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
866 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
867 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
868 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
869 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
870 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
871 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
872 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
873 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
874 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
875 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
876 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
877 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
878 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
879 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
880 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
881 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
882 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
883 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
884 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
885 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
886 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
887 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
888 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
889 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
890 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
891 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
892 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
893 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
894 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
895 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
896 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
897 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
898 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
899 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
900 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
901 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
902 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
903 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
904 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
905 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
906 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
907 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
908 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
909 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
910 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
911 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
912 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
913 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
914 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
915 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
916 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
917 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
918 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
919 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
920 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
921 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
922 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
923 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
924 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
925 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
926 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
927 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
928 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
929 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
930 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
931 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
932 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
933 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
934 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
935 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
936 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
937 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
938 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
939 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
940 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
941 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
942 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
943 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
944 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
945 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
946 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
947 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
948 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
949 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
950 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
951 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
952 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
953 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
954 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
955 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
956 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
957 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
958 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
959 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
960 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
961 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
962 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
963 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
964 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
965 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
966 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
967 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
968 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
969 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
970 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
971 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
972 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
973 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
974 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
975 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
976 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
977 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
978 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
979 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
980 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
981 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
982 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
983 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
984 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
985 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
986 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
987 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
988 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
989 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
990 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
991 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
992 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
993 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
994 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
995 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
996 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
997 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
998 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
999 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1000 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1001 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
1002 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
1003 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1004 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
1005 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
1006 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
1007 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
1008 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1009 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
1010 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
1011 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
1012 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
1013 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
1014 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1015 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
1016 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
1017 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
1018 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
1019 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
1020 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
1021 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
1022 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
1023 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
1024 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
1025 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
1026 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
1027 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
1028 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
1029 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
1030 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
1031 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
1032 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
1033 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
1034 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
1035 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
1036 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
1037 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
1038 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
1039 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
1040 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
1041 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
1042 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
1043 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
1044 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
1045 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
1046 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
1047 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
1048 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
1049 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
1050 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
1051 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
1052 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
1053 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
1054 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
1055 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
1056 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
1057 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
1058 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
1059 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
1060 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
1061 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
1062 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
1063 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
1064 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
1065 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
1066 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
1067 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
1068 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
1069 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
1070 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
1071 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
1072 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
1073 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
1074 3300041907 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaT_extra_run Metatranscriptome Unclassified
1075 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
1076 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
1077 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
1078 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
1079 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
1080 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
1081 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
1082 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
1083 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
1084 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
1085 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
1086 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
1087 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
1088 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
1089 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
1090 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
1091 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
1092 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
1093 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
1094 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
1095 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
1096 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
1097 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
1098 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
1099 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
1100 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
1101 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
1102 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
1103 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
1104 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
1105 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
1106 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
1107 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
1108 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
1109 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
1110 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
1111 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
1112 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
1113 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
1114 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
1115 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
1116 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
1117 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
1118 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
1119 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
1120 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
1121 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
1122 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
1123 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
1124 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
1125 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
1126 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
1127 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
1128 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
1129 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
1130 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
1131 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
1132 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
1133 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
1134 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
1135 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
1136 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
1137 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
1138 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
1139 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
1140 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
1141 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
1142 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
1143 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
1144 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
1145 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
1146 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
1147 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
1148 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
1149 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
1150 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
1151 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
1152 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
1153 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
1154 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
1155 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
1156 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
1157 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
1158 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
1159 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
1160 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
1161 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
1162 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
1163 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
1164 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
1165 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
1166 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
1167 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
1168 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
1169 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
1170 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
1171 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
1172 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
1173 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
1174 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
1175 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
1176 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
1177 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
1178 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
1179 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
1180 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
1181 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
1182 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
1183 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
1184 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
1185 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
1186 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
1187 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
1188 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
1189 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
1190 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
1191 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
1192 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
1193 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
1194 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
1195 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
1196 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
1197 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
1198 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
1199 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
1200 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
1201 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
1202 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
1203 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
1204 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
1205 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
1206 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
1207 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
1208 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
1209 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
1210 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
1211 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
1212 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
1213 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
1214 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
1215 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
1216 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
1217 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
1218 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
1219 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
1220 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
1221 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
1222 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
1223 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
1224 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
1225 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
1226 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
1227 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
1228 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
1229 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
1230 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
1231 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
1232 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
1233 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
1234 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
1235 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
1236 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
1237 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
1238 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
1239 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
1240 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
1241 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
1242 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
1243 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
1244 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
1245 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
1246 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
1247 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
1248 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
1249 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
1250 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
1251 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
1252 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
1253 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
1254 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
1255 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
1256 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
1257 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
1258 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
1259 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
1260 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
1261 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
1262 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
1263 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
1264 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
1265 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
1266 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
1267 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
1268 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
1269 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
1270 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
1271 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
1272 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
1273 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
1274 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
