F496219
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1994 | 1328 | 1098 | 270 |
Family's Representative Sequence
| Representative Sequence | 3300049571|Ga0501034_0060256|Ga0501034_0060256_503_1333 |
| Length | 276 |
| Sequence | MAMNGNGKSNGAQSDVIIGVRDLVVGFGAANVLDHLDLDVYRGEILGFVGASGAGKSVLMRTIIGLLPRRAGEITVLGVELSKATEKERRAVERRWGVLFQHGALFSSLTVAENIQFPMREYLKLSQQLMDEIAVAKLEMVGLDPSVRGKYPSELSGGMIKRLARALALDPDILFLDEPTSGLDPIGAGDFDELIATMQRTLGLTVFMVTHDLDSLHTVCDRIAVLAEGKVIAAGTMDVMLASQHPWLKAYFHGKRARAVGAAASGQTAGAIAPGR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2503198000 | Mesorhizobium opportunistum WSM2075 | Isolate | Nodule |
| 2 | 2508501122 | Ensifer yinggardensis WSM1721 | Isolate | Nodule |
| 3 | 2508501123 | Mesorhizobium sp. WSM3626 | Isolate | Nodule |
| 4 | 2508501127 | Mesorhizobium sp. WSM2561 | Isolate | Nodule |
| 5 | 2509276018 | Mesorhizobium ciceri CMG6 | Isolate | Nodule |
| 6 | 2509276019 | Ensifer aridi TW10 | Isolate | Nodule |
| 7 | 2509276021 | Rhizobium leguminosarum bv. trifolii WSM597 | Isolate | Nodule |
| 8 | 2509276022 | Mesorhizobium australicum WSM2073 | Isolate | Nodule |
| 9 | 2509276033 | Rhizobium leguminosarum bv. trifolii WSM2012 | Isolate | Nodule |
| 10 | 2510065019 | Rhizobium leguminosarum bv. trifolii WSM1689 | Isolate | Nodule |
| 11 | 2510065057 | Sinorhizobium meliloti WSM1022 | Isolate | Nodule |
| 12 | 2510065059 | Mesorhizobium ciceri WSM4083 | Isolate | Nodule |
| 13 | 2510461069 | Rhizobium sp. PDO1-076 | Isolate | Rhizosphere |
| 14 | 2510461076 | Rhizobium leguminosarum bv. trifolii TA1 | Isolate | Nodule |
| 15 | 2510917022 | Rhizobium sp. AP16 | Isolate | Rhizosphere |
| 16 | 2510917026 | Rhizobium sp. CF80 | Isolate | Rhizosphere |
| 17 | 2510917028 | Rhizobium sp. CF122 | Isolate | Rhizosphere |
| 18 | 2510917030 | Rhizobium sp. CF142 | Isolate | Rhizosphere |
| 19 | 2511231052 | Sinorhizobium meliloti AK58 | Isolate | Nodule |
| 20 | 2512047086 | Sinorhizobium arboris LMG 14919 | Isolate | Nodule |
| 21 | 2512875016 | Mesorhizobium japonicum R7A | Isolate | Nodule |
| 22 | 2512875024 | Mesorhizobium loti R88b | Isolate | Nodule |
| 23 | 2512875026 | Sinorhizobium medicae WSM1115 | Isolate | Nodule |
| 24 | 2513237084 | Rhizobium leguminosarum bv. viciae UPM1131 | Isolate | Nodule |
| 25 | 2513237085 | Rhizobium leguminosarum bv. viciae UPM1137 | Isolate | Nodule |
| 26 | 2513237086 | Sinorhizobium meliloti MVII-I | Isolate | Nodule |
| 27 | 2513237088 | Rhizobium mesoamericanum STM6155 | Isolate | Nodule |
| 28 | 2513237089 | Sinorhizobium medicae DI28 | Isolate | Nodule |
| 29 | 2513237090 | Mesorhizobium sp. WSM3224 | Isolate | Nodule |
| 30 | 2513237091 | Sinorhizobium meliloti RRI128 | Isolate | Nodule |
| 31 | 2513237093 | Rhizobium leguminosarum bv. phaseoli FA23 | Isolate | Nodule |
| 32 | 2513237103 | Rhizobium leguminosarum bv. viciae VF39 | Isolate | Nodule |
| 33 | 2513237138 | Rhizobium favelukesii OR191 | Isolate | Nodule |
| 34 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 35 | 2513237140 | Sinorhizobium meliloti GVPV12 | Isolate | Nodule |
| 36 | 2513237143 | Sinorhizobium meliloti Mlalz-1 | Isolate | Nodule |
| 37 | 2513237144 | Rhizobium sullae WSM1592 | Isolate | Nodule |
| 38 | 2513237146 | Rhizobium mongolense USDA 1844 (Illumina) | Isolate | Nodule |
| 39 | 2513237156 | Sinorhizobium medicae WSM1369 | Isolate | Nodule |
| 40 | 2513237159 | Rhizobium giardinii bv. giardinii H152 | Isolate | Nodule |
| 41 | 2513237160 | Sinorhizobium medicae WSM244 | Isolate | Nodule |
| 42 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 43 | 2513237162 | Rhizobium ruizarguesonis GB30 | Isolate | Nodule |
| 44 | 2513237164 | Mesorhizobium loti CJ3sym | Isolate | Nodule |
| 45 | 2513237305 | Mesorhizobium amorphae CCNWGS0123 | Isolate | Nodule |
| 46 | 2513237351 | Mesorhizobium alhagi CCNWXJ12-2 | Isolate | Nodule |
| 47 | 2515075009 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 48 | 2515154107 | Sinorhizobium meliloti 4H41 | Isolate | Nodule |
| 49 | 2515154113 | Rhizobium ruizarguesonis Vc2 | Isolate | Nodule |
| 50 | 2515154114 | Rhizobium ruizarguesonis Vh3 | Isolate | Nodule |
| 51 | 2515154116 | Rhizobium ruizarguesonis Ps8 | Isolate | Nodule |
| 52 | 2515154134 | Rhizobium gallicum bv. gallicum R602sp | Isolate | Nodule |
| 53 | 2516143018 | Ensifer sp. BR816 | Isolate | Nodule |
| 54 | 2516653046 | Sinorhizobium meliloti BO21CC | Isolate | Nodule |
| 55 | 2516653077 | Rhizobium acaciae WSM1481 | Isolate | Nodule |
| 56 | 2516653085 | Rhizobium leguminosarum bv. phaseoli 4292 | Isolate | Nodule |
| 57 | 2517093000 | Rhizobium leguminosarum bv. trifolii SRDI943 | Isolate | Nodule |
| 58 | 2517287029 | Rhizobium leguminosarum bv. trifolii SRDI565 | Isolate | Nodule |
| 59 | 2517487022 | Sinorhizobium medicae WSM4191 | Isolate | Nodule |
| 60 | 2519899620 | Rhizobium sp. Pop5 | Isolate | Nodule |
| 61 | 2524023207 | Ensifer sp. USDA 6670 | Isolate | Nodule |
| 62 | 2524023209 | Rhizobium leucaenae USDA 9039 | Isolate | Nodule |
| 63 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 64 | 2529292951 | Rhizobium sp. CCGE 510 | Isolate | Nodule |
| 65 | 2534681796 | Rhizobium grahamii CCGE 502 | Isolate | Nodule |
| 66 | 2537561587 | Agrobacterium tumefaciens Cherry 2E-2-2 | Isolate | Rhizosphere |
| 67 | 2551306084 | Sinorhizobium meliloti 5A14 | Isolate | Nodule |
| 68 | 2551306085 | Sinorhizobium meliloti AE608H | Isolate | Nodule |
| 69 | 2551306086 | Sinorhizobium meliloti AK11 | Isolate | Nodule |
| 70 | 2551306087 | Sinorhizobium meliloti A0643DD | Isolate | Nodule |
| 71 | 2551306089 | Sinorhizobium meliloti 1A42 | Isolate | Nodule |
| 72 | 2551306090 | Sinorhizobium meliloti A0641M | Isolate | Nodule |
| 73 | 2551306091 | Sinorhizobium meliloti C0431A | Isolate | Nodule |
| 74 | 2551306092 | Sinorhizobium meliloti AK75 | Isolate | Nodule |
| 75 | 2551306093 | Sinorhizobium meliloti C0438LL | Isolate | Nodule |
| 76 | 2554235003 | Agrobacterium tumefaciens WRT31 | Isolate | Rhizosphere |
| 77 | 2558860100 | Sinorhizobium sp. PC2 | Isolate | Nodule |
| 78 | 2558860242 | Agrobacterium fabacearum P4 | Isolate | Rhizosphere |
| 79 | 2558860983 | Allorhizobium undicola ATCC 700741 | Isolate | Rhizoplane |
| 80 | 2582581283 | Rhizobium sp. OK665 | Isolate | Rhizosphere |
| 81 | 2582581294 | Rhizobium sp. CF394 | Isolate | Rhizosphere |
| 82 | 2582581298 | Rhizobium alamii YR540 | Isolate | Rhizosphere |
| 83 | 2582581299 | Rhizobium leguminosarum OV483 | Isolate | Rhizosphere |
| 84 | 2582581304 | Rhizobium sp. YR519 | Isolate | Rhizosphere |
| 85 | 2582581306 | Rhizobium sp. YR295 | Isolate | Rhizosphere |
| 86 | 2582581307 | Rhizobium sp. YR060 | Isolate | Rhizosphere |
| 87 | 2582581308 | Rhizobium sp. OK494 | Isolate | Rhizosphere |
| 88 | 2582581315 | Agrobacterium rhizogenes YR147 | Isolate | Rhizosphere |
| 89 | 2582581316 | Agrobacterium rhizogenes OK036 | Isolate | Rhizosphere |
| 90 | 2582581865 | Rhizobium sp. CF258 | Isolate | Rhizosphere |
| 91 | 2582581866 | Rhizobium sp. CF097 | Isolate | Rhizosphere |
| 92 | 2582581867 | Rhizobium sp. OV201 | Isolate | Rhizosphere |
| 93 | 2585427526 | Rhizobium leguminosarum OV152 | Isolate | Rhizosphere |
| 94 | 2585427527 | Rhizobium lusitanum YR374 | Isolate | Rhizosphere |
| 95 | 2585427528 | Rhizobium leguminosarum CF307 | Isolate | Rhizosphere |
| 96 | 2585427529 | Rhizobium alamii YR584 | Isolate | Rhizosphere |
| 97 | 2585427530 | Rhizobium tropici YR635 | Isolate | Rhizosphere |
| 98 | 2585427531 | Agrobacterium rhizogenes YR530 | Isolate | Rhizosphere |
| 99 | 2585427590 | Rhizobium sp. CF048 | Isolate | Rhizosphere |
| 100 | 2585427593 | Rhizobium tropici CF286 | Isolate | Rhizosphere |
| 101 | 2585427594 | Rhizobium sp. YR528 | Isolate | Rhizosphere |
| 102 | 2585427608 | Agrobacterium rhizogenes OV677 | Isolate | Rhizosphere |
| 103 | 2585427609 | Agrobacterium rhizogenes CF263 | Isolate | Rhizosphere |
| 104 | 2585427633 | Neorhizobium galegae bv. officinalis HAMBI 1141 | Isolate | Nodule |
| 105 | 2585427634 | Neorhizobium galegae bv. orientalis HAMBI 540 | Isolate | Nodule |
| 106 | 2585428125 | Agrobacterium rhizogenes CF262 | Isolate | Rhizosphere |
| 107 | 2588253730 | Mesorhizobium huakuii 7653R | Isolate | Rhizosphere |
| 108 | 2597489875 | Mesorhizobium ciceri ca181 | Isolate | Unclassified |
| 109 | 2599185170 | Rhizobium mongolense USDA 1844 (PacBio) | Isolate | Nodule |
| 110 | 2599185210 | Rhizobium sp. NFACC06-2 | Isolate | Rhizoplane |
| 111 | 2599185236 | Rhizobium sp. NFR07 | Isolate | Rhizoplane |
| 112 | 2599185301 | Mesorhizobium sp. NFR06 | Isolate | Rhizoplane |
| 113 | 2599185352 | Sinorhizobium sp. NFACC03 | Isolate | Rhizoplane |
| 114 | 2600254933 | Rhizobium sp. NFR12 | Isolate | Rhizoplane |
| 115 | 2600255279 | Rhizobium sp. NFIX01 | Isolate | Rhizoplane |
| 116 | 2600255308 | Rhizobium sp. NFIX02 | Isolate | Rhizoplane |
| 117 | 2615840624 | Rhizobium aethiopicum HBR26 | Isolate | Nodule |
| 118 | 2615840626 | Rhizobium lusitanum P1-7 | Isolate | Nodule |
| 119 | 2615840698 | Rhizobium multihospitium HAMBI 2975 | Isolate | Nodule |
| 120 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 121 | 2617270742 | Rhizobium miluonense HAMBI 2971 | Isolate | Nodule |
| 122 | 2643221550 | Mesorhizobium sp. Root552 | Isolate | Unclassified |
| 123 | 2643221551 | Mesorhizobium sp. Root1471 | Isolate | Unclassified |
| 124 | 2643221555 | Mesorhizobium sp. Root554 | Isolate | Unclassified |
| 125 | 2643221557 | Ensifer sp. Root558 | Isolate | Unclassified |
| 126 | 2643221558 | Rhizobium sp. Root149 | Isolate | Unclassified |
| 127 | 2643221564 | Mesorhizobium sp. Root157 | Isolate | Unclassified |
| 128 | 2643221568 | Rhizobium sp. Root564 | Isolate | Unclassified |
| 129 | 2643221582 | Rhizobium sp. Root651 | Isolate | Unclassified |
| 130 | 2643221595 | Mesorhizobium sp. Root695 | Isolate | Unclassified |
| 131 | 2643221599 | Rhizobium sp. Root708 | Isolate | Unclassified |
| 132 | 2643221607 | Rhizobium sp. Root73 | Isolate | Unclassified |
| 133 | 2643221610 | Ensifer sp. Root74 | Isolate | Unclassified |
| 134 | 2643221618 | Ensifer sp. Root231 | Isolate | Unclassified |
| 135 | 2643221623 | Aminobacter sp. DSM 101952 Root100 | Isolate | Unclassified |
| 136 | 2643221626 | Ensifer sp. Root31 | Isolate | Unclassified |
| 137 | 2643221627 | Mesorhizobium sp. Root102 | Isolate | Unclassified |
| 138 | 2643221634 | Rhizobium sp. Root1203 | Isolate | Unclassified |
| 139 | 2643221636 | Rhizobium sp. Root1204 | Isolate | Unclassified |
| 140 | 2643221637 | Rhizobium sp. Root1212 | Isolate | Unclassified |
| 141 | 2643221643 | Rhizobium sp. Root1220 | Isolate | Unclassified |
| 142 | 2643221651 | Afipia sp. Root123D2 | Isolate | Unclassified |
| 143 | 2643221653 | Rhizobium sp. Root1240 | Isolate | Unclassified |
| 144 | 2643221655 | Ensifer sp. Root1252 | Isolate | Unclassified |
| 145 | 2643221659 | Ensifer sp. Root127 | Isolate | Unclassified |
| 146 | 2643221668 | Ensifer sp. Root423 | Isolate | Unclassified |
| 147 | 2643221675 | Ensifer sp. Root1298 | Isolate | Unclassified |
| 148 | 2643221680 | Ensifer sp. Root1312 | Isolate | Unclassified |
| 149 | 2643221686 | Rhizobium sp. Root1334 | Isolate | Unclassified |
| 150 | 2643221688 | Rhizobium sp. Root482 | Isolate | Unclassified |
| 151 | 2643221689 | Rhizobium sp. Root483D2 | Isolate | Unclassified |
| 152 | 2643221693 | Rhizobium sp. Root491 | Isolate | Unclassified |
| 153 | 2643221698 | Ensifer sp. Root142 | Isolate | Unclassified |
| 154 | 2643221712 | Ensifer sp. Root258 | Isolate | Unclassified |
| 155 | 2643221718 | Rhizobium sp. Root268 | Isolate | Unclassified |
| 156 | 2643221719 | Rhizobium sp. Root274 | Isolate | Unclassified |
| 157 | 2643221723 | Ensifer sp. Root278 | Isolate | Unclassified |
| 158 | 2643221726 | Ensifer sp. Root954 | Isolate | Unclassified |
| 159 | 2657244999 | Sinorhizobium sojae CCBAU 05684 | Isolate | Unclassified |
| 160 | 2667528174 | Rhizobium sp. NFR17 | Isolate | Rhizoplane |
| 161 | 2687453392 | Mesorhizobium ciceri biserrulae WSM1284 | Isolate | Unclassified |
| 162 | 2690316117 | Sinorhizobium fredii CCBAU 45436 | Isolate | Unclassified |
| 163 | 2693429783 | Mesorhizobium sp. LCM 4577 | Isolate | Rhizosphere |
| 164 | 2693429784 | Mesorhizobium sp. LCM 4576 | Isolate | Rhizosphere |
| 165 | 2718217882 | Rhizobium sp. N741 | Isolate | Nodule |
| 166 | 2718217927 | Rhizobium sp. N324 | Isolate | Nodule |
| 167 | 2718217997 | Rhizobium phaseoli sv. phaseoli R723 | Isolate | Nodule |
| 168 | 2718218009 | Rhizobium sp. N561 | Isolate | Nodule |
| 169 | 2718218199 | Rhizobium phaseoli sv. phaseoli N261 | Isolate | Nodule |
| 170 | 2718218232 | Rhizobium phaseoli sv. phaseoli N161 | Isolate | Nodule |
| 171 | 2718218233 | Rhizobium phaseoli sv. phaseoli R744 | Isolate | Nodule |
| 172 | 2718218235 | Rhizobium phaseoli sv. phaseoli R620 | Isolate | Nodule |
| 173 | 2718218269 | Rhizobium phaseoli sv. phaseoli N671 | Isolate | Nodule |
| 174 | 2718218363 | Rhizobium sp. N113 | Isolate | Nodule |
| 175 | 2718218365 | Rhizobium sp. N731 | Isolate | Nodule |
| 176 | 2718218366 | Rhizobium sp. N621 | Isolate | Nodule |
| 177 | 2718218423 | Rhizobium sp. N941 | Isolate | Nodule |
| 178 | 2721755514 | Rhizobium sp. N6212 | Isolate | Nodule |
| 179 | 2721755556 | Rhizobium phaseoli sv. phaseoli N931 | Isolate | Nodule |
| 180 | 2721755684 | Rhizobium phaseoli sv. phaseoli N841 | Isolate | Nodule |
| 181 | 2721755685 | Rhizobium phaseoli sv. phaseoli R611 | Isolate | Nodule |
| 182 | 2721755686 | Mesorhizobium amorphae CCNWGS0123 | Isolate | Nodule |
| 183 | 2721755809 | Rhizobium sp. N541 | Isolate | Nodule |
| 184 | 2721755810 | Rhizobium sp. N871 | Isolate | Nodule |
| 185 | 2721755819 | Rhizobium phaseoli sv. phaseoli N771 | Isolate | Nodule |
| 186 | 2721755822 | Rhizobium phaseoli sv. phaseoli R650 | Isolate | Nodule |
| 187 | 2721755823 | Rhizobium phaseoli sv. phaseoli R630 | Isolate | Nodule |
| 188 | 2724679232 | Rhizobium leguminosarum Vaf12 | Isolate | Unclassified |
| 189 | 2728369352 | Rhizobium phaseoli sv. phaseoli N831 | Isolate | Nodule |
| 190 | 2728369365 | Rhizobium sp. N1341 | Isolate | Nodule |
| 191 | 2728369397 | Rhizobium sp. N1314 | Isolate | Nodule |
| 192 | 2738541293 | Rhizobium sp. GV031 | Isolate | Unclassified |
| 193 | 2738541317 | Rhizobium halophytocola DSM 21600 | Isolate | Unclassified |
| 194 | 2738541333 | Rhizobium sophoriradicis CCBAU 03470 | Isolate | Unclassified |
| 195 | 2738543024 | Aminobacter sp. AP02 | Isolate | Unclassified |
| 196 | 2751185821 | Ensifer shofinae CCBAU 251167 | Isolate | Unclassified |
| 197 | 2756170246 | Mesorhizobium loti DSM 2626 | Isolate | Nodule |
| 198 | 2757320392 | Phyllobacterium leguminum ORS 1419 | Isolate | Nodule |
| 199 | 2765235802 | Phyllobacterium bourgognense 31-25a | Isolate | Rhizoplane |
| 200 | 2765235942 | Rhizobium sp. WYCCWR10014 | Isolate | Nodule |
| 201 | 2767802442 | Phyllobacterium brassicacearum 29-15 | Isolate | Rhizoplane |
| 202 | 2775506902 | Phyllobacterium zundukense Tri-48 | Isolate | Unclassified |
| 203 | 2775506904 | Phyllobacterium zundukense Tri-38 | Isolate | Unclassified |
| 204 | 2775507049 | Rhizobium sp. ACO-34A | Isolate | Unclassified |
| 205 | 2775507266 | Rhizobium tropici PRF 81 | Isolate | Nodule |
| 206 | 2791355082 | Ensifer alkalisoli YIC4027 | Isolate | Nodule |
| 207 | 2791355091 | Sinorhizobium sp. FG01 | Isolate | Nodule |
| 208 | 2791355092 | Sinorhizobium sp. NG07B | Isolate | Nodule |
| 209 | 2791355094 | Sinorhizobium sp. BJ1 | Isolate | Nodule |
| 210 | 2791355123 | Mesorhizobium sophorae ICMP 19535 | Isolate | Unclassified |
| 211 | 2791355253 | Rhizobium rhizosphaerae RD15 | Isolate | Rhizosphere |
| 212 | 2791355256 | Rhizobium sp. M10 | Isolate | Nodule |
| 213 | 2791355259 | Rhizobium hidalgonense FH14 | Isolate | Nodule |
| 214 | 2791355260 | Rhizobium sp. L9 | Isolate | Nodule |
| 215 | 2791355261 | Rhizobium sp. J15 | Isolate | Nodule |
| 216 | 2791355262 | Rhizobium sp. M1 | Isolate | Nodule |
| 217 | 2791355263 | Rhizobium chutanense C5 | Isolate | Nodule |
| 218 | 2791355264 | Rhizobium sp. S9 | Isolate | Nodule |
| 219 | 2791355265 | Rhizobium sp. H4 | Isolate | Nodule |
| 220 | 2791355266 | Rhizobium sp. L43 | Isolate | Nodule |
| 221 | 2791355267 | Rhizobium sp. L18 | Isolate | Nodule |
| 222 | 2802428858 | Sinorhizobium medicae M14-1 | Isolate | Nodule |
| 223 | 2802428859 | Sinorhizobium medicae SF3.41 | Isolate | Nodule |
| 224 | 2802428860 | Sinorhizobium medicae M19-1 | Isolate | Nodule |
| 225 | 2802428861 | Sinorhizobium medicae USDA1037 | Isolate | Nodule |
| 226 | 2802428862 | Sinorhizobium medicae M7-4 | Isolate | Nodule |
| 227 | 2802428863 | Sinorhizobium medicae M26-2 | Isolate | Nodule |
| 228 | 2802429268 | Sinorhizobium sojae CCBAU 05684 | Isolate | Unclassified |
| 229 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 230 | 2802429605 | Rhizobium sophoriradicis L101 | Isolate | Nodule |
| 231 | 2802429606 | Rhizobium sophoriradicis JJW1 | Isolate | Nodule |
| 232 | 2802429633 | Rhizobium anhuiense J3 | Isolate | Nodule |
| 233 | 2802429634 | Rhizobium anhuiense S10 | Isolate | Nodule |
| 234 | 2802429635 | Rhizobium anhuiense Y27 | Isolate | Nodule |
| 235 | 2802429636 | Rhizobium anhuiense JX3 | Isolate | Nodule |
| 236 | 2802429637 | Rhizobium anhuiense C15 | Isolate | Nodule |
| 237 | 2808606387 | Rhizobium sp. SJZ105 | Isolate | Rhizosphere |
| 238 | 2818991272 | Rhizobium sp. SLBN-4 | Isolate | Unclassified |
| 239 | 2818991439 | Agrobacterium tumefaciens 1187 | Isolate | Unclassified |
| 240 | 2818991448 | Rhizobium miluonense 1234 | Isolate | Unclassified |
| 241 | 2818991453 | Rhizobium lusitanum 1158 | Isolate | Unclassified |
| 242 | 2818991461 | Neorhizobium alkalisoli 1225 | Isolate | Unclassified |
| 243 | 2821123053 | Rhizobium cellulosilyticum 1193 | Isolate | Unclassified |
| 244 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 245 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 246 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 247 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 248 | 2838016132 | Rhizobium phaseoli SEMIA 4071 | Isolate | Nodule |
| 249 | 2838022645 | Rhizobium aethiopicum SEMIA 4074 | Isolate | Nodule |
| 250 | 2838029111 | Rhizobium tropici SEMIA 4079 | Isolate | Nodule |
| 251 | 2838035591 | Rhizobium mongolense SEMIA 4087 | Isolate | Nodule |
| 252 | 2838042994 | Rhizobium esperanzae SEMIA 4089 | Isolate | Nodule |
| 253 | 2838048938 | Rhizobium pisi 27/80 | Isolate | Nodule |
| 254 | 2838061910 | Rhizobium phaseoli L15 | Isolate | Nodule |
| 255 | 2838068647 | Rhizobium esperanzae VC28 | Isolate | Nodule |
| 256 | 2838074704 | Sinorhizobium terangae SEMIA 6460 | Isolate | Unclassified |
| 257 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 258 | 2838661181 | Rhizobium mongolense SEMIA 402 | Isolate | Nodule |
| 259 | 2838668709 | Rhizobium sophoriradicis SEMIA 403 | Isolate | Nodule |
| 260 | 2838675328 | Agrobacterium radiobacter SEMIA 410 | Isolate | Nodule |
| 261 | 2838680041 | Rhizobium leguminosarum SEMIA 415 | Isolate | Nodule |
| 262 | 2838686498 | Rhizobium leguminosarum SEMIA 416 | Isolate | Nodule |
| 263 | 2838694306 | Rhizobium leguminosarum SEMIA 421 | Isolate | Nodule |
| 264 | 2838701080 | Rhizobium aethiopicum SEMIA 428 | Isolate | Nodule |
| 265 | 2838707686 | Rhizobium leguminosarum SEMIA 430 | Isolate | Nodule |
| 266 | 2838714209 | Agrobacterium radiobacter SEMIA 435 | Isolate | Nodule |
| 267 | 2838719591 | Agrobacterium radiobacter SEMIA 436 | Isolate | Nodule |
| 268 | 2838724970 | Agrobacterium radiobacter SEMIA 437 | Isolate | Nodule |
| 269 | 2838729681 | Rhizobium leguminosarum SEMIA 445 | Isolate | Nodule |
| 270 | 2838736955 | Rhizobium cellulosilyticum SEMIA 448 | Isolate | Nodule |
| 271 | 2838742623 | Rhizobium leguminosarum SEMIA 449 | Isolate | Nodule |
| 272 | 2839993093 | Phyllobacterium endophyticum PEPV15 | Isolate | Unclassified |
| 273 | 2840764183 | Phyllobacterium sophorae CCBAU 03422 | Isolate | Unclassified |
| 274 | 2841734538 | Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 | Isolate | Nodule |
| 275 | 2841840854 | Rhizobium cellulosilyticum SEMIA 444 | Isolate | Nodule |
| 276 | 2841846520 | Agrobacterium radiobacter SEMIA 440 | Isolate | Nodule |
| 277 | 2841851746 | Rhizobium leguminosarum SEMIA 498 | Isolate | Nodule |
| 278 | 2841859092 | Agrobacterium radiobacter SEMIA 4026 | Isolate | Nodule |
| 279 | 2841864319 | Rhizobium leguminosarum SEMIA 4052 | Isolate | Nodule |
| 280 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 281 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 282 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 283 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 284 | 2842077413 | Rhizobium leguminosarum SEMIA 422 | Isolate | Nodule |
| 285 | 2842110456 | Rhizobium esperanzae SEMIA 414 | Isolate | Nodule |
| 286 | 2842118031 | Rhizobium esperanzae SEMIA 420 | Isolate | Nodule |
| 287 | 2842124991 | Agrobacterium radiobacter SEMIA 434 | Isolate | Nodule |
| 288 | 2842130223 | Agrobacterium radiobacter SEMIA 441 | Isolate | Nodule |
| 289 | 2842140634 | Rhizobium cellulosilyticum SEMIA 452 | Isolate | Nodule |
| 290 | 2842146304 | Rhizobium sophoriradicis SEMIA 454 | Isolate | Nodule |
| 291 | 2842152218 | Agrobacterium radiobacter SEMIA 457 | Isolate | Nodule |
| 292 | 2842156927 | Rhizobium leguminosarum SEMIA 459 | Isolate | Nodule |
| 293 | 2842163707 | Rhizobium leguminosarum SEMIA 460 | Isolate | Nodule |
| 294 | 2842170452 | Agrobacterium radiobacter SEMIA 461 | Isolate | Nodule |
| 295 | 2842175837 | Agrobacterium radiobacter SEMIA 462 | Isolate | Nodule |
| 296 | 2842180545 | Rhizobium leguminosarum SEMIA 463 | Isolate | Nodule |
| 297 | 2842187318 | Agrobacterium radiobacter SEMIA 464 | Isolate | Nodule |
| 298 | 2842192696 | Rhizobium esperanzae SEMIA 468 | Isolate | Nodule |
| 299 | 2842198810 | Rhizobium aethiopicum SEMIA 470 | Isolate | Nodule |
| 300 | 2842205361 | Rhizobium etli SEMIA 471 | Isolate | Nodule |
| 301 | 2842211629 | Agrobacterium radiobacter SEMIA 472 | Isolate | Nodule |
| 302 | 2842217011 | Rhizobium leguminosarum SEMIA 475 | Isolate | Nodule |
| 303 | 2842224351 | Agrobacterium radiobacter SEMIA 480 | Isolate | Nodule |
| 304 | 2842229732 | Rhizobium leguminosarum SEMIA 481 | Isolate | Nodule |
| 305 | 2842237096 | Rhizobium leguminosarum SEMIA 482 | Isolate | Nodule |
| 306 | 2842243621 | Rhizobium leguminosarum SEMIA 483 | Isolate | Nodule |
| 307 | 2842250916 | Rhizobium etli SEMIA 484 | Isolate | Nodule |
| 308 | 2842257432 | Rhizobium leguminosarum SEMIA 485 | Isolate | Nodule |
| 309 | 2842264693 | Rhizobium phaseoli SEMIA 487 | Isolate | Nodule |
| 310 | 2842271015 | Rhizobium leguminosarum SEMIA 488 | Isolate | Nodule |
| 311 | 2842278818 | Rhizobium etli SEMIA 489 | Isolate | Nodule |
| 312 | 2842285085 | Rhizobium lentis SEMIA 490 | Isolate | Nodule |
| 313 | 2842291075 | Rhizobium leguminosarum SEMIA 491 | Isolate | Nodule |
| 314 | 2842298080 | Rhizobium leucaenae SEMIA 492 | Isolate | Nodule |
| 315 | 2842304105 | Rhizobium leguminosarum SEMIA 499 | Isolate | Nodule |
| 316 | 2842311132 | Rhizobium phaseoli SEMIA 4002 | Isolate | Nodule |
| 317 | 2842317721 | Rhizobium etli SEMIA 4004 | Isolate | Nodule |
| 318 | 2842341865 | Rhizobium leguminosarum SEMIA 4011 | Isolate | Nodule |
| 319 | 2842357229 | Rhizobium leucaenae SEMIA 4015 | Isolate | Nodule |
| 320 | 2842363717 | Rhizobium leguminosarum SEMIA 4016 | Isolate | Nodule |
| 321 | 2842370503 | Rhizobium leguminosarum SEMIA 4022 | Isolate | Nodule |
| 322 | 2842377471 | Rhizobium leguminosarum SEMIA 4024 | Isolate | Nodule |
| 323 | 2842384541 | Rhizobium leguminosarum SEMIA 4025 | Isolate | Nodule |
| 324 | 2842395702 | Rhizobium ecuadorense SEMIA 4029 | Isolate | Nodule |
| 325 | 2842402390 | Rhizobium lentis SEMIA 4033 | Isolate | Nodule |
| 326 | 2842409023 | Rhizobium lentis SEMIA 4034 | Isolate | Nodule |
| 327 | 2842415677 | Rhizobium lentis SEMIA 4036 | Isolate | Nodule |
| 328 | 2842422224 | Rhizobium esperanzae SEMIA 4042 | Isolate | Nodule |
| 329 | 2842428310 | Rhizobium phaseoli SEMIA 4050 | Isolate | Nodule |