1275 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
1276 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
1277 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
1278 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
1279 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
1280 8004695233 Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 Isolate Nodule
1281 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
1282 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
1283 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
1284 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
1285 8005258706 Rhizobium sp. R693 Isolate Nodule
1286 8005275841 Rhizobium sp. N4311 Isolate Nodule
1287 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
1288 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
1289 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
1290 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
1291 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
1292 8005321885 Rhizobium sp. R72 Isolate Nodule
1293 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
1294 8005382845 Rhizobium sp. R634 Isolate Nodule
1295 8005395548 Rhizobium sp. R339 Isolate Nodule
1296 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
1297 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
1298 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
1299 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
1300 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
1301 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
1302 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
1303 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
1304 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
1305 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
1306 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
1307 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
1308 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
1309 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
1310 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
1311 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
1312 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
1313 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
1314 8018176218 Rhizobium sp. N122 Isolate Nodule
1315 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
1316 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
1317 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
1318 8024501048 Rhizobium sp. H4 Isolate Nodule
1319 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
1320 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
1321 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
1322 8055431914 Allorhizobium sonneratiae BGMRC 0089 Isolate Unclassified
1323 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule
1324 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
1325 8056382006 Rhizobium croatiense 13T Isolate Nodule
1326 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere
1327 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
1328 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 55.02
Metatranscriptomes 0.05
Isolates 44.93

Biome Distribution

Category Percentage (%)
Aerial Root 0.25
Bulb 0
Endosphere 14.44
Nodule 35.21
Rhizoplane 3.16
Rhizosphere 34
Stem 0
Stem Tuber 0
Unclassified 12.94

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10000166 3300001979 Bacteria 26287
2 JGI24735J21928_10012420 3300002067 Bacteria 2692
3 JGI25155J39150_1000001 3300002704 Bacteria 354543
4 JGI25156J39149_1000001 3300002705 Bacteria 354557
5 JGI25156J39149_1004074 3300002705 Bacteria 4558
6 JGI25162J39368_1000331 3300002737 Bacteria 41467
7 JGI25162J39368_1001207 3300002737 Bacteria 15046
8 JGI25154J39366_1000011 3300002738 Bacteria 296007
9 JGI25154J39366_1007551 3300002738 Bacteria 1475
10 JGI25158J39367_1000133 3300002739 Bacteria 17330
11 JGI25158J39367_1000148 3300002739 Bacteria 16461
12 JGI25157J39369_1000030 3300002741 Bacteria 146112
13 JGI25157J39369_1001617 3300002741 Bacteria 7805
14 JGI25152J39213_1000470 3300002773 Bacteria 23536
15 JGI25152J39213_1000568 3300002773 Bacteria 20156
16 JGI25152J39213_1003760 3300002773 Bacteria 5054
17 JGI25152J39213_1004211 3300002773 Bacteria 4611
18 JGI25152J39213_1009965 3300002773 Bacteria 2211
19 JGI25150J39212_1000010 3300002774 Bacteria 236260
20 JGI25159J45721_1000007 3300002987 Bacteria 176362
21 JGI25159J45721_1000410 3300002987 Bacteria 19908
22 JGI25159J45721_1002339 3300002987 Bacteria 7261
23 JGI25151J46595_10000026 3300003187 Bacteria 211045
24 JGI25151J46595_10000134 3300003187 Bacteria 98987
25 JGI25151J46595_10013406 3300003187 Bacteria 3688
26 JGI25151J46595_10019572 3300003187 Bacteria 2874
27 JGI25151J46595_10032559 3300003187 Bacteria 2019
28 JGI25151J46595_10049507 3300003187 Bacteria 1441
29 JGI25406J46586_10030139 3300003203 Bacteria 2045
30 JGI25165J46597_1000087 3300003214 Bacteria 170335
31 JGI25165J46597_1000139 3300003214 Bacteria 121216
32 JGI25165J46597_1000449 3300003214 Bacteria 41467
33 JGI25153J46596_10000110 3300003215 Bacteria 93591
34 JGI25153J46596_10000263 3300003215 Bacteria 41900
35 JGI25153J46596_10001408 3300003215 Bacteria 14433
36 JGI25153J46596_10003170 3300003215 Bacteria 9267
37 JGI25153J46596_10004512 3300003215 Bacteria 7492
38 JGI25153J46596_10022980 3300003215 Bacteria 2284
39 JGI25153J46596_10060883 3300003215 Bacteria 1025
40 rootH1_10066326 3300003316 Bacteria 3990
41 rootH2_10116711 3300003320 Bacteria 6741
42 rootL2_10046034 3300003322 Bacteria 10531
43 rootH1_10128595 3300003323 Bacteria 3068
44 JGI25160J50197_1000010 3300003354 Bacteria 279365
45 JGI25160J50197_1000011 3300003354 Bacteria 275577
46 JGI25160J50197_1000649 3300003354 Bacteria 19328
47 JGI25161J50226_1000006 3300003374 Bacteria 279563
48 JGI25161J50226_1000108 3300003374 Bacteria 65159
49 JGI25161J50226_1000282 3300003374 Bacteria 29080
50 JGI25161J50226_1000672 3300003374 Bacteria 13590
51 JGI25161J50226_1004351 3300003374 Bacteria 2982
52 Ga0055542_1000852 3300003762 Bacteria 21386
53 Ga0055529_1006783 3300003763 Bacteria 1581
54 Ga0055526_1000191 3300003771 Bacteria 53302
55 Ga0055526_1001796 3300003771 Bacteria 14855
56 Ga0055526_1005965 3300003771 Bacteria 6782
57 Ga0055526_1007156 3300003771 Bacteria 5875
58 Ga0055526_1027613 3300003771 Bacteria 1747
59 Ga0055526_1029311 3300003771 Bacteria 1638
60 Ga0055524_1000520 3300003775 Bacteria 29623
61 Ga0055524_1004687 3300003775 Bacteria 6264
62 Ga0055524_1008693 3300003775 Bacteria 4199
63 Ga0055524_1012051 3300003775 Bacteria 3341
64 Ga0055536_1003670 3300003781 Bacteria 8162
65 Ga0055536_1033987 3300003781 Bacteria 1294
66 Ga0055528_1001039 3300003790 Bacteria 18346
67 Ga0055528_1001510 3300003790 Bacteria 14086
68 Ga0055528_1003797 3300003790 Bacteria 7444
69 Ga0055528_1006531 3300003790 Bacteria 5283
70 Ga0055528_1009799 3300003790 Bacteria 3967
71 Ga0055528_1013610 3300003790 Bacteria 3070
72 Ga0055528_1016265 3300003790 Bacteria 2640
73 Ga0055530_10009365 3300003791 Bacteria 3774
74 Ga0055540_1000201 3300003792 Bacteria 57758
75 Ga0055540_1002986 3300003792 Bacteria 8481
76 Ga0055540_1006629 3300003792 Bacteria 4549
77 Ga0055531_10008315 3300003794 Bacteria 5500
78 Ga0055531_10009401 3300003794 Bacteria 4996
79 Ga0055531_10019893 3300003794 Bacteria 2687
80 Ga0058692_1000843 3300003856 Bacteria 12129
81 Ga0058692_1001796 3300003856 Bacteria 7580
82 Ga0055543_1000020 3300004625 Bacteria 150535
83 Ga0055543_1000117 3300004625 Bacteria 67816
84 Ga0055543_1000171 3300004625 Bacteria 54400
85 Ga0055543_1000599 3300004625 Bacteria 19565
86 Ga0055543_1002843 3300004625 Bacteria 5459
87 Ga0065165_1000018 3300005262 Bacteria 275082
88 Ga0065165_1000485 3300005262 Bacteria 61473
89 Ga0065165_1004034 3300005262 Bacteria 9552
90 Ga0065165_1004569 3300005262 Bacteria 8453
91 Ga0065165_1028168 3300005262 Bacteria 1817
92 Ga0068869_100397513 3300005334 Bacteria 1133
93 Ga0070666_10236772 3300005335 Bacteria 1290
94 Ga0070680_100066818 3300005336 Bacteria 2949
95 Ga0070682_100062957 3300005337 Unclassified 2351
96 Ga0070660_100013552 3300005339 Bacteria 5852
97 Ga0070660_100157699 3300005339 Bacteria 1828
98 Ga0070668_100454789 3300005347 Bacteria 1101
99 Ga0070671_100076097 3300005355 Bacteria 2804
100 Ga0070671_100103037 3300005355 Bacteria 2394
101 Ga0070674_100045424 3300005356 Bacteria 3002
102 Ga0070673_100010267 3300005364 Bacteria 6331
103 Ga0070659_100166152 3300005366 Bacteria 1806
104 Ga0070659_100394898 3300005366 Bacteria 1167
105 Ga0070709_10094639 3300005434 Bacteria 1977
106 Ga0070711_100120096 3300005439 Bacteria 1942
107 Ga0070705_100022516 3300005440 Bacteria 3368
108 Ga0070694_100058295 3300005444 Bacteria 2627
109 Ga0070663_100007733 3300005455 Bacteria 6564
110 Ga0070663_100077820 3300005455 Bacteria 2429
111 Ga0070663_100491468 3300005455 Bacteria 1018
112 Ga0070678_100038765 3300005456 Bacteria 3357
113 Ga0070662_100246244 3300005457 Bacteria 1435
114 Ga0070681_10041151 3300005458 Bacteria 4630
115 Ga0068867_100446713 3300005459 Bacteria 1101
116 Ga0070679_100124290 3300005530 Unclassified 2563
117 Ga0068853_100008598 3300005539 Bacteria 8208
118 Ga0068853_100054361 3300005539 Bacteria 3450
119 Ga0068853_100555889 3300005539 Bacteria 1087
120 Ga0070672_100097229 3300005543 Bacteria 2383
121 Ga0070695_100007331 3300005545 Bacteria 6539
122 Ga0070696_100007479 3300005546 Bacteria 7307
123 Ga0070665_100014927 3300005548 Bacteria 7798
124 Ga0070665_100172527 3300005548 Bacteria 2163
125 Ga0070665_100577499 3300005548 Bacteria 1137
126 Ga0070704_100192281 3300005549 Bacteria 1641
127 Ga0068855_100412190 3300005563 Bacteria 1479
128 Ga0068857_100229458 3300005577 Bacteria 1698
129 Ga0068857_100267173 3300005577 Bacteria 1571
130 Ga0068856_100153459 3300005614 Bacteria 2312
131 Ga0068856_100188014 3300005614 Bacteria 2079
132 Ga0068856_100336098 3300005614 Bacteria 1528
133 Ga0070702_100005850 3300005615 Bacteria 5767
134 Ga0068859_100461043 3300005617 Bacteria 1367
135 Ga0068864_100542261 3300005618 Bacteria 1123
136 Ga0068861_100549835 3300005719 Bacteria 1052
137 Ga0068858_100134898 3300005842 Bacteria 2316
138 Ga0068858_100497021 3300005842 Bacteria 1178
139 Ga0068860_100034267 3300005843 Bacteria 4869
140 Ga0068862_100344208 3300005844 Bacteria 1382
141 Ga0068862_100388974 3300005844 Bacteria 1302
142 Ga0081455_10000419 3300005937 Bacteria 55807
143 Ga0081540_1045128 3300005983 Bacteria 2242
144 Ga0081539_10001646 3300005985 Bacteria 36279
145 Ga0070717_10225787 3300006028 Bacteria 1647
146 Ga0075365_10003753 3300006038 Bacteria 7902
147 Ga0075365_10005402 3300006038 Bacteria 6886
148 Ga0075365_10034425 3300006038 Bacteria 3271
149 Ga0075365_10113648 3300006038 Bacteria 1863
150 Ga0075365_10230296 3300006038 Bacteria 1300
151 Ga0075368_10001469 3300006042 Bacteria 7545
152 Ga0075368_10005197 3300006042 Bacteria 4464
153 Ga0075364_10001264 3300006051 Bacteria 13592
154 Ga0075364_10002512 3300006051 Bacteria 10272
155 Ga0075364_10004863 3300006051 Bacteria 7782
156 Ga0075364_10014961 3300006051 Bacteria 4802
157 Ga0075364_10022670 3300006051 Bacteria 3969
158 Ga0075364_10023991 3300006051 Bacteria 3867
159 Ga0075364_10093302 3300006051 Bacteria 1999
160 Ga0075364_10150001 3300006051 Bacteria 1571
161 Ga0070715_10119369 3300006163 Bacteria 1255
162 Ga0075362_10002890 3300006177 Bacteria 5880
163 Ga0075362_10021642 3300006177 Bacteria 2702
164 Ga0075362_10037867 3300006177 Bacteria 2117
165 Ga0075367_10001099 3300006178 Bacteria 11174
166 Ga0075367_10005656 3300006178 Bacteria 6236
167 Ga0075367_10051610 3300006178 Bacteria 2431
168 Ga0075367_10100969 3300006178 Bacteria 1764
169 Ga0075367_10110186 3300006178 Bacteria 1689
170 Ga0075367_10247917 3300006178 Bacteria 1117
171 Ga0075369_10002370 3300006186 Bacteria 6718
172 Ga0075369_10002384 3300006186 Bacteria 6705
173 Ga0075369_10004127 3300006186 Bacteria 5345
174 Ga0075369_10070313 3300006186 Bacteria 1540
175 Ga0075369_10106086 3300006186 Bacteria 1263
176 Ga0075366_10000417 3300006195 Bacteria 19914
177 Ga0075366_10116420 3300006195 Bacteria 1609
178 Ga0075366_10263173 3300006195 Bacteria 1053
179 Ga0075370_10004513 3300006353 Bacteria 6774
180 Ga0075370_10047088 3300006353 Bacteria 2441
181 Ga0075370_10057908 3300006353 Bacteria 2203
182 Ga0075434_100129911 3300006871 Bacteria 2538
183 Ga0097620_100461040 3300006931 Bacteria 1367
184 Ga0079104_1000022 3300006946 Bacteria 223522
185 Ga0079104_1002441 3300006946 Bacteria 10037
186 Ga0079104_1007269 3300006946 Bacteria 4048
187 Ga0099826_10000088 3300006948 Bacteria 46140
188 Ga0099826_10006034 3300006948 Bacteria 8775
189 Ga0075435_100059145 3300007076 Bacteria 3106
190 Ga0075435_100082393 3300007076 Bacteria 2644
191 Ga0075435_100314964 3300007076 Bacteria 1339
192 Ga0105244_10084900 3300009036 Bacteria 1563
193 Ga0105240_10000005 3300009093 Bacteria 702630
194 Ga0105240_10252034 3300009093 Bacteria 2041
195 Ga0105240_10295384 3300009093 Bacteria 1855
196 Ga0105240_10443969 3300009093 Bacteria 1453
197 Ga0105240_10472042 3300009093 Bacteria 1400
198 Ga0111539_10408817 3300009094 Bacteria 1581
199 Ga0105243_10006823 3300009148 Bacteria 8801
200 Ga0105241_10606601 3300009174 Bacteria 989
201 Ga0105248_10036988 3300009177 Bacteria 5459
202 Ga0105248_10210616 3300009177 Bacteria 2190
203 Ga0105237_10005428 3300009545 Bacteria 14395
204 Ga0105237_10012219 3300009545 Bacteria 9054
205 Ga0105237_10444322 3300009545 Bacteria 1303
206 Ga0105237_10619111 3300009545 Bacteria 1089
207 Ga0105237_10834477 3300009545 Bacteria 928
208 Ga0105238_10031563 3300009551 Bacteria 5394
209 Ga0105238_10059607 3300009551 Bacteria 3823
210 Ga0105249_10121557 3300009553 Unclassified 2482
211 Ga0123341_1000004 3300009765 Bacteria 153727
212 Ga0123342_1006529 3300009766 Bacteria 16099
213 Ga0105239_10129746 3300010375 Bacteria 2803
214 Ga0105239_10205613 3300010375 Bacteria 2206
215 Ga0105239_10249422 3300010375 Bacteria 1994
216 Ga0105239_10271995 3300010375 Bacteria 1906
217 Ga0105239_10396976 3300010375 Bacteria 1561
218 Ga0105246_10133274 3300011119 Bacteria 1859
219 Ga0105246_10178956 3300011119 Bacteria 1631
220 Ga0105246_10737895 3300011119 Bacteria 867
221 Ga0157373_10029332 3300013100 Bacteria 3962
222 Ga0157373_10051238 3300013100 Bacteria 2941
223 Ga0157371_10000015 3300013102 Bacteria 339838
224 Ga0157371_10038034 3300013102 Bacteria 3444
225 Ga0157370_10000861 3300013104 Bacteria 38538
226 Ga0157370_10001194 3300013104 Bacteria 32395
227 Ga0157370_10111552 3300013104 Bacteria 2556
228 Ga0157370_10367694 3300013104 Bacteria 1325
229 Ga0157369_10187868 3300013105 Bacteria 2172
230 Ga0171463_1008 3300013249 Bacteria 299022
231 Ga0157374_10299973 3300013296 Bacteria 1589
232 Ga0157378_10500894 3300013297 Bacteria 1213
233 Ga0163162_10932151 3300013306 Bacteria 980
234 Ga0182008_10095506 3300014497 Bacteria 1467
235 Ga0157379_10250380 3300014968 Bacteria 1608
236 Ga0157379_10343555 3300014968 Bacteria 1365
237 Ga0182006_1056158 3300015261 Bacteria 1500
238 Ga0182007_10001955 3300015262 Bacteria 10657
239 Ga0182005_1002400 3300015265 Bacteria 6734
240 Ga0183363_1265 3300015690 Bacteria 8492
241 Ga0163161_10196113 3300017792 Bacteria 1554
242 Ga0214544_1000691 3300021320 Bacteria 64943
243 Ga0214542_1000019 3300021321 Bacteria 199445
244 Ga0214542_1024306 3300021321 Bacteria 3416
245 Ga0214543_1000010 3300021327 Bacteria 364844
246 Ga0214543_1000011 3300021327 Bacteria 344093
247 Ga0228711_1000007 3300022739 Bacteria 202413
248 Ga0228710_1000007 3300022740 Bacteria 189104
249 Ga0228598_1002460 3300024227 Bacteria 4035
250 Ga0209435_100012 3300025206 Bacteria 401621
251 Ga0209760_102779 3300025207 Bacteria 1605
252 Ga0209436_100439 3300025208 Bacteria 18629
253 Ga0209436_100870 3300025208 Bacteria 12074
254 Ga0209437_100047 3300025233 Bacteria 405163
255 Ga0209437_100165 3300025233 Bacteria 145009
256 Ga0207425_1000010 3300025245 Bacteria 572898
257 Ga0207425_1001496 3300025245 Bacteria 9692
258 Ga0207425_1004946 3300025245 Bacteria 3891
259 Ga0207425_1036123 3300025245 Bacteria 960
260 Ga0209646_1000026 3300025246 Bacteria 401621
261 Ga0209646_1004022 3300025246 Bacteria 2759
262 Ga0209026_1000002 3300025250 Bacteria 1136158
263 Ga0209026_1000014 3300025250 Bacteria 401621
264 Ga0209677_101402 3300025253 Bacteria 10466
265 Ga0209148_1000072 3300025254 Bacteria 325292
266 Ga0209759_1000012 3300025256 Bacteria 401621
267 Ga0209759_1000062 3300025256 Bacteria 197996
268 Ga0209129_1000069 3300025258 Bacteria 212790
269 Ga0209129_1000197 3300025258 Bacteria 78908
270 Ga0209129_1000817 3300025258 Bacteria 19602
271 Ga0209129_1000939 3300025258 Bacteria 17583
272 Ga0209129_1001103 3300025258 Bacteria 15735
273 Ga0209129_1010409 3300025258 Bacteria 2321
274 Ga0209233_1000027 3300025261 Bacteria 652089
275 Ga0209233_1000048 3300025261 Bacteria 453669
276 Ga0209233_1000069 3300025261 Bacteria 367639
277 Ga0209233_1000195 3300025261 Bacteria 125863
278 Ga0209455_1000329 3300025272 Bacteria 45659
279 Ga0209673_1000013 3300025273 Bacteria 571633
280 Ga0209673_1000048 3300025273 Bacteria 287976
281 Ga0209673_1000552 3300025273 Bacteria 60264
282 Ga0209673_1000959 3300025273 Bacteria 36010
283 Ga0209673_1003109 3300025273 Bacteria 10161
284 Ga0209673_1010825 3300025273 Bacteria 3811
285 Ga0209673_1047577 3300025273 Bacteria 1162
286 Ga0209130_1000004 3300025284 Bacteria 633436
287 Ga0209130_1000021 3300025284 Bacteria 374278
288 Ga0209130_1000029 3300025284 Bacteria 323399
289 Ga0209676_1012295 3300025292 Bacteria 3378
290 Ga0209025_1000022 3300025294 Bacteria 574487
291 Ga0209025_1000033 3300025294 Bacteria 414511
292 Ga0209025_1000094 3300025294 Bacteria 241080
293 Ga0209025_1000119 3300025294 Bacteria 210606
294 Ga0209025_1000166 3300025294 Bacteria 164692
295 Ga0209025_1001272 3300025294 Bacteria 34703
296 Ga0209025_1010738 3300025294 Bacteria 6158
297 Ga0209025_1015850 3300025294 Bacteria 4502
298 Ga0209025_1028708 3300025294 Bacteria 2716
299 Ga0209025_1035421 3300025294 Bacteria 2256
300 Ga0209025_1052144 3300025294 Bacteria 1618
301 Ga0209564_1000273 3300025295 Bacteria 108165
302 Ga0209564_1000288 3300025295 Bacteria 102088
303 Ga0209564_1000469 3300025295 Bacteria 67659
304 Ga0209564_1001482 3300025295 Bacteria 23692
305 Ga0209564_1021130 3300025295 Bacteria 2354
306 Ga0209758_1000075 3300025297 Bacteria 271585
307 Ga0209758_1000086 3300025297 Bacteria 254778
308 Ga0209758_1000087 3300025297 Bacteria 254384
309 Ga0209758_1000218 3300025297 Bacteria 124300
310 Ga0209758_1000384 3300025297 Bacteria 76474
311 Ga0209758_1000629 3300025297 Bacteria 54026
312 Ga0209758_1000749 3300025297 Bacteria 47284
313 Ga0209758_1001310 3300025297 Bacteria 30349
314 Ga0209758_1005350 3300025297 Bacteria 9954
315 Ga0209758_1014353 3300025297 Bacteria 4221
316 Ga0209758_1028882 3300025297 Bacteria 2334
317 Ga0209050_1005022 3300025298 Bacteria 8593
318 Ga0209050_1011079 3300025298 Bacteria 4332
319 Ga0209256_1000194 3300025299 Bacteria 116709
320 Ga0209256_1000371 3300025299 Bacteria 72192
321 Ga0209256_1001625 3300025299 Bacteria 21916
322 Ga0209256_1002003 3300025299 Bacteria 18218
323 Ga0209256_1002513 3300025299 Bacteria 14748
324 Ga0209256_1003035 3300025299 Bacteria 12390
325 Ga0209256_1010879 3300025299 Bacteria 3735
326 Ga0207426_1000003 3300025302 Bacteria 1063212
327 Ga0207426_1000010 3300025302 Bacteria 796003
328 Ga0207426_1000039 3300025302 Bacteria 439937
329 Ga0207426_1000074 3300025302 Bacteria 323399
330 Ga0207426_1001010 3300025302 Bacteria 27314
331 Ga0207426_1001731 3300025302 Bacteria 16650
332 Ga0207426_1042112 3300025302 Bacteria 1411
333 Ga0209051_1000142 3300025303 Bacteria 135337
334 Ga0209051_1000723 3300025303 Bacteria 35964
335 Ga0209051_1001634 3300025303 Bacteria 18181
336 Ga0209051_1008600 3300025303 Bacteria 5382
337 Ga0209051_1033591 3300025303 Bacteria 1937
338 Ga0209051_1045978 3300025303 Bacteria 1505
339 Ga0209257_1000795 3300025304 Bacteria 46064
340 Ga0209257_1001864 3300025304 Bacteria 22869
341 Ga0209257_1003242 3300025304 Bacteria 14301
342 Ga0209257_1014247 3300025304 Bacteria 3433
343 Ga0209257_1022999 3300025304 Bacteria 2205
344 Ga0207688_10241251 3300025901 Bacteria 1093
345 Ga0207647_10008647 3300025904 Bacteria 7277
346 Ga0207699_10154046 3300025906 Bacteria 1524
347 Ga0207645_10141288 3300025907 Bacteria 1569
348 Ga0207645_10293898 3300025907 Bacteria 1081
349 Ga0207707_10076955 3300025912 Bacteria 2912
350 Ga0207695_10000011 3300025913 Bacteria 910221
351 Ga0207695_10125922 3300025913 Bacteria 2524
352 Ga0207695_10152526 3300025913 Bacteria 2249
353 Ga0207695_10238269 3300025913 Bacteria 1721
354 Ga0207671_10000804 3300025914 Bacteria 39792
355 Ga0207671_10115590 3300025914 Bacteria 2046
356 Ga0207693_10153669 3300025915 Bacteria 1810
357 Ga0207663_10033876 3300025916 Bacteria 3047
358 Ga0207660_10023384 3300025917 Bacteria 4173
359 Ga0207657_10019384 3300025919 Bacteria 6462
360 Ga0207657_10055298 3300025919 Bacteria 3429
361 Ga0207694_10121901 3300025924 Bacteria 2082
362 Ga0207694_10122626 3300025924 Bacteria 2076
363 Ga0207687_10141056 3300025927 Bacteria 1828
364 Ga0207700_10271993 3300025928 Bacteria 1454
365 Ga0207664_10073102 3300025929 Bacteria 2766
366 Ga0207644_10038112 3300025931 Bacteria 3384
367 Ga0207644_10046328 3300025931 Bacteria 3097
368 Ga0207690_10034852 3300025932 Bacteria 3246
369 Ga0207690_10208170 3300025932 Bacteria 1489
370 Ga0207706_10149500 3300025933 Bacteria 2054
371 Ga0207691_10066544 3300025940 Bacteria 3260
372 Ga0207711_10082775 3300025941 Bacteria 2806
373 Ga0207689_10384522 3300025942 Bacteria 1169
374 Ga0207689_10578837 3300025942 Bacteria 944
375 Ga0207661_10501699 3300025944 Bacteria 1109
376 Ga0207679_10168546 3300025945 Bacteria 1800
377 Ga0207667_10368231 3300025949 Bacteria 1465
378 Ga0207651_10069164 3300025960 Bacteria 2492
379 Ga0207712_10288509 3300025961 Bacteria 1342
380 Ga0207712_10290128 3300025961 Bacteria 1338
381 Ga0207668_10165588 3300025972 Bacteria 1728
382 Ga0207668_10168636 3300025972 Bacteria 1715
383 Ga0207668_10448162 3300025972 Bacteria 1101
384 Ga0207668_10497691 3300025972 Bacteria 1048
385 Ga0207658_10241812 3300025986 Bacteria 1530
386 Ga0207703_10111849 3300026035 Unclassified 2332
387 Ga0207703_10206470 3300026035 Bacteria 1749
388 Ga0207703_10352652 3300026035 Bacteria 1355
389 Ga0207703_10483042 3300026035 Bacteria 1161
390 Ga0207639_10091893 3300026041 Bacteria 2431
391 Ga0207639_10389234 3300026041 Bacteria 1254
392 Ga0207639_10642175 3300026041 Bacteria 981
393 Ga0207678_10002469 3300026067 Bacteria 16796
394 Ga0207678_10018602 3300026067 Bacteria 6099
395 Ga0207678_10027650 3300026067 Bacteria 4950
396 Ga0207678_10078531 3300026067 Bacteria 2827
397 Ga0207678_10083182 3300026067 Bacteria 2738
398 Ga0207678_10153009 3300026067 Bacteria 1970
399 Ga0207702_10119691 3300026078 Bacteria 2355
400 Ga0207702_10152250 3300026078 Bacteria 2105
401 Ga0207648_10243476 3300026089 Bacteria 1602
402 Ga0207674_10077701 3300026116 Bacteria 3325
403 Ga0207674_10107388 3300026116 Unclassified 2768
404 Ga0207674_10618452 3300026116 Bacteria 1046
405 Ga0207675_100097538 3300026118 Bacteria 2768
406 Ga0207683_10059560 3300026121 Bacteria 3354
407 Ga0207698_10079523 3300026142 Bacteria 2637
408 Ga0209281_1000128 3300027111 Bacteria 199265
409 Ga0209281_1000538 3300027111 Bacteria 47771
410 Ga0209281_1000864 3300027111 Bacteria 26486
411 Ga0209371_1000178 3300027312 Bacteria 93894
412 Ga0209371_1000621 3300027312 Bacteria 31605
413 Ga0209371_1005448 3300027312 Bacteria 5053
414 Ga0209282_1000034 3300027666 Bacteria 140100
415 Ga0209282_1000372 3300027666 Bacteria 21889
416 Ga0209282_1004392 3300027666 Bacteria 8488
417 Ga0209813_10005200 3300027866 Bacteria 3147
418 Ga0268266_10017817 3300028379 Bacteria 6053
419 Ga0268266_10050734 3300028379 Bacteria 3560
420 Ga0307515_10000198 3300028794 Bacteria 147738
421 Ga0307515_10000656 3300028794 Bacteria 79816
422 Ga0307515_10007800 3300028794 Bacteria 21064
423 Ga0307515_10015486 3300028794 Bacteria 14044
424 Ga0268256_1001287 3300030500 Bacteria 15519
425 Ga0268256_1004786 3300030500 Bacteria 5501
426 Ga0268256_1005356 3300030500 Bacteria 5053
427 Ga0316181_1240954 3300030744 Bacteria 3022
428 Ga0307513_10019835 3300031456 Bacteria 7991
429 Ga0307408_100125221 3300031548 Bacteria 1997
430 Ga0307408_100306544 3300031548 Bacteria 1332
431 Ga0307408_100405441 3300031548 Bacteria 1172
432 Ga0316575_10015584 3300031665 Bacteria 2867
433 Ga0265314_10015665 3300031711 Bacteria 6009
434 Ga0316576_10267750 3300031727 Bacteria 1281
435 Ga0316578_10013064 3300031728 Bacteria 4392
436 Ga0307405_10005745 3300031731 Bacteria 6029
437 Ga0307405_10097793 3300031731 Bacteria 1961
438 Ga0307405_10117606 3300031731 Bacteria 1813
439 Ga0307412_10000449 3300031911 Bacteria 24913
440 Ga0307412_10433599 3300031911 Bacteria 1078
441 Ga0315914_1000010 3300031967 Bacteria 171642
442 Ga0307409_100382880 3300031995 Bacteria 1338
443 Ga0307416_100208919 3300032002 Bacteria 1860
444 Ga0307414_10240394 3300032004 Bacteria 1499
445 Ga0316583_10016742 3300032133 Bacteria 2636
446 Ga0315913_1000005 3300033430 Bacteria 171651
447 Ga0315915_1000012 3300033464 Bacteria 199284
448 Ga0373929_0016640 3300035085 Bacteria 1443
449 Ga0373936_0001937 3300035113 Bacteria 7654
450 Ga0373936_0035998 3300035113 Bacteria 1972
451 Ga0373945_0001585 3300035116 Bacteria 6968
452 Ga0373945_0012768 3300035116 Bacteria 2795
453 Ga0373953_0001305 3300035117 Bacteria 7138
454 Ga0373953_0011755 3300035117 Bacteria 3083
455 Ga0373953_0030857 3300035117 Bacteria 2081
456 Ga0373954_0018425 3300035118 Bacteria 3143
457 Ga0373956_0004598 3300035119 Bacteria 5515
458 Ga0373956_0013030 3300035119 Bacteria 3457
459 Ga0373957_0019954 3300035120 Bacteria 2364
460 Ga0373946_0123186 3300035171 Bacteria 1185
461 Ga0373946_0139516 3300035171 Bacteria 1122
462 Ga0373955_0000213 3300035172 Bacteria 24300
463 Ga0373955_0147427 3300035172 Bacteria 1383
464 Ga0316574_0007201 3300035398 Bacteria 6080
465 Ga0316574_0366422 3300035398 Bacteria 910
466 Ga0373931_0345240 3300035691 Bacteria 930
467 Ga0373935_0000131 3300035692 Bacteria 34019
468 Ga0373935_0009153 3300035692 Bacteria 5927
469 Ga0373935_0024391 3300035692 Bacteria 3723
470 Ga0373935_0030875 3300035692 Bacteria 3322
471 Ga0373935_0042425 3300035692 Bacteria 2861
472 Ga0373935_0060761 3300035692 Bacteria 2418
473 Ga0373927_0000147 3300035695 Bacteria 55399
474 Ga0373927_0014897 3300035695 Bacteria 5143
475 Ga0373927_0025227 3300035695 Bacteria 3885
476 Ga0373933_0003159 3300035724 Bacteria 9200
477 Ga0373933_0014822 3300035724 Bacteria 4337
478 Ga0373933_0053964 3300035724 Bacteria 2407
479 Ga0373947_0002523 3300035725 Bacteria 11003
480 Ga0373947_0023677 3300035725 Bacteria 3574
481 Ga0373947_0279101 3300035725 Bacteria 1110
482 Ga0373937_0000293 3300036401 Bacteria 47507
483 Ga0373937_0001336 3300036401 Bacteria 20629
484 Ga0373937_0024713 3300036401 Bacteria 5421
485 Ga0373937_0026411 3300036401 Bacteria 5247
486 Ga0373937_0067560 3300036401 Bacteria 3294
487 Ga0373937_0177870 3300036401 Bacteria 1997
488 Ga0373937_0805842 3300036401 Bacteria 887
489 Ga0316582_0144311 3300036647 Bacteria 1606
490 Ga0316584_0016716 3300036712 Bacteria 5264
491 Ga0373925_0000087 3300037068 Bacteria 99043
492 Ga0373925_0007077 3300037068 Bacteria 8198
493 Ga0373925_0041897 3300037068 Bacteria 3396
494 Ga0373925_0214808 3300037068 Bacteria 1533
495 Ga0395899_0000073 3300037312 Bacteria 181387
496 Ga0395899_0235955 3300037312 Bacteria 1261
497 Ga0395899_0402979 3300037312 Bacteria 905
498 Ga0395900_0000027 3300037418 Bacteria 285957
499 Ga0395900_0136486 3300037418 Bacteria 2513
500 Ga0395900_0289467 3300037418 Bacteria 1627
501 Ga0395898_0000043 3300037466 Bacteria 301783
502 Ga0395898_0294943 3300037466 Bacteria 1547
503 Ga0395905_0000032 3300037471 Bacteria 285932
504 Ga0395905_0005236 3300037471 Bacteria 13273
505 Ga0395905_0041067 3300037471 Bacteria 4340
506 Ga0395905_0062219 3300037471 Bacteria 3491
507 Ga0395905_0181248 3300037471 Bacteria 1977
508 Ga0395905_0281100 3300037471 Bacteria 1550
509 Ga0395905_0358766 3300037471 Bacteria 1350
510 Ga0436364_1553897 3300037853 Bacteria 2217
511 Ga0395901_0000056 3300038443 Bacteria 154356
512 Ga0395901_0096884 3300038443 Bacteria 3092
513 Ga0395901_0178660 3300038443 Bacteria 2226
514 Ga0395901_0187019 3300038443 Bacteria 2172
515 Ga0395901_0267695 3300038443 Bacteria 1778
516 Ga0400486_12421 3300038742 Bacteria 1289
517 Ga0436365_1820406 3300039437 Bacteria 4408
518 Ga0436360_0982192 3300039438 Bacteria 2517
519 Ga0439438_047014 3300041405 Bacteria 1107
520 Ga0439439_0039344 3300041406 Bacteria 1222
521 Ga0439439_0040060 3300041406 Bacteria 1212
522 Ga0439466_0058972 3300041411 Bacteria 1241
523 Ga0439465_0003539 3300041413 Bacteria 5090
524 Ga0439465_0009350 3300041413 Bacteria 3088
525 Ga0439465_0094901 3300041413 Bacteria 1024
526 Ga0451787_223311 3300041441 Bacteria 3821
527 Ga0451793_1350958 3300041452 Bacteria 1419
528 Ga0451795_1607243 3300041456 Bacteria 1182
529 Ga0451798_0200031 3300041458 Bacteria 3660
530 Ga0451833_1421423 3300041491 Bacteria 1809
531 Ga0451835_0113922 3300041492 Bacteria 1481
532 Ga0451839_0358112 3300041496 Bacteria 2727
533 Ga0451841_0003394 3300041498 Bacteria 941
534 Ga0451845_0403951 3300041501 Bacteria 2133
535 Ga0452268_09468 3300041907 Bacteria 1743
536 Ga0439449_0074392 3300042007 Bacteria 1252
537 Ga0466961_0142275 3300044693 Bacteria 1501
538 Ga0466963_0091702 3300044694 Bacteria 2070
539 Ga0466963_0206435 3300044694 Bacteria 1374
540 Ga0466970_0003056 3300044765 Bacteria 8124
541 Ga0466959_0039377 3300045049 Bacteria 3493
542 Ga0451576_0455335 3300045051 Bacteria 1343
543 Ga0466967_0093353 3300045976 Bacteria 2738
544 Ga0495592_0000001 3300046454 Bacteria 305819
545 Ga0495592_0013394 3300046454 Bacteria 6241
546 Ga0495592_0191825 3300046454 Bacteria 1384
547 Ga0495592_0242406 3300046454 Bacteria 1195
548 Ga0495603_0041109 3300046455 Bacteria 2765
549 Ga0495603_0104030 3300046455 Bacteria 1657
550 Ga0495590_0038560 3300046457 Bacteria 1666
551 Ga0495629_0000401 3300046459 Bacteria 36430
552 Ga0495629_0010498 3300046459 Bacteria 6737
553 Ga0495629_0011315 3300046459 Bacteria 6482
554 Ga0495638_0000145 3300046460 Bacteria 112275
555 Ga0495638_0002113 3300046460 Bacteria 16763
556 Ga0495638_0013340 3300046460 Bacteria 5600
557 Ga0495638_0023397 3300046460 Bacteria 4040
558 Ga0495638_0035740 3300046460 Bacteria 3166
559 Ga0495638_0113396 3300046460 Bacteria 1608
560 Ga0495651_0001675 3300046462 Bacteria 17143
561 Ga0495651_0119946 3300046462 Bacteria 1934
562 Ga0495651_0128903 3300046462 Bacteria 1849
563 Ga0495653_0000015 3300046463 Bacteria 213697
564 Ga0495653_0073254 3300046463 Bacteria 2556
565 Ga0495653_0073882 3300046463 Bacteria 2543
566 Ga0495650_0040565 3300046471 Bacteria 1997
567 Ga0495582_0168722 3300046473 Bacteria 1246
568 Ga0495605_0000715 3300046474 Bacteria 24441
569 Ga0495662_0000957 3300046476 Bacteria 14125
570 Ga0495664_0000001 3300046477 Bacteria 757730
571 Ga0495585_0015627 3300046492 Bacteria 4409
572 Ga0495585_0055210 3300046492 Bacteria 2195
573 Ga0495594_0011198 3300046499 Bacteria 4657
574 Ga0495583_0004528 3300046506 Bacteria 9897
575 Ga0495583_0061171 3300046506 Bacteria 1681
576 Ga0495606_0001788 3300046507 Bacteria 27355
577 Ga0495606_0182851 3300046507 Bacteria 1207
578 Ga0495606_0218901 3300046507 Bacteria 1074
579 Ga0495608_0000066 3300046511 Bacteria 81664
580 Ga0495608_0000442 3300046511 Bacteria 28963
581 Ga0495608_0067504 3300046511 Bacteria 2339
582 Ga0495610_0003504 3300046512 Bacteria 12191
583 Ga0495610_0052350 3300046512 Bacteria 1982
584 Ga0495616_0004639 3300046513 Bacteria 8628
585 Ga0495618_0000021 3300046514 Bacteria 129750
586 Ga0495620_0021715 3300046515 Bacteria 3110
587 Ga0495628_0000005 3300046516 Bacteria 420969
588 Ga0495628_0111604 3300046516 Bacteria 2102
589 Ga0495630_0000254 3300046517 Bacteria 43049
590 Ga0495630_0058818 3300046517 Bacteria 2882
591 Ga0495631_0001131 3300046518 Bacteria 16535
592 Ga0495632_0008494 3300046519 Bacteria 6295
593 Ga0495632_0008869 3300046519 Bacteria 6115
594 Ga0495632_0100761 3300046519 Bacteria 1362
595 Ga0495637_0036141 3300046520 Bacteria 2154
596 Ga0495643_0014754 3300046522 Bacteria 4640
597 Ga0495643_0018816 3300046522 Bacteria 4002
598 Ga0495648_0005337 3300046524 Bacteria 10711
599 Ga0495648_0019014 3300046524 Bacteria 4845
600 Ga0495648_0034773 3300046524 Bacteria 3275
601 Ga0495648_0140771 3300046524 Bacteria 1270
602 Ga0495648_0149306 3300046524 Bacteria 1221
603 Ga0495652_0000001 3300046529 Bacteria 1045081
604 Ga0495652_0177606 3300046529 Bacteria 1637
605 Ga0495654_0000315 3300046530 Bacteria 42530
606 Ga0495654_0096625 3300046530 Bacteria 1365
607 Ga0495640_0000006 3300046533 Bacteria 285419
608 Ga0495640_0060368 3300046533 Bacteria 2579
609 Ga0495640_0299459 3300046533 Bacteria 999
610 Ga0495587_0000012 3300046536 Bacteria 197088
611 Ga0495587_0044458 3300046536 Bacteria 2642
612 Ga0495587_0071017 3300046536 Bacteria 2025
613 Ga0495609_0078224 3300046538 Bacteria 1448
614 Ga0495597_0028981 3300046542 Bacteria 2530
615 Ga0495645_0000041 3300046543 Bacteria 92278
616 Ga0495622_0069319 3300046557 Bacteria 1628
617 Ga0495667_0000001 3300046559 Bacteria 834831
618 Ga0495667_0041089 3300046559 Bacteria 3068
619 Ga0495667_0056015 3300046559 Bacteria 2593
620 Ga0495656_0492283 3300046615 Bacteria 649
621 Ga0495668_0043818 3300046616 Bacteria 2487
622 Ga0495668_0104353 3300046616 Bacteria 1551
623 Ga0495634_0000624 3300046642 Bacteria 34336
624 Ga0495611_0008325 3300046648 Bacteria 4392
625 Ga0495625_0002190 3300046660 Bacteria 21683
626 Ga0495625_0059346 3300046660 Bacteria 2715
627 Ga0495625_0147457 3300046660 Bacteria 1583
628 Ga0495625_0237881 3300046660 Bacteria 1187
629 Ga0495625_0327300 3300046660 Bacteria 974
630 Ga0495635_0000007 3300046663 Bacteria 278786
631 Ga0495635_0019774 3300046663 Bacteria 4691
632 Ga0495635_0062717 3300046663 Bacteria 2553
633 Ga0495635_0063779 3300046663 Bacteria 2530
634 Ga0495635_0311267 3300046663 Bacteria 1055
635 Ga0495588_0041178 3300046674 Bacteria 2358
636 Ga0495588_0241404 3300046674 Bacteria 953
637 Ga0495657_0000047 3300046675 Bacteria 104362
638 Ga0495657_0040502 3300046675 Bacteria 3195
639 Ga0495657_0081415 3300046675 Bacteria 2094
640 Ga0495657_0112356 3300046675 Bacteria 1725
641 Ga0495657_0265480 3300046675 Bacteria 1030
642 Ga0495599_0000002 3300046678 Bacteria 348168
643 Ga0495599_0073355 3300046678 Bacteria 2136
644 Ga0495623_0000023 3300046679 Bacteria 96650
645 Ga0495623_0198428 3300046679 Bacteria 1155
646 Ga0495646_0000024 3300046680 Bacteria 107836
647 Ga0495646_0010351 3300046680 Bacteria 5932
648 Ga0495658_0000265 3300046683 Bacteria 29770
649 Ga0495613_0170939 3300046689 Bacteria 1542
650 Ga0495624_0011265 3300046690 Bacteria 6150
651 Ga0495670_0068696 3300046691 Bacteria 1791
652 Ga0495671_0197205 3300046692 Bacteria 977
653 Ga0495600_0000013 3300046809 Bacteria 119404
654 Ga0495581_0009849 3300047315 Bacteria 5530
655 Ga0495604_0000007 3300047317 Bacteria 412174
656 Ga0495604_0006585 3300047317 Bacteria 9206
657 Ga0495604_0024912 3300047317 Bacteria 4771
658 Ga0495604_0183907 3300047317 Bacteria 1460
659 Ga0495674_0000001 3300047319 Bacteria 778665
660 Ga0495674_0049741 3300047319 Bacteria 3702
661 Ga0495674_0123895 3300047319 Bacteria 2182
662 Ga0495672_0006422 3300047320 Bacteria 9109
663 Ga0495672_0019795 3300047320 Bacteria 4429
664 Ga0495672_0155244 3300047320 Bacteria 1183
665 Ga0495676_0031404 3300047321 Bacteria 4493
666 Ga0495680_0001437 3300047322 Bacteria 25662
667 Ga0495680_0030613 3300047322 Bacteria 4393
668 Ga0495680_0058117 3300047322 Bacteria 2989
669 Ga0495680_0105083 3300047322 Bacteria 2100
670 Ga0495675_0000014 3300047444 Bacteria 137646
671 Ga0495675_0016294 3300047444 Bacteria 4701
672 Ga0495685_047916 3300047447 Bacteria 1453
673 Ga0495681_0004088 3300047470 Bacteria 10039
674 Ga0495684_0000027 3300047471 Bacteria 124367
675 Ga0495684_0133030 3300047471 Bacteria 1867
676 Ga0495684_0148862 3300047471 Bacteria 1751
677 Ga0495684_0183592 3300047471 Bacteria 1550
678 Ga0495686_0000761 3300047472 Bacteria 42521
679 Ga0495686_0035591 3300047472 Bacteria 3199
680 Ga0495686_0044364 3300047472 Bacteria 2815
681 Ga0495593_0002819 3300047673 Bacteria 10465
682 Ga0495593_0051458 3300047673 Bacteria 2179
683 Ga0495602_0000004 3300048088 Bacteria 326932
684 Ga0495602_0024539 3300048088 Bacteria 5850
685 Ga0495602_0037412 3300048088 Bacteria 4505
686 Ga0495602_0162113 3300048088 Bacteria 1745
687 Ga0495614_0137373 3300048089 Bacteria 1085
688 Ga0495615_0023537 3300048090 Bacteria 1412
689 Ga0495615_0073354 3300048090 Bacteria 926
690 Ga0496100_0074169 3300048903 Unclassified 2279
691 Ga0496100_0154624 3300048903 Bacteria 1639
692 Ga0496100_0210136 3300048903 Bacteria 1423
693 Ga0496100_0233027 3300048903 Bacteria 1355
694 Ga0496101_0117487 3300048904 Bacteria 2008
695 Ga0496101_0177400 3300048904 Bacteria 1639
696 Ga0496101_0213875 3300048904 Bacteria 1494
697 Ga0496102_0208481 3300048905 Bacteria 1842
698 Ga0496102_0379779 3300048905 Bacteria 1330
699 Ga0496102_0710548 3300048905 Bacteria 928
700 Ga0496103_0001223 3300048906 Bacteria 17609
701 Ga0496103_0200609 3300048906 Bacteria 1283
702 Ga0496103_0210581 3300048906 Bacteria 1250
703 Ga0496104_0003761 3300048907 Bacteria 13118
704 Ga0496104_0068429 3300048907 Bacteria 3374
705 Ga0496104_0079760 3300048907 Bacteria 3120
706 Ga0496104_0195967 3300048907 Bacteria 1932
707 Ga0496104_0740274 3300048907 Bacteria 890
708 Ga0496105_0033637 3300048908 Bacteria 4212
709 Ga0496105_0054115 3300048908 Bacteria 3314
710 Ga0496105_0480245 3300048908 Bacteria 978
711 Ga0496106_0000125 3300048909 Bacteria 59031
712 Ga0496106_0014060 3300048909 Bacteria 5914
713 Ga0496106_0015871 3300048909 Bacteria 5572
714 Ga0496106_0421694 3300048909 Bacteria 1072
715 Ga0496107_0063116 3300048910 Unclassified 2684
716 Ga0496107_0141897 3300048910 Bacteria 1775
717 Ga0496107_0247403 3300048910 Bacteria 1327
718 Ga0496108_0160575 3300048911 Bacteria 1942
719 Ga0496109_0131999 3300048912 Bacteria 2331
720 Ga0496109_0142061 3300048912 Bacteria 2245
721 Ga0496110_0016493 3300048913 Bacteria 6168
722 Ga0496110_0033360 3300048913 Bacteria 4453
723 Ga0496110_0252922 3300048913 Bacteria 1604
724 Ga0496110_0379011 3300048913 Bacteria 1289
725 Ga0496110_0469187 3300048913 Bacteria 1147
726 Ga0496111_0000701 3300048914 Bacteria 17721
727 Ga0496112_0024527 3300048915 Bacteria 5777
728 Ga0496112_0044012 3300048915 Bacteria 4372
729 Ga0496112_0064226 3300048915 Bacteria 3622
730 Ga0496113_0235653 3300048916 Bacteria 1460
731 Ga0496114_0148890 3300048917 Bacteria 2030
732 Ga0496114_0182909 3300048917 Bacteria 1831
733 Ga0496114_0274070 3300048917 Bacteria 1487
734 Ga0496115_0057816 3300048918 Bacteria 3120
735 Ga0496115_0094320 3300048918 Unclassified 2448
736 Ga0496115_0259045 3300048918 Bacteria 1431
737 Ga0496115_0283293 3300048918 Bacteria 1360
738 Ga0496116_0003130 3300048919 Bacteria 16610
739 Ga0496116_0009520 3300048919 Bacteria 8272
740 Ga0496116_0018287 3300048919 Bacteria 5408
741 Ga0496116_0100104 3300048919 Bacteria 1734
742 Ga0496117_0000002 3300048920 Bacteria 2483758
743 Ga0496117_0000878 3300048920 Bacteria 46410
744 Ga0496117_0016796 3300048920 Bacteria 6151
745 Ga0496117_0105321 3300048920 Bacteria 1773
746 Ga0496117_0115494 3300048920 Bacteria 1661
747 Ga0496117_0119910 3300048920 Bacteria 1618
748 Ga0496117_0155074 3300048920 Bacteria 1349
749 Ga0496117_0263502 3300048920 Bacteria 933
750 Ga0496118_0001855 3300048921 Bacteria 30243
751 Ga0496118_0004791 3300048921 Bacteria 15800
752 Ga0496118_0008798 3300048921 Bacteria 10344
753 Ga0496118_0013135 3300048921 Bacteria 7861
754 Ga0496118_0016459 3300048921 Bacteria 6783
755 Ga0496118_0025089 3300048921 Bacteria 5124
756 Ga0496118_0056264 3300048921 Bacteria 2959
757 Ga0496118_0064435 3300048921 Bacteria 2689
758 Ga0496119_0008779 3300048922 Bacteria 8806
759 Ga0496119_0014680 3300048922 Bacteria 6102
760 Ga0496119_0066578 3300048922 Bacteria 2128
761 Ga0496119_0096074 3300048922 Bacteria 1673
762 Ga0496120_0000078 3300048923 Bacteria 162312
763 Ga0496120_0002707 3300048923 Bacteria 17363
764 Ga0496120_0015555 3300048923 Bacteria 5012
765 Ga0496120_0034513 3300048923 Bacteria 3029
766 Ga0496120_0154817 3300048923 Bacteria 1148
767 Ga0496121_0000001 3300048924 Bacteria 1830318
768 Ga0496121_0000959 3300048924 Bacteria 52098
769 Ga0496121_0003355 3300048924 Bacteria 22973
770 Ga0496121_0011499 3300048924 Bacteria 9812
771 Ga0496121_0012773 3300048924 Bacteria 9097
772 Ga0496121_0025174 3300048924 Bacteria 5659
773 Ga0496121_0034679 3300048924 Bacteria 4538
774 Ga0496121_0049492 3300048924 Bacteria 3563
775 Ga0496121_0051550 3300048924 Bacteria 3464
776 Ga0496121_0092891 3300048924 Bacteria 2351
777 Ga0496121_0304089 3300048924 Bacteria 1081
778 Ga0496121_0342526 3300048924 Bacteria 998
779 Ga0496122_0000001 3300048925 Bacteria 1827766
780 Ga0496122_0000025 3300048925 Bacteria 362915
781 Ga0496122_0000992 3300048925 Bacteria 50592
782 Ga0496122_0008019 3300048925 Bacteria 11533
783 Ga0496122_0010790 3300048925 Bacteria 9362
784 Ga0496122_0021071 3300048925 Bacteria 5854
785 Ga0496122_0039541 3300048925 Bacteria 3760
786 Ga0496122_0045620 3300048925 Bacteria 3404
787 Ga0496122_0055173 3300048925 Bacteria 2976
788 Ga0496122_0155754 3300048925 Bacteria 1402
789 Ga0496123_0000001 3300048926 Bacteria 1831497
790 Ga0496123_0000032 3300048926 Bacteria 285282
791 Ga0496123_0000552 3300048926 Bacteria 64124
792 Ga0496123_0007805 3300048926 Bacteria 9962
793 Ga0496123_0010385 3300048926 Bacteria 8237
794 Ga0496123_0016379 3300048926 Bacteria 6023
795 Ga0496123_0041233 3300048926 Bacteria 3203
796 Ga0496123_0098600 3300048926 Bacteria 1708
797 Ga0496124_0000740 3300048927 Bacteria 53495
798 Ga0496124_0002623 3300048927 Bacteria 23151
799 Ga0496124_0004853 3300048927 Bacteria 15467
800 Ga0496124_0010792 3300048927 Bacteria 9206
801 Ga0496124_0010996 3300048927 Bacteria 9095
802 Ga0496124_0015632 3300048927 Bacteria 7264
803 Ga0496124_0027905 3300048927 Bacteria 5055
804 Ga0496124_0028283 3300048927 Bacteria 5018
805 Ga0496124_0047659 3300048927 Bacteria 3665
806 Ga0496124_0100308 3300048927 Bacteria 2347
807 Ga0496124_0248539 3300048927 Bacteria 1317
808 Ga0496125_0000001 3300048928 Bacteria 1766138
809 Ga0496125_0000063 3300048928 Bacteria 250260
810 Ga0496125_0000394 3300048928 Bacteria 81230
811 Ga0496125_0000829 3300048928 Bacteria 49885
812 Ga0496125_0017863 3300048928 Bacteria 6749
813 Ga0496125_0019884 3300048928 Bacteria 6316
814 Ga0496125_0100465 3300048928 Bacteria 2132
815 Ga0496125_0230067 3300048928 Bacteria 1186
816 Ga0496126_0000788 3300048929 Bacteria 57185
817 Ga0496126_0005149 3300048929 Bacteria 15124
818 Ga0496126_0011177 3300048929 Bacteria 9318
819 Ga0496126_0081636 3300048929 Bacteria 2857
820 Ga0496126_0108949 3300048929 Bacteria 2414
821 Ga0496126_0127939 3300048929 Bacteria 2197
822 Ga0496126_0481256 3300048929 Bacteria 995
823 Ga0495678_027150 3300049459 Bacteria 2432
824 Ga0501031_0000019 3300049568 Bacteria 104793
825 Ga0501031_0015055 3300049568 Bacteria 5023
826 Ga0501031_0066253 3300049568 Bacteria 2353
827 Ga0501031_0075753 3300049568 Bacteria 2191
828 Ga0501031_0303856 3300049568 Bacteria 1034
829 Ga0501032_0000009 3300049569 Bacteria 228107
830 Ga0501032_0000312 3300049569 Bacteria 40889
831 Ga0501032_0006976 3300049569 Bacteria 8281
832 Ga0501032_0027515 3300049569 Bacteria 3907
833 Ga0501032_0046515 3300049569 Bacteria 2933
834 Ga0501032_0053046 3300049569 Bacteria 2732
835 Ga0501032_0218384 3300049569 Bacteria 1241
836 Ga0501033_0000019 3300049570 Bacteria 204699
837 Ga0501033_0000752 3300049570 Bacteria 29825
838 Ga0501033_0002156 3300049570 Bacteria 17025
839 Ga0501033_0007943 3300049570 Bacteria 8219
840 Ga0501033_0015322 3300049570 Bacteria 5815
841 Ga0501033_0024710 3300049570 Bacteria 4530
842 Ga0501033_0026725 3300049570 Bacteria 4342
843 Ga0501033_0035599 3300049570 Bacteria 3732
844 Ga0501033_0107723 3300049570 Bacteria 2030
845 Ga0501033_0172096 3300049570 Bacteria 1555
846 Ga0501034_0000044 3300049571 Bacteria 227982
847 Ga0501034_0002486 3300049571 Bacteria 22142
848 Ga0501034_0003827 3300049571 Bacteria 16957
849 Ga0501034_0023964 3300049571 Bacteria 6212
850 Ga0501034_0025143 3300049571 Bacteria 6060
851 Ga0501034_0060256 3300049571 Bacteria 3813
852 Ga0501034_0061223 3300049571 Bacteria 3780
853 Ga0501034_0105050 3300049571 Bacteria 2817
854 Ga0501034_0117026 3300049571 Bacteria 2653
855 Ga0501034_0191407 3300049571 Bacteria 2008
856 Ga0501034_0340306 3300049571 Bacteria 1430
857 Ga0501034_0363280 3300049571 Bacteria 1375
858 Ga0501036_0000008 3300049572 Bacteria 228106
859 Ga0501036_0001112 3300049572 Bacteria 20410
860 Ga0501036_0020356 3300049572 Bacteria 5573
861 Ga0501036_0058962 3300049572 Bacteria 3252
862 Ga0501036_0241096 3300049572 Bacteria 1516
863 Ga0501036_0257097 3300049572 Bacteria 1463
864 Ga0501036_0273426 3300049572 Bacteria 1414
865 Ga0501037_0000055 3300049573 Bacteria 109790
866 Ga0501037_0000118 3300049573 Bacteria 73584
867 Ga0501037_0000857 3300049573 Bacteria 22686
868 Ga0501037_0006217 3300049573 Bacteria 8731
869 Ga0501037_0023099 3300049573 Bacteria 4600
870 Ga0501037_0122415 3300049573 Bacteria 1869
871 Ga0501037_0196838 3300049573 Bacteria 1425
872 Ga0501038_0000006 3300049574 Bacteria 228107
873 Ga0501038_0000248 3300049574 Bacteria 45662
874 Ga0501038_0011040 3300049574 Bacteria 8247
875 Ga0501038_0028283 3300049574 Bacteria 4981
876 Ga0501038_0052588 3300049574 Bacteria 3511
877 Ga0501038_0069500 3300049574 Bacteria 2991
878 Ga0501038_0210218 3300049574 Bacteria 1557
879 Ga0501039_0000014 3300049575 Bacteria 228107
880 Ga0501039_0000048 3300049575 Bacteria 102012
881 Ga0501039_0030683 3300049575 Bacteria 4145
882 Ga0501039_0098634 3300049575 Bacteria 2279
883 Ga0501039_0153399 3300049575 Bacteria 1809
884 Ga0501039_0361676 3300049575 Bacteria 1140
885 Ga0501040_0002131 3300049576 Bacteria 12761
886 Ga0501041_0058195 3300049577 Bacteria 2364
887 Ga0501042_0102107 3300049578 Bacteria 2063
888 Ga0501043_0000107 3300049579 Bacteria 77469
889 Ga0501043_0000639 3300049579 Bacteria 30943
890 Ga0501043_0001366 3300049579 Bacteria 21372
891 Ga0501043_0012772 3300049579 Bacteria 6565
892 Ga0501043_0019526 3300049579 Bacteria 5320
893 Ga0501043_0024816 3300049579 Bacteria 4704
894 Ga0501043_0230588 3300049579 Bacteria 1430
895 Ga0501043_0468686 3300049579 Bacteria 944
896 Ga0501046_0044412 3300049580 Bacteria 3534
897 Ga0501046_0049181 3300049580 Bacteria 3336
898 Ga0501046_0058235 3300049580 Bacteria 3029
899 Ga0501046_0100950 3300049580 Bacteria 2214
900 Ga0501046_0136083 3300049580 Bacteria 1861
901 Ga0501047_0001105 3300049581 Bacteria 26770
902 Ga0501047_0017404 3300049581 Bacteria 6883
903 Ga0501047_0031991 3300049581 Bacteria 5076
904 Ga0501047_0045004 3300049581 Bacteria 4266
905 Ga0501047_0062837 3300049581 Bacteria 3582
906 Ga0501047_0085517 3300049581 Bacteria 3030
907 Ga0501047_0100575 3300049581 Bacteria 2770
908 Ga0501047_0202133 3300049581 Bacteria 1848
909 Ga0501047_0209212 3300049581 Bacteria 1809
910 Ga0501047_0269147 3300049581 Bacteria 1550
911 Ga0501048_0003551 3300049582 Bacteria 11855
912 Ga0501048_0102175 3300049582 Bacteria 2022
913 Ga0501048_0118797 3300049582 Bacteria 1868
914 Ga0501067_0050531 3300049583 Bacteria 2304
915 Ga0501067_0063660 3300049583 Bacteria 2042
916 Ga0501068_0028700 3300049584 Bacteria 3292
917 Ga0501068_0053868 3300049584 Bacteria 2437
918 Ga0501069_0001348 3300049585 Bacteria 12039
919 Ga0501069_0028971 3300049585 Bacteria 3037
920 Ga0501069_0116980 3300049585 Bacteria 1521
921 Ga0501070_0000132 3300049586 Bacteria 67092
922 Ga0501070_0000631 3300049586 Bacteria 32396
923 Ga0501070_0028755 3300049586 Bacteria 4660
924 Ga0501070_0031602 3300049586 Bacteria 4435
925 Ga0501070_0044320 3300049586 Bacteria 3702
926 Ga0501070_0049649 3300049586 Bacteria 3484
927 Ga0501070_0049997 3300049586 Bacteria 3471
928 Ga0501070_0495630 3300049586 Bacteria 982
929 Ga0501070_0543356 3300049586 Bacteria 931
930 Ga0501071_0017228 3300049587 Bacteria 4980
931 Ga0501071_0041634 3300049587 Bacteria 3290
932 Ga0501071_0101804 3300049587 Bacteria 2118
933 Ga0501072_0010225 3300049588 Bacteria 7148
934 Ga0501072_0386373 3300049588 Bacteria 1111
935 Ga0501073_0009343 3300049589 Bacteria 7235
936 Ga0501073_0020718 3300049589 Bacteria 4742