| 330 | 2842434925 | Rhizobium esperanzae SEMIA 4051 | Isolate | Nodule |
| 331 | 2842441272 | Rhizobium esperanzae SEMIA 4053 | Isolate | Nodule |
| 332 | 2842447887 | Rhizobium esperanzae SEMIA 4055 | Isolate | Nodule |
| 333 | 2842462802 | Rhizobium phaseoli SEMIA 4057 | Isolate | Nodule |
| 334 | 2842469257 | Rhizobium phaseoli SEMIA 4058 | Isolate | Nodule |
| 335 | 2842475841 | Rhizobium tropici SEMIA 4059 | Isolate | Nodule |
| 336 | 2842482326 | Rhizobium lusitanum SEMIA 4060 | Isolate | Nodule |
| 337 | 2842489311 | Rhizobium sophoriradicis SEMIA 4061 | Isolate | Nodule |
| 338 | 2842495871 | Rhizobium etli SEMIA 4062 | Isolate | Nodule |
| 339 | 2842502639 | Rhizobium tropici SEMIA 4063 | Isolate | Nodule |
| 340 | 2842509118 | Rhizobium paranaense SEMIA 4064 | Isolate | Nodule |
| 341 | 2842515876 | Agrobacterium radiobacter SEMIA 4072 | Isolate | Nodule |
| 342 | 2842521101 | Rhizobium giardinii SEMIA 4084 | Isolate | Nodule |
| 343 | 2842871566 | Phyllobacterium sp. R-73111 | Isolate | Unclassified |
| 344 | 2842922631 | Pararhizobium sp. R-72066 | Isolate | Unclassified |
| 345 | 2844002411 | Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 | Isolate | Nodule |
| 346 | 2844009547 | Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 | Isolate | Nodule |
| 347 | 2844163670 | Ensifer sp. 1H6 | Isolate | Unclassified |
| 348 | 2844454524 | Rhizobium leguminosarum bv. viciae BIHB 1217 | Isolate | Nodule |
| 349 | 2847417321 | Sinorhizobium fredii CCBAU 45436 | Isolate | Unclassified |
| 350 | 2847670302 | Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 | Isolate | Nodule |
| 351 | 2847686936 | Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 | Isolate | Nodule |
| 352 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 353 | 2848992105 | Sinorhizobium fredii CCBAU 25509 | Isolate | Unclassified |
| 354 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 355 | 2850079185 | Ensifer aridi JNVU TP6 | Isolate | Unclassified |
| 356 | 2852387548 | Rhizobium jaguaris CCGE525 | Isolate | Unclassified |
| 357 | 2854896431 | Neorhizobium alkalisoli DSM 21826 | Isolate | Unclassified |
| 358 | 2854916844 | Neorhizobium huautlense DSM 21817 | Isolate | Unclassified |
| 359 | 2855825444 | Sinorhizobium meliloti CXM1-105 | Isolate | Nodule |
| 360 | 2855839649 | Sinorhizobium meliloti AK555 | Isolate | Unclassified |
| 361 | 2855872281 | Sinorhizobium fredii PCH1 | Isolate | Nodule |
| 362 | 2856314179 | Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 | Isolate | Nodule |
| 363 | 2856320880 | Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 | Isolate | Nodule |
| 364 | 2856328259 | Mesorhizobium sp. Primo-B | Isolate | Nodule |
| 365 | 2856334872 | Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 | Isolate | Nodule |
| 366 | 2856342000 | Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 | Isolate | Nodule |
| 367 | 2856349417 | Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 | Isolate | Nodule |
| 368 | 2856356410 | Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 | Isolate | Nodule |
| 369 | 2856364286 | Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 | Isolate | Nodule |
| 370 | 2857349434 | Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 | Isolate | Nodule |
| 371 | 2857367948 | Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 | Isolate | Nodule |
| 372 | 2857516855 | Rhizobium sp. R-72456 | Isolate | Unclassified |
| 373 | 2857531043 | Neorhizobium sp. R-72160 | Isolate | Unclassified |
| 374 | 2858800743 | Sinorhizobium meliloti AK170 | Isolate | Unclassified |
| 375 | 2869162929 | Mesorhizobium sanjuanii BSA136 | Isolate | Nodule |
| 376 | 2869169390 | Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 | Isolate | Nodule |
| 377 | 2869234852 | Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 | Isolate | Nodule |
| 378 | 2869242130 | Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 | Isolate | Nodule |
| 379 | 2869249662 | Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 | Isolate | Nodule |
| 380 | 2869256925 | Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 | Isolate | Nodule |
| 381 | 2869264136 | Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 | Isolate | Nodule |
| 382 | 2869271264 | Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 | Isolate | Nodule |
| 383 | 2869278585 | Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 | Isolate | Nodule |
| 384 | 2869285874 | Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 | Isolate | Nodule |
| 385 | 2871429161 | Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 | Isolate | Nodule |
| 386 | 2871435913 | Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 | Isolate | Nodule |
| 387 | 2871444079 | Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 | Isolate | Nodule |
| 388 | 2871451962 | Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 | Isolate | Nodule |
| 389 | 2871459585 | Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 | Isolate | Nodule |
| 390 | 2871466892 | Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 | Isolate | Nodule |
| 391 | 2871474448 | Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 | Isolate | Nodule |
| 392 | 2871481445 | Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 | Isolate | Nodule |
| 393 | 2871488783 | Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 | Isolate | Nodule |
| 394 | 2871495908 | Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 | Isolate | Nodule |
| 395 | 2874102143 | Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 | Isolate | Nodule |
| 396 | 2874109183 | Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 | Isolate | Nodule |
| 397 | 2874116593 | Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 | Isolate | Nodule |
| 398 | 2874123672 | Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 | Isolate | Nodule |
| 399 | 2874131515 | Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 | Isolate | Nodule |
| 400 | 2874139085 | Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 | Isolate | Nodule |
| 401 | 2874146452 | Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 | Isolate | Nodule |
| 402 | 2874155637 | Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 | Isolate | Nodule |
| 403 | 2874162495 | Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 | Isolate | Nodule |
| 404 | 2874168670 | Mesorhizobium kowhaii Ach-343 | Isolate | Nodule |
| 405 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 406 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 407 | 2876363079 | Mesorhizobium loti R7ANS::ICEMlSym2042 | Isolate | Nodule |
| 408 | 2876369609 | Mesorhizobium sp. USDA-HM6 | Isolate | Unclassified |
| 409 | 2876377896 | Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 | Isolate | Nodule |
| 410 | 2876386047 | Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 | Isolate | Nodule |
| 411 | 2876392853 | Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 | Isolate | Nodule |
| 412 | 2876399893 | Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 | Isolate | Nodule |
| 413 | 2876413966 | Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 | Isolate | Nodule |
| 414 | 2876420981 | Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 | Isolate | Nodule |
| 415 | 2878035449 | Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 | Isolate | Nodule |
| 416 | 2878730984 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 | Isolate | Nodule |
| 417 | 2878738818 | Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 | Isolate | Nodule |
| 418 | 2878745973 | Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 | Isolate | Nodule |
| 419 | 2878753008 | Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 | Isolate | Nodule |
| 420 | 2878760144 | Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 | Isolate | Nodule |
| 421 | 2878767105 | Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 | Isolate | Nodule |
| 422 | 2878774303 | Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 | Isolate | Nodule |
| 423 | 2878781027 | Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 | Isolate | Nodule |
| 424 | 2878788777 | Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 | Isolate | Nodule |
| 425 | 2881147464 | Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 | Isolate | Nodule |
| 426 | 2881155292 | Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 | Isolate | Nodule |
| 427 | 2881161766 | Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 | Isolate | Nodule |
| 428 | 2881845957 | Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 | Isolate | Nodule |
| 429 | 2881853255 | Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 | Isolate | Nodule |
| 430 | 2881861095 | Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 | Isolate | Nodule |
| 431 | 2882632389 | Mesorhizobium waimense ICMP19557 | Isolate | Unclassified |
| 432 | 2882912400 | Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 | Isolate | Nodule |
| 433 | 2885305155 | Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 | Isolate | Nodule |
| 434 | 2885312484 | Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 | Isolate | Nodule |
| 435 | 2885318864 | Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 | Isolate | Nodule |
| 436 | 2885342637 | Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 | Isolate | Nodule |
| 437 | 2885350715 | Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 | Isolate | Nodule |
| 438 | 2888337043 | Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 | Isolate | Nodule |
| 439 | 2888343758 | Mesorhizobium sp. AA22 | Isolate | Unclassified |
| 440 | 2888350351 | Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 | Isolate | Nodule |
| 441 | 2889010040 | Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 | Isolate | Nodule |
| 442 | 2889016732 | Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 | Isolate | Nodule |
| 443 | 2889790730 | Chelativorans xinjiangense lm93 | Isolate | Rhizosphere |
| 444 | 2889914905 | Chelativorans alearense UJN715 | Isolate | Rhizosphere |
| 445 | 2891048133 | Martelella lutilitoris GH2-6 | Isolate | Rhizosphere |
| 446 | 2891373044 | Shinella sp. AETb1-6 | Isolate | Rhizosphere |
| 447 | 2894652903 | Phyllobacterium sp. SYP-B3895 | Isolate | Rhizosphere |
| 448 | 2896384573 | Ensifer sp. MPMI2T | Isolate | Unclassified |
| 449 | 2899792073 | Agrobacterium deltaense CNPSo 3391 | Isolate | Nodule |
| 450 | 2899803654 | Agrobacterium sp. a22-2 | Isolate | Unclassified |
| 451 | 2899845264 | Agrobacterium fabacearum CNPSo 675 | Isolate | Unclassified |
| 452 | 2903448605 | Mesorhizobium japonicum Opo-235 | Isolate | Nodule |
| 453 | 2903492973 | Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 | Isolate | Nodule |
| 454 | 2903513507 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 | Isolate | Nodule |
| 455 | 2903521522 | Mesorhizobium loti R7ANS::ICEMlSym2014 | Isolate | Nodule |
| 456 | 2903528002 | Mesorhizobium loti R7ANS::ICEMlSym2037 | Isolate | Nodule |
| 457 | 2903540706 | Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 | Isolate | Nodule |
| 458 | 2904578770 | Phyllobacterium sp. 586 | Isolate | Unclassified |
| 459 | 2904659560 | Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 | Isolate | Nodule |
| 460 | 2906308376 | Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 | Isolate | Nodule |
| 461 | 2906321335 | Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 | Isolate | Nodule |
| 462 | 2906328253 | Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 | Isolate | Nodule |
| 463 | 2906354277 | Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 | Isolate | Nodule |
| 464 | 2906363423 | Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 | Isolate | Nodule |
| 465 | 2906370794 | Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 | Isolate | Nodule |
| 466 | 2906378014 | Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 | Isolate | Nodule |
| 467 | 2906386501 | Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 | Isolate | Nodule |
| 468 | 2906393657 | Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 | Isolate | Nodule |
| 469 | 2906401398 | Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 | Isolate | Nodule |