937 Ga0501073_0033412 3300049589 Bacteria 3663
938 Ga0501073_0270038 3300049589 Bacteria 1174
939 Ga0501074_0000088 3300049590 Bacteria 44911
940 Ga0501075_0094127 3300049591 Bacteria 2274
941 Ga0501076_0058409 3300049592 Bacteria 3066
942 Ga0501076_0092799 3300049592 Bacteria 2429
943 Ga0501080_0000128 3300049742 Bacteria 53662
944 Ga0501080_0017979 3300049742 Bacteria 6545
945 Ga0501080_0040601 3300049742 Bacteria 4339
946 Ga0501080_0124777 3300049742 Bacteria 2385
947 Ga0501080_0231255 3300049742 Bacteria 1690
948 Ga0501080_0538651 3300049742 Bacteria 1041
949 Ga0501081_0063804 3300049743 Bacteria 2557
950 Ga0501083_0000065 3300049744 Bacteria 73075
951 Ga0501083_0023789 3300049744 Bacteria 4248
952 Ga0501083_0139735 3300049744 Bacteria 1586
953 Ga0501083_0145701 3300049744 Bacteria 1550
954 Ga0501083_0242108 3300049744 Bacteria 1174
955 Ga0501035_0000096 3300049822 Bacteria 110635
956 Ga0501035_0000118 3300049822 Bacteria 95482
957 Ga0501035_0000185 3300049822 Bacteria 76291
958 Ga0501035_0000245 3300049822 Bacteria 65283
959 Ga0501035_0002121 3300049822 Bacteria 19738
960 Ga0501035_0002402 3300049822 Bacteria 18354
961 Ga0501035_0011321 3300049822 Bacteria 8268
962 Ga0501035_0014314 3300049822 Bacteria 7322
963 Ga0501035_0021609 3300049822 Bacteria 5918
964 Ga0501035_0077476 3300049822 Bacteria 2937
965 Ga0501035_0079908 3300049822 Bacteria 2888
966 Ga0501035_0082161 3300049822 Bacteria 2843
967 Ga0501035_0456323 3300049822 Bacteria 1057
968 Ga0501035_0522428 3300049822 Bacteria 975
969 Ga0501044_0000003 3300049823 Bacteria 345647
970 Ga0501044_0000017 3300049823 Bacteria 228107
971 Ga0501044_0021082 3300049823 Bacteria 6957
972 Ga0501044_0056837 3300049823 Bacteria 4017
973 Ga0501044_0061755 3300049823 Bacteria 3832
974 Ga0501044_0082243 3300049823 Bacteria 3259
975 Ga0501044_0112084 3300049823 Bacteria 2735
976 Ga0501044_0112933 3300049823 Bacteria 2724
977 Ga0501044_0127508 3300049823 Bacteria 2541
978 Ga0501044_0186250 3300049823 Bacteria 2040
979 Ga0501044_0277489 3300049823 Bacteria 1610
980 Ga0501044_0428036 3300049823 Bacteria 1233
981 Ga0501045_0069803 3300049824 Bacteria 2584
982 Ga0501045_0096237 3300049824 Bacteria 2190
983 nmdc:mga03683_564_c1 3300050489 Bacteria 10675
984 nmdc:mga03n38_146186_c1 3300050490 Bacteria 1185
985 nmdc:mga03n38_2724_c1 3300050490 Bacteria 5532
986 nmdc:mga00v17_14099_c1 3300050491 Bacteria 4455
987 nmdc:mga00v17_236505_c1 3300050491 Bacteria 1184
988 nmdc:mga00v17_53493_c1 3300050491 Bacteria 2461
989 nmdc:mga00v17_56095_c1 3300050491 Bacteria 2408
990 nmdc:mga0yw44_157926_c1 3300050492 Bacteria 1483
991 nmdc:mga0yw44_276826_c1 3300050492 Bacteria 1121
992 nmdc:mga0yw44_349_c1 3300050492 Bacteria 16248
993 nmdc:mga0yw44_35770_c1 3300050492 Bacteria 2921
994 nmdc:mga0yw44_3818_c1 3300050492 Bacteria 3160
995 nmdc:mga0yw44_4313_c1 3300050492 Bacteria 6494
996 nmdc:mga0yw44_64458_c1 3300050492 Bacteria 2255
997 nmdc:mga0yw44_7216_c2 3300050492 Bacteria 2954
998 nmdc:mga0k408_36016_c1 3300050493 Bacteria 2839
999 nmdc:mga0k408_4188_c1 3300050493 Bacteria 7653
1000 nmdc:mga0k408_51532_c1 3300050493 Bacteria 2385
1001 nmdc:mga06z11_2403_c1 3300050494 Bacteria 7134
1002 nmdc:mga06z11_242580_c1 3300050494 Bacteria 1059
1003 nmdc:mga06z11_344468_c1 3300050494 Bacteria 891
1004 nmdc:mga06z11_52752_c1 3300050494 Bacteria 2088
1005 nmdc:mga06z11_71168_c1 3300050494 Bacteria 1841
1006 nmdc:mga04h51_28645_c1 3300050495 Bacteria 1739
1007 nmdc:mga04h51_73035_c1 3300050495 Bacteria 1202
1008 nmdc:mga07m45_155605_c1 3300050496 Bacteria 1326
1009 nmdc:mga07m45_4076_c1 3300050496 Bacteria 7124
1010 nmdc:mga07m45_93014_c1 3300050496 Bacteria 1728
1011 nmdc:mga0n895_128829_c1 3300050512 Bacteria 2555
1012 nmdc:mga0n895_745588_c1 3300050512 Bacteria 973
1013 nmdc:mga0rr50_15118_c1 3300050513 Bacteria 5087
1014 nmdc:mga0rr50_276565_c1 3300050513 Bacteria 1400
1015 nmdc:mga0rr50_58788_c1 3300050513 Bacteria 2883
1016 nmdc:mga0sz30_23726_c1 3300050516 Bacteria 2499
1017 nmdc:mga0sz30_3205_c2 3300050516 Bacteria 1633
1018 nmdc:mga0sz30_34318_c2 3300050516 Bacteria 1224
1019 nmdc:mga0sz30_45262_c1 3300050516 Bacteria 1856
1020 Ga0495601_0000006 3300053077 Bacteria 373770
1021 Ga0495601_0000549 3300053077 Bacteria 19855
1022 Ga0495601_0015181 3300053077 Bacteria 4654
1023 Ga0495601_0043124 3300053077 Bacteria 2833
1024 Ga0495612_0000004 3300053078 Bacteria 286946
1025 Ga0495612_0011648 3300053078 Bacteria 3544
1026 Ga0495612_0015944 3300053078 Bacteria 3011
1027 Ga0495612_0071201 3300053078 Bacteria 1450
1028 Ga0500635_0015076 3300053080 Bacteria 2277
1029 Ga0495655_0056967 3300053083 Bacteria 1053
1030 Ga0495595_0000006 3300053084 Bacteria 231295
1031 Ga0495595_0002822 3300053084 Bacteria 6832
1032 Ga0495595_0003722 3300053084 Bacteria 6063
1033 Ga0495595_0030084 3300053084 Bacteria 2433
1034 Ga0495619_0000011 3300053085 Bacteria 287128
1035 Ga0495619_0000164 3300053085 Bacteria 48672
1036 Ga0495619_0001121 3300053085 Bacteria 17592
1037 Ga0495619_0162164 3300053085 Bacteria 1544
1038 Ga0500578_0107045 3300053086 Bacteria 1765
1039 Ga0500578_0174366 3300053086 Bacteria 1328
1040 Ga0500643_000037 3300053087 Bacteria 180821
1041 Ga0500643_024125 3300053087 Bacteria 1935
1042 Ga0500643_039564 3300053087 Bacteria 1392
1043 Ga0500644_0005437 3300053088 Bacteria 3217
1044 Ga0500646_0033849 3300053090 Bacteria 1415
1045 Ga0500583_0008901 3300053092 Bacteria 3637
1046 Ga0500566_0000335 3300053094 Bacteria 25676
1047 Ga0500555_015557 3300053103 Bacteria 2194
1048 Ga0500557_000047 3300053105 Bacteria 59226
1049 Ga0500560_004671 3300053107 Bacteria 2942
1050 Ga0500562_033078 3300053108 Bacteria 1366
1051 Ga0500569_000857 3300053109 Bacteria 5395
1052 Ga0500593_013096 3300053117 Bacteria 3534
1053 Ga0500594_0000615 3300053118 Bacteria 7613
1054 Ga0500608_074631 3300053122 Bacteria 1608
1055 Ga0500618_000084 3300053125 Bacteria 76331
1056 Ga0500618_000592 3300053125 Bacteria 22323
1057 Ga0500618_004461 3300053125 Bacteria 4468
1058 Ga0500618_011663 3300053125 Bacteria 2324
1059 Ga0500642_0158018 3300053130 Bacteria 1063
1060 Ga0500658_0000636 3300053134 Bacteria 14557
1061 Ga0500658_0057747 3300053134 Bacteria 1605
1062 Ga0500559_0002896 3300053136 Bacteria 8645
1063 Ga0500559_0053236 3300053136 Bacteria 1791
1064 Ga0500561_0001272 3300053137 Bacteria 4098
1065 Ga0500568_0000056 3300053139 Bacteria 109531
1066 Ga0500568_0000846 3300053139 Bacteria 21547
1067 Ga0500568_0002227 3300053139 Bacteria 11640
1068 Ga0500568_0008272 3300053139 Bacteria 5030
1069 Ga0500568_0027980 3300053139 Bacteria 2353
1070 Ga0500573_0000429 3300053140 Bacteria 17964
1071 Ga0500577_0000032 3300053142 Bacteria 33173
1072 Ga0500577_0060322 3300053142 Bacteria 1456
1073 Ga0500604_0031096 3300053151 Bacteria 1565
1074 Ga0500616_0000084 3300053153 Bacteria 195562
1075 Ga0500616_0000551 3300053153 Bacteria 46529
1076 Ga0500616_0000917 3300053153 Bacteria 32210
1077 Ga0500620_000830 3300053155 Bacteria 5363
1078 Ga0500620_009455 3300053155 Bacteria 2518
1079 Ga0500622_0000159 3300053156 Bacteria 71047
1080 Ga0500622_0000425 3300053156 Bacteria 40013
1081 Ga0500624_000255 3300053157 Bacteria 18774
1082 Ga0500624_005173 3300053157 Bacteria 1729
1083 Ga0500627_0022426 3300053158 Bacteria 2561
1084 Ga0500627_0038752 3300053158 Bacteria 2039
1085 Ga0500627_0076805 3300053158 Bacteria 1485
1086 Ga0500627_0084823 3300053158 Bacteria 1414
1087 Ga0500627_0113291 3300053158 Bacteria 1221
1088 Ga0500634_0054534 3300053161 Bacteria 2142
1089 Ga0500634_0063075 3300053161 Bacteria 1961
1090 Ga0500636_0000015 3300053177 Bacteria 123980
1091 Ga0500636_0012938 3300053177 Bacteria 4896
1092 Ga0500611_005646 3300053727 Bacteria 1774
1093 Ga0500599_000444 3300053736 Bacteria 4272
1094 Ga0500601_000014 3300053737 Bacteria 41972
1095 Ga0501084_0032546 3300054114 Bacteria 4362
1096 Ga0501084_0083485 3300054114 Bacteria 2681
1097 Ga0501084_0137227 3300054114 Bacteria 2059
1098 Ga0530510_0261203 3300061734 Bacteria 1291

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046457 Ga0495590_0038560 Ga0495590_0038560_10_630 203
2 3300046615 Ga0495656_0492283 Ga0495656_0492283_17_637 203
3 3300053105 Ga0500557_000047 Ga0500557_000047_28597_29364 215
4 3300006195 Ga0075366_10116420 Ga0075366_101164202 216
5 3300050493 nmdc:mga0k408_36016_c1 nmdc:mga0k408_36016_c1_57_827 216
6 3300025302 Ga0207426_1042112 Ga0207426_10421121 220
7 3300004625 Ga0055543_1002843 Ga0055543_10028435 224
8 3300050492 nmdc:mga0yw44_35770_c1 nmdc:mga0yw44_35770_c1_326_1093 224
9 3300047471 Ga0495684_0183592 Ga0495684_0183592_741_1442 225
10 3300046455 Ga0495603_0104030 Ga0495603_0104030_13_717 228
11 3300046538 Ga0495609_0078224 Ga0495609_0078224_444_1211 228
12 3300037312 Ga0395899_0402979 Ga0395899_0402979_30_797 229
13 3300005455 Ga0070663_100491468 Ga0070663_1004914682 230
14 3300025919 Ga0207657_10055298 Ga0207657_100552982 230
15 3300026067 Ga0207678_10078531 Ga0207678_100785311 230
16 3300041452 Ga0451793_1350958 Ga0451793_1350958_374_1141 230
17 3300046460 Ga0495638_0013340 Ga0495638_0013340_3419_4180 230
18 3300046524 Ga0495648_0034773 Ga0495648_0034773_1725_2486 230
19 3300005262 Ga0065165_1004569 Ga0065165_10045695 231
20 3300025302 Ga0207426_1001010 Ga0207426_100101015 231
21 3300048903 Ga0496100_0074169 Ga0496100_0074169_16_720 231
22 3300048905 Ga0496102_0208481 Ga0496102_0208481_12_716 231
23 3300053087 Ga0500643_000037 Ga0500643_000037_87245_88012 231
24 3300053092 Ga0500583_0008901 Ga0500583_0008901_1062_1829 231
25 3300053103 Ga0500555_015557 Ga0500555_015557_484_1251 231
26 3300053134 Ga0500658_0057747 Ga0500658_0057747_154_921 231
27 3300053139 Ga0500568_0008272 Ga0500568_0008272_1815_2582 231
28 3300053142 Ga0500577_0060322 Ga0500577_0060322_222_989 231
29 3300053158 Ga0500627_0038752 Ga0500627_0038752_268_1035 231
30 3300053161 Ga0500634_0054534 Ga0500634_0054534_502_1269 231
31 3300053737 Ga0500601_000014 Ga0500601_000014_5873_6640 231
32 3300053080 Ga0500635_0015076 Ga0500635_0015076_430_1197 235
33 3300053736 Ga0500599_000444 Ga0500599_000444_2192_2959 235
34 iso_pu_bacteria 2977971508 2977978292 235
35 3300021320 Ga0214544_1000691 Ga0214544_100069110 237
36 3300021321 Ga0214542_1000019 Ga0214542_100001962 237
37 3300021327 Ga0214543_1000010 Ga0214543_1000010218 237
38 3300049582 Ga0501048_0003551 Ga0501048_0003551_2745_3470 238
39 3300035085 Ga0373929_0016640 Ga0373929_0016640_14_754 240
40 3300048913 Ga0496110_0016493 Ga0496110_0016493_30_770 240
41 3300048924 Ga0496121_0051550 Ga0496121_0051550_1717_2484 240
42 3300053094 Ga0500566_0000335 Ga0500566_0000335_6257_7024 240
43 3300003215 JGI25153J46596_10000263 JGI25153J46596_1000026317 242
44 3300025297 Ga0209758_1000087 Ga0209758_1000087175 242
45 3300038443 Ga0395901_0178660 Ga0395901_0178660_726_1493 242
46 3300048905 Ga0496102_0710548 Ga0496102_0710548_159_905 242
47 3300050512 nmdc:mga0n895_745588_c1 nmdc:mga0n895_745588_c1_68_814 242
48 3300041456 Ga0451795_1607243 Ga0451795_1607243_221_961 244
49 3300048918 Ga0496115_0094320 Ga0496115_0094320_1660_2409 246
50 3300049586 Ga0501070_0495630 Ga0501070_0495630_43_864 246
51 iso_pu_bacteria 2513237139 2513877738 248
52 iso_pu_bacteria 2513237161 2514015070 248
53 iso_pu_bacteria 2528768022 2528852309 248
54 iso_pu_bacteria 2617270735 2617350000 248
55 iso_pu_bacteria 2802429603 2805917133 248
56 iso_pu_bacteria 2824671348 2824675881 248
57 iso_pu_bacteria 2824687955 2824692003 248
58 iso_pu_bacteria 2824696289 2824696605 248
59 iso_pu_bacteria 2824773399 2824776760 248
60 iso_pu_bacteria 2838122688 2838125417 248
61 iso_pu_bacteria 2841941048 2841941923 248
62 iso_pu_bacteria 2841949485 2841951357 248
63 iso_pu_bacteria 2841974524 2841976155 248
64 iso_pu_bacteria 2841983080 2841987520 248
65 iso_pu_bacteria 2847939898 2847944708 248
66 iso_pu_bacteria 2849076700 2849081064 248
67 iso_pu_bacteria 2874612657 2874612920 248
68 iso_pu_bacteria 2874628541 2874634752 248
69 iso_pu_bacteria 2932784394 2932793128 248
70 iso_pu_bacteria 2932809354 2932814566 248
71 iso_pu_bacteria 2932818245 2932824631 248
72 iso_pu_bacteria 2935616580 2935623321 248
73 iso_pu_bacteria 2935638405 2935646681 248
74 iso_pu_bacteria 2935665750 2935672649 248
75 iso_pu_bacteria 2935675223 2935682522 248
76 iso_pu_bacteria 2935777560 2935784917 248
77 iso_pu_bacteria 2935827899 2935835948 248
78 iso_pu_bacteria 2935837841 2935844928 248
79 iso_pu_bacteria 2935855204 2935861679 248
80 iso_pu_bacteria 2935864058 2935870718 248
81 iso_pu_bacteria 2935873716 2935881409 248
82 iso_pu_bacteria 2935992306 2936000409 248
83 iso_pu_bacteria 2941538514 2941546735 248
84 iso_pu_bacteria 3005506211 3005512168 248
85 3300041405 Ga0439438_047014 Ga0439438_047014_16_867 249
86 3300041498 Ga0451841_0003394 Ga0451841_0003394_19_849 249
87 3300003215 JGI25153J46596_10000110 JGI25153J46596_1000011021 250
88 3300003794 Ga0055531_10008315 Ga0055531_100083157 250
89 3300005719 Ga0068861_100549835 Ga0068861_1005498352 250
90 3300005844 Ga0068862_100344208 Ga0068862_1003442082 250
91 3300006163 Ga0070715_10119369 Ga0070715_101193691 250
92 3300009093 Ga0105240_10295384 Ga0105240_102953842 250
93 3300009545 Ga0105237_10834477 Ga0105237_108344772 250
94 3300025297 Ga0209758_1000075 Ga0209758_1000075103 250
95 3300025299 Ga0209256_1003035 Ga0209256_10030351 250
96 3300025304 Ga0209257_1000795 Ga0209257_10007957 250
97 3300025913 Ga0207695_10238269 Ga0207695_102382692 250
98 3300025942 Ga0207689_10384522 Ga0207689_103845222 250
99 3300025945 Ga0207679_10168546 Ga0207679_101685462 250
100 3300026035 Ga0207703_10206470 Ga0207703_102064701 250
101 3300026118 Ga0207675_100097538 Ga0207675_1000975382 250
102 3300036401 Ga0373937_0805842 Ga0373937_0805842_15_782 250
103 3300046674 Ga0495588_0041178 Ga0495588_0041178_1416_2183 250
104 3300048903 Ga0496100_0233027 Ga0496100_0233027_475_1242 250
105 3300048904 Ga0496101_0177400 Ga0496101_0177400_747_1514 250
106 3300048906 Ga0496103_0200609 Ga0496103_0200609_150_959 250
107 3300048906 Ga0496103_0210581 Ga0496103_0210581_444_1211 250
108 3300048907 Ga0496104_0068429 Ga0496104_0068429_1467_2234 250
109 3300048908 Ga0496105_0054115 Ga0496105_0054115_1914_2681 250
110 3300048909 Ga0496106_0421694 Ga0496106_0421694_254_1021 250
111 3300048913 Ga0496110_0469187 Ga0496110_0469187_47_814 250
112 3300048916 Ga0496113_0235653 Ga0496113_0235653_315_1082 250
113 3300048917 Ga0496114_0148890 Ga0496114_0148890_255_1022 250
114 3300048918 Ga0496115_0283293 Ga0496115_0283293_259_1026 250
115 3300048924 Ga0496121_0034679 Ga0496121_0034679_716_1483 250
116 3300048929 Ga0496126_0127939 Ga0496126_0127939_354_1121 250
117 3300053177 Ga0500636_0000015 Ga0500636_0000015_98102_98935 250
118 iso_pu_bacteria 2738543024 2739308037 250
119 iso_pu_bacteria 2921296804 2921297339 250
120 3300002705 JGI25156J39149_1004074 JGI25156J39149_10040743 251
121 3300002741 JGI25157J39369_1001617 JGI25157J39369_10016173 251
122 3300005355 Ga0070671_100103037 Ga0070671_1001030372 251
123 3300005364 Ga0070673_100010267 Ga0070673_1000102675 251
124 3300005366 Ga0070659_100394898 Ga0070659_1003948981 251
125 3300005434 Ga0070709_10094639 Ga0070709_100946392 251
126 3300005439 Ga0070711_100120096 Ga0070711_1001200962 251
127 3300005543 Ga0070672_100097229 Ga0070672_1000972292 251
128 3300005548 Ga0070665_100577499 Ga0070665_1005774992 251
129 3300005842 Ga0068858_100497021 Ga0068858_1004970212 251
130 3300006028 Ga0070717_10225787 Ga0070717_102257872 251
131 3300006051 Ga0075364_10014961 Ga0075364_100149612 251
132 3300010375 Ga0105239_10205613 Ga0105239_102056132 251
133 3300011119 Ga0105246_10178956 Ga0105246_101789562 251
134 3300014968 Ga0157379_10250380 Ga0157379_102503802 251
135 3300024227 Ga0228598_1002460 Ga0228598_10024603 251
136 3300025250 Ga0209026_1000002 Ga0209026_1000002272 251
137 3300025256 Ga0209759_1000062 Ga0209759_100006244 251
138 3300025906 Ga0207699_10154046 Ga0207699_101540462 251
139 3300025915 Ga0207693_10153669 Ga0207693_101536692 251
140 3300025916 Ga0207663_10033876 Ga0207663_100338762 251
141 3300025927 Ga0207687_10141056 Ga0207687_101410562 251
142 3300025931 Ga0207644_10046328 Ga0207644_100463283 251
143 3300025933 Ga0207706_10149500 Ga0207706_101495002 251
144 3300025940 Ga0207691_10066544 Ga0207691_100665443 251
145 3300025960 Ga0207651_10069164 Ga0207651_100691643 251
146 3300026035 Ga0207703_10352652 Ga0207703_103526522 251
147 3300028379 Ga0268266_10050734 Ga0268266_100507343 251
148 3300035117 Ga0373953_0030857 Ga0373953_0030857_99_863 251
149 3300036401 Ga0373937_0177870 Ga0373937_0177870_938_1702 251
150 3300046454 Ga0495592_0242406 Ga0495592_0242406_343_1107 251
151 3300046463 Ga0495653_0073254 Ga0495653_0073254_1696_2460 251
152 3300046511 Ga0495608_0067504 Ga0495608_0067504_499_1263 251
153 3300046516 Ga0495628_0111604 Ga0495628_0111604_128_892 251
154 3300046536 Ga0495587_0071017 Ga0495587_0071017_330_1094 251
155 3300046559 Ga0495667_0041089 Ga0495667_0041089_1892_2656 251
156 3300046663 Ga0495635_0062717 Ga0495635_0062717_848_1612 251
157 3300046675 Ga0495657_0112356 Ga0495657_0112356_14_778 251
158 3300046678 Ga0495599_0073355 Ga0495599_0073355_196_960 251
159 3300047317 Ga0495604_0183907 Ga0495604_0183907_630_1394 251
160 3300047471 Ga0495684_0148862 Ga0495684_0148862_807_1571 251
161 3300048088 Ga0495602_0024539 Ga0495602_0024539_3008_3772 251
162 3300048903 Ga0496100_0154624 Ga0496100_0154624_815_1579 251
163 3300048904 Ga0496101_0213875 Ga0496101_0213875_588_1352 251
164 3300048907 Ga0496104_0195967 Ga0496104_0195967_706_1470 251
165 3300048912 Ga0496109_0131999 Ga0496109_0131999_1168_1932 251
166 3300048913 Ga0496110_0379011 Ga0496110_0379011_199_963 251
167 3300048915 Ga0496112_0064226 Ga0496112_0064226_264_1028 251
168 3300050491 nmdc:mga00v17_14099_c1 nmdc:mga00v17_14099_c1_934_1818 251
169 3300053084 Ga0495595_0030084 Ga0495595_0030084_1581_2345 251
170 iso_pu_bacteria 2643221651 2644287664 251
171 3300054114 Ga0501084_0083485 Ga0501084_0083485_54_830 252
172 iso_pu_bacteria 2891373044 2891373070 252
173 3300005335 Ga0070666_10236772 Ga0070666_102367722 253
174 3300026035 Ga0207703_10483042 Ga0207703_104830422 253
175 3300032004 Ga0307414_10240394 Ga0307414_102403942 253
176 3300035724 Ga0373933_0003159 Ga0373933_0003159_1158_1946 253
177 3300036401 Ga0373937_0001336 Ga0373937_0001336_6930_7718 253
178 3300037853 Ga0436364_1553897 Ga0436364_1553897_1062_1835 253
179 3300038742 Ga0400486_12421 Ga0400486_12421_141_920 253
180 3300039437 Ga0436365_1820406 Ga0436365_1820406_1054_1827 253
181 3300046511 Ga0495608_0000442 Ga0495608_0000442_17809_18597 253
182 3300046524 Ga0495648_0005337 Ga0495648_0005337_379_1149 253
183 3300046675 Ga0495657_0265480 Ga0495657_0265480_225_1013 253
184 3300046680 Ga0495646_0010351 Ga0495646_0010351_1523_2311 253
185 3300047320 Ga0495672_0019795 Ga0495672_0019795_44_814 253
186 3300048924 Ga0496121_0012773 Ga0496121_0012773_6375_7145 253
187 3300048924 Ga0496121_0092891 Ga0496121_0092891_472_1242 253
188 3300048928 Ga0496125_0000063 Ga0496125_0000063_165029_165799 253
189 3300048928 Ga0496125_0000829 Ga0496125_0000829_47056_47826 253
190 3300048929 Ga0496126_0081636 Ga0496126_0081636_63_833 253
191 3300049568 Ga0501031_0303856 Ga0501031_0303856_41_817 253
192 3300049569 Ga0501032_0027515 Ga0501032_0027515_830_1606 253
193 3300049570 Ga0501033_0107723 Ga0501033_0107723_625_1401 253
194 3300049572 Ga0501036_0058962 Ga0501036_0058962_1192_1968 253
195 3300049574 Ga0501038_0028283 Ga0501038_0028283_273_1040 253
196 3300049589 Ga0501073_0020718 Ga0501073_0020718_2533_3309 253
197 3300049589 Ga0501073_0270038 Ga0501073_0270038_218_985 253
198 3300049744 Ga0501083_0139735 Ga0501083_0139735_98_874 253
199 3300049822 Ga0501035_0021609 Ga0501035_0021609_3476_4243 253
200 3300049822 Ga0501035_0456323 Ga0501035_0456323_232_999 253
201 3300050491 nmdc:mga00v17_236505_c1 nmdc:mga00v17_236505_c1_215_985 253
202 3300053077 Ga0495601_0043124 Ga0495601_0043124_629_1417 253
203 3300053087 Ga0500643_039564 Ga0500643_039564_401_1168 253
204 3300053139 Ga0500568_0027980 Ga0500568_0027980_198_971 253
205 3300053142 Ga0500577_0000032 Ga0500577_0000032_18747_19517 253
206 3300053153 Ga0500616_0000084 Ga0500616_0000084_63189_63959 253
207 iso_pu_bacteria 8054558443 8054562616 253
208 3300005844 Ga0068862_100388974 Ga0068862_1003889742 254
209 3300005937 Ga0081455_10000419 Ga0081455_1000041937 254
210 3300007076 Ga0075435_100059145 Ga0075435_1000591453 254
211 3300035113 Ga0373936_0001937 Ga0373936_0001937_471_1253 254
212 3300035116 Ga0373945_0001585 Ga0373945_0001585_821_1603 254
213 3300035116 Ga0373945_0012768 Ga0373945_0012768_211_993 254
214 3300035117 Ga0373953_0001305 Ga0373953_0001305_3994_4776 254
215 3300035118 Ga0373954_0018425 Ga0373954_0018425_1210_1992 254
216 3300035119 Ga0373956_0013030 Ga0373956_0013030_801_1583 254
217 3300035120 Ga0373957_0019954 Ga0373957_0019954_380_1162 254
218 3300035171 Ga0373946_0123186 Ga0373946_0123186_174_956 254
219 3300035171 Ga0373946_0139516 Ga0373946_0139516_219_1001 254
220 3300035172 Ga0373955_0000213 Ga0373955_0000213_20675_21457 254
221 3300035692 Ga0373935_0000131 Ga0373935_0000131_11511_12293 254
222 3300035692 Ga0373935_0024391 Ga0373935_0024391_108_890 254
223 3300035692 Ga0373935_0030875 Ga0373935_0030875_411_1190 254
224 3300035695 Ga0373927_0014897 Ga0373927_0014897_2334_3116 254
225 3300035695 Ga0373927_0025227 Ga0373927_0025227_605_1387 254
226 3300035724 Ga0373933_0053964 Ga0373933_0053964_792_1574 254
227 3300035725 Ga0373947_0002523 Ga0373947_0002523_8379_9161 254
228 3300035725 Ga0373947_0023677 Ga0373947_0023677_1438_2220 254
229 3300036401 Ga0373937_0000293 Ga0373937_0000293_35050_35832 254
230 3300036401 Ga0373937_0067560 Ga0373937_0067560_1204_1983 254
231 3300037068 Ga0373925_0000087 Ga0373925_0000087_66331_67113 254
232 3300037068 Ga0373925_0041897 Ga0373925_0041897_955_1737 254
233 3300044694 Ga0466963_0091702 Ga0466963_0091702_1027_1812 254
234 3300045976 Ga0466967_0093353 Ga0466967_0093353_1632_2417 254
235 3300046454 Ga0495592_0000001 Ga0495592_0000001_277649_278431 254
236 3300046455 Ga0495603_0041109 Ga0495603_0041109_1916_2698 254
237 3300046459 Ga0495629_0000401 Ga0495629_0000401_10357_11139 254
238 3300046459 Ga0495629_0010498 Ga0495629_0010498_5153_5935 254
239 3300046462 Ga0495651_0001675 Ga0495651_0001675_6762_7544 254
240 3300046463 Ga0495653_0000015 Ga0495653_0000015_41957_42739 254
241 3300046473 Ga0495582_0168722 Ga0495582_0168722_311_1093 254
242 3300046476 Ga0495662_0000957 Ga0495662_0000957_3272_4054 254
243 3300046477 Ga0495664_0000001 Ga0495664_0000001_37929_38711 254
244 3300046499 Ga0495594_0011198 Ga0495594_0011198_1245_2027 254
245 3300046511 Ga0495608_0000066 Ga0495608_0000066_14440_15222 254
246 3300046514 Ga0495618_0000021 Ga0495618_0000021_6839_7621 254
247 3300046516 Ga0495628_0000005 Ga0495628_0000005_289930_290712 254
248 3300046517 Ga0495630_0000254 Ga0495630_0000254_7651_8433 254
249 3300046529 Ga0495652_0000001 Ga0495652_0000001_788454_789236 254
250 3300046533 Ga0495640_0000006 Ga0495640_0000006_236090_236872 254
251 3300046536 Ga0495587_0000012 Ga0495587_0000012_130095_130877 254
252 3300046543 Ga0495645_0000041 Ga0495645_0000041_23577_24359 254
253 3300046559 Ga0495667_0000001 Ga0495667_0000001_628422_629204 254
254 3300046642 Ga0495634_0000624 Ga0495634_0000624_8560_9342 254
255 3300046663 Ga0495635_0000007 Ga0495635_0000007_62463_63245 254
256 3300046663 Ga0495635_0311267 Ga0495635_0311267_121_903 254
257 3300046675 Ga0495657_0000047 Ga0495657_0000047_79793_80575 254
258 3300046678 Ga0495599_0000002 Ga0495599_0000002_129515_130297 254
259 3300046679 Ga0495623_0000023 Ga0495623_0000023_68369_69151 254
260 3300046680 Ga0495646_0000024 Ga0495646_0000024_69278_70060 254
261 3300046683 Ga0495658_0000265 Ga0495658_0000265_19654_20436 254
262 3300046689 Ga0495613_0170939 Ga0495613_0170939_297_1079 254
263 3300046690 Ga0495624_0011265 Ga0495624_0011265_914_1696 254
264 3300046809 Ga0495600_0000013 Ga0495600_0000013_99306_100088 254
265 3300047315 Ga0495581_0009849 Ga0495581_0009849_279_1061 254
266 3300047317 Ga0495604_0000007 Ga0495604_0000007_155504_156286 254
267 3300047319 Ga0495674_0000001 Ga0495674_0000001_237866_238648 254
268 3300047319 Ga0495674_0123895 Ga0495674_0123895_191_970 254
269 3300047321 Ga0495676_0031404 Ga0495676_0031404_2888_3670 254
270 3300047322 Ga0495680_0001437 Ga0495680_0001437_17972_18754 254
271 3300047322 Ga0495680_0030613 Ga0495680_0030613_3271_4053 254
272 3300047444 Ga0495675_0000014 Ga0495675_0000014_110043_110825 254
273 3300047471 Ga0495684_0000027 Ga0495684_0000027_56286_57068 254
274 3300047673 Ga0495593_0002819 Ga0495593_0002819_1842_2624 254
275 3300047673 Ga0495593_0051458 Ga0495593_0051458_1355_2137 254
276 3300048088 Ga0495602_0000004 Ga0495602_0000004_130138_130920 254
277 3300048089 Ga0495614_0137373 Ga0495614_0137373_152_934 254
278 3300048907 Ga0496104_0740274 Ga0496104_0740274_34_816 254
279 3300048918 Ga0496115_0057816 Ga0496115_0057816_1320_2102 254
280 3300050513 nmdc:mga0rr50_15118_c1 nmdc:mga0rr50_15118_c1_3909_4691 254
281 3300053077 Ga0495601_0000006 Ga0495601_0000006_77916_78698 254
282 3300053078 Ga0495612_0000004 Ga0495612_0000004_235962_236744 254
283 3300053084 Ga0495595_0000006 Ga0495595_0000006_163408_164190 254
284 3300053085 Ga0495619_0000011 Ga0495619_0000011_195987_196769 254
285 3300053085 Ga0495619_0000164 Ga0495619_0000164_8346_9128 254
286 iso_pu_bacteria 2989349275 2989349331 254
287 3300006871 Ga0075434_100129911 Ga0075434_1001299112 255
288 3300009551 Ga0105238_10059607 Ga0105238_100596073 255
289 3300025924 Ga0207694_10122626 Ga0207694_101226262 255
290 3300025928 Ga0207700_10271993 Ga0207700_102719932 255
291 3300025929 Ga0207664_10073102 Ga0207664_100731022 255
292 3300031665 Ga0316575_10015584 Ga0316575_100155842 255
293 3300031727 Ga0316576_10267750 Ga0316576_102677502 255
294 3300031728 Ga0316578_10013064 Ga0316578_100130643 255
295 3300035113 Ga0373936_0035998 Ga0373936_0035998_655_1434 255
296 3300035398 Ga0316574_0007201 Ga0316574_0007201_3610_4392 255
297 3300036647 Ga0316582_0144311 Ga0316582_0144311_217_999 255
298 3300036712 Ga0316584_0016716 Ga0316584_0016716_808_1590 255
299 3300046660 Ga0495625_0327300 Ga0495625_0327300_100_876 255
300 3300048907 Ga0496104_0003761 Ga0496104_0003761_8140_8928 255
301 3300048908 Ga0496105_0033637 Ga0496105_0033637_3215_4003 255
302 3300048909 Ga0496106_0015871 Ga0496106_0015871_206_994 255
303 3300048910 Ga0496107_0247403 Ga0496107_0247403_412_1197 255
304 3300048911 Ga0496108_0160575 Ga0496108_0160575_997_1785 255
305 3300048912 Ga0496109_0142061 Ga0496109_0142061_816_1604 255
306 3300048913 Ga0496110_0252922 Ga0496110_0252922_796_1584 255
307 3300048915 Ga0496112_0024527 Ga0496112_0024527_4450_5238 255
308 3300050512 nmdc:mga0n895_128829_c1 nmdc:mga0n895_128829_c1_1731_2513 255
309 iso_pu_bacteria 2856328259 2856329015 255
310 iso_pu_bacteria 2869234852 2869240120 255
311 iso_pu_bacteria 2869264136 2869265924 255
312 iso_pu_bacteria 2871435913 2871439906 255
313 iso_pu_bacteria 2871451962 2871452468 255
314 iso_pu_bacteria 2874109183 2874114458 255
315 iso_pu_bacteria 2874131515 2874136198 255
316 iso_pu_bacteria 2874162495 2874166133 255
317 iso_pu_bacteria 2876399893 2876405722 255
318 iso_pu_bacteria 2878730984 2878734058 255
319 iso_pu_bacteria 2903513507 2903517564 255
320 iso_pu_bacteria 2906363423 2906364898 255
321 iso_pu_bacteria 2906370794 2906375731 255
322 iso_pu_bacteria 2906386501 2906393157 255
323 iso_pu_bacteria 2906408224 2906410316 255
324 iso_pu_bacteria 2922172374 2922175360 255
325 iso_pu_bacteria 2924733363 2924737073 255
326 iso_pu_bacteria 2924748358 2924750747 255
327 iso_pu_bacteria 3003930520 3003933680 255
328 3300003187 JGI25151J46595_10019572 JGI25151J46595_100195722 256
329 3300005334 Ga0068869_100397513 Ga0068869_1003975132 256
330 3300005617 Ga0068859_100461043 Ga0068859_1004610432 256
331 3300006931 Ga0097620_100461040 Ga0097620_1004610402 256
332 3300025294 Ga0209025_1000119 Ga0209025_1000119176 256
333 3300025942 Ga0207689_10578837 Ga0207689_105788372 256
334 3300032133 Ga0316583_10016742 Ga0316583_100167423 256
335 3300035117 Ga0373953_0011755 Ga0373953_0011755_180_986 256
336 3300035119 Ga0373956_0004598 Ga0373956_0004598_1641_2426 256
337 3300035724 Ga0373933_0014822 Ga0373933_0014822_2031_2816 256
338 3300036401 Ga0373937_0024713 Ga0373937_0024713_2297_3082 256
339 3300036401 Ga0373937_0026411 Ga0373937_0026411_2911_3696 256
340 3300037471 Ga0395905_0358766 Ga0395905_0358766_548_1333 256
341 3300046454 Ga0495592_0013394 Ga0495592_0013394_2452_3258 256
342 3300046462 Ga0495651_0119946 Ga0495651_0119946_985_1770 256
343 3300046463 Ga0495653_0073882 Ga0495653_0073882_958_1743 256
344 3300046517 Ga0495630_0058818 Ga0495630_0058818_1128_1934 256
345 3300046529 Ga0495652_0177606 Ga0495652_0177606_765_1550 256
346 3300046533 Ga0495640_0060368 Ga0495640_0060368_625_1410 256
347 3300046533 Ga0495640_0299459 Ga0495640_0299459_59_844 256
348 3300046536 Ga0495587_0044458 Ga0495587_0044458_1549_2334 256
349 3300046559 Ga0495667_0056015 Ga0495667_0056015_951_1736 256
350 3300046663 Ga0495635_0019774 Ga0495635_0019774_3040_3825 256
351 3300046675 Ga0495657_0040502 Ga0495657_0040502_1060_1845 256
352 3300046675 Ga0495657_0081415 Ga0495657_0081415_1191_1976 256
353 3300046679 Ga0495623_0198428 Ga0495623_0198428_148_933 256
354 3300047317 Ga0495604_0006585 Ga0495604_0006585_51_836 256
355 3300047319 Ga0495674_0049741 Ga0495674_0049741_1501_2286 256
356 3300047322 Ga0495680_0058117 Ga0495680_0058117_1456_2241 256
357 3300047322 Ga0495680_0105083 Ga0495680_0105083_938_1723 256
358 3300047444 Ga0495675_0016294 Ga0495675_0016294_955_1761 256
359 3300047471 Ga0495684_0133030 Ga0495684_0133030_747_1532 256
360 3300048088 Ga0495602_0037412 Ga0495602_0037412_403_1188 256
361 3300048088 Ga0495602_0162113 Ga0495602_0162113_534_1319 256
362 3300048925 Ga0496122_0000992 Ga0496122_0000992_32553_33332 256
363 3300048926 Ga0496123_0000552 Ga0496123_0000552_31847_32626 256
364 3300048928 Ga0496125_0000394 Ga0496125_0000394_47678_48457 256
365 3300049570 Ga0501033_0002156 Ga0501033_0002156_3917_4699 256
366 3300049822 Ga0501035_0002402 Ga0501035_0002402_3903_4685 256
367 3300049822 Ga0501035_0522428 Ga0501035_0522428_143_925 256
368 3300053077 Ga0495601_0000549 Ga0495601_0000549_12937_13722 256
369 3300053077 Ga0495601_0015181 Ga0495601_0015181_1934_2719 256
370 3300053078 Ga0495612_0011648 Ga0495612_0011648_1208_1993 256
371 3300053078 Ga0495612_0015944 Ga0495612_0015944_958_1743 256
372 3300053084 Ga0495595_0002822 Ga0495595_0002822_4467_5252 256
373 3300053084 Ga0495595_0003722 Ga0495595_0003722_4674_5459 256
374 3300053085 Ga0495619_0001121 Ga0495619_0001121_4236_5021 256
375 3300053085 Ga0495619_0162164 Ga0495619_0162164_393_1178 256
376 iso_pu_bacteria 2643221564 2643837826 256
377 3300035398 Ga0316574_0366422 Ga0316574_0366422_48_839 257
378 3300035692 Ga0373935_0060761 Ga0373935_0060761_389_1177 257
379 3300035725 Ga0373947_0279101 Ga0373947_0279101_153_941 257
380 3300037068 Ga0373925_0214808 Ga0373925_0214808_657_1445 257
381 3300049575 Ga0501039_0030683 Ga0501039_0030683_1311_2105 257
382 3300049575 Ga0501039_0361676 Ga0501039_0361676_21_806 257
383 3300049580 Ga0501046_0100950 Ga0501046_0100950_310_1104 257
384 3300049582 Ga0501048_0118797 Ga0501048_0118797_683_1477 257
385 3300049588 Ga0501072_0010225 Ga0501072_0010225_4740_5534 257
386 3300049591 Ga0501075_0094127 Ga0501075_0094127_793_1587 257
387 3300049592 Ga0501076_0058409 Ga0501076_0058409_1651_2445 257
388 3300049742 Ga0501080_0231255 Ga0501080_0231255_27_821 257
389 3300054114 Ga0501084_0032546 Ga0501084_0032546_2231_3025 257
390 3300061734 Ga0530510_0261203 Ga0530510_0261203_360_1154 257
391 iso_pu_bacteria 2513237138 2513864653 257
392 iso_pu_bacteria 2582581867 2585402020 257
393 iso_pu_bacteria 2585427590 2585821805 257
394 3300005336 Ga0070680_100066818 Ga0070680_1000668182 258
395 3300005337 Ga0070682_100062957 Ga0070682_1000629572 258
396 3300005339 Ga0070660_100013552 Ga0070660_1000135522 258
397 3300005366 Ga0070659_100166152 Ga0070659_1001661522 258
398 3300005440 Ga0070705_100022516 Ga0070705_1000225162 258
399 3300005444 Ga0070694_100058295 Ga0070694_1000582952 258
400 3300005455 Ga0070663_100007733 Ga0070663_1000077337 258
401 3300005456 Ga0070678_100038765 Ga0070678_1000387653 258
402 3300005458 Ga0070681_10041151 Ga0070681_100411512 258
403 3300005530 Ga0070679_100124290 Ga0070679_1001242903 258
404 3300005539 Ga0068853_100008598 Ga0068853_1000085985 258
405 3300005545 Ga0070695_100007331 Ga0070695_1000073316 258
406 3300005546 Ga0070696_100007479 Ga0070696_1000074794 258
407 3300005549 Ga0070704_100192281 Ga0070704_1001922812 258
408 3300005615 Ga0070702_100005850 Ga0070702_1000058506 258
409 3300005618 Ga0068864_100542261 Ga0068864_1005422611 258
410 3300005842 Ga0068858_100134898 Ga0068858_1001348983 258
411 3300005843 Ga0068860_100034267 Ga0068860_1000342672 258
412 3300009545 Ga0105237_10012219 Ga0105237_100122196 258
413 3300011119 Ga0105246_10133274 Ga0105246_101332742 258
414 3300025912 Ga0207707_10076955 Ga0207707_100769551 258
415 3300025914 Ga0207671_10115590 Ga0207671_101155902 258
416 3300025917 Ga0207660_10023384 Ga0207660_100233843 258
417 3300025919 Ga0207657_10019384 Ga0207657_100193845 258
418 3300025932 Ga0207690_10208170 Ga0207690_102081702 258
419 3300025944 Ga0207661_10501699 Ga0207661_105016992 258
420 3300025972 Ga0207668_10448162 Ga0207668_104481622 258
421 3300026035 Ga0207703_10111849 Ga0207703_101118491 258
422 3300026041 Ga0207639_10091893 Ga0207639_100918932 258
423 3300026067 Ga0207678_10002469 Ga0207678_1000246914 258
424 3300026116 Ga0207674_10107388 Ga0207674_101073883 258
425 3300026121 Ga0207683_10059560 Ga0207683_100595603 258
426 3300031711 Ga0265314_10015665 Ga0265314_100156653 258
427 3300035691 Ga0373931_0345240 Ga0373931_0345240_47_844 258
428 3300044693 Ga0466961_0142275 Ga0466961_0142275_13_828 258
429 3300045049 Ga0466959_0039377 Ga0466959_0039377_1332_2147 258
430 3300048920 Ga0496117_0000878 Ga0496117_0000878_21221_22006 258
431 3300048927 Ga0496124_0010792 Ga0496124_0010792_2210_2995 258
432 3300048928 Ga0496125_0230067 Ga0496125_0230067_266_1051 258
433 3300048929 Ga0496126_0000788 Ga0496126_0000788_12197_12982 258
434 3300048929 Ga0496126_0011177 Ga0496126_0011177_8284_9069 258
435 3300049568 Ga0501031_0066253 Ga0501031_0066253_1201_1986 258
436 3300049571 Ga0501034_0025143 Ga0501034_0025143_2199_2990 258
437 3300049572 Ga0501036_0273426 Ga0501036_0273426_296_1081 258
438 3300049574 Ga0501038_0069500 Ga0501038_0069500_367_1152 258
439 3300049579 Ga0501043_0019526 Ga0501043_0019526_3226_4011 258
440 3300049579 Ga0501043_0230588 Ga0501043_0230588_525_1316 258
441 3300049581 Ga0501047_0085517 Ga0501047_0085517_1429_2220 258
442 iso_pu_bacteria 2657244999 2657685440 258
443 iso_pu_bacteria 2791355082 2792581897 258
444 iso_pu_bacteria 2802429268 2804752262 258
445 iso_pu_bacteria 2913295892 2913300677 258
446 iso_pu_bacteria 2995392953 2995392991 258
447 iso_pu_bacteria 8049293176 8049294828 258
448 3300025304 Ga0209257_1022999 Ga0209257_10229992 259
449 3300047447 Ga0495685_047916 Ga0495685_047916_655_1440 259
450 3300049569 Ga0501032_0218384 Ga0501032_0218384_88_933 259
451 3300049572 Ga0501036_0241096 Ga0501036_0241096_298_1143 259
452 3300049577 Ga0501041_0058195 Ga0501041_0058195_355_1152 259
453 3300049578 Ga0501042_0102107 Ga0501042_0102107_611_1408 259
454 3300049579 Ga0501043_0468686 Ga0501043_0468686_37_834 259
455 3300049580 Ga0501046_0136083 Ga0501046_0136083_349_1146 259
456 3300049587 Ga0501071_0101804 Ga0501071_0101804_1157_1954 259
457 3300049592 Ga0501076_0092799 Ga0501076_0092799_401_1198 259
458 3300049742 Ga0501080_0124777 Ga0501080_0124777_759_1604 259
459 3300049743 Ga0501081_0063804 Ga0501081_0063804_401_1198 259
460 3300049744 Ga0501083_0145701 Ga0501083_0145701_622_1467 259
461 3300049824 Ga0501045_0069803 Ga0501045_0069803_392_1189 259
462 3300054114 Ga0501084_0137227 Ga0501084_0137227_92_889 259
463 iso_pu_bacteria 2512875026 2512971260 259
464 iso_pu_bacteria 2513237089 2513603970 259
465 iso_pu_bacteria 2513237156 2513984408 259
466 iso_pu_bacteria 2513237160 2514006196 259
467 iso_pu_bacteria 2517487022 2517569858 259
468 iso_pu_bacteria 2643221550 2643774280 259
469 iso_pu_bacteria 2802428858 2802719132 259
470 iso_pu_bacteria 2802428859 2802727363 259
471 iso_pu_bacteria 2802428860 2802732145 259
472 iso_pu_bacteria 2802428861 2802739075 259
473 iso_pu_bacteria 2802428862 2802744975 259
474 iso_pu_bacteria 2802428863 2802752250 259
475 iso_pu_bacteria 2856364286 2856368791 259
476 iso_pu_bacteria 2857349434 2857350249 259
477 iso_pu_bacteria 2869285874 2869291286 259
478 iso_pu_bacteria 2871429161 2871433566 259
479 iso_pu_bacteria 2874146452 2874153167 259
480 iso_pu_bacteria 2874155637 2874160432 259
481 iso_pu_bacteria 2876413966 2876419458 259
482 iso_pu_bacteria 2878745973 2878751177 259
483 iso_pu_bacteria 2903492973 2903501675 259
484 iso_pu_bacteria 2906308376 2906313118 259
485 iso_pu_bacteria 2906321335 2906325829 259
486 iso_pu_bacteria 2915980308 2915981616 259
487 iso_pu_bacteria 2916061851 2916065253 259
488 iso_pu_bacteria 2920760137 2920766186 259
489 iso_pu_bacteria 2921250672 2921255143 259
490 iso_pu_bacteria 2937029754 2937034781 259
491 iso_pu_bacteria 2937036028 2937041878 259
492 iso_pu_bacteria 2937078374 2937079286 259
493 iso_pu_bacteria 2937084907 2937088410 259
494 iso_pu_bacteria 2937813078 2937820731 259
495 iso_pu_bacteria 2957375807 2957381508 259
496 iso_pu_bacteria 2957437181 2957441100 259
497 iso_pu_bacteria 2958130278 2958135686 259
498 iso_pu_bacteria 2958179912 2958185177 259
499 iso_pu_bacteria 2960591022 2960597284 259
500 iso_pu_bacteria 2960631154 2960631864 259
501 iso_pu_bacteria 2960680706 2960687236 259
502 iso_pu_bacteria 2960693952 2960698439 259
503 iso_pu_bacteria 2961077736 2961083444 259
504 iso_pu_bacteria 2967686174 2967690069 259
505 iso_pu_bacteria 2967728569 2967732766 259
506 iso_pu_bacteria 2970026789 2970030874 259
507 iso_pu_bacteria 2970122695 2970126686 259
508 iso_pu_bacteria 2970143518 2970148122 259
509 iso_pu_bacteria 2977530762 2977534769 259
510 iso_pu_bacteria 2977544691 2977547795 259
511 iso_pu_bacteria 2977843712 2977849029 259
512 iso_pu_bacteria 2977942078 2977948289 259
513 iso_pu_bacteria 2987636660 2987637437 259
514 iso_pu_bacteria 2996336353 2996337862 259
515 iso_pu_bacteria 3004203850 3004206166 259
516 iso_pu_bacteria 8003999396 8004001223 259
517 iso_pu_bacteria 8004387939 8004394158 259
518 iso_pu_bacteria 8004640170 8004646631 259
519 iso_pu_bacteria 8004714634 8004719375 259
520 3300006038 Ga0075365_10113648 Ga0075365_101136482 260
521 3300006042 Ga0075368_10005197 Ga0075368_100051974 260
522 3300006051 Ga0075364_10022670 Ga0075364_100226703 260
523 3300031548 Ga0307408_100405441 Ga0307408_1004054412 260
524 3300035172 Ga0373955_0147427 Ga0373955_0147427_503_1312 260
525 3300035692 Ga0373935_0042425 Ga0373935_0042425_533_1342 260
526 3300045051 Ga0451576_0455335 Ga0451576_0455335_302_1108 260
527 3300048929 Ga0496126_0481256 Ga0496126_0481256_130_927 260
528 3300050495 nmdc:mga04h51_73035_c1 nmdc:mga04h51_73035_c1_365_1192 260
529 3300050496 nmdc:mga07m45_93014_c1 nmdc:mga07m45_93014_c1_24_851 260
530 3300053078 Ga0495612_0071201 Ga0495612_0071201_465_1274 260
531 iso_pu_bacteria 2503198000 2503202181 260
532 iso_pu_bacteria 2508501122 2509107512 260
533 iso_pu_bacteria 2508501123 2509118644 260
534 iso_pu_bacteria 2509276019 2509375847 260
535 iso_pu_bacteria 2509276022 2509396827 260
536 iso_pu_bacteria 2510065057 2510303382 260
537 iso_pu_bacteria 2511231052 2511501803 260
538 iso_pu_bacteria 2512047086 2512533240 260
539 iso_pu_bacteria 2512875016 2512930920 260
540 iso_pu_bacteria 2513237086 2513584663 260
541 iso_pu_bacteria 2513237090 2513609959 260
542 iso_pu_bacteria 2513237091 2513615372 260
543 iso_pu_bacteria 2513237140 2513881160 260
544 iso_pu_bacteria 2513237143 2513905699 260
545 iso_pu_bacteria 2515154107 2515608666 260
546 iso_pu_bacteria 2516143018 2516209591 260
547 iso_pu_bacteria 2516653046 2516893099 260
548 iso_pu_bacteria 2524023207 2524448930 260
549 iso_pu_bacteria 2551306084 2551678007 260
550 iso_pu_bacteria 2551306085 2551686720 260
551 iso_pu_bacteria 2551306086 2551696231 260
552 iso_pu_bacteria 2551306087 2551697956 260
553 iso_pu_bacteria 2551306089 2551714727 260
554 iso_pu_bacteria 2551306090 2551723102 260
555 iso_pu_bacteria 2551306091 2551730570 260
556 iso_pu_bacteria 2551306092 2551737084 260
557 iso_pu_bacteria 2551306093 2551744416 260
558 iso_pu_bacteria 2558860100 2558868118 260
559 iso_pu_bacteria 2588253730 2588516605 260
560 iso_pu_bacteria 2599185301 2599938119 260
561 iso_pu_bacteria 2643221618 2644107823 260
562 iso_pu_bacteria 2643221626 2644148504 260
563 iso_pu_bacteria 2643221655 2644309217 260
564 iso_pu_bacteria 2643221659 2644333044 260
565 iso_pu_bacteria 2643221698 2644545784 260
566 iso_pu_bacteria 2643221712 2644615159 260
567 iso_pu_bacteria 2690316117 2692315939 260
568 iso_pu_bacteria 2693429783 2694632251 260
569 iso_pu_bacteria 2693429784 2694634342 260
570 iso_pu_bacteria 2751185821 2753458788 260
571 iso_pu_bacteria 2791355091 2792620065 260
572 iso_pu_bacteria 2791355092 2792626516 260
573 iso_pu_bacteria 2791355094 2792639448 260
574 iso_pu_bacteria 2838074704 2838078903 260
575 iso_pu_bacteria 2844163670 2844167452 260
576 iso_pu_bacteria 2847417321 2847418994 260
577 iso_pu_bacteria 2847670302 2847676271 260
578 iso_pu_bacteria 2848992105 2848994027 260
579 iso_pu_bacteria 2850079185 2850082039 260
580 iso_pu_bacteria 2855825444 2855825899 260
581 iso_pu_bacteria 2855839649 2855841247 260
582 iso_pu_bacteria 2855872281 2855876670 260
583 iso_pu_bacteria 2856314179 2856316058 260
584 iso_pu_bacteria 2856320880 2856325815 260
585 iso_pu_bacteria 2856349417 2856352824 260
586 iso_pu_bacteria 2858800743 2858802226 260
587 iso_pu_bacteria 2869278585 2869279432 260
588 iso_pu_bacteria 2874123672 2874126025 260
589 iso_pu_bacteria 2874139085 2874145180 260
590 iso_pu_bacteria 2874168670 2874176168 260
591 iso_pu_bacteria 2876363079 2876366008 260
592 iso_pu_bacteria 2876377896 2876384075 260
593 iso_pu_bacteria 2878035449 2878040326 260
594 iso_pu_bacteria 2878738818 2878743377 260
595 iso_pu_bacteria 2881155292 2881156390 260
596 iso_pu_bacteria 2881853255 2881857080 260
597 iso_pu_bacteria 2885342637 2885350458 260
598 iso_pu_bacteria 2885350715 2885352904 260
599 iso_pu_bacteria 2888337043 2888340109 260
600 iso_pu_bacteria 2888350351 2888356513 260
601 iso_pu_bacteria 2889010040 2889011423 260
602 iso_pu_bacteria 2889016732 2889016848 260
603 iso_pu_bacteria 2889790730 2889791845 260
604 iso_pu_bacteria 2889914905 2889918882 260
605 iso_pu_bacteria 2891048133 2891051784 260
606 iso_pu_bacteria 2896384573 2896390771 260
607 iso_pu_bacteria 2903448605 2903455575 260
608 iso_pu_bacteria 2903521522 2903522764 260
609 iso_pu_bacteria 2903528002 2903532954 260
610 iso_pu_bacteria 2906354277 2906361443 260
611 iso_pu_bacteria 2906414383 2906416195 260
612 iso_pu_bacteria 2915986958 2915988417 260
613 iso_pu_bacteria 2915993759 2915999077 260
614 iso_pu_bacteria 2916000859 2916005338 260
615 iso_pu_bacteria 2916007675 2916013756 260
616 iso_pu_bacteria 2916014648 2916017398 260
617 iso_pu_bacteria 2916021584 2916023983 260
618 iso_pu_bacteria 2916028427 2916033256 260
619 iso_pu_bacteria 2916035215 2916036685 260
620 iso_pu_bacteria 2916041962 2916044250 260
621 iso_pu_bacteria 2916048683 2916052188 260
622 iso_pu_bacteria 2916055098 2916055509 260
623 iso_pu_bacteria 2916068649 2916071594 260
624 iso_pu_bacteria 2916076590 2916081205 260
625 iso_pu_bacteria 2921201388 2921207402 260
626 iso_pu_bacteria 2921208531 2921214390 260
627 iso_pu_bacteria 2921237296 2921241858 260
628 iso_pu_bacteria 2921244191 2921246606 260
629 iso_pu_bacteria 2921257292 2921259566 260
630 iso_pu_bacteria 2921263974 2921267002 260
631 iso_pu_bacteria 2921282425 2921288292 260
632 iso_pu_bacteria 2921289301 2921290531 260
633 iso_pu_bacteria 2922185730 2922192542 260
634 iso_pu_bacteria 2924144063 2924145962 260
635 iso_pu_bacteria 2924150972 2924154580 260
636 iso_pu_bacteria 2924158325 2924162302 260
637 iso_pu_bacteria 2924165586 2924166990 260
638 iso_pu_bacteria 2924172951 2924176308 260
639 iso_pu_bacteria 2924179722 2924184362 260
640 iso_pu_bacteria 2924186466 2924189811 260
641 iso_pu_bacteria 2924193448 2924196509 260
642 iso_pu_bacteria 2924200457 2924205793 260
643 iso_pu_bacteria 2924207177 2924211256 260
644 iso_pu_bacteria 2924214083 2924215132 260
645 iso_pu_bacteria 2924221636 2924224992 260
646 iso_pu_bacteria 2924228884 2924231476 260
647 iso_pu_bacteria 2924762789 2924765076 260
648 iso_pu_bacteria 2924776078 2924781189 260
649 iso_pu_bacteria 2936996657 2936999619 260
650 iso_pu_bacteria 2937002841 2937006019 260
651 iso_pu_bacteria 2937009748 2937013309 260
652 iso_pu_bacteria 2937016420 2937019306 260
653 iso_pu_bacteria 2937023124 2937028879 260
654 iso_pu_bacteria 2937042894 2937044329 260
655 iso_pu_bacteria 2937049772 2937054679 260
656 iso_pu_bacteria 2937056579 2937057301 260
657 iso_pu_bacteria 2937063883 2937068058 260
658 iso_pu_bacteria 2937071275 2937077523 260
659 iso_pu_bacteria 2937091812 2937093629 260
660 iso_pu_bacteria 2937098957 2937099668 260
661 iso_pu_bacteria 2937106411 2937107247 260
662 iso_pu_bacteria 2937113482 2937115188 260
663 iso_pu_bacteria 2937119839 2937120290 260
664 iso_pu_bacteria 2937126314 2937129078 260
665 iso_pu_bacteria 2937848649 2937849167 260
666 iso_pu_bacteria 2937877337 2937877612 260
667 iso_pu_bacteria 2937972304 2937975303 260
668 iso_pu_bacteria 2938014810 2938015400 260
669 iso_pu_bacteria 2941499720 2941503670 260
670 iso_pu_bacteria 2957382221 2957387476 260
671 iso_pu_bacteria 2957388812 2957391756 260
672 iso_pu_bacteria 2957395598 2957399980 260
673 iso_pu_bacteria 2957402308 2957404848 260
674 iso_pu_bacteria 2957408893 2957410885 260
675 iso_pu_bacteria 2957415311 2957420985 260
676 iso_pu_bacteria 2957422303 2957425965 260
677 iso_pu_bacteria 2957430029 2957433961 260
678 iso_pu_bacteria 2957443900 2957445668 260
679 iso_pu_bacteria 2957450854 2957454603 260
680 iso_pu_bacteria 2957457609 2957464279 260
681 iso_pu_bacteria 2957464669 2957467793 260
682 iso_pu_bacteria 2957471148 2957472482 260
683 iso_pu_bacteria 2957478035 2957480751 260
684 iso_pu_bacteria 2957484790 2957488504 260
685 iso_pu_bacteria 2957491536 2957494382 260
686 iso_pu_bacteria 2957498199 2957502694 260
687 iso_pu_bacteria 2957505466 2957508766 260
688 iso_pu_bacteria 2958034702 2958035571 260
689 iso_pu_bacteria 2958041894 2958043758 260
690 iso_pu_bacteria 2958064165 2958066960 260
691 iso_pu_bacteria 2958084443 2958084720 260
692 iso_pu_bacteria 2958092219 2958096455 260
693 iso_pu_bacteria 2958100919 2958107012 260
694 iso_pu_bacteria 2958144490 2958147061 260
695 iso_pu_bacteria 2958172287 2958176532 260
696 iso_pu_bacteria 2960584000 2960590833 260
697 iso_pu_bacteria 2960597568 2960598228 260
698 iso_pu_bacteria 2960603979 2960609097 260
699 iso_pu_bacteria 2960610863 2960615857 260
700 iso_pu_bacteria 2960617483 2960623535 260
701 iso_pu_bacteria 2960624210 2960627625 260
702 iso_pu_bacteria 2960637947 2960645434 260
703 iso_pu_bacteria 2960645483 2960649064 260
704 iso_pu_bacteria 2960652885 2960659276 260
705 iso_pu_bacteria 2960660292 2960662215 260
706 iso_pu_bacteria 2960667422 2960672752 260
707 iso_pu_bacteria 2960674078 2960677127 260
708 iso_pu_bacteria 2960687367 2960689880 260
709 iso_pu_bacteria 2961127735 2961132610 260
710 iso_pu_bacteria 2963644680 2963648305 260
711 iso_pu_bacteria 2964607997 2964614532 260
712 iso_pu_bacteria 2964615318 2964616891 260
713 iso_pu_bacteria 2964621998 2964624651 260
714 iso_pu_bacteria 2964628898 2964631141 260
715 iso_pu_bacteria 2964636051 2964637521 260
716 iso_pu_bacteria 2964643177 2964646414 260
717 iso_pu_bacteria 2964649959 2964651633 260
718 iso_pu_bacteria 2964656573 2964662384 260
719 iso_pu_bacteria 2964663802 2964669856 260
720 iso_pu_bacteria 2964670856 2964675870 260
721 iso_pu_bacteria 2964678106 2964683761 260
722 iso_pu_bacteria 2964685014 2964686843 260
723 iso_pu_bacteria 2964691889 2964694431 260
724 iso_pu_bacteria 2964698721 2964699682 260
725 iso_pu_bacteria 2964705432 2964710701 260
726 iso_pu_bacteria 2964712639 2964715671 260
727 iso_pu_bacteria 2964719344 2964723489 260