| 470 | 2906408224 | Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 | Isolate | Nodule |
| 471 | 2906414383 | Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 | Isolate | Nodule |
| 472 | 2906427513 | Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 | Isolate | Nodule |
| 473 | 2913295892 | Sinorhizobium kostiensis DSM 13372 | Isolate | Nodule |
| 474 | 2913308742 | Rhizobium halophytocola DSM 21600 | Isolate | Unclassified |
| 475 | 2915980308 | Sinorhizobium medicae USDA1149 | Isolate | Nodule |
| 476 | 2915986958 | Sinorhizobium meliloti USDA1659 | Isolate | Nodule |
| 477 | 2915993759 | Sinorhizobium meliloti USDA1336 | Isolate | Nodule |
| 478 | 2916000859 | Sinorhizobium meliloti USDA1562 | Isolate | Nodule |
| 479 | 2916007675 | Sinorhizobium meliloti USDA1289 | Isolate | Nodule |
| 480 | 2916014648 | Sinorhizobium meliloti USDA1583 | Isolate | Nodule |
| 481 | 2916021584 | Sinorhizobium meliloti USDA1550 | Isolate | Nodule |
| 482 | 2916028427 | Sinorhizobium meliloti USDA1613 | Isolate | Nodule |
| 483 | 2916035215 | Sinorhizobium meliloti 3011 | Isolate | Nodule |
| 484 | 2916041962 | Sinorhizobium meliloti USDA1795 | Isolate | Nodule |
| 485 | 2916048683 | Sinorhizobium meliloti USDA1796 | Isolate | Nodule |
| 486 | 2916055098 | Sinorhizobium meliloti USDA1770 | Isolate | Nodule |
| 487 | 2916061851 | Sinorhizobium medicae USDA1638 | Isolate | Nodule |
| 488 | 2916068649 | Sinorhizobium meliloti USDA1220 | Isolate | Nodule |
| 489 | 2916076590 | Sinorhizobium meliloti USDA1661 | Isolate | Nodule |
| 490 | 2919100787 | Rhizobium sp. 1399 | Isolate | Rhizosphere |
| 491 | 2919114240 | Agrobacterium tumefaciens 1457 | Isolate | Rhizosphere |
| 492 | 2919119836 | Phyllobacterium sp. 1468 | Isolate | Rhizosphere |
| 493 | 2919166419 | Agrobacterium cavarae 2074 | Isolate | Unclassified |
| 494 | 2919171160 | Neorhizobium sp. 2083 | Isolate | Unclassified |
| 495 | 2919408235 | Rhizobium miluonense 3199 | Isolate | Unclassified |
| 496 | 2920760137 | Ensifer psoraleae CCBAU 65732 | Isolate | Unclassified |
| 497 | 2920822456 | Ensifer sesbaniae CCBAU 65729 | Isolate | Unclassified |
| 498 | 2921201388 | Sinorhizobium meliloti USDA1692 | Isolate | Nodule |
| 499 | 2921208531 | Sinorhizobium meliloti USDA1660 | Isolate | Nodule |
| 500 | 2921237296 | Sinorhizobium meliloti USDA1508 | Isolate | Nodule |
| 501 | 2921244191 | Sinorhizobium meliloti 2119 | Isolate | Nodule |
| 502 | 2921250672 | Sinorhizobium medicae USDA1169 | Isolate | Nodule |
| 503 | 2921257292 | Sinorhizobium meliloti USDA1320 | Isolate | Nodule |
| 504 | 2921263974 | Sinorhizobium meliloti USDA1107 | Isolate | Nodule |
| 505 | 2921282425 | Sinorhizobium meliloti USDA1203 | Isolate | Nodule |
| 506 | 2921289301 | Sinorhizobium meliloti USDA1730 | Isolate | Nodule |
| 507 | 2921296804 | Sinorhizobium meliloti USDA1200 | Isolate | Nodule |
| 508 | 2922151315 | Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 | Isolate | Nodule |
| 509 | 2922158528 | Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 | Isolate | Nodule |
| 510 | 2922172374 | Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 | Isolate | Nodule |
| 511 | 2922185730 | Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 | Isolate | Nodule |
| 512 | 2923556063 | Rhizobium tibeticum 3740 | Isolate | Unclassified |
| 513 | 2924144063 | Sinorhizobium meliloti USDA1022 | Isolate | Nodule |
| 514 | 2924150972 | Sinorhizobium meliloti USDA1700 | Isolate | Nodule |
| 515 | 2924158325 | Sinorhizobium meliloti USDA1146 | Isolate | Nodule |
| 516 | 2924165586 | Sinorhizobium meliloti USDA1264 | Isolate | Nodule |
| 517 | 2924172951 | Sinorhizobium meliloti USDA1626 | Isolate | Nodule |
| 518 | 2924179722 | Sinorhizobium meliloti USDA1280 | Isolate | Nodule |
| 519 | 2924186466 | Sinorhizobium meliloti USDA1389 | Isolate | Nodule |
| 520 | 2924193448 | Sinorhizobium meliloti USDA1158 | Isolate | Nodule |
| 521 | 2924200457 | Sinorhizobium meliloti USDA1007 | Isolate | Nodule |
| 522 | 2924207177 | Sinorhizobium meliloti USDA1589 | Isolate | Nodule |
| 523 | 2924214083 | Sinorhizobium meliloti USDA1702 | Isolate | Nodule |
| 524 | 2924221636 | Sinorhizobium meliloti USDA1416 | Isolate | Nodule |
| 525 | 2924228884 | Sinorhizobium meliloti USDA1581 | Isolate | Nodule |
| 526 | 2924726620 | Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 | Isolate | Nodule |
| 527 | 2924733363 | Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 | Isolate | Nodule |
| 528 | 2924741084 | Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 | Isolate | Nodule |
| 529 | 2924748358 | Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 | Isolate | Nodule |
| 530 | 2924754689 | Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 | Isolate | Nodule |
| 531 | 2924762789 | Mesorhizobium sp. WSM4303 | Isolate | Unclassified |
| 532 | 2924776078 | Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 | Isolate | Nodule |
| 533 | 2924784321 | Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 | Isolate | Nodule |
| 534 | 2926754445 | Agrobacterium radiobacter SLBN-94 | Isolate | Rhizosphere |
| 535 | 2926760298 | Agrobacterium tumefaciens SLBN-170 | Isolate | Rhizosphere |
| 536 | 2928521798 | Phyllobacterium ifriqiyense 1451 | Isolate | Rhizosphere |
| 537 | 2929138655 | Agrobacterium sp. R-72433 Hybrid assembly | Isolate | Unclassified |
| 538 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 539 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 540 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 541 | 2933006813 | Rhizobium sp. SEMIA 439 | Isolate | Unclassified |
| 542 | 2933011516 | Rhizobium sp. SEMIA 4032 | Isolate | Unclassified |
| 543 | 2933016740 | Rhizobium sp. SEMIA 4085 | Isolate | Nodule |
| 544 | 2933570622 | Rhizobium leguminosarum SEMIA 409 | Isolate | Nodule |
| 545 | 2933586486 | Rhizobium leguminosarum SEMIA 4039 | Isolate | Nodule |
| 546 | 2933594066 | Agrobacterium fabrum 35/80 | Isolate | Nodule |
| 547 | 2933599457 | Rhizobium phaseoli M3 | Isolate | Nodule |
| 548 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 549 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 550 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 551 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 552 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 553 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 554 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 555 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 556 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 557 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 558 | 2935894831 | Rhizobium leguminosarum SEMIA 419 | Isolate | Nodule |
| 559 | 2935901341 | Rhizobium leguminosarum SEMIA 4082 | Isolate | Nodule |
| 560 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 561 | 2936367885 | Rhizobium changzhiense WYCCWR 11290 | Isolate | Nodule |
| 562 | 2936375103 | Rhizobium changzhiense WYCCWR 11317 | Isolate | Nodule |
| 563 | 2936381700 | Rhizobium chutanense C16 | Isolate | Unclassified |
| 564 | 2936996657 | Sinorhizobium meliloti USDA1025 | Isolate | Nodule |
| 565 | 2937002841 | Sinorhizobium meliloti USDA1006 | Isolate | Nodule |
| 566 | 2937009748 | Sinorhizobium meliloti USDA1162 | Isolate | Nodule |
| 567 | 2937016420 | Sinorhizobium meliloti USDA1027 | Isolate | Nodule |
| 568 | 2937023124 | Sinorhizobium meliloti USDA1335 | Isolate | Nodule |
| 569 | 2937029754 | Sinorhizobium medicae USDA1624 | Isolate | Nodule |
| 570 | 2937036028 | Sinorhizobium medicae USDA1608 | Isolate | Nodule |
| 571 | 2937042894 | Sinorhizobium meliloti USDA1687 | Isolate | Nodule |
| 572 | 2937049772 | Sinorhizobium meliloti USDA1691 | Isolate | Nodule |
| 573 | 2937056579 | Sinorhizobium meliloti USDA1357 | Isolate | Nodule |
| 574 | 2937063883 | Sinorhizobium meliloti USDA1808 | Isolate | Nodule |
| 575 | 2937071275 | Sinorhizobium meliloti USDA1623 | Isolate | Nodule |
| 576 | 2937078374 | Sinorhizobium medicae USDA1004 | Isolate | Nodule |
| 577 | 2937084907 | Sinorhizobium medicae USDA1664 | Isolate | Nodule |
| 578 | 2937091812 | Sinorhizobium meliloti USDA1221 | Isolate | Nodule |
| 579 | 2937098957 | Sinorhizobium meliloti USDA1519 | Isolate | Nodule |
| 580 | 2937106411 | Sinorhizobium meliloti USDA1214 | Isolate | Nodule |
| 581 | 2937113482 | Sinorhizobium meliloti USDA1180 | Isolate | Nodule |
| 582 | 2937119839 | Sinorhizobium meliloti USDA1790 | Isolate | Nodule |
| 583 | 2937126314 | Sinorhizobium meliloti USDA1612 | Isolate | Nodule |
| 584 | 2937813078 | Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 | Isolate | Nodule |
| 585 | 2937822353 | Mesorhizobium neociceri CCANP35 | Isolate | Nodule |
| 586 | 2937836603 | Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 | Isolate | Nodule |
| 587 | 2937843397 | Mesorhizobium xinjiangense lm94 | Isolate | Rhizosphere |
| 588 | 2937848649 | Mesorhizobium sp. WSM4310 | Isolate | Unclassified |
| 589 | 2937861824 | Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 | Isolate | Nodule |
| 590 | 2937868953 | Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 | Isolate | Nodule |
| 591 | 2937877337 | Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 | Isolate | Nodule |
| 592 | 2937891427 | Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 | Isolate | Nodule |
| 593 | 2937972304 | Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 | Isolate | Nodule |
| 594 | 2937980651 | Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 | Isolate | Nodule |
| 595 | 2937994558 | Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 | Isolate | Nodule |
| 596 | 2938014810 | Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 | Isolate | Nodule |
| 597 | 2941499720 | Ensifer sp. 4252 | Isolate | Rhizosphere |
| 598 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 599 | 2954011201 | Phyllobacterium ifrigiyense W4I11 | Isolate | Rhizosphere |
| 600 | 2957375807 | Sinorhizobium medicae USDA1632 | Isolate | Nodule |
| 601 | 2957382221 | Sinorhizobium meliloti USDA1919 | Isolate | Nodule |
| 602 | 2957388812 | Sinorhizobium meliloti USDA1195 | Isolate | Nodule |
| 603 | 2957395598 | Sinorhizobium meliloti USDA1237 | Isolate | Nodule |
| 604 | 2957402308 | Sinorhizobium meliloti USDA1794 | Isolate | Nodule |
| 605 | 2957408893 | Sinorhizobium meliloti USDA1163 | Isolate | Nodule |
| 606 | 2957415311 | Sinorhizobium meliloti USDA1724 | Isolate | Nodule |
| 607 | 2957422303 | Sinorhizobium meliloti USDA1497 | Isolate | Nodule |
| 608 | 2957430029 | Sinorhizobium meliloti USDA1590 | Isolate | Nodule |
| 609 | 2957437181 | Sinorhizobium medicae USDA1694 | Isolate | Nodule |
| 610 | 2957443900 | Sinorhizobium meliloti USDA1734 | Isolate | Nodule |
| 611 | 2957450854 | Sinorhizobium meliloti USDA1655 | Isolate | Nodule |
| 612 | 2957457609 | Sinorhizobium meliloti USDA1751 | Isolate | Nodule |
| 613 | 2957464669 | Sinorhizobium meliloti USDA1520 | Isolate | Nodule |
| 614 | 2957471148 | Sinorhizobium meliloti USDA1204 | Isolate | Nodule |
| 615 | 2957478035 | Sinorhizobium meliloti USDA1171 | Isolate | Nodule |
| 616 | 2957484790 | Sinorhizobium meliloti USDA1464 | Isolate | Nodule |
| 617 | 2957491536 | Sinorhizobium meliloti USDA1804 | Isolate | Nodule |
| 618 | 2957498199 | Sinorhizobium meliloti USDA1561 | Isolate | Nodule |
| 619 | 2957505466 | Sinorhizobium meliloti USDA1696 | Isolate | Nodule |
| 620 | 2958034702 | Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 | Isolate | Nodule |
| 621 | 2958041894 | Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 | Isolate | Nodule |
| 622 | 2958064165 | Mesorhizobium sp. SARCC-RB16n | Isolate | Unclassified |
| 623 | 2958071322 | Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 | Isolate | Nodule |
| 624 | 2958084443 | Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 | Isolate | Nodule |
| 625 | 2958092219 | Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 | Isolate | Nodule |
| 626 | 2958100919 | Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 | Isolate | Nodule |