728 iso_pu_bacteria 2965119406 2965124433 260
729 iso_pu_bacteria 2967664464 2967665218 260
730 iso_pu_bacteria 2967671571 2967675565 260
731 iso_pu_bacteria 2967678726 2967681536 260
732 iso_pu_bacteria 2967693043 2967699590 260
733 iso_pu_bacteria 2967699805 2967700023 260
734 iso_pu_bacteria 2967706974 2967709016 260
735 iso_pu_bacteria 2967714385 2967716785 260
736 iso_pu_bacteria 2967721400 2967728151 260
737 iso_pu_bacteria 2967735183 2967741367 260
738 iso_pu_bacteria 2967742019 2967745747 260
739 iso_pu_bacteria 2967748971 2967753782 260
740 iso_pu_bacteria 2967755722 2967758655 260
741 iso_pu_bacteria 2967762386 2967762818 260
742 iso_pu_bacteria 2967769361 2967770882 260
743 iso_pu_bacteria 2967775926 2967779309 260
744 iso_pu_bacteria 2968016561 2968017881 260
745 iso_pu_bacteria 2968083720 2968084819 260
746 iso_pu_bacteria 2968117919 2968123138 260
747 iso_pu_bacteria 2970019648 2970024622 260
748 iso_pu_bacteria 2970033650 2970036958 260
749 iso_pu_bacteria 2970040964 2970046540 260
750 iso_pu_bacteria 2970047711 2970048895 260
751 iso_pu_bacteria 2970054988 2970057133 260
752 iso_pu_bacteria 2970061556 2970062592 260
753 iso_pu_bacteria 2970068827 2970070894 260
754 iso_pu_bacteria 2970076120 2970082641 260
755 iso_pu_bacteria 2970082768 2970083652 260
756 iso_pu_bacteria 2970088815 2970090489 260
757 iso_pu_bacteria 2970095765 2970099155 260
758 iso_pu_bacteria 2970102677 2970107405 260
759 iso_pu_bacteria 2970109326 2970111607 260
760 iso_pu_bacteria 2970116247 2970121896 260
761 iso_pu_bacteria 2970129317 2970130357 260
762 iso_pu_bacteria 2970136068 2970136353 260
763 iso_pu_bacteria 2970149975 2970155877 260
764 iso_pu_bacteria 2970156795 2970157501 260
765 iso_pu_bacteria 2970164137 2970168211 260
766 iso_pu_bacteria 2970170962 2970174677 260
767 iso_pu_bacteria 2970177841 2970180500 260
768 iso_pu_bacteria 2970184632 2970190466 260
769 iso_pu_bacteria 2970191845 2970195771 260
770 iso_pu_bacteria 2970469710 2970471944 260
771 iso_pu_bacteria 2970593180 2970594027 260
772 iso_pu_bacteria 2977516862 2977522866 260
773 iso_pu_bacteria 2977523885 2977530707 260
774 iso_pu_bacteria 2977537788 2977542607 260
775 iso_pu_bacteria 2977551784 2977555882 260
776 iso_pu_bacteria 2977558990 2977561023 260
777 iso_pu_bacteria 2977565890 2977567875 260
778 iso_pu_bacteria 2977572785 2977575144 260
779 iso_pu_bacteria 2977579622 2977586111 260
780 iso_pu_bacteria 2977922695 2977923054 260
781 iso_pu_bacteria 2977986579 2977990369 260
782 iso_pu_bacteria 2979710463 2979712098 260
783 iso_pu_bacteria 2979742915 2979743953 260
784 iso_pu_bacteria 2987652177 2987653195 260
785 iso_pu_bacteria 2987666974 2987672369 260
786 iso_pu_bacteria 2989771324 2989774923 260
787 iso_pu_bacteria 2996348954 2996350877 260
788 iso_pu_bacteria 3004211236 3004211716 260
789 iso_pu_bacteria 3004218560 3004218963 260
790 iso_pu_bacteria 3004275668 3004277575 260
791 iso_pu_bacteria 3004334049 3004341044 260
792 iso_pu_bacteria 637000159 637073964 260
793 iso_pu_bacteria 643692032 643825884 260
794 iso_pu_bacteria 648276728 648737468 260
795 iso_pu_bacteria 8003992118 8003993753 260
796 3300005262 Ga0065165_1028168 Ga0065165_10281682 261
797 3300006186 Ga0075369_10002384 Ga0075369_100023846 261
798 3300037418 Ga0395900_0136486 Ga0395900_0136486_985_1794 261
799 3300048918 Ga0496115_0259045 Ga0496115_0259045_83_886 261
800 iso_pu_bacteria 2643221607 2644049152 261
801 iso_pu_bacteria 2643221636 2644204503 261
802 iso_pu_bacteria 2643221686 2644482186 261
803 iso_pu_bacteria 2885312484 2885317084 261
804 3300003203 JGI25406J46586_10030139 JGI25406J46586_100301392 262
805 3300005985 Ga0081539_10001646 Ga0081539_100016465 262
806 3300009094 Ga0111539_10408817 Ga0111539_104088172 262
807 3300013306 Ga0163162_10932151 Ga0163162_109321512 262
808 3300041413 Ga0439465_0094901 Ga0439465_0094901_144_995 262
809 3300042007 Ga0439449_0074392 Ga0439449_0074392_78_929 262
810 3300046460 Ga0495638_0035740 Ga0495638_0035740_943_1749 262
811 3300049571 Ga0501034_0191407 Ga0501034_0191407_278_1087 262
812 3300053088 Ga0500644_0005437 Ga0500644_0005437_700_1506 262
813 3300053090 Ga0500646_0033849 Ga0500646_0033849_506_1312 262
814 3300053122 Ga0500608_074631 Ga0500608_074631_623_1429 262
815 3300053156 Ga0500622_0000159 Ga0500622_0000159_47988_48794 262
816 iso_pu_bacteria 2508501127 2509145007 262
817 iso_pu_bacteria 2513237305 2514422681 262
818 iso_pu_bacteria 2643221551 2643775362 262
819 iso_pu_bacteria 2643221555 2643793808 262
820 iso_pu_bacteria 2721755686 2723576416 262
821 iso_pu_bacteria 2847686936 2847692923 262
822 iso_pu_bacteria 2856356410 2856360326 262
823 iso_pu_bacteria 2871444079 2871450789 262
824 iso_pu_bacteria 2871488783 2871495812 262
825 iso_pu_bacteria 2871495908 2871503018 262
826 iso_pu_bacteria 2874102143 2874106317 262
827 iso_pu_bacteria 2876369609 2876373440 262
828 iso_pu_bacteria 2876392853 2876394942 262
829 iso_pu_bacteria 2878753008 2878753389 262
830 iso_pu_bacteria 2878760144 2878766907 262
831 iso_pu_bacteria 2878767105 2878774105 262
832 iso_pu_bacteria 2881147464 2881152901 262
833 iso_pu_bacteria 2881161766 2881168280 262
834 iso_pu_bacteria 2881845957 2881848825 262
835 iso_pu_bacteria 2881861095 2881863361 262
836 iso_pu_bacteria 2882632389 2882637910 262
837 iso_pu_bacteria 2882912400 2882917074 262
838 iso_pu_bacteria 2885305155 2885310269 262
839 iso_pu_bacteria 2885318864 2885322952 262
840 iso_pu_bacteria 2903492973 2903495244 262
841 iso_pu_bacteria 2903540706 2903548207 262
842 iso_pu_bacteria 2904659560 2904661573 262
843 iso_pu_bacteria 2906328253 2906335328 262
844 iso_pu_bacteria 2922158528 2922161636 262
845 iso_pu_bacteria 2924726620 2924733169 262
846 iso_pu_bacteria 2924784321 2924789697 262
847 iso_pu_bacteria 2937822353 2937827337 262
848 iso_pu_bacteria 2937891427 2937897014 262
849 iso_pu_bacteria 2937994558 2938002032 262
850 iso_pu_bacteria 2958115193 2958122229 262
851 iso_pu_bacteria 2958165035 2958172086 262
852 iso_pu_bacteria 2961114664 2961116726 262
853 iso_pu_bacteria 2961163497 2961170533 262
854 iso_pu_bacteria 2961170736 2961177833 262
855 iso_pu_bacteria 2965018300 2965025280 262
856 iso_pu_bacteria 2965062239 2965065391 262
857 iso_pu_bacteria 2967996073 2968003100 262
858 iso_pu_bacteria 2968003550 2968003926 262
859 iso_pu_bacteria 2968091066 2968096038 262
860 iso_pu_bacteria 2968097103 2968097526 262
861 iso_pu_bacteria 2968110612 2968112633 262
862 iso_pu_bacteria 2968128360 2968130928 262
863 iso_pu_bacteria 2968171901 2968178919 262
864 iso_pu_bacteria 2970503327 2970510509 262
865 iso_pu_bacteria 2970554993 2970561763 262
866 iso_pu_bacteria 2977821940 2977822671 262
867 iso_pu_bacteria 2977828996 2977835139 262
868 iso_pu_bacteria 2977858184 2977863278 262
869 iso_pu_bacteria 2977864932 2977872479 262
870 iso_pu_bacteria 2979779861 2979785075 262
871 iso_pu_bacteria 2979808191 2979815383 262
872 iso_pu_bacteria 2987659509 2987666773 262
873 iso_pu_bacteria 2996341866 2996344957 262
874 iso_pu_bacteria 3004188549 3004195776 262
875 iso_pu_bacteria 8004374579 8004374961 262
876 iso_pu_bacteria 8004445564 8004452175 262
877 iso_pu_bacteria 8004703790 8004713663 262
878 3300006186 Ga0075369_10106086 Ga0075369_101060862 263
879 3300006946 Ga0079104_1002441 Ga0079104_100244110 263
880 3300009177 Ga0105248_10210616 Ga0105248_102106162 263
881 3300022739 Ga0228711_1000007 Ga0228711_100000746 263
882 3300022740 Ga0228710_1000007 Ga0228710_100000733 263
883 3300027111 Ga0209281_1000128 Ga0209281_1000128158 263
884 3300027666 Ga0209282_1000034 Ga0209282_100003492 263
885 3300031731 Ga0307405_10117606 Ga0307405_101176062 263
886 3300031967 Ga0315914_1000010 Ga0315914_1000010130 263
887 3300033430 Ga0315913_1000005 Ga0315913_1000005130 263
888 3300033464 Ga0315915_1000012 Ga0315915_100001233 263
889 3300041411 Ga0439466_0058972 Ga0439466_0058972_212_1039 263
890 3300049568 Ga0501031_0000019 Ga0501031_0000019_7208_8020 263
891 3300049568 Ga0501031_0075753 Ga0501031_0075753_853_1665 263
892 3300049569 Ga0501032_0000009 Ga0501032_0000009_119968_120780 263
893 3300049570 Ga0501033_0000019 Ga0501033_0000019_107328_108140 263
894 3300049570 Ga0501033_0015322 Ga0501033_0015322_4859_5671 263
895 3300049570 Ga0501033_0035599 Ga0501033_0035599_719_1531 263
896 3300049571 Ga0501034_0000044 Ga0501034_0000044_119968_120780 263
897 3300049571 Ga0501034_0061223 Ga0501034_0061223_145_957 263
898 3300049571 Ga0501034_0363280 Ga0501034_0363280_491_1303 263
899 3300049572 Ga0501036_0000008 Ga0501036_0000008_119968_120780 263
900 3300049573 Ga0501037_0000055 Ga0501037_0000055_74314_75126 263
901 3300049573 Ga0501037_0122415 Ga0501037_0122415_938_1750 263
902 3300049574 Ga0501038_0000006 Ga0501038_0000006_119968_120780 263
903 3300049574 Ga0501038_0210218 Ga0501038_0210218_196_1008 263
904 3300049575 Ga0501039_0000014 Ga0501039_0000014_107328_108140 263
905 3300049575 Ga0501039_0153399 Ga0501039_0153399_853_1665 263
906 3300049576 Ga0501040_0002131 Ga0501040_0002131_524_1336 263
907 3300049579 Ga0501043_0001366 Ga0501043_0001366_10857_11669 263
908 3300049580 Ga0501046_0044412 Ga0501046_0044412_2352_3164 263
909 3300049581 Ga0501047_0001105 Ga0501047_0001105_2137_2949 263
910 3300049581 Ga0501047_0202133 Ga0501047_0202133_625_1437 263
911 3300049581 Ga0501047_0209212 Ga0501047_0209212_853_1665 263
912 3300049582 Ga0501048_0102175 Ga0501048_0102175_179_991 263
913 3300049584 Ga0501068_0028700 Ga0501068_0028700_480_1292 263
914 3300049585 Ga0501069_0116980 Ga0501069_0116980_695_1507 263
915 3300049586 Ga0501070_0031602 Ga0501070_0031602_3049_3861 263
916 3300049586 Ga0501070_0049649 Ga0501070_0049649_2492_3304 263
917 3300049586 Ga0501070_0543356 Ga0501070_0543356_12_824 263
918 3300049588 Ga0501072_0386373 Ga0501072_0386373_90_899 263
919 3300049589 Ga0501073_0033412 Ga0501073_0033412_2470_3282 263
920 3300049744 Ga0501083_0023789 Ga0501083_0023789_795_1607 263
921 3300049822 Ga0501035_0000096 Ga0501035_0000096_35482_36294 263
922 3300049822 Ga0501035_0077476 Ga0501035_0077476_199_1011 263
923 3300049822 Ga0501035_0079908 Ga0501035_0079908_70_882 263
924 3300049823 Ga0501044_0000017 Ga0501044_0000017_107328_108140 263
925 3300049823 Ga0501044_0112084 Ga0501044_0112084_971_1783 263
926 3300049824 Ga0501045_0096237 Ga0501045_0096237_527_1339 263
927 3300050516 nmdc:mga0sz30_34318_c2 nmdc:mga0sz30_34318_c2_390_1202 263
928 3300053087 Ga0500643_024125 Ga0500643_024125_768_1595 263
929 iso_pu_bacteria 2509276018 2509370748 263
930 iso_pu_bacteria 2510065059 2510317536 263
931 iso_pu_bacteria 2512875024 2512958648 263
932 iso_pu_bacteria 2513237164 2514034938 263
933 iso_pu_bacteria 2513237351 2514590148 263
934 iso_pu_bacteria 2597489875 2597814128 263
935 iso_pu_bacteria 2599185352 2600193206 263
936 iso_pu_bacteria 2643221557 2643803703 263
937 iso_pu_bacteria 2643221595 2643989357 263
938 iso_pu_bacteria 2643221610 2644067672 263
939 iso_pu_bacteria 2643221627 2644152929 263
940 iso_pu_bacteria 2643221668 2644375350 263
941 iso_pu_bacteria 2643221675 2644418726 263
942 iso_pu_bacteria 2643221680 2644452092 263
943 iso_pu_bacteria 2643221723 2644672582 263
944 iso_pu_bacteria 2643221726 2644690855 263
945 iso_pu_bacteria 2687453392 2688599463 263
946 iso_pu_bacteria 2756170246 2756675935 263
947 iso_pu_bacteria 2791355123 2792748571 263
948 iso_pu_bacteria 2841734538 2841739980 263
949 iso_pu_bacteria 2844002411 2844006404 263
950 iso_pu_bacteria 2844009547 2844014736 263
951 iso_pu_bacteria 2856334872 2856335062 263
952 iso_pu_bacteria 2856342000 2856348339 263
953 iso_pu_bacteria 2857367948 2857372742 263
954 iso_pu_bacteria 2869162929 2869165226 263
955 iso_pu_bacteria 2869169390 2869170425 263
956 iso_pu_bacteria 2869242130 2869245221 263
957 iso_pu_bacteria 2869249662 2869249799 263
958 iso_pu_bacteria 2869256925 2869259676 263
959 iso_pu_bacteria 2869271264 2869276333 263
960 iso_pu_bacteria 2871459585 2871465996 263
961 iso_pu_bacteria 2871466892 2871469267 263
962 iso_pu_bacteria 2871474448 2871477270 263
963 iso_pu_bacteria 2871481445 2871484521 263
964 iso_pu_bacteria 2874116593 2874119197 263
965 iso_pu_bacteria 2876386047 2876392323 263
966 iso_pu_bacteria 2876420981 2876422440 263
967 iso_pu_bacteria 2878774303 2878776977 263
968 iso_pu_bacteria 2878781027 2878784704 263
969 iso_pu_bacteria 2878788777 2878794568 263
970 iso_pu_bacteria 2888343758 2888347434 263
971 iso_pu_bacteria 2906378014 2906378806 263
972 iso_pu_bacteria 2906393657 2906398979 263
973 iso_pu_bacteria 2906401398 2906404614 263
974 iso_pu_bacteria 2906427513 2906429937 263
975 iso_pu_bacteria 2920822456 2920824607 263
976 iso_pu_bacteria 2922151315 2922152874 263
977 iso_pu_bacteria 2924741084 2924745822 263
978 iso_pu_bacteria 2924754689 2924761847 263
979 iso_pu_bacteria 2937836603 2937839774 263
980 iso_pu_bacteria 2937861824 2937866608 263
981 iso_pu_bacteria 2937868953 2937873407 263
982 iso_pu_bacteria 2937980651 2937987169 263
983 iso_pu_bacteria 2958071322 2958077474 263
984 iso_pu_bacteria 2958108152 2958109485 263
985 iso_pu_bacteria 2958122699 2958123841 263
986 iso_pu_bacteria 2961136820 2961142140 263
987 iso_pu_bacteria 2961183825 2961186367 263
988 iso_pu_bacteria 2965025482 2965029564 263
989 iso_pu_bacteria 2965032056 2965032079 263
990 iso_pu_bacteria 2965040258 2965046462 263
991 iso_pu_bacteria 2965047637 2965053794 263
992 iso_pu_bacteria 2965089291 2965094255 263
993 iso_pu_bacteria 2965102966 2965105390 263
994 iso_pu_bacteria 2965110997 2965111444 263
995 iso_pu_bacteria 2970489779 2970492736 263
996 iso_pu_bacteria 2970510686 2970518186 263
997 iso_pu_bacteria 2970540015 2970541176 263
998 iso_pu_bacteria 2970547951 2970549997 263
999 iso_pu_bacteria 2970619444 2970620884 263
1000 iso_pu_bacteria 2970627176 2970631636 263
1001 iso_pu_bacteria 2977851361 2977858052 263
1002 iso_pu_bacteria 2977872689 2977875172 263
1003 iso_pu_bacteria 2977907340 2977911227 263
1004 iso_pu_bacteria 2977915119 2977917768 263
1005 iso_pu_bacteria 2977935797 2977939637 263
1006 iso_pu_bacteria 2977950692 2977955324 263
1007 iso_pu_bacteria 2977957713 2977960911 263
1008 iso_pu_bacteria 2979764755 2979771622 263
1009 iso_pu_bacteria 2979793036 2979795595 263
1010 iso_pu_bacteria 2987645492 2987648473 263
1011 iso_pu_bacteria 2987673487 2987674961 263
1012 iso_pu_bacteria 2989776772 2989779040 263
1013 iso_pu_bacteria 2996310559 2996310713 263
1014 iso_pu_bacteria 2996386984 2996392529 263
1015 iso_pu_bacteria 3000135777 3000138522 263
1016 iso_pu_bacteria 3004167301 3004169549 263
1017 iso_pu_bacteria 3004195979 3004196422 263
1018 iso_pu_bacteria 3004232784 3004237132 263
1019 iso_pu_bacteria 3004248173 3004251980 263
1020 iso_pu_bacteria 3004268573 3004275162 263
1021 iso_pu_bacteria 649633066 649873967 263
1022 iso_pu_bacteria 8004300914 8004302312 263
1023 iso_pu_bacteria 8004312739 8004319294 263
1024 iso_pu_bacteria 8004361976 8004367952 263
1025 iso_pu_bacteria 8004633249 8004634109 263
1026 iso_pu_bacteria 8004695233 8004695502 263
1027 iso_pu_bacteria 8004727605 8004727855 263
1028 iso_pu_bacteria 8055617313 8055621495 263
1029 3300002067 JGI24735J21928_10012420 JGI24735J21928_100124202 264
1030 3300003214 JGI25165J46597_1000087 JGI25165J46597_100008712 264
1031 3300003214 JGI25165J46597_1000139 JGI25165J46597_100013995 264
1032 3300003762 Ga0055542_1000852 Ga0055542_10008526 264
1033 3300003763 Ga0055529_1006783 Ga0055529_10067832 264
1034 3300005339 Ga0070660_100157699 Ga0070660_1001576992 264
1035 3300005459 Ga0068867_100446713 Ga0068867_1004467131 264
1036 3300005539 Ga0068853_100054361 Ga0068853_1000543611 264
1037 3300005539 Ga0068853_100555889 Ga0068853_1005558892 264
1038 3300005548 Ga0070665_100172527 Ga0070665_1001725272 264
1039 3300005577 Ga0068857_100229458 Ga0068857_1002294582 264
1040 3300005577 Ga0068857_100267173 Ga0068857_1002671732 264
1041 3300005614 Ga0068856_100153459 Ga0068856_1001534592 264
1042 3300005614 Ga0068856_100336098 Ga0068856_1003360982 264
1043 3300005983 Ga0081540_1045128 Ga0081540_10451282 264
1044 3300006038 Ga0075365_10230296 Ga0075365_102302961 264
1045 3300006051 Ga0075364_10002512 Ga0075364_100025125 264
1046 3300006051 Ga0075364_10023991 Ga0075364_100239913 264
1047 3300006051 Ga0075364_10150001 Ga0075364_101500012 264
1048 3300006178 Ga0075367_10100969 Ga0075367_101009691 264
1049 3300006178 Ga0075367_10247917 Ga0075367_102479172 264
1050 3300006186 Ga0075369_10070313 Ga0075369_100703132 264
1051 3300006195 Ga0075366_10263173 Ga0075366_102631732 264
1052 3300006946 Ga0079104_1007269 Ga0079104_10072693 264
1053 3300009093 Ga0105240_10252034 Ga0105240_102520342 264
1054 3300009093 Ga0105240_10443969 Ga0105240_104439692 264
1055 3300009093 Ga0105240_10472042 Ga0105240_104720422 264
1056 3300009174 Ga0105241_10606601 Ga0105241_106066012 264
1057 3300009545 Ga0105237_10619111 Ga0105237_106191112 264
1058 3300009551 Ga0105238_10031563 Ga0105238_100315634 264
1059 3300010375 Ga0105239_10271995 Ga0105239_102719952 264
1060 3300013104 Ga0157370_10367694 Ga0157370_103676942 264
1061 3300013296 Ga0157374_10299973 Ga0157374_102999732 264
1062 3300014968 Ga0157379_10343555 Ga0157379_103435552 264
1063 3300015261 Ga0182006_1056158 Ga0182006_10561582 264
1064 3300021321 Ga0214542_1024306 Ga0214542_10243064 264
1065 3300021327 Ga0214543_1000011 Ga0214543_100001150 264
1066 3300025254 Ga0209148_1000072 Ga0209148_1000072294 264
1067 3300025261 Ga0209233_1000027 Ga0209233_1000027273 264
1068 3300025272 Ga0209455_1000329 Ga0209455_100032911 264
1069 3300025297 Ga0209758_1005350 Ga0209758_10053505 264
1070 3300025904 Ga0207647_10008647 Ga0207647_100086475 264
1071 3300025907 Ga0207645_10293898 Ga0207645_102938981 264
1072 3300025913 Ga0207695_10125922 Ga0207695_101259222 264
1073 3300025913 Ga0207695_10152526 Ga0207695_101525262 264
1074 3300025924 Ga0207694_10121901 Ga0207694_101219012 264
1075 3300025961 Ga0207712_10288509 Ga0207712_102885092 264
1076 3300025986 Ga0207658_10241812 Ga0207658_102418122 264
1077 3300026041 Ga0207639_10642175 Ga0207639_106421751 264
1078 3300026067 Ga0207678_10153009 Ga0207678_101530092 264
1079 3300026078 Ga0207702_10119691 Ga0207702_101196912 264
1080 3300026089 Ga0207648_10243476 Ga0207648_102434762 264
1081 3300026116 Ga0207674_10077701 Ga0207674_100777013 264
1082 3300026142 Ga0207698_10079523 Ga0207698_100795233 264
1083 3300027111 Ga0209281_1000864 Ga0209281_100086417 264
1084 3300028794 Ga0307515_10000656 Ga0307515_100006565 264
1085 3300031548 Ga0307408_100306544 Ga0307408_1003065442 264
1086 3300031731 Ga0307405_10097793 Ga0307405_100977932 264
1087 3300031911 Ga0307412_10433599 Ga0307412_104335991 264
1088 3300037312 Ga0395899_0235955 Ga0395899_0235955_189_1001 264
1089 3300037418 Ga0395900_0289467 Ga0395900_0289467_254_1066 264
1090 3300037466 Ga0395898_0294943 Ga0395898_0294943_598_1416 264
1091 3300037471 Ga0395905_0041067 Ga0395905_0041067_2190_3008 264
1092 3300037471 Ga0395905_0181248 Ga0395905_0181248_393_1205 264
1093 3300037471 Ga0395905_0281100 Ga0395905_0281100_683_1495 264
1094 3300038443 Ga0395901_0096884 Ga0395901_0096884_1255_2067 264
1095 3300038443 Ga0395901_0187019 Ga0395901_0187019_546_1358 264
1096 3300046460 Ga0495638_0002113 Ga0495638_0002113_14190_15014 264
1097 3300046460 Ga0495638_0023397 Ga0495638_0023397_1157_1975 264
1098 3300046519 Ga0495632_0100761 Ga0495632_0100761_210_1022 264
1099 3300048905 Ga0496102_0379779 Ga0496102_0379779_495_1307 264
1100 3300048915 Ga0496112_0044012 Ga0496112_0044012_1311_2120 264
1101 3300048917 Ga0496114_0274070 Ga0496114_0274070_487_1335 264
1102 3300048920 Ga0496117_0263502 Ga0496117_0263502_36_848 264
1103 3300048923 Ga0496120_0154817 Ga0496120_0154817_239_1048 264
1104 3300048924 Ga0496121_0304089 Ga0496121_0304089_90_902 264
1105 3300049742 Ga0501080_0538651 Ga0501080_0538651_189_1001 264
1106 3300050492 nmdc:mga0yw44_157926_c1 nmdc:mga0yw44_157926_c1_496_1308 264
1107 3300050492 nmdc:mga0yw44_4313_c1 nmdc:mga0yw44_4313_c1_2115_2924 264
1108 3300050494 nmdc:mga06z11_242580_c1 nmdc:mga06z11_242580_c1_117_926 264
1109 3300050516 nmdc:mga0sz30_23726_c1 nmdc:mga0sz30_23726_c1_319_1128 264
1110 3300050516 nmdc:mga0sz30_45262_c1 nmdc:mga0sz30_45262_c1_834_1646 264
1111 3300053083 Ga0495655_0056967 Ga0495655_0056967_219_1031 264
1112 3300053108 Ga0500562_033078 Ga0500562_033078_318_1142 264
1113 3300053117 Ga0500593_013096 Ga0500593_013096_1616_2467 264
1114 3300053136 Ga0500559_0053236 Ga0500559_0053236_132_944 264
1115 3300053139 Ga0500568_0000056 Ga0500568_0000056_70629_71453 264
1116 iso_pu_bacteria 2558860983 2561466333 264
1117 iso_pu_bacteria 2643221623 2644132221 264
1118 iso_pu_bacteria 2738541317 2738946229 264
1119 iso_pu_bacteria 2838736955 2838738308 264
1120 iso_pu_bacteria 2841840854 2841841322 264
1121 iso_pu_bacteria 2842140634 2842141100 264
1122 iso_pu_bacteria 2857531043 2857534375 264
1123 iso_pu_bacteria 2913308742 2913311185 264
1124 iso_pu_bacteria 2970524798 2970531678 264
1125 iso_pu_bacteria 8002285264 8002286248 264
1126 iso_pu_bacteria 8055431914 8055435940 264
1127 iso_pu_bacteria 8056875544 8056877526 264
1128 3300005356 Ga0070674_100045424 Ga0070674_1000454242 265
1129 3300006038 Ga0075365_10034425 Ga0075365_100344252 265
1130 3300006051 Ga0075364_10093302 Ga0075364_100933022 265
1131 3300006177 Ga0075362_10037867 Ga0075362_100378672 265
1132 3300007076 Ga0075435_100314964 Ga0075435_1003149642 265
1133 3300010375 Ga0105239_10396976 Ga0105239_103969762 265
1134 3300011119 Ga0105246_10737895 Ga0105246_107378951 265
1135 3300013297 Ga0157378_10500894 Ga0157378_105008942 265
1136 3300025907 Ga0207645_10141288 Ga0207645_101412882 265
1137 3300025972 Ga0207668_10168636 Ga0207668_101686362 265
1138 3300025972 Ga0207668_10497691 Ga0207668_104976911 265
1139 3300026041 Ga0207639_10389234 Ga0207639_103892342 265
1140 3300026067 Ga0207678_10083182 Ga0207678_100831822 265
1141 3300026116 Ga0207674_10618452 Ga0207674_106184522 265
1142 3300028379 Ga0268266_10017817 Ga0268266_100178173 265
1143 3300035692 Ga0373935_0009153 Ga0373935_0009153_4486_5301 265
1144 3300035695 Ga0373927_0000147 Ga0373927_0000147_4871_5686 265
1145 3300037068 Ga0373925_0007077 Ga0373925_0007077_4445_5260 265
1146 3300037312 Ga0395899_0000073 Ga0395899_0000073_32317_33135 265
1147 3300037418 Ga0395900_0000027 Ga0395900_0000027_136887_137705 265
1148 3300037466 Ga0395898_0000043 Ga0395898_0000043_284661_285479 265
1149 3300037471 Ga0395905_0000032 Ga0395905_0000032_148228_149046 265
1150 3300038443 Ga0395901_0000056 Ga0395901_0000056_136887_137705 265
1151 3300046520 Ga0495637_0036141 Ga0495637_0036141_998_1813 265
1152 3300046616 Ga0495668_0104353 Ga0495668_0104353_300_1118 265
1153 3300046660 Ga0495625_0147457 Ga0495625_0147457_433_1248 265
1154 3300047320 Ga0495672_0155244 Ga0495672_0155244_322_1149 265
1155 3300048908 Ga0496105_0480245 Ga0496105_0480245_40_861 265
1156 3300048922 Ga0496119_0008779 Ga0496119_0008779_6462_7295 265
1157 3300048923 Ga0496120_0002707 Ga0496120_0002707_2330_3163 265
1158 3300049569 Ga0501032_0000312 Ga0501032_0000312_2228_3064 265
1159 3300049570 Ga0501033_0000752 Ga0501033_0000752_26716_27552 265
1160 3300049571 Ga0501034_0002486 Ga0501034_0002486_2275_3111 265
1161 3300049571 Ga0501034_0023964 Ga0501034_0023964_2482_3306 265
1162 3300049572 Ga0501036_0001112 Ga0501036_0001112_2045_2881 265
1163 3300049573 Ga0501037_0000118 Ga0501037_0000118_70568_71404 265
1164 3300049573 Ga0501037_0023099 Ga0501037_0023099_2152_2988 265
1165 3300049574 Ga0501038_0000248 Ga0501038_0000248_42548_43384 265
1166 3300049575 Ga0501039_0000048 Ga0501039_0000048_56414_57250 265
1167 3300049579 Ga0501043_0000639 Ga0501043_0000639_10948_11784 265
1168 3300049580 Ga0501046_0049181 Ga0501046_0049181_1776_2612 265
1169 3300049581 Ga0501047_0269147 Ga0501047_0269147_295_1131 265
1170 3300049822 Ga0501035_0000118 Ga0501035_0000118_19060_19896 265
1171 3300049823 Ga0501044_0056837 Ga0501044_0056837_2360_3196 265
1172 3300049823 Ga0501044_0428036 Ga0501044_0428036_372_1187 265
1173 3300050492 nmdc:mga0yw44_276826_c1 nmdc:mga0yw44_276826_c1_230_1051 265
1174 3300050492 nmdc:mga0yw44_64458_c1 nmdc:mga0yw44_64458_c1_46_867 265
1175 3300050494 nmdc:mga06z11_344468_c1 nmdc:mga06z11_344468_c1_26_850 265
1176 3300050513 nmdc:mga0rr50_276565_c1 nmdc:mga0rr50_276565_c1_131_967 265
1177 3300053151 Ga0500604_0031096 Ga0500604_0031096_249_1067 265
1178 3300053155 Ga0500620_000830 Ga0500620_000830_770_1594 265
1179 3300053155 Ga0500620_009455 Ga0500620_009455_589_1407 265
1180 3300053158 Ga0500627_0076805 Ga0500627_0076805_86_907 265
1181 3300053158 Ga0500627_0084823 Ga0500627_0084823_442_1269 265
1182 3300053727 Ga0500611_005646 Ga0500611_005646_264_1082 265
1183 iso_pu_bacteria 2510461069 2510840578 265
1184 iso_pu_bacteria 2775507049 2776913704 265
1185 iso_pu_bacteria 2818991272 2819241624 265
1186 iso_pu_bacteria 8005301065 8005302569 265
1187 iso_pu_bacteria 8005658619 8005659690 265
1188 3300005347 Ga0070668_100454789 Ga0070668_1004547892 266
1189 3300009553 Ga0105249_10121557 Ga0105249_101215573 266
1190 3300017792 Ga0163161_10196113 Ga0163161_101961132 266
1191 3300025901 Ga0207688_10241251 Ga0207688_102412512 266
1192 3300025961 Ga0207712_10290128 Ga0207712_102901282 266
1193 3300048906 Ga0496103_0001223 Ga0496103_0001223_7214_8050 266
1194 3300048909 Ga0496106_0014060 Ga0496106_0014060_3655_4491 266
1195 3300048910 Ga0496107_0063116 Ga0496107_0063116_1823_2659 266
1196 3300048922 Ga0496119_0066578 Ga0496119_0066578_556_1377 266
1197 3300049571 Ga0501034_0003827 Ga0501034_0003827_14215_15045 266
1198 3300049571 Ga0501034_0060256 Ga0501034_0060256_503_1333 266
1199 3300053125 Ga0500618_000592 Ga0500618_000592_529_1368 266
1200 iso_pu_bacteria 2643221653 2644298511 266
1201 iso_pu_bacteria 2643221719 2644656740 266
1202 iso_pu_bacteria 2757320392 2757569531 266
1203 iso_pu_bacteria 2854896431 2854899544 266
1204 iso_pu_bacteria 2899803654 2899807677 266
1205 iso_pu_bacteria 8005246636 8005248595 266
1206 3300002987 JGI25159J45721_1000007 JGI25159J45721_100000739 267
1207 3300003187 JGI25151J46595_10032559 JGI25151J46595_100325591 267
1208 3300003354 JGI25160J50197_1000011 JGI25160J50197_100001184 267
1209 3300003374 JGI25161J50226_1000672 JGI25161J50226_100067216 267
1210 3300003771 Ga0055526_1005965 Ga0055526_10059652 267
1211 3300003781 Ga0055536_1003670 Ga0055536_10036702 267
1212 3300003794 Ga0055531_10019893 Ga0055531_100198932 267
1213 3300004625 Ga0055543_1000117 Ga0055543_100011737 267
1214 3300005262 Ga0065165_1000018 Ga0065165_100001884 267
1215 3300007076 Ga0075435_100082393 Ga0075435_1000823932 267
1216 3300013249 Ga0171463_1008 Ga0171463_1008243 267
1217 3300015690 Ga0183363_1265 Ga0183363_126511 267
1218 3300025208 Ga0209436_100870 Ga0209436_10087012 267
1219 3300025284 Ga0209130_1000029 Ga0209130_1000029169 267
1220 3300025294 Ga0209025_1000033 Ga0209025_100003325 267
1221 3300025295 Ga0209564_1000288 Ga0209564_100028819 267
1222 3300025298 Ga0209050_1011079 Ga0209050_10110793 267
1223 3300025299 Ga0209256_1000194 Ga0209256_100019418 267
1224 3300025299 Ga0209256_1002513 Ga0209256_100251312 267
1225 3300025302 Ga0207426_1000074 Ga0207426_1000074129 267
1226 3300025303 Ga0209051_1033591 Ga0209051_10335912 267
1227 3300048921 Ga0496118_0064435 Ga0496118_0064435_193_1047 267
1228 3300048923 Ga0496120_0034513 Ga0496120_0034513_1176_2030 267
1229 3300048926 Ga0496123_0007805 Ga0496123_0007805_3254_4069 267
1230 3300048928 Ga0496125_0000001 Ga0496125_0000001_1438445_1439299 267
1231 3300049568 Ga0501031_0015055 Ga0501031_0015055_244_1077 267
1232 3300049569 Ga0501032_0006976 Ga0501032_0006976_5889_6722 267
1233 3300049570 Ga0501033_0024710 Ga0501033_0024710_1269_2102 267
1234 3300049571 Ga0501034_0105050 Ga0501034_0105050_1556_2389 267
1235 3300049572 Ga0501036_0020356 Ga0501036_0020356_2476_3309 267
1236 3300049573 Ga0501037_0006217 Ga0501037_0006217_1881_2714 267
1237 3300049574 Ga0501038_0011040 Ga0501038_0011040_5759_6592 267
1238 3300049575 Ga0501039_0098634 Ga0501039_0098634_1223_2056 267
1239 3300049581 Ga0501047_0031991 Ga0501047_0031991_1579_2412 267
1240 3300049586 Ga0501070_0028755 Ga0501070_0028755_1421_2254 267
1241 3300049822 Ga0501035_0014314 Ga0501035_0014314_1219_2052 267
1242 3300049823 Ga0501044_0061755 Ga0501044_0061755_1176_2009 267
1243 3300050513 nmdc:mga0rr50_58788_c1 nmdc:mga0rr50_58788_c1_1319_2161 267
1244 iso_pu_bacteria 2821123053 2821127884 267
1245 3300046691 Ga0495670_0068696 Ga0495670_0068696_596_1468 268
1246 3300053125 Ga0500618_011663 Ga0500618_011663_886_1758 268
1247 iso_pu_bacteria 2537561587 2537873923 268
1248 iso_pu_bacteria 2554235003 2554247722 268
1249 iso_pu_bacteria 2558860242 2559294855 268
1250 iso_pu_bacteria 2599185210 2599604117 268
1251 iso_pu_bacteria 2600255279 2601608086 268
1252 iso_pu_bacteria 2600255308 2601744861 268
1253 iso_pu_bacteria 2643221558 2643811721 268
1254 iso_pu_bacteria 2643221582 2643919344 268
1255 iso_pu_bacteria 2643221693 2644522248 268
1256 iso_pu_bacteria 2808606387 2808985374 268
1257 iso_pu_bacteria 2818991439 2819559810 268
1258 iso_pu_bacteria 2838675328 2838676218 268
1259 iso_pu_bacteria 2838714209 2838715100 268
1260 iso_pu_bacteria 2838719591 2838721100 268
1261 iso_pu_bacteria 2838724970 2838725859 268
1262 iso_pu_bacteria 2841846520 2841848057 268
1263 iso_pu_bacteria 2841859092 2841859396 268
1264 iso_pu_bacteria 2842124991 2842125913 268
1265 iso_pu_bacteria 2842130223 2842131112 268
1266 iso_pu_bacteria 2842152218 2842153718 268
1267 iso_pu_bacteria 2842170452 2842171343 268
1268 iso_pu_bacteria 2842175837 2842177338 268
1269 iso_pu_bacteria 2842187318 2842188208 268
1270 iso_pu_bacteria 2842211629 2842212519 268
1271 iso_pu_bacteria 2842224351 2842225862 268
1272 iso_pu_bacteria 2842515876 2842516180 268
1273 iso_pu_bacteria 2899792073 2899796182 268
1274 iso_pu_bacteria 2899845264 2899849203 268
1275 iso_pu_bacteria 2919114240 2919115192 268
1276 iso_pu_bacteria 2926754445 2926756237 268
1277 iso_pu_bacteria 2926760298 2926760468 268
1278 iso_pu_bacteria 2933006813 2933008365 268
1279 iso_pu_bacteria 2933011516 2933013177 268
1280 iso_pu_bacteria 2933594066 2933597873 268
1281 iso_pu_bacteria 2937843397 2937847398 268
1282 iso_pu_bacteria 2979089926 2979094254 268
1283 iso_pu_bacteria 2979095461 2979098365 268
1284 iso_pu_bacteria 2979100975 2979106257 268
1285 iso_pu_bacteria 2984509177 2984511944 268
1286 iso_pu_bacteria 2984518228 2984521695 268
1287 iso_pu_bacteria 2984537506 2984540991 268
1288 iso_pu_bacteria 2984601300 2984603274 268
1289 iso_pu_bacteria 650716007 650740110 268
1290 iso_pu_bacteria 8003570095 8003571112 268
1291 3300009148 Ga0105243_10006823 Ga0105243_100068235 269
1292 3300013100 Ga0157373_10029332 Ga0157373_100293322 269
1293 3300013102 Ga0157371_10000015 Ga0157371_10000015163 269
1294 3300013104 Ga0157370_10000861 Ga0157370_1000086116 269
1295 iso_pu_bacteria 2643221568 2643857748 269
1296 iso_pu_bacteria 2838016132 2838021461 269
1297 iso_pu_bacteria 2838048938 2838052413 269
1298 iso_pu_bacteria 2838061910 2838067729 269
1299 iso_pu_bacteria 2838068647 2838073596 269
1300 iso_pu_bacteria 2838668709 2838672019 269
1301 iso_pu_bacteria 2838701080 2838704701 269
1302 iso_pu_bacteria 2842110456 2842110488 269
1303 iso_pu_bacteria 2842146304 2842148559 269
1304 iso_pu_bacteria 2842192696 2842194500 269
1305 iso_pu_bacteria 2842205361 2842206031 269
1306 iso_pu_bacteria 2842250916 2842254381 269
1307 iso_pu_bacteria 2842264693 2842266037 269
1308 iso_pu_bacteria 2842278818 2842279488 269
1309 iso_pu_bacteria 2842285085 2842286135 269
1310 iso_pu_bacteria 2842311132 2842316715 269
1311 iso_pu_bacteria 2842317721 2842317897 269
1312 iso_pu_bacteria 2842402390 2842403495 269
1313 iso_pu_bacteria 2842409023 2842409132 269
1314 iso_pu_bacteria 2842415677 2842415786 269
1315 iso_pu_bacteria 2842422224 2842428081 269
1316 iso_pu_bacteria 2842428310 2842429326 269
1317 iso_pu_bacteria 2842434925 2842435939 269
1318 iso_pu_bacteria 2842441272 2842442286 269
1319 iso_pu_bacteria 2842447887 2842450577 269
1320 iso_pu_bacteria 2842462802 2842463747 269
1321 iso_pu_bacteria 2842469257 2842470268 269
1322 iso_pu_bacteria 2842489311 2842490033 269
1323 iso_pu_bacteria 2842495871 2842496167 269
1324 iso_pu_bacteria 2854916844 2854918367 269
1325 iso_pu_bacteria 2857516855 2857518725 269
1326 iso_pu_bacteria 2919166419 2919167928 269
1327 iso_pu_bacteria 2919171160 2919175230 269
1328 iso_pu_bacteria 2978969890 2978974379 269
1329 iso_pu_bacteria 2984587000 2984589719 269
1330 3300028794 Ga0307515_10000198 Ga0307515_10000198123 270
1331 3300031456 Ga0307513_10019835 Ga0307513_100198354 270
1332 3300048907 Ga0496104_0079760 Ga0496104_0079760_13_861 270
1333 3300048913 Ga0496110_0033360 Ga0496110_0033360_3327_4175 270
1334 3300048917 Ga0496114_0182909 Ga0496114_0182909_739_1587 270
1335 3300048927 Ga0496124_0000740 Ga0496124_0000740_34326_35180 270
1336 iso_pu_bacteria 2838022645 2838027854 270
1337 iso_pu_bacteria 2842198810 2842203830 270
1338 iso_pu_bacteria 2842395702 2842401878 270
1339 3300005455 Ga0070663_100077820 Ga0070663_1000778202 271
1340 3300006946 Ga0079104_1000022 Ga0079104_1000022165 271
1341 3300025932 Ga0207690_10034852 Ga0207690_100348522 271
1342 3300026067 Ga0207678_10027650 Ga0207678_100276504 271
1343 3300027111 Ga0209281_1000538 Ga0209281_100053819 271
1344 3300031548 Ga0307408_100125221 Ga0307408_1001252212 271
1345 3300032002 Ga0307416_100208919 Ga0307416_1002089192 271
1346 3300038443 Ga0395901_0267695 Ga0395901_0267695_310_1161 271
1347 3300039438 Ga0436360_0982192 Ga0436360_0982192_175_1029 271
1348 3300048925 Ga0496122_0045620 Ga0496122_0045620_787_1641 271
1349 3300049569 Ga0501032_0053046 Ga0501032_0053046_1336_2196 271
1350 3300049570 Ga0501033_0007943 Ga0501033_0007943_1457_2317 271
1351 3300049571 Ga0501034_0340306 Ga0501034_0340306_450_1310 271
1352 3300049572 Ga0501036_0257097 Ga0501036_0257097_65_925 271
1353 3300049573 Ga0501037_0000857 Ga0501037_0000857_16491_17351 271
1354 3300049579 Ga0501043_0000107 Ga0501043_0000107_15913_16773 271
1355 3300049579 Ga0501043_0012772 Ga0501043_0012772_3215_4075 271
1356 3300049580 Ga0501046_0058235 Ga0501046_0058235_1881_2741 271
1357 3300049581 Ga0501047_0100575 Ga0501047_0100575_1160_2020 271
1358 3300049583 Ga0501067_0063660 Ga0501067_0063660_883_1743 271
1359 3300049584 Ga0501068_0053868 Ga0501068_0053868_355_1215 271
1360 3300049585 Ga0501069_0001348 Ga0501069_0001348_330_1190 271
1361 3300049586 Ga0501070_0000132 Ga0501070_0000132_59726_60586 271
1362 3300049586 Ga0501070_0049997 Ga0501070_0049997_1795_2655 271
1363 3300049587 Ga0501071_0017228 Ga0501071_0017228_3610_4470 271
1364 3300049589 Ga0501073_0009343 Ga0501073_0009343_160_1020 271
1365 3300049590 Ga0501074_0000088 Ga0501074_0000088_19341_20201 271
1366 3300049742 Ga0501080_0040601 Ga0501080_0040601_2891_3751 271
1367 3300049744 Ga0501083_0000065 Ga0501083_0000065_40069_40929 271
1368 3300049744 Ga0501083_0242108 Ga0501083_0242108_18_878 271
1369 3300049822 Ga0501035_0000185 Ga0501035_0000185_16303_17163 271
1370 3300049822 Ga0501035_0082161 Ga0501035_0082161_971_1831 271
1371 3300049823 Ga0501044_0000003 Ga0501044_0000003_19343_20203 271
1372 3300049823 Ga0501044_0277489 Ga0501044_0277489_378_1238 271
1373 iso_pu_bacteria 2513237085 2513577290 271
1374 iso_pu_bacteria 2515154114 2515639782 271
1375 iso_pu_bacteria 2599185236 2599721085 271
1376 iso_pu_bacteria 2643221637 2644210312 271
1377 iso_pu_bacteria 2643221718 2644653864 271
1378 iso_pu_bacteria 2838686498 2838689504 271
1379 iso_pu_bacteria 2838729681 2838730838 271
1380 iso_pu_bacteria 2838742623 2838743779 271
1381 iso_pu_bacteria 2841851746 2841857854 271
1382 iso_pu_bacteria 2841864319 2841864552 271
1383 iso_pu_bacteria 2842156927 2842157409 271
1384 iso_pu_bacteria 2842163707 2842164600 271
1385 iso_pu_bacteria 2842180545 2842181006 271
1386 iso_pu_bacteria 2842217011 2842217240 271
1387 iso_pu_bacteria 2842229732 2842230935 271
1388 iso_pu_bacteria 2842243621 2842244958 271
1389 iso_pu_bacteria 2842257432 2842258771 271
1390 iso_pu_bacteria 2842271015 2842273524 271
1391 iso_pu_bacteria 2842304105 2842304301 271
1392 iso_pu_bacteria 2842341865 2842345829 271
1393 iso_pu_bacteria 2842363717 2842364540 271
1394 iso_pu_bacteria 2844454524 2844459155 271
1395 iso_pu_bacteria 2904578770 2904580879 271
1396 iso_pu_bacteria 2919119836 2919121406 271
1397 iso_pu_bacteria 8005556819 8005557710 271
1398 iso_pu_bacteria 8018163183 8018166796 271
1399 iso_pu_bacteria 8023680758 8023685383 271
1400 iso_pu_bacteria 8057874678 8057875061 271
1401 3300003187 JGI25151J46595_10049507 JGI25151J46595_100495072 272
1402 3300003856 Ga0058692_1000843 Ga0058692_10008434 272
1403 3300003856 Ga0058692_1001796 Ga0058692_10017964 272
1404 3300005548 Ga0070665_100014927 Ga0070665_1000149274 272
1405 3300006042 Ga0075368_10001469 Ga0075368_100014695 272
1406 3300006051 Ga0075364_10001264 Ga0075364_100012645 272
1407 3300006178 Ga0075367_10051610 Ga0075367_100516103 272
1408 3300006178 Ga0075367_10110186 Ga0075367_101101862 272
1409 3300006353 Ga0075370_10057908 Ga0075370_100579082 272
1410 3300006948 Ga0099826_10000088 Ga0099826_100000889 272
1411 3300006948 Ga0099826_10006034 Ga0099826_100060345 272
1412 3300013104 Ga0157370_10111552 Ga0157370_101115522 272
1413 3300025294 Ga0209025_1000094 Ga0209025_1000094233 272
1414 3300027312 Ga0209371_1000178 Ga0209371_100017888 272
1415 3300027312 Ga0209371_1000621 Ga0209371_100062122 272
1416 3300027666 Ga0209282_1000372 Ga0209282_100037215 272
1417 3300027666 Ga0209282_1004392 Ga0209282_10043922 272
1418 3300027866 Ga0209813_10005200 Ga0209813_100052004 272
1419 3300030500 Ga0268256_1001287 Ga0268256_10012877 272
1420 3300030500 Ga0268256_1004786 Ga0268256_10047863 272
1421 3300030744 Ga0316181_1240954 Ga0316181_12409543 272
1422 3300048924 Ga0496121_0000959 Ga0496121_0000959_28316_29158 272
1423 3300049570 Ga0501033_0026725 Ga0501033_0026725_2788_3651 272
1424 3300049570 Ga0501033_0172096 Ga0501033_0172096_190_1053 272
1425 3300049573 Ga0501037_0196838 Ga0501037_0196838_39_902 272
1426 3300049581 Ga0501047_0017404 Ga0501047_0017404_2754_3617 272
1427 3300049581 Ga0501047_0045004 Ga0501047_0045004_2683_3546 272
1428 3300049581 Ga0501047_0062837 Ga0501047_0062837_347_1210 272
1429 3300049585 Ga0501069_0028971 Ga0501069_0028971_389_1252 272
1430 3300049586 Ga0501070_0000631 Ga0501070_0000631_12311_13174 272
1431 3300049586 Ga0501070_0044320 Ga0501070_0044320_1610_2473 272
1432 3300049587 Ga0501071_0041634 Ga0501071_0041634_418_1281 272
1433 3300049742 Ga0501080_0000128 Ga0501080_0000128_8104_8967 272
1434 3300049742 Ga0501080_0017979 Ga0501080_0017979_4799_5662 272
1435 3300049822 Ga0501035_0000245 Ga0501035_0000245_33992_34855 272
1436 3300049822 Ga0501035_0002121 Ga0501035_0002121_3626_4489 272
1437 3300049822 Ga0501035_0011321 Ga0501035_0011321_3157_4020 272
1438 3300049823 Ga0501044_0021082 Ga0501044_0021082_4701_5564 272
1439 3300049823 Ga0501044_0112933 Ga0501044_0112933_1351_2214 272
1440 3300049823 Ga0501044_0127508 Ga0501044_0127508_1566_2429 272
1441 3300049823 Ga0501044_0186250 Ga0501044_0186250_540_1403 272
1442 3300053140 Ga0500573_0000429 Ga0500573_0000429_11190_12029 272
1443 3300053157 Ga0500624_005173 Ga0500624_005173_381_1229 272
1444 3300053161 Ga0500634_0063075 Ga0500634_0063075_844_1680 272
1445 iso_pu_bacteria 2600254933 2600374525 272
1446 iso_pu_bacteria 2818991461 2819687303 272
1447 3300003187 JGI25151J46595_10000134 JGI25151J46595_1000013450 273
1448 3300003215 JGI25153J46596_10003170 JGI25153J46596_100031705 273
1449 3300003215 JGI25153J46596_10022980 JGI25153J46596_100229801 273
1450 3300003354 JGI25160J50197_1000649 JGI25160J50197_10006497 273
1451 3300003374 JGI25161J50226_1004351 JGI25161J50226_10043513 273
1452 3300003771 Ga0055526_1000191 Ga0055526_100019126 273
1453 3300003771 Ga0055526_1029311 Ga0055526_10293112 273
1454 3300003775 Ga0055524_1000520 Ga0055524_10005205 273
1455 3300003775 Ga0055524_1012051 Ga0055524_10120512 273
1456 3300003781 Ga0055536_1033987 Ga0055536_10339872 273
1457 3300003790 Ga0055528_1001039 Ga0055528_10010399 273
1458 3300003790 Ga0055528_1003797 Ga0055528_10037971 273
1459 3300003790 Ga0055528_1006531 Ga0055528_10065312 273
1460 3300003791 Ga0055530_10009365 Ga0055530_100093652 273
1461 3300003792 Ga0055540_1002986 Ga0055540_10029862 273
1462 3300003794 Ga0055531_10009401 Ga0055531_100094014 273
1463 3300004625 Ga0055543_1000599 Ga0055543_10005997 273
1464 3300005262 Ga0065165_1004034 Ga0065165_10040344 273
1465 3300006038 Ga0075365_10003753 Ga0075365_100037534 273
1466 3300006177 Ga0075362_10002890 Ga0075362_100028902 273
1467 3300006178 Ga0075367_10005656 Ga0075367_100056565 273
1468 3300006186 Ga0075369_10002370 Ga0075369_100023702 273
1469 3300006195 Ga0075366_10000417 Ga0075366_100004177 273
1470 3300006353 Ga0075370_10004513 Ga0075370_100045133 273
1471 3300010375 Ga0105239_10249422 Ga0105239_102494222 273
1472 3300013102 Ga0157371_10038034 Ga0157371_100380342 273
1473 3300025245 Ga0207425_1004946 Ga0207425_10049464 273
1474 3300025273 Ga0209673_1000013 Ga0209673_1000013429 273
1475 3300025273 Ga0209673_1000552 Ga0209673_100055220 273
1476 3300025292 Ga0209676_1012295 Ga0209676_10122953 273
1477 3300025294 Ga0209025_1000166 Ga0209025_100016617 273
1478 3300025295 Ga0209564_1000273 Ga0209564_100027383 273
1479 3300025295 Ga0209564_1000469 Ga0209564_10004697 273
1480 3300025297 Ga0209758_1000218 Ga0209758_100021810 273
1481 3300025297 Ga0209758_1000629 Ga0209758_100062915 273
1482 3300025297 Ga0209758_1028882 Ga0209758_10288822 273
1483 3300025298 Ga0209050_1005022 Ga0209050_10050225 273
1484 3300025299 Ga0209256_1000371 Ga0209256_100037121 273
1485 3300025299 Ga0209256_1002003 Ga0209256_10020037 273
1486 3300025302 Ga0207426_1000039 Ga0207426_1000039110 273
1487 3300025303 Ga0209051_1000723 Ga0209051_100072318 273
1488 3300025303 Ga0209051_1001634 Ga0209051_10016347 273
1489 3300025304 Ga0209257_1003242 Ga0209257_10032423 273
1490 3300025972 Ga0207668_10165588 Ga0207668_101655882 273
1491 3300028794 Ga0307515_10015486 Ga0307515_1001548610 273
1492 3300037471 Ga0395905_0005236 Ga0395905_0005236_12040_12894 273
1493 3300037471 Ga0395905_0062219 Ga0395905_0062219_1284_2138 273
1494 3300041406 Ga0439439_0039344 Ga0439439_0039344_265_1104 273
1495 3300041406 Ga0439439_0040060 Ga0439439_0040060_144_995 273
1496 3300041413 Ga0439465_0009350 Ga0439465_0009350_341_1180 273
1497 3300046660 Ga0495625_0059346 Ga0495625_0059346_295_1146 273
1498 3300047470 Ga0495681_0004088 Ga0495681_0004088_582_1469 273
1499 3300048919 Ga0496116_0100104 Ga0496116_0100104_518_1405 273
1500 3300048920 Ga0496117_0000002 Ga0496117_0000002_963006_963893 273
1501 3300048921 Ga0496118_0001855 Ga0496118_0001855_22142_23029 273
1502 3300048921 Ga0496118_0013135 Ga0496118_0013135_2096_2935 273
1503 3300048922 Ga0496119_0014680 Ga0496119_0014680_4306_5193 273
1504 3300048923 Ga0496120_0000078 Ga0496120_0000078_20000_20887 273
1505 3300048924 Ga0496121_0011499 Ga0496121_0011499_59_913 273
1506 3300048925 Ga0496122_0000001 Ga0496122_0000001_269442_270329 273
1507 3300048926 Ga0496123_0000001 Ga0496123_0000001_273173_274060 273
1508 3300048927 Ga0496124_0010996 Ga0496124_0010996_357_1211 273
1509 3300048927 Ga0496124_0027905 Ga0496124_0027905_3702_4589 273
1510 3300048928 Ga0496125_0019884 Ga0496125_0019884_4063_4950 273
1511 3300048928 Ga0496125_0100465 Ga0496125_0100465_899_1786 273
1512 3300049571 Ga0501034_0117026 Ga0501034_0117026_1623_2483 273
1513 3300050489 nmdc:mga03683_564_c1 nmdc:mga03683_564_c1_5550_6389 273
1514 3300050490 nmdc:mga03n38_2724_c1 nmdc:mga03n38_2724_c1_536_1423 273
1515 3300050491 nmdc:mga00v17_56095_c1 nmdc:mga00v17_56095_c1_320_1207 273
1516 3300050492 nmdc:mga0yw44_349_c1 nmdc:mga0yw44_349_c1_9893_10732 273
1517 3300050492 nmdc:mga0yw44_3818_c1 nmdc:mga0yw44_3818_c1_295_1182 273
1518 3300050493 nmdc:mga0k408_4188_c1 nmdc:mga0k408_4188_c1_344_1183 273
1519 3300050493 nmdc:mga0k408_51532_c1 nmdc:mga0k408_51532_c1_1458_2345 273
1520 3300050494 nmdc:mga06z11_2403_c1 nmdc:mga06z11_2403_c1_5586_6425 273
1521 3300050494 nmdc:mga06z11_52752_c1 nmdc:mga06z11_52752_c1_537_1424 273
1522 3300050494 nmdc:mga06z11_71168_c1 nmdc:mga06z11_71168_c1_304_1191 273
1523 3300050495 nmdc:mga04h51_28645_c1 nmdc:mga04h51_28645_c1_357_1244 273
1524 3300050496 nmdc:mga07m45_4076_c1 nmdc:mga07m45_4076_c1_2560_3399 273
1525 3300050516 nmdc:mga0sz30_3205_c2 nmdc:mga0sz30_3205_c2_388_1227 273
1526 3300053107 Ga0500560_004671 Ga0500560_004671_584_1471 273
1527 3300053137 Ga0500561_0001272 Ga0500561_0001272_523_1410 273
1528 3300053153 Ga0500616_0000551 Ga0500616_0000551_21949_22794 273
1529 3300053157 Ga0500624_000255 Ga0500624_000255_4846_5733 273
1530 3300053158 Ga0500627_0113291 Ga0500627_0113291_168_1019 273
1531 3300053177 Ga0500636_0012938 Ga0500636_0012938_1443_2306 273
1532 iso_pu_bacteria 2509276033 2509443271 273
1533 iso_pu_bacteria 2510917026 2511172837 273
1534 iso_pu_bacteria 2510917028 2511183543 273
1535 iso_pu_bacteria 2513237088 2513594595 273
1536 iso_pu_bacteria 2513237144 2513912427 273
1537 iso_pu_bacteria 2513237146 2513926213 273
1538 iso_pu_bacteria 2513237159 2513997186 273
1539 iso_pu_bacteria 2519899620 2520379304 273
1540 iso_pu_bacteria 2534681796 2535516506 273
1541 iso_pu_bacteria 2582581283 2585166014 273
1542 iso_pu_bacteria 2582581294 2585200179 273
1543 iso_pu_bacteria 2582581299 2585233543 273
1544 iso_pu_bacteria 2582581306 2585268035 273
1545 iso_pu_bacteria 2582581865 2585386862 273
1546 iso_pu_bacteria 2582581866 2585396749 273
1547 iso_pu_bacteria 2585427528 2585537548 273
1548 iso_pu_bacteria 2585427593 2585835498 273
1549 iso_pu_bacteria 2585427633 2585995767 273
1550 iso_pu_bacteria 2585427634 2586000329 273
1551 iso_pu_bacteria 2599185170 2599417691 273
1552 iso_pu_bacteria 2615840624 2616292449 273
1553 iso_pu_bacteria 2643221643 2644239586 273
1554 iso_pu_bacteria 2643221689 2644501831 273
1555 iso_pu_bacteria 2718217927 2719385797 273
1556 iso_pu_bacteria 2718217997 2719665618 273
1557 iso_pu_bacteria 2718218199 2720492038 273
1558 iso_pu_bacteria 2718218232 2720613302 273
1559 iso_pu_bacteria 2718218233 2720620178 273
1560 iso_pu_bacteria 2718218235 2720631603 273
1561 iso_pu_bacteria 2718218269 2720775331 273
1562 iso_pu_bacteria 2718218423 2721399577 273
1563 iso_pu_bacteria 2721755556 2723026950 273
1564 iso_pu_bacteria 2721755684 2723560564 273
1565 iso_pu_bacteria 2721755685 2723567150 273
1566 iso_pu_bacteria 2721755809 2724038390 273
1567 iso_pu_bacteria 2721755819 2724089938 273
1568 iso_pu_bacteria 2721755822 2724104415 273
1569 iso_pu_bacteria 2721755823 2724110208 273
1570 iso_pu_bacteria 2728369352 2730107886 273
1571 iso_pu_bacteria 2738541333 2739036510 273
1572 iso_pu_bacteria 2765235942 2766063178 273
1573 iso_pu_bacteria 2791355256 2793294683 273
1574 iso_pu_bacteria 2791355259 2793312263 273
1575 iso_pu_bacteria 2791355262 2793335722 273
1576 iso_pu_bacteria 2791355265 2793353058 273
1577 iso_pu_bacteria 2802429605 2805925717 273
1578 iso_pu_bacteria 2802429606 2805933559 273
1579 iso_pu_bacteria 2802429633 2806046060 273
1580 iso_pu_bacteria 2802429634 2806054439 273
1581 iso_pu_bacteria 2802429635 2806060444 273
1582 iso_pu_bacteria 2802429636 2806065098 273
1583 iso_pu_bacteria 2802429637 2806072363 273
1584 iso_pu_bacteria 2838035591 2838038096 273
1585 iso_pu_bacteria 2838661181 2838667217 273
1586 iso_pu_bacteria 2842521101 2842522571 273
1587 iso_pu_bacteria 2923556063 2923557939 273
1588 iso_pu_bacteria 2933016740 2933023078 273
1589 iso_pu_bacteria 2933586486 2933586517 273
1590 iso_pu_bacteria 2933599457 2933603922 273
1591 iso_pu_bacteria 2996887358 2996891709 273
1592 iso_pu_bacteria 2996893221 2996894158 273
1593 iso_pu_bacteria 3005409236 3005415133 273
1594 iso_pu_bacteria 8005258706 8005263039 273
1595 iso_pu_bacteria 8005275841 8005280575 273
1596 iso_pu_bacteria 8005282627 8005283195 273
1597 iso_pu_bacteria 8005289223 8005290249 273
1598 iso_pu_bacteria 8005321885 8005326236 273
1599 iso_pu_bacteria 8005382845 8005388334 273
1600 iso_pu_bacteria 8005430974 8005432142 273
1601 iso_pu_bacteria 8005497431 8005500341 273
1602 iso_pu_bacteria 8005542996 8005545157 273
1603 iso_pu_bacteria 8005570704 8005574241 273
1604 iso_pu_bacteria 8005619151 8005621717 273
1605 iso_pu_bacteria 8005626139 8005626536 273
1606 iso_pu_bacteria 8005668836 8005671759 273
1607 iso_pu_bacteria 8018127388 8018129924 273
1608 iso_pu_bacteria 8018176218 8018179828 273