| 627 | 2958108152 | Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 | Isolate | Nodule |
| 628 | 2958115193 | Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 | Isolate | Nodule |
| 629 | 2958122699 | Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 | Isolate | Nodule |
| 630 | 2958130278 | Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 | Isolate | Nodule |
| 631 | 2958144490 | Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 | Isolate | Nodule |
| 632 | 2958165035 | Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 | Isolate | Nodule |
| 633 | 2958172287 | Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 | Isolate | Nodule |
| 634 | 2958179912 | Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 | Isolate | Nodule |
| 635 | 2960584000 | Sinorhizobium meliloti USDA1530 | Isolate | Nodule |
| 636 | 2960591022 | Sinorhizobium medicae USDA1066 | Isolate | Nodule |
| 637 | 2960597568 | Sinorhizobium meliloti 3085 | Isolate | Nodule |
| 638 | 2960603979 | Sinorhizobium meliloti USDA1580 | Isolate | Nodule |
| 639 | 2960610863 | Sinorhizobium meliloti USDA1792 | Isolate | Nodule |
| 640 | 2960617483 | Sinorhizobium meliloti USDA1719 | Isolate | Nodule |
| 641 | 2960624210 | Sinorhizobium meliloti USDA1415 | Isolate | Nodule |
| 642 | 2960631154 | Sinorhizobium medicae USDA1629 | Isolate | Nodule |
| 643 | 2960637947 | Sinorhizobium meliloti USDA1202 | Isolate | Nodule |
| 644 | 2960645483 | Sinorhizobium meliloti USDA1703 | Isolate | Nodule |
| 645 | 2960652885 | Sinorhizobium meliloti USDA1199 | Isolate | Nodule |
| 646 | 2960660292 | Sinorhizobium meliloti USDA1883 | Isolate | Nodule |
| 647 | 2960667422 | Sinorhizobium meliloti USDA1170 | Isolate | Nodule |
| 648 | 2960674078 | Sinorhizobium meliloti USDA1666 | Isolate | Nodule |
| 649 | 2960680706 | Sinorhizobium medicae USDA1150 | Isolate | Nodule |
| 650 | 2960687367 | Sinorhizobium meliloti USDA1462 | Isolate | Nodule |
| 651 | 2960693952 | Sinorhizobium medicae USDA1630 | Isolate | Nodule |
| 652 | 2961077736 | Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 | Isolate | Nodule |
| 653 | 2961114664 | Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 | Isolate | Nodule |
| 654 | 2961127735 | Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 | Isolate | Nodule |
| 655 | 2961136820 | Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 | Isolate | Nodule |
| 656 | 2961163497 | Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 | Isolate | Nodule |
| 657 | 2961170736 | Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 | Isolate | Nodule |
| 658 | 2961183825 | Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 | Isolate | Nodule |
| 659 | 2963644680 | Mesorhizobium japonicum R7A | Isolate | Nodule |
| 660 | 2964607997 | Sinorhizobium meliloti USDA1212 | Isolate | Nodule |
| 661 | 2964615318 | Sinorhizobium meliloti USDA1248 | Isolate | Nodule |
| 662 | 2964621998 | Sinorhizobium meliloti USDA1235 | Isolate | Nodule |
| 663 | 2964628898 | Sinorhizobium meliloti USDA1191 | Isolate | Nodule |
| 664 | 2964636051 | Sinorhizobium meliloti USDA1594 | Isolate | Nodule |
| 665 | 2964643177 | Sinorhizobium meliloti USDA1760 | Isolate | Nodule |
| 666 | 2964649959 | Sinorhizobium meliloti USDA1591 | Isolate | Nodule |
| 667 | 2964656573 | Sinorhizobium meliloti USDA1308 | Isolate | Nodule |
| 668 | 2964663802 | Sinorhizobium meliloti USDA1688 | Isolate | Nodule |
| 669 | 2964670856 | Sinorhizobium meliloti USDA1211 | Isolate | Nodule |
| 670 | 2964678106 | Sinorhizobium meliloti USDA1210 | Isolate | Nodule |
| 671 | 2964685014 | Sinorhizobium meliloti USDA1232 | Isolate | Nodule |
| 672 | 2964691889 | Sinorhizobium meliloti USDA1379 | Isolate | Nodule |
| 673 | 2964698721 | Sinorhizobium meliloti USDA1656 | Isolate | Nodule |
| 674 | 2964705432 | Sinorhizobium meliloti USDA1614 | Isolate | Nodule |
| 675 | 2964712639 | Sinorhizobium meliloti USDA1616 | Isolate | Nodule |
| 676 | 2964719344 | Sinorhizobium meliloti USDA1456 | Isolate | Nodule |
| 677 | 2965018300 | Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 | Isolate | Nodule |
| 678 | 2965025482 | Mesorhizobium sp. Primo-A | Isolate | Nodule |
| 679 | 2965032056 | Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 | Isolate | Nodule |
| 680 | 2965040258 | Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 | Isolate | Nodule |
| 681 | 2965047637 | Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 | Isolate | Nodule |
| 682 | 2965062239 | Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 | Isolate | Nodule |
| 683 | 2965089291 | Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 | Isolate | Nodule |
| 684 | 2965102966 | Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 | Isolate | Nodule |
| 685 | 2965110997 | Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 | Isolate | Nodule |
| 686 | 2965119406 | Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 | Isolate | Nodule |
| 687 | 2967664464 | Sinorhizobium meliloti USDA1208 | Isolate | Nodule |
| 688 | 2967671571 | Sinorhizobium meliloti USDA1496 | Isolate | Nodule |
| 689 | 2967678726 | Sinorhizobium meliloti USDA1467 | Isolate | Nodule |
| 690 | 2967686174 | Sinorhizobium medicae USDA1641 | Isolate | Nodule |
| 691 | 2967693043 | Sinorhizobium meliloti USDA1183 | Isolate | Nodule |
| 692 | 2967699805 | Sinorhizobium meliloti USDA1695 | Isolate | Nodule |
| 693 | 2967706974 | Sinorhizobium meliloti USDA1206 | Isolate | Nodule |
| 694 | 2967714385 | Sinorhizobium meliloti USDA1023 | Isolate | Nodule |
| 695 | 2967721400 | Sinorhizobium meliloti USDA1742 | Isolate | Nodule |
| 696 | 2967728569 | Sinorhizobium medicae USDA1607 | Isolate | Nodule |
| 697 | 2967735183 | Sinorhizobium meliloti USDA1710 | Isolate | Nodule |
| 698 | 2967742019 | Sinorhizobium meliloti USDA1676 | Isolate | Nodule |
| 699 | 2967748971 | Sinorhizobium meliloti USDA1024A | Isolate | Nodule |
| 700 | 2967755722 | Sinorhizobium meliloti USDA1302 | Isolate | Nodule |
| 701 | 2967762386 | Sinorhizobium meliloti USDA1397 | Isolate | Nodule |
| 702 | 2967769361 | Sinorhizobium meliloti USDA1005 | Isolate | Nodule |
| 703 | 2967775926 | Sinorhizobium meliloti USDA1678 | Isolate | Nodule |
| 704 | 2967996073 | Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 | Isolate | Nodule |
| 705 | 2968003550 | Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 | Isolate | Nodule |
| 706 | 2968016561 | Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 | Isolate | Nodule |
| 707 | 2968083720 | Mesorhizobium erdmanii Opo-242 | Isolate | Unclassified |
| 708 | 2968091066 | Mesorhizobium sp. AA23 | Isolate | Unclassified |
| 709 | 2968097103 | Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 | Isolate | Nodule |
| 710 | 2968110612 | Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 | Isolate | Nodule |
| 711 | 2968117919 | Mesorhizobium atlanticum CNPSo 3140 | Isolate | Unclassified |
| 712 | 2968128360 | Mesorhizobium sp. WSM3873 | Isolate | Unclassified |
| 713 | 2968171901 | Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 | Isolate | Nodule |
| 714 | 2970019648 | Sinorhizobium meliloti USDA1603 | Isolate | Nodule |
| 715 | 2970026789 | Sinorhizobium medicae USDA1611 | Isolate | Nodule |
| 716 | 2970033650 | Sinorhizobium meliloti USDA1565 | Isolate | Nodule |
| 717 | 2970040964 | Sinorhizobium meliloti USDA1501 | Isolate | Nodule |
| 718 | 2970047711 | Sinorhizobium meliloti USDA1793 | Isolate | Nodule |
| 719 | 2970054988 | Sinorhizobium meliloti USDA1031 | Isolate | Nodule |
| 720 | 2970061556 | Sinorhizobium meliloti USDA1810 | Isolate | Nodule |
| 721 | 2970068827 | Sinorhizobium meliloti USDA1227 | Isolate | Nodule |
| 722 | 2970076120 | Sinorhizobium meliloti USDA1706 | Isolate | Nodule |
| 723 | 2970082768 | Sinorhizobium meliloti USDA1803 | Isolate | Nodule |
| 724 | 2970088815 | Sinorhizobium meliloti USDA1819 | Isolate | Nodule |
| 725 | 2970095765 | Sinorhizobium meliloti USDA1225 | Isolate | Nodule |
| 726 | 2970102677 | Sinorhizobium meliloti USDA1325 | Isolate | Nodule |
| 727 | 2970109326 | Sinorhizobium meliloti USDA1186 | Isolate | Nodule |
| 728 | 2970116247 | Sinorhizobium meliloti USDA1566 | Isolate | Nodule |
| 729 | 2970122695 | Sinorhizobium medicae 3082 | Isolate | Nodule |
| 730 | 2970129317 | Sinorhizobium meliloti USDA1008 | Isolate | Nodule |
| 731 | 2970136068 | Sinorhizobium meliloti USDA1699 | Isolate | Nodule |
| 732 | 2970143518 | Sinorhizobium medicae USDA1652 | Isolate | Nodule |
| 733 | 2970149975 | Sinorhizobium meliloti USDA1215 | Isolate | Nodule |
| 734 | 2970156795 | Sinorhizobium meliloti USDA1491 | Isolate | Nodule |
| 735 | 2970164137 | Sinorhizobium meliloti USDA1018 | Isolate | Nodule |
| 736 | 2970170962 | Sinorhizobium meliloti USDA1571 | Isolate | Nodule |
| 737 | 2970177841 | Sinorhizobium meliloti USDA1533 | Isolate | Nodule |
| 738 | 2970184632 | Sinorhizobium meliloti USDA1593 | Isolate | Nodule |
| 739 | 2970191845 | Sinorhizobium meliloti USDA1187 | Isolate | Nodule |
| 740 | 2970469710 | Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 | Isolate | Nodule |
| 741 | 2970489779 | Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 | Isolate | Nodule |
| 742 | 2970503327 | Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 | Isolate | Nodule |
| 743 | 2970510686 | Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 | Isolate | Nodule |
| 744 | 2970524798 | Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 | Isolate | Nodule |
| 745 | 2970540015 | Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 | Isolate | Nodule |
| 746 | 2970547951 | Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 | Isolate | Nodule |
| 747 | 2970554993 | Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 | Isolate | Nodule |
| 748 | 2970593180 | Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 | Isolate | Nodule |
| 749 | 2970619444 | Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 | Isolate | Nodule |
| 750 | 2970627176 | Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 | Isolate | Nodule |
| 751 | 2977516862 | Sinorhizobium meliloti USDA1791 | Isolate | Nodule |
| 752 | 2977523885 | Sinorhizobium meliloti USDA1777 | Isolate | Nodule |
| 753 | 2977530762 | Sinorhizobium medicae USDA1606 | Isolate | Nodule |
| 754 | 2977537788 | Sinorhizobium meliloti USDA1184 | Isolate | Nodule |
| 755 | 2977544691 | Sinorhizobium medicae USDA1631 | Isolate | Nodule |
| 756 | 2977551784 | Sinorhizobium meliloti USDA1035 | Isolate | Nodule |
| 757 | 2977558990 | Sinorhizobium meliloti USDA1222 | Isolate | Nodule |
| 758 | 2977565890 | Sinorhizobium meliloti USDA1617 | Isolate | Nodule |
| 759 | 2977572785 | Sinorhizobium meliloti USDA1767 | Isolate | Nodule |
| 760 | 2977579622 | Sinorhizobium meliloti USDA1161 | Isolate | Nodule |
| 761 | 2977821940 | Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 | Isolate | Nodule |
| 762 | 2977828996 | Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 | Isolate | Nodule |
| 763 | 2977843712 | Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 | Isolate | Nodule |
| 764 | 2977851361 | Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 | Isolate | Nodule |
| 765 | 2977858184 | Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 | Isolate | Nodule |
| 766 | 2977864932 | Mesorhizobium tamadayense DSM 28320 | Isolate | Nodule |
| 767 | 2977872689 | Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 | Isolate | Nodule |
| 768 | 2977907340 | Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 | Isolate | Nodule |
| 769 | 2977915119 | Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 | Isolate | Nodule |
| 770 | 2977922695 | Mesorhizobium sp. WSM4305 | Isolate | Unclassified |
| 771 | 2977935797 | Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 | Isolate | Nodule |
| 772 | 2977942078 | Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 | Isolate | Nodule |
| 773 | 2977950692 | Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 | Isolate | Nodule |
| 774 | 2977957713 | Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 | Isolate | Nodule |
| 775 | 2977971508 | Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 | Isolate | Nodule |
| 776 | 2977986579 | Mesorhizobium intechi BD68 | Isolate | Unclassified |
| 777 | 2978969890 | Agrobacterium sp. SORGH_AS 787 | Isolate | Unclassified |
| 778 | 2979089926 | Agrobacterium sp. SORGH_AS 745 | Isolate | Unclassified |
| 779 | 2979095461 | Agrobacterium tumefaciens SORGH_AS 749 | Isolate | Unclassified |
| 780 | 2979100975 | Agrobacterium pusense SORGH_AS 755 | Isolate | Unclassified |
| 781 | 2979710463 | Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 | Isolate | Nodule |
| 782 | 2979742915 | Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 | Isolate | Nodule |
| 783 | 2979764755 | Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 | Isolate | Nodule |
| 784 | 2979779861 | Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 | Isolate | Nodule |
| 785 | 2979793036 | Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 | Isolate | Nodule |
| 786 | 2979808191 | Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 | Isolate | Nodule |
| 787 | 2984509177 | Agrobacterium pusense SORGH_AS260 | Isolate | Aerial Root |
| 788 | 2984518228 | Agrobacterium pusense SORGH_AS285 | Isolate | Aerial Root |
| 789 | 2984537506 | Agrobacterium sp. SORGH_AS440 | Isolate | Aerial Root |
| 790 | 2984587000 | Agrobacterium larrymoorei SORGH_AS974 | Isolate | Aerial Root |
| 791 | 2984601300 | Rhizobium pusense SORGH_AS1083 | Isolate | Aerial Root |
| 792 | 2987636660 | Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 | Isolate | Nodule |
| 793 | 2987645492 | Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 | Isolate | Nodule |
| 794 | 2987652177 | Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 | Isolate | Nodule |
| 795 | 2987659509 | Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 | Isolate | Nodule |
| 796 | 2987666974 | Mesorhizobium sp. WSM4306 | Isolate | Unclassified |
| 797 | 2987673487 | Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 | Isolate | Nodule |
| 798 | 2989349275 | Shinella kummerowiae CCBAU 25048 | Isolate | Unclassified |
| 799 | 2989771324 | Rhizobium rhizolycopersici DBTS2 | Isolate | Rhizosphere |
| 800 | 2989776772 | Rhizobium glycinendophyticum CL12 | Isolate | Unclassified |
| 801 | 2995392953 | Martelella limonii NBRC 109441 | Isolate | Unclassified |
| 802 | 2996310559 | Mesorhizobium zhangyense CGMCC 1.15528 | Isolate | Unclassified |
| 803 | 2996336353 | Mesorhizobium sp. YM1C-6-2 | Isolate | Unclassified |
| 804 | 2996341866 | Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 | Isolate | Nodule |
| 805 | 2996348954 | Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 | Isolate | Nodule |
| 806 | 2996386984 | Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 | Isolate | Nodule |
| 807 | 2996887358 | Rhizobium sp. R711 | Isolate | Nodule |
| 808 | 2996893221 | Rhizobium sp. R635 | Isolate | Nodule |
| 809 | 3000135777 | Unclassified bacterium M00.F.Ca.ET.205.01.1.1 | Isolate | Unclassified |
| 810 | 3002141150 | Phyllobacterium sp. 628 | Isolate | Unclassified |
| 811 | 3003930520 | Sinorhizobium sp. BG8 | Isolate | Unclassified |
| 812 | 3004167301 | Mesorhizobium loti 582 | Isolate | Unclassified |
| 813 | 3004188549 | Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 | Isolate | Nodule |
| 814 | 3004195979 | Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 | Isolate | Nodule |
| 815 | 3004203850 | Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 | Isolate | Nodule |
| 816 | 3004211236 | Mesorhizobium sp. WSM4307 | Isolate | Unclassified |
| 817 | 3004218560 | Mesorhizobium sp. WSM4315 | Isolate | Unclassified |
| 818 | 3004232784 | Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 | Isolate | Nodule |
| 819 | 3004248173 | Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 | Isolate | Nodule |
| 820 | 3004268573 | Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 | Isolate | Nodule |
| 821 | 3004275668 | Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 | Isolate | Nodule |
| 822 | 3004334049 | Mesorhizobium huakuii 583 | Isolate | Unclassified |
| 823 | 3005409236 | Rhizobium sp. P32RR-XVIII | Isolate | Rhizosphere |
| 824 | 3005416602 | Rhizobium sp. P40RR-XXII | Isolate | Rhizosphere |
| 825 | 3005445848 | Rhizobium sp. WYJ-E13 | Isolate | Unclassified |
| 826 | 3005452660 | Rhizobium grahamii BG7 | Isolate | Unclassified |
| 827 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 828 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 829 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 830 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 831 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 832 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 833 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 834 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 835 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 836 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 837 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 838 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 839 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 840 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 841 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 842 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 843 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 844 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 845 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 846 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 847 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 848 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 849 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 850 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 851 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 852 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 853 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 854 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 855 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 856 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 857 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 858 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 859 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 860 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 861 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 862 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 863 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 864 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 865 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 866 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 867 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 868 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 869 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 870 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 871 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 872 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 873 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 874 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 875 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 876 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 877 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 878 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 879 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 880 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 881 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 882 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 883 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 884 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 885 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 886 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 887 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 888 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 889 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 890 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 891 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 892 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 893 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 894 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 895 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 896 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 897 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 898 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 899 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 900 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 901 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 902 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 903 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 904 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 905 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 906 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 907 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 908 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 909 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 910 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 911 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 912 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 913 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 914 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 915 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 916 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 917 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 918 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 919 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 920 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 921 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 922 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 923 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 924 | 3300009765 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule | Metagenome | Nodule |
| 925 | 3300009766 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule | Metagenome | Nodule |
| 926 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 927 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 928 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 929 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 930 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 931 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 932 | 3300013249 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 | Metagenome | Rhizosphere |
| 933 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 934 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 935 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 936 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 937 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 938 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 939 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 940 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 941 | 3300015690 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 | Metagenome | Rhizosphere |
| 942 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 943 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 944 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 945 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 946 | 3300022739 | Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules | Metagenome | Nodule |
| 947 | 3300022740 | Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules | Metagenome | Nodule |
| 948 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 949 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 950 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 951 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 952 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 953 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 954 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 955 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 956 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 957 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 958 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 959 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 960 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 961 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 962 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 963 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 964 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 965 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 966 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 967 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 968 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 969 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 970 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 971 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 972 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 973 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 974 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 975 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 976 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 977 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 978 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 979 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 980 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 981 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 982 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 983 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 984 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 985 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 986 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 987 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 988 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 989 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 990 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 991 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 992 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 993 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 994 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 995 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 996 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 997 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 998 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 999 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1000 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1001 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1002 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1003 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1004 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1005 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1006 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1007 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1008 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1009 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1010 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 1011 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1012 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 1013 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 1014 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1015 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 1016 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 1017 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 1018 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 1019 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 1020 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 1021 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 1022 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 1023 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 1024 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 1025 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 1026 | 3300031967 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules | Metagenome | Nodule |
| 1027 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 1028 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 1029 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 1030 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 1031 | 3300033430 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules | Metagenome | Nodule |
| 1032 | 3300033464 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules | Metagenome | Nodule |
| 1033 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 1034 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 1035 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 1036 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 1037 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 1038 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 1039 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 1040 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 1041 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 1042 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 1043 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 1044 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 1045 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 1046 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 1047 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 1048 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 1049 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 1050 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 1051 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 1052 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 1053 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 1054 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 1055 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 1056 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 1057 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 1058 | 3300038742 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 | Metagenome | Unclassified |
| 1059 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 1060 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 1061 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 1062 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 1063 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 1064 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 1065 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 1066 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 1067 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 1068 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 1069 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 1070 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 1071 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 1072 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 1073 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 1074 | 3300041907 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaT_extra_run | Metatranscriptome | Unclassified |
| 1075 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 1076 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 1077 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 1078 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 1079 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 1080 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 1081 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 1082 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 1083 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 1084 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 1085 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 1086 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 1087 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 1088 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 1089 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 1090 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 1091 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 1092 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 1093 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 1094 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 1095 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 1096 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 1097 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 1098 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 1099 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 1100 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 1101 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 1102 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 1103 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 1104 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 1105 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 1106 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 1107 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 1108 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 1109 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 1110 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 1111 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 1112 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 1113 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 1114 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 1115 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 1116 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 1117 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 1118 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 1119 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 1120 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 1121 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 1122 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 1123 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 1124 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 1125 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 1126 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 1127 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 1128 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 1129 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 1130 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 1131 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 1132 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 1133 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 1134 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 1135 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 1136 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 1137 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 1138 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 1139 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 1140 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 1141 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 1142 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 1143 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 1144 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 1145 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 1146 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 1147 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 1148 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 1149 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 1150 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 1151 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 1152 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 1153 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 1154 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 1155 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 1156 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 1157 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 1158 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 