1609 iso_pu_bacteria 8024501048 8024506585 273
1610 iso_pu_bacteria 8056382006 8056387841 273
1611 3300009765 Ga0123341_1000004 Ga0123341_1000004116 274
1612 3300028794 Ga0307515_10007800 Ga0307515_100078004 274
1613 3300046524 Ga0495648_0140771 Ga0495648_0140771_194_1066 274
1614 3300048914 Ga0496111_0000701 Ga0496111_0000701_3159_3998 274
1615 3300048920 Ga0496117_0105321 Ga0496117_0105321_438_1328 274
1616 3300048921 Ga0496118_0056264 Ga0496118_0056264_906_1796 274
1617 3300048922 Ga0496119_0096074 Ga0496119_0096074_251_1141 274
1618 3300048925 Ga0496122_0000025 Ga0496122_0000025_212291_213145 274
1619 3300048925 Ga0496122_0055173 Ga0496122_0055173_375_1265 274
1620 3300048926 Ga0496123_0000032 Ga0496123_0000032_151068_151922 274
1621 3300048926 Ga0496123_0098600 Ga0496123_0098600_395_1285 274
1622 3300048927 Ga0496124_0047659 Ga0496124_0047659_1391_2230 274
1623 3300048929 Ga0496126_0005149 Ga0496126_0005149_11092_11982 274
1624 3300049574 Ga0501038_0052588 Ga0501038_0052588_538_1383 274
1625 3300049823 Ga0501044_0082243 Ga0501044_0082243_232_1077 274
1626 3300050490 nmdc:mga03n38_146186_c1 nmdc:mga03n38_146186_c1_253_1095 274
1627 iso_pu_bacteria 2515075009 2515112281 274
1628 iso_pu_bacteria 2529292951 2530645539 274
1629 iso_pu_bacteria 2582581304 2585254771 274
1630 iso_pu_bacteria 2585427594 2585846571 274
1631 iso_pu_bacteria 2643221599 2644005070 274
1632 iso_pu_bacteria 2643221634 2644192891 274
1633 iso_pu_bacteria 2643221688 2644491710 274
1634 iso_pu_bacteria 2718217882 2719181193 274
1635 iso_pu_bacteria 2718218009 2719731942 274
1636 iso_pu_bacteria 2718218363 2721147287 274
1637 iso_pu_bacteria 2718218365 2721158820 274
1638 iso_pu_bacteria 2718218366 2721164205 274
1639 iso_pu_bacteria 2721755514 2722840375 274
1640 iso_pu_bacteria 2721755810 2724044698 274
1641 iso_pu_bacteria 2728369365 2730164430 274
1642 iso_pu_bacteria 2728369397 2730298452 274
1643 iso_pu_bacteria 2738541293 2738801935 274
1644 iso_pu_bacteria 2791355260 2793322009 274
1645 iso_pu_bacteria 2791355261 2793331287 274
1646 iso_pu_bacteria 2791355264 2793349065 274
1647 iso_pu_bacteria 2842298080 2842302018 274
1648 iso_pu_bacteria 2842357229 2842357515 274
1649 iso_pu_bacteria 2842482326 2842484812 274
1650 iso_pu_bacteria 2852387548 2852389924 274
1651 iso_pu_bacteria 2936367885 2936372696 274
1652 iso_pu_bacteria 2936375103 2936378549 274
1653 iso_pu_bacteria 3005452660 3005454091 274
1654 iso_pu_bacteria 8005376324 8005379222 274
1655 iso_pu_bacteria 8005395548 8005397138 274
1656 iso_pu_bacteria 8005460587 8005462944 274
1657 iso_pu_bacteria 8005688590 8005694582 274
1658 iso_pu_bacteria 8005695170 8005700014 274
1659 iso_pu_bacteria 8024479707 8024483539 274
1660 3300003215 JGI25153J46596_10004512 JGI25153J46596_100045125 275
1661 3300003790 Ga0055528_1016265 Ga0055528_10162652 275
1662 3300025258 Ga0209129_1010409 Ga0209129_10104093 275
1663 3300025297 Ga0209758_1014353 Ga0209758_10143534 275
1664 3300041441 Ga0451787_223311 Ga0451787_223311_1267_2112 275
1665 3300041458 Ga0451798_0200031 Ga0451798_0200031_1216_2061 275
1666 3300041491 Ga0451833_1421423 Ga0451833_1421423_660_1505 275
1667 3300041492 Ga0451835_0113922 Ga0451835_0113922_294_1139 275
1668 3300041496 Ga0451839_0358112 Ga0451839_0358112_1784_2629 275
1669 3300041501 Ga0451845_0403951 Ga0451845_0403951_380_1225 275
1670 3300041907 Ga0452268_09468 Ga0452268_09468_582_1427 275
1671 3300046460 Ga0495638_0113396 Ga0495638_0113396_53_898 275
1672 3300046471 Ga0495650_0040565 Ga0495650_0040565_363_1208 275
1673 3300046492 Ga0495585_0055210 Ga0495585_0055210_228_1073 275
1674 3300046515 Ga0495620_0021715 Ga0495620_0021715_1385_2230 275
1675 3300046519 Ga0495632_0008494 Ga0495632_0008494_2809_3654 275
1676 3300046524 Ga0495648_0019014 Ga0495648_0019014_2790_3635 275
1677 3300046530 Ga0495654_0096625 Ga0495654_0096625_276_1121 275
1678 3300046542 Ga0495597_0028981 Ga0495597_0028981_1525_2370 275
1679 3300048090 Ga0495615_0023537 Ga0495615_0023537_421_1266 275
1680 3300053086 Ga0500578_0107045 Ga0500578_0107045_124_969 275
1681 3300053134 Ga0500658_0000636 Ga0500658_0000636_6184_7029 275
1682 3300053136 Ga0500559_0002896 Ga0500559_0002896_4133_4993 275
1683 iso_pu_bacteria 2509276021 2509386673 275
1684 iso_pu_bacteria 2509276021 2509392918 275
1685 iso_pu_bacteria 2510065019 2510133322 275
1686 iso_pu_bacteria 2510461076 2510894691 275
1687 iso_pu_bacteria 2513237084 2513572491 275
1688 iso_pu_bacteria 2513237093 2513636047 275
1689 iso_pu_bacteria 2513237103 2513708722 275
1690 iso_pu_bacteria 2513237162 2514021640 275
1691 iso_pu_bacteria 2515154113 2515637556 275
1692 iso_pu_bacteria 2515154116 2515657428 275
1693 iso_pu_bacteria 2515154134 2515738568 275
1694 iso_pu_bacteria 2516653077 2517036014 275
1695 iso_pu_bacteria 2516653085 2517076407 275
1696 iso_pu_bacteria 2517093000 2517095165 275
1697 iso_pu_bacteria 2517287029 2517406794 275
1698 iso_pu_bacteria 2585427526 2585527649 275
1699 iso_pu_bacteria 2724679232 2725950636 275
1700 iso_pu_bacteria 2765235802 2765464889 275
1701 iso_pu_bacteria 2767802442 2770195184 275
1702 iso_pu_bacteria 2791355253 2793279691 275
1703 iso_pu_bacteria 2791355263 2793341529 275
1704 iso_pu_bacteria 2791355266 2793361160 275
1705 iso_pu_bacteria 2791355267 2793369250 275
1706 iso_pu_bacteria 2838042994 2838043449 275
1707 iso_pu_bacteria 2838680041 2838682203 275
1708 iso_pu_bacteria 2838694306 2838696774 275
1709 iso_pu_bacteria 2838707686 2838709986 275
1710 iso_pu_bacteria 2839993093 2839994813 275
1711 iso_pu_bacteria 2842077413 2842078159 275
1712 iso_pu_bacteria 2842118031 2842119332 275
1713 iso_pu_bacteria 2842237096 2842239398 275
1714 iso_pu_bacteria 2842291075 2842291822 275
1715 iso_pu_bacteria 2842370503 2842372769 275
1716 iso_pu_bacteria 2842377471 2842378218 275
1717 iso_pu_bacteria 2842384541 2842385841 275
1718 iso_pu_bacteria 2933570622 2933571577 275
1719 iso_pu_bacteria 2935894831 2935897370 275
1720 iso_pu_bacteria 2935901341 2935904750 275
1721 iso_pu_bacteria 2936381700 2936384973 275
1722 iso_pu_bacteria 639633055 639648537 275
1723 iso_pu_bacteria 8005307578 8005311185 275
1724 iso_pu_bacteria 8005563573 8005568883 275
1725 iso_pu_bacteria 8056375014 8056376631 275
1726 3300002739 JGI25158J39367_1000133 JGI25158J39367_10001336 276
1727 3300002739 JGI25158J39367_1000148 JGI25158J39367_10001485 276
1728 3300002773 JGI25152J39213_1009965 JGI25152J39213_10099652 276
1729 3300002987 JGI25159J45721_1002339 JGI25159J45721_10023395 276
1730 3300003187 JGI25151J46595_10013406 JGI25151J46595_100134062 276
1731 3300003374 JGI25161J50226_1000108 JGI25161J50226_100010847 276
1732 3300003374 JGI25161J50226_1000282 JGI25161J50226_100028213 276
1733 3300003771 Ga0055526_1001796 Ga0055526_10017966 276
1734 3300003771 Ga0055526_1027613 Ga0055526_10276132 276
1735 3300003775 Ga0055524_1008693 Ga0055524_10086933 276
1736 3300003790 Ga0055528_1001510 Ga0055528_10015109 276
1737 3300003790 Ga0055528_1009799 Ga0055528_10097993 276
1738 3300003792 Ga0055540_1000201 Ga0055540_10002019 276
1739 3300003792 Ga0055540_1006629 Ga0055540_10066293 276
1740 3300004625 Ga0055543_1000020 Ga0055543_100002038 276
1741 3300006051 Ga0075364_10004863 Ga0075364_100048635 276
1742 3300006353 Ga0075370_10047088 Ga0075370_100470882 276
1743 3300009036 Ga0105244_10084900 Ga0105244_100849002 276
1744 3300013100 Ga0157373_10051238 Ga0157373_100512383 276
1745 3300025208 Ga0209436_100439 Ga0209436_1004396 276
1746 3300025258 Ga0209129_1000069 Ga0209129_1000069116 276
1747 3300025258 Ga0209129_1000817 Ga0209129_10008173 276
1748 3300025273 Ga0209673_1000048 Ga0209673_1000048198 276
1749 3300025273 Ga0209673_1000959 Ga0209673_10009598 276
1750 3300025284 Ga0209130_1000004 Ga0209130_1000004201 276
1751 3300025294 Ga0209025_1001272 Ga0209025_10012726 276
1752 3300025294 Ga0209025_1010738 Ga0209025_10107382 276
1753 3300025294 Ga0209025_1052144 Ga0209025_10521442 276
1754 3300025295 Ga0209564_1001482 Ga0209564_10014826 276
1755 3300025295 Ga0209564_1021130 Ga0209564_10211302 276
1756 3300025297 Ga0209758_1000384 Ga0209758_100038440 276
1757 3300025299 Ga0209256_1001625 Ga0209256_10016256 276
1758 3300025302 Ga0207426_1000003 Ga0207426_1000003527 276
1759 3300025303 Ga0209051_1000142 Ga0209051_100014295 276
1760 3300025303 Ga0209051_1008600 Ga0209051_10086004 276
1761 3300025303 Ga0209051_1045978 Ga0209051_10459782 276
1762 3300025304 Ga0209257_1001864 Ga0209257_100186412 276
1763 3300025304 Ga0209257_1014247 Ga0209257_10142473 276
1764 3300046530 Ga0495654_0000315 Ga0495654_0000315_36107_36973 276
1765 3300046692 Ga0495671_0197205 Ga0495671_0197205_78_917 276
1766 3300048910 Ga0496107_0141897 Ga0496107_0141897_161_1009 276
1767 3300048920 Ga0496117_0115494 Ga0496117_0115494_164_1018 276
1768 3300048924 Ga0496121_0000001 Ga0496121_0000001_1279366_1280220 276
1769 3300048924 Ga0496121_0342526 Ga0496121_0342526_102_950 276
1770 3300048925 Ga0496122_0155754 Ga0496122_0155754_493_1341 276
1771 3300048927 Ga0496124_0015632 Ga0496124_0015632_4356_5210 276
1772 3300048927 Ga0496124_0248539 Ga0496124_0248539_125_973 276
1773 3300050491 nmdc:mga00v17_53493_c1 nmdc:mga00v17_53493_c1_1015_1869 276
1774 3300050496 nmdc:mga07m45_155605_c1 nmdc:mga07m45_155605_c1_381_1229 276
1775 3300053125 Ga0500618_000084 Ga0500618_000084_49192_50055 276
1776 iso_pu_bacteria 2775506902 2776270916 276
1777 iso_pu_bacteria 2775506904 2776282807 276
1778 iso_pu_bacteria 2842871566 2842871686 276
1779 iso_pu_bacteria 2894652903 2894656248 276
1780 iso_pu_bacteria 2928521798 2928523626 276
1781 iso_pu_bacteria 2929138655 2929139897 276
1782 iso_pu_bacteria 2954011201 2954015907 276
1783 iso_pu_bacteria 3002141150 3002144427 276
1784 3300002773 JGI25152J39213_1003760 JGI25152J39213_10037602 277
1785 3300002773 JGI25152J39213_1004211 JGI25152J39213_10042111 277
1786 3300003215 JGI25153J46596_10060883 JGI25153J46596_100608831 277
1787 3300003771 Ga0055526_1007156 Ga0055526_10071563 277
1788 3300003775 Ga0055524_1004687 Ga0055524_10046874 277
1789 3300003790 Ga0055528_1013610 Ga0055528_10136103 277
1790 3300005355 Ga0070671_100076097 Ga0070671_1000760973 277
1791 3300005457 Ga0070662_100246244 Ga0070662_1002462442 277
1792 3300006038 Ga0075365_10005402 Ga0075365_100054023 277
1793 3300006177 Ga0075362_10021642 Ga0075362_100216423 277
1794 3300006178 Ga0075367_10001099 Ga0075367_100010994 277
1795 3300009177 Ga0105248_10036988 Ga0105248_100369883 277
1796 3300009766 Ga0123342_1006529 Ga0123342_100652911 277
1797 3300025245 Ga0207425_1001496 Ga0207425_10014966 277
1798 3300025245 Ga0207425_1036123 Ga0207425_10361232 277
1799 3300025258 Ga0209129_1000939 Ga0209129_10009397 277
1800 3300025258 Ga0209129_1001103 Ga0209129_10011039 277
1801 3300025273 Ga0209673_1003109 Ga0209673_10031094 277
1802 3300025273 Ga0209673_1047577 Ga0209673_10475772 277
1803 3300025294 Ga0209025_1015850 Ga0209025_10158505 277
1804 3300025294 Ga0209025_1028708 Ga0209025_10287082 277
1805 3300025294 Ga0209025_1035421 Ga0209025_10354212 277
1806 3300025297 Ga0209758_1000749 Ga0209758_100074922 277
1807 3300025297 Ga0209758_1001310 Ga0209758_100131019 277
1808 3300025299 Ga0209256_1010879 Ga0209256_10108791 277
1809 3300025302 Ga0207426_1001731 Ga0207426_10017312 277
1810 3300025931 Ga0207644_10038112 Ga0207644_100381123 277
1811 3300025941 Ga0207711_10082775 Ga0207711_100827753 277
1812 3300026067 Ga0207678_10018602 Ga0207678_100186025 277
1813 3300041413 Ga0439465_0003539 Ga0439465_0003539_2039_2887 277
1814 3300046460 Ga0495638_0000145 Ga0495638_0000145_81203_82051 277
1815 3300046474 Ga0495605_0000715 Ga0495605_0000715_20743_21591 277
1816 3300046492 Ga0495585_0015627 Ga0495585_0015627_461_1309 277
1817 3300046506 Ga0495583_0061171 Ga0495583_0061171_486_1334 277
1818 3300046507 Ga0495606_0182851 Ga0495606_0182851_333_1181 277
1819 3300046512 Ga0495610_0052350 Ga0495610_0052350_562_1434 277
1820 3300046513 Ga0495616_0004639 Ga0495616_0004639_7451_8299 277
1821 3300046518 Ga0495631_0001131 Ga0495631_0001131_5899_6747 277
1822 3300046519 Ga0495632_0008869 Ga0495632_0008869_1279_2127 277
1823 3300046522 Ga0495643_0014754 Ga0495643_0014754_1733_2605 277
1824 3300046522 Ga0495643_0018816 Ga0495643_0018816_371_1219 277
1825 3300046524 Ga0495648_0149306 Ga0495648_0149306_33_881 277
1826 3300046616 Ga0495668_0043818 Ga0495668_0043818_427_1275 277
1827 3300046648 Ga0495611_0008325 Ga0495611_0008325_2267_3115 277
1828 3300046660 Ga0495625_0002190 Ga0495625_0002190_237_1085 277
1829 3300047320 Ga0495672_0006422 Ga0495672_0006422_7333_8181 277
1830 3300048920 Ga0496117_0119910 Ga0496117_0119910_95_955 277
1831 3300048924 Ga0496121_0025174 Ga0496121_0025174_4382_5254 277
1832 3300049569 Ga0501032_0046515 Ga0501032_0046515_246_1127 277
1833 3300049579 Ga0501043_0024816 Ga0501043_0024816_365_1246 277
1834 3300049583 Ga0501067_0050531 Ga0501067_0050531_802_1683 277
1835 3300050492 nmdc:mga0yw44_7216_c2 nmdc:mga0yw44_7216_c2_1205_2083 277
1836 3300053086 Ga0500578_0174366 Ga0500578_0174366_423_1271 277
1837 3300053109 Ga0500569_000857 Ga0500569_000857_3777_4625 277
1838 3300053118 Ga0500594_0000615 Ga0500594_0000615_3868_4716 277
1839 3300053130 Ga0500642_0158018 Ga0500642_0158018_137_985 277
1840 3300053139 Ga0500568_0000846 Ga0500568_0000846_215_1063 277
1841 3300053153 Ga0500616_0000917 Ga0500616_0000917_7116_7964 277
1842 3300053156 Ga0500622_0000425 Ga0500622_0000425_33205_34056 277
1843 3300053158 Ga0500627_0022426 Ga0500627_0022426_575_1423 277
1844 iso_pu_bacteria 2582581298 2585224356 277
1845 iso_pu_bacteria 2585427529 2585546477 277
1846 iso_pu_bacteria 2840764183 2840767676 277
1847 iso_pu_bacteria 3005445848 3005447531 277
1848 3300002773 JGI25152J39213_1000470 JGI25152J39213_100047011 278
1849 3300002773 JGI25152J39213_1000568 JGI25152J39213_100056811 278
1850 3300002774 JGI25150J39212_1000010 JGI25150J39212_1000010212 278
1851 3300003187 JGI25151J46595_10000026 JGI25151J46595_10000026192 278
1852 3300003215 JGI25153J46596_10001408 JGI25153J46596_100014088 278
1853 3300025245 Ga0207425_1000010 Ga0207425_1000010539 278
1854 3300025258 Ga0209129_1000197 Ga0209129_100019744 278
1855 3300025273 Ga0209673_1010825 Ga0209673_10108252 278
1856 3300025294 Ga0209025_1000022 Ga0209025_100002244 278
1857 3300025297 Ga0209758_1000086 Ga0209758_1000086215 278
1858 3300031731 Ga0307405_10005745 Ga0307405_100057455 278
1859 3300031911 Ga0307412_10000449 Ga0307412_1000044915 278
1860 3300031995 Ga0307409_100382880 Ga0307409_1003828802 278
1861 3300046506 Ga0495583_0004528 Ga0495583_0004528_4450_5298 278
1862 3300046507 Ga0495606_0001788 Ga0495606_0001788_8572_9447 278
1863 3300046512 Ga0495610_0003504 Ga0495610_0003504_5471_6319 278
1864 3300046660 Ga0495625_0237881 Ga0495625_0237881_223_1071 278
1865 3300046674 Ga0495588_0241404 Ga0495588_0241404_79_927 278
1866 3300047472 Ga0495686_0044364 Ga0495686_0044364_1685_2533 278
1867 3300048090 Ga0495615_0073354 Ga0495615_0073354_29_877 278
1868 3300048904 Ga0496101_0117487 Ga0496101_0117487_49_897 278
1869 3300048909 Ga0496106_0000125 Ga0496106_0000125_40770_41654 278
1870 3300048919 Ga0496116_0003130 Ga0496116_0003130_12977_13825 278
1871 3300048919 Ga0496116_0009520 Ga0496116_0009520_1373_2221 278
1872 3300048919 Ga0496116_0018287 Ga0496116_0018287_3393_4241 278
1873 3300048920 Ga0496117_0016796 Ga0496117_0016796_1028_1876 278
1874 3300048921 Ga0496118_0016459 Ga0496118_0016459_61_909 278
1875 3300048921 Ga0496118_0025089 Ga0496118_0025089_4242_5090 278
1876 3300048924 Ga0496121_0049492 Ga0496121_0049492_245_1120 278
1877 3300048925 Ga0496122_0021071 Ga0496122_0021071_925_1773 278
1878 3300048925 Ga0496122_0039541 Ga0496122_0039541_1710_2558 278
1879 3300048926 Ga0496123_0016379 Ga0496123_0016379_2131_2979 278
1880 3300048926 Ga0496123_0041233 Ga0496123_0041233_1415_2263 278
1881 3300048927 Ga0496124_0002623 Ga0496124_0002623_20173_21021 278
1882 3300048927 Ga0496124_0004853 Ga0496124_0004853_4300_5148 278
1883 3300048928 Ga0496125_0017863 Ga0496125_0017863_4413_5261 278
1884 3300049459 Ga0495678_027150 Ga0495678_027150_1484_2332 278
1885 3300053125 Ga0500618_004461 Ga0500618_004461_1294_2142 278
1886 3300053139 Ga0500568_0002227 Ga0500568_0002227_366_1250 278
1887 iso_pu_bacteria 2510917030 2511200318 278
1888 3300006186 Ga0075369_10004127 Ga0075369_100041275 280
1889 3300048921 Ga0496118_0004791 Ga0496118_0004791_5612_6502 280
1890 3300048925 Ga0496122_0010790 Ga0496122_0010790_7266_8156 280
1891 3300048926 Ga0496123_0010385 Ga0496123_0010385_3820_4710 280
1892 3300048927 Ga0496124_0028283 Ga0496124_0028283_111_1001 280
1893 iso_pu_bacteria 2842922631 2842923880 280
1894 iso_pu_bacteria 2919100787 2919106649 280
1895 iso_pu_bacteria 8046767195 8046773766 280
1896 iso_pu_bacteria 2585427608 2585897965 282
1897 iso_pu_bacteria 2510917022 2511135139 283
1898 iso_pu_bacteria 2524023209 2524460255 283
1899 iso_pu_bacteria 2582581307 2585270879 283
1900 iso_pu_bacteria 2582581308 2585277226 283
1901 iso_pu_bacteria 2582581315 2585323765 283
1902 iso_pu_bacteria 2582581316 2585331744 283
1903 iso_pu_bacteria 2585427527 2585534038 283
1904 iso_pu_bacteria 2585427530 2585552111 283
1905 iso_pu_bacteria 2585427531 2585558603 283
1906 iso_pu_bacteria 2585427609 2585904428 283
1907 iso_pu_bacteria 2585428125 2587980455 283
1908 iso_pu_bacteria 2615840626 2616308604 283
1909 iso_pu_bacteria 2615840698 2616557091 283
1910 iso_pu_bacteria 2617270742 2617385643 283
1911 iso_pu_bacteria 2667528174 2671111692 283
1912 iso_pu_bacteria 2775507266 2778174042 283
1913 iso_pu_bacteria 2818991448 2819612772 283
1914 iso_pu_bacteria 2818991453 2819637885 283
1915 iso_pu_bacteria 2838029111 2838030066 283
1916 iso_pu_bacteria 2842475841 2842476649 283
1917 iso_pu_bacteria 2842502639 2842503594 283
1918 iso_pu_bacteria 2842509118 2842511410 283
1919 iso_pu_bacteria 2919408235 2919411664 283
1920 iso_pu_bacteria 3005416602 3005420081 283
1921 iso_pu_bacteria 8005314921 8005317032 283
1922 iso_pu_bacteria 8005484373 8005485173 283
1923 iso_pu_bacteria 8005645114 8005645336 283
1924 iso_pu_bacteria 8005682033 8005683163 283
1925 iso_pu_bacteria 8024486573 8024492240 283
1926 iso_pu_bacteria 8057575449 8057576859 283
1927 3300048903 Ga0496100_0210136 Ga0496100_0210136_494_1363 286
1928 3300001979 JGI24740J21852_10000166 JGI24740J21852_1000016614 287
1929 3300002704 JGI25155J39150_1000001 JGI25155J39150_100000141 287
1930 3300002705 JGI25156J39149_1000001 JGI25156J39149_1000001291 287
1931 3300002737 JGI25162J39368_1000331 JGI25162J39368_100033123 287
1932 3300002737 JGI25162J39368_1001207 JGI25162J39368_10012072 287
1933 3300002738 JGI25154J39366_1000011 JGI25154J39366_100001192 287
1934 3300002738 JGI25154J39366_1007551 JGI25154J39366_10075512 287
1935 3300002741 JGI25157J39369_1000030 JGI25157J39369_100003093 287
1936 3300002987 JGI25159J45721_1000410 JGI25159J45721_100041012 287
1937 3300003214 JGI25165J46597_1000449 JGI25165J46597_100044923 287
1938 3300003316 rootH1_10066326 rootH1_100663261 287
1939 3300003320 rootH2_10116711 rootH2_101167115 287
1940 3300003322 rootL2_10046034 rootL2_100460344 287
1941 3300003323 rootH1_10128595 rootH1_101285952 287
1942 3300003354 JGI25160J50197_1000010 JGI25160J50197_100001078 287
1943 3300003374 JGI25161J50226_1000006 JGI25161J50226_100000678 287
1944 3300004625 Ga0055543_1000171 Ga0055543_100017111 287
1945 3300005262 Ga0065165_1000485 Ga0065165_100048543 287
1946 3300005563 Ga0068855_100412190 Ga0068855_1004121902 287
1947 3300005614 Ga0068856_100188014 Ga0068856_1001880142 287
1948 3300009093 Ga0105240_10000005 Ga0105240_10000005619 287
1949 3300009545 Ga0105237_10005428 Ga0105237_100054289 287
1950 3300009545 Ga0105237_10444322 Ga0105237_104443222 287
1951 3300010375 Ga0105239_10129746 Ga0105239_101297463 287
1952 3300013104 Ga0157370_10001194 Ga0157370_100011947 287
1953 3300013105 Ga0157369_10187868 Ga0157369_101878682 287
1954 3300014497 Ga0182008_10095506 Ga0182008_100955061 287
1955 3300015262 Ga0182007_10001955 Ga0182007_100019555 287
1956 3300015265 Ga0182005_1002400 Ga0182005_10024004 287
1957 3300025206 Ga0209435_100012 Ga0209435_10001291 287
1958 3300025207 Ga0209760_102779 Ga0209760_1027792 287
1959 3300025233 Ga0209437_100047 Ga0209437_100047203 287
1960 3300025233 Ga0209437_100165 Ga0209437_100165106 287
1961 3300025246 Ga0209646_1000026 Ga0209646_100002691 287
1962 3300025246 Ga0209646_1004022 Ga0209646_10040222 287
1963 3300025250 Ga0209026_1000014 Ga0209026_100001491 287
1964 3300025253 Ga0209677_101402 Ga0209677_1014024 287
1965 3300025256 Ga0209759_1000012 Ga0209759_100001291 287
1966 3300025261 Ga0209233_1000048 Ga0209233_1000048199 287
1967 3300025261 Ga0209233_1000069 Ga0209233_1000069236 287
1968 3300025261 Ga0209233_1000195 Ga0209233_100019536 287
1969 3300025284 Ga0209130_1000021 Ga0209130_1000021189 287
1970 3300025302 Ga0207426_1000010 Ga0207426_1000010169 287
1971 3300025913 Ga0207695_10000011 Ga0207695_10000011299 287
1972 3300025914 Ga0207671_10000804 Ga0207671_1000080415 287
1973 3300025949 Ga0207667_10368231 Ga0207667_103682312 287
1974 3300026078 Ga0207702_10152250 Ga0207702_101522502 287
1975 3300027312 Ga0209371_1005448 Ga0209371_10054484 287
1976 3300030500 Ga0268256_1005356 Ga0268256_10053563 287
1977 3300044694 Ga0466963_0206435 Ga0466963_0206435_389_1252 287
1978 3300044765 Ga0466970_0003056 Ga0466970_0003056_2893_3756 287
1979 3300046454 Ga0495592_0191825 Ga0495592_0191825_278_1156 287
1980 3300046459 Ga0495629_0011315 Ga0495629_0011315_5285_6163 287
1981 3300046462 Ga0495651_0128903 Ga0495651_0128903_472_1350 287
1982 3300046507 Ga0495606_0218901 Ga0495606_0218901_53_931 287
1983 3300046557 Ga0495622_0069319 Ga0495622_0069319_501_1379 287
1984 3300046663 Ga0495635_0063779 Ga0495635_0063779_1045_1923 287
1985 3300047317 Ga0495604_0024912 Ga0495604_0024912_2814_3713 287
1986 3300047472 Ga0495686_0000761 Ga0495686_0000761_13350_14228 287
1987 3300047472 Ga0495686_0035591 Ga0495686_0035591_1769_2641 287
1988 3300048920 Ga0496117_0155074 Ga0496117_0155074_23_895 287
1989 3300048921 Ga0496118_0008798 Ga0496118_0008798_6102_6974 287
1990 3300048923 Ga0496120_0015555 Ga0496120_0015555_1518_2390 287
1991 3300048924 Ga0496121_0003355 Ga0496121_0003355_16051_16923 287
1992 3300048925 Ga0496122_0008019 Ga0496122_0008019_10039_10902 287
1993 3300048927 Ga0496124_0100308 Ga0496124_0100308_694_1557 287
1994 3300048929 Ga0496126_0108949 Ga0496126_0108949_591_1463 287

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

33

181

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
7ch8-assembly1.cif.gz_J cryo-em structure of p.aeruginosa mlafebd with adp-v 0.9677 19 259
7ch8-assembly1.cif.gz_I cryo-em structure of p.aeruginosa mlafebd with adp-v 0.9657 19 259
8fee-assembly1.cif.gz_H structure of mce1 transporter from mycobacterium smegmatis in the absence of lucb (map2) 0.9522 19 259
3tuj-assembly1.cif.gz_C inward facing conformations of the metni methionine abc transporter: dm crystal form 0.9411 20 258
2pcj-assembly1.cif.gz_B crystal structure of abc transporter (aq_297) from aquifex aeolicus vf5 0.9383 19 241
ID Description Score Start End Superfamily
af_P9WQL5_26_341_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9702 21 256 3.40.50.300
af_P63386_5_251_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.959 19 260 3.40.50.300
af_P33360_1_239_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9515 21 257 3.40.50.300
af_Q2G1F8_275_530_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.947 19 259 3.40.50.300
af_P75957_1_229_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9417 17 236 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A522AFW5-F1-model_v4 ATP-binding cassette domain-containing protein 0.9822 17 267 GO:0005524
GO:0016887
AF-A0A355T0Z8-F1-model_v4 ABC transporter ATP-binding protein 0.9718 17 165 GO:0005524
GO:0016887
AF-A0A522AFW5-F1-model_v4 ATP-binding cassette domain-containing protein 0.9707 17 267 GO:0005524
GO:0016887
AF-A0A831UKK4-F1-model_v4 ATP-binding cassette domain-containing protein 0.968 19 180 GO:0005524
GO:0016887
AF-A0A096ZN85-F1-model_v4 Invasion associated marker 0.9675 37 188 GO:0005524
GO:0016887

Feature Viewer

pLDDT pTM Quality
85.89 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map