1159 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 1160 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 1161 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 1162 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 1163 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 1164 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 1165 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 1166 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 1167 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 1168 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 1169 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 1170 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 1171 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 1172 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 1173 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 1174 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 1175 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 1176 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 1177 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 1178 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 1179 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 1180 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 1181 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 1182 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 1183 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 1184 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 1185 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 1186 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 1187 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 1188 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 1189 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 1190 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 1191 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 1192 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 1193 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 1194 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 1195 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 1196 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 1197 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 1198 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 1199 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 1200 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 1201 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 1202 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 1203 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 1204 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 1205 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 1206 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 1207 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 1208 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 1209 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 1210 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 1211 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 1212 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 1213 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 1214 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 1215 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 1216 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 1217 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 1218 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 1219 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 1220 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 1221 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 1222 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 1223 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 1224 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 1225 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 1226 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 1227 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 1228 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 1229 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 1230 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 1231 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 1232 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 1233 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 1234 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 1235 | 3300053107 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere | Metagenome | Endosphere |
| 1236 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 1237 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 1238 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 1239 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 1240 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 1241 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 1242 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 1243 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 1244 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 1245 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 1246 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 1247 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 1248 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 1249 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 1250 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 1251 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 1252 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 1253 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 1254 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 1255 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 1256 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 1257 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 1258 | 3300053736 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere | Metagenome | Endosphere |
| 1259 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 1260 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 1261 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 1262 | 637000159 | Mesorhizobium japonicum MAFF 303099 | Isolate | Unclassified |
| 1263 | 639633055 | Rhizobium leguminosarum bv. viciae 3841 | Isolate | Unclassified |
| 1264 | 643692032 | Sinorhizobium fredii NGR234 | Isolate | Nodule |
| 1265 | 648276728 | Sinorhizobium meliloti BL225C | Isolate | Nodule |
| 1266 | 649633066 | Mesorhizobium ciceri bv. biserrulae WSM1271 | Isolate | Nodule |
| 1267 | 650716007 | Agrobacterium fabacearum H13-3 | Isolate | Rhizosphere |
| 1268 | 8002285264 | Aminobacter anthyllidis LMG 26462 | Isolate | Nodule |
| 1269 | 8003570095 | Agrobacterium rhizogenes GBBC3284 | Isolate | Unclassified |
| 1270 | 8003992118 | Sinorhizobium meliloti RRI128 | Isolate | Nodule |
| 1271 | 8003999396 | Sinorhizobium medicae WSM1115 | Isolate | Nodule |
| 1272 | 8004300914 | Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 | Isolate | Nodule |
| 1273 | 8004312739 | Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 | Isolate | Nodule |
| 1274 | 8004361976 | Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 | Isolate | Nodule |
| 1275 | 8004374579 | Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 | Isolate | Nodule |
| 1276 | 8004387939 | Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 | Isolate | Nodule |
| 1277 | 8004445564 | Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 | Isolate | Nodule |
| 1278 | 8004633249 | Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 | Isolate | Nodule |
| 1279 | 8004640170 | Mesorhizobium sp. GbtcB19 | Isolate | Unclassified |
| 1280 | 8004695233 | Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 | Isolate | Nodule |
| 1281 | 8004703790 | Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 | Isolate | Nodule |
| 1282 | 8004714634 | Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 | Isolate | Nodule |
| 1283 | 8004727605 | Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 | Isolate | Nodule |
| 1284 | 8005246636 | Rhizobium wuzhouense W44 | Isolate | Rhizosphere |
| 1285 | 8005258706 | Rhizobium sp. R693 | Isolate | Nodule |
| 1286 | 8005275841 | Rhizobium sp. N4311 | Isolate | Nodule |
| 1287 | 8005282627 | Rhizobium phaseoli NC1 | Isolate | Nodule |
| 1288 | 8005289223 | Rhizobium bangladeshense 1002 | Isolate | Nodule |
| 1289 | 8005301065 | Rhizobium bangladeshense 1017 | Isolate | Nodule |
| 1290 | 8005307578 | Rhizobium leguminosarum bv. phaseoli LCS0306 | Isolate | Unclassified |
| 1291 | 8005314921 | Rhizobium sp. P28RR-XV | Isolate | Rhizosphere |
| 1292 | 8005321885 | Rhizobium sp. R72 | Isolate | Nodule |
| 1293 | 8005376324 | Rhizobium changzhiense WYCCWR 11279 | Isolate | Nodule |
| 1294 | 8005382845 | Rhizobium sp. R634 | Isolate | Nodule |
| 1295 | 8005395548 | Rhizobium sp. R339 | Isolate | Nodule |
| 1296 | 8005430974 | Rhizobium phaseoli Y20 | Isolate | Nodule |
| 1297 | 8005460587 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 1298 | 8005484373 | Rhizobium tropici SARCC-755 | Isolate | Nodule |
| 1299 | 8005497431 | Rhizobium phaseoli CCGM8 | Isolate | Unclassified |
| 1300 | 8005542996 | Rhizobium grahamii CCGM3 | Isolate | Unclassified |
| 1301 | 8005556819 | Rhizobium sp. WYCCWR 11128 | Isolate | Nodule |
| 1302 | 8005563573 | Rhizobium sp. WYCCWR 11152 | Isolate | Nodule |
| 1303 | 8005570704 | Rhizobium anhuiense bv. trifolii WYCCWR10015 | Isolate | Nodule |
| 1304 | 8005619151 | Rhizobium phaseoli CCGM2 | Isolate | Unclassified |
| 1305 | 8005626139 | Rhizobium phaseoli Y18 | Isolate | Nodule |
| 1306 | 8005645114 | Rhizobium tropici IGFRI Rhizo-19 | Isolate | Rhizosphere |
| 1307 | 8005658619 | Rhizobium terrae CC-HIH110 | Isolate | Unclassified |
| 1308 | 8005668836 | Rhizobium phaseoli CCGM9 | Isolate | Unclassified |
| 1309 | 8005682033 | Rhizobium dioscoreae S-93 | Isolate | Unclassified |
| 1310 | 8005688590 | Rhizobium bangladeshense 1024 | Isolate | Nodule |
| 1311 | 8005695170 | Rhizobium sp. RMa-01 | Isolate | Unclassified |
| 1312 | 8018127388 | Rhizobium aegyptiacum 950 | Isolate | Nodule |
| 1313 | 8018163183 | Rhizobium sp. WYCCWR 11146 | Isolate | Nodule |
| 1314 | 8018176218 | Rhizobium sp. N122 | Isolate | Nodule |
| 1315 | 8023680758 | Rhizobium leguminosarum SARCC-132 | Isolate | Nodule |
| 1316 | 8024479707 | Rhizobium leguminosarum Tri-43 | Isolate | Nodule |
| 1317 | 8024486573 | Rhizobium tubonense CCBAU 85046 | Isolate | Nodule |
| 1318 | 8024501048 | Rhizobium sp. H4 | Isolate | Nodule |
| 1319 | 8046767195 | Rhizobium calliandrae CCGE524 | Isolate | Unclassified |
| 1320 | 8049293176 | Ensifer alkalisoli YIC4027 | Isolate | Nodule |
| 1321 | 8054558443 | Rhizobium alarense TRM95111 | Isolate | Nodule |
| 1322 | 8055431914 | Allorhizobium sonneratiae BGMRC 0089 | Isolate | Unclassified |
| 1323 | 8055617313 | Mesorhizobium onobrychidis OM4 | Isolate | Nodule |
| 1324 | 8056375014 | Rhizobium redzepovicii 18T | Isolate | Nodule |
| 1325 | 8056382006 | Rhizobium croatiense 13T | Isolate | Nodule |
| 1326 | 8056875544 | Rhizobium halophilum TRM95001 | Isolate | Rhizosphere |
| 1327 | 8057575449 | Rhizobium mayense CCGE526 | Isolate | Nodule |
| 1328 | 8057874678 | Rhizobium acaciae 1AS12 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 55.02 |
| Metatranscriptomes | 0.05 |
| Isolates | 44.93 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.25 |
| Bulb | 0 |
| Endosphere | 14.44 |
| Nodule | 35.21 |
| Rhizoplane | 3.16 |
| Rhizosphere | 34 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 12.94 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10000166 | 3300001979 | Bacteria | 26287 |
| 2 | JGI24735J21928_10012420 | 3300002067 | Bacteria | 2692 |
| 3 | JGI25155J39150_1000001 | 3300002704 | Bacteria | 354543 |
| 4 | JGI25156J39149_1000001 | 3300002705 | Bacteria | 354557 |
| 5 | JGI25156J39149_1004074 | 3300002705 | Bacteria | 4558 |
| 6 | JGI25162J39368_1000331 | 3300002737 | Bacteria | 41467 |
| 7 | JGI25162J39368_1001207 | 3300002737 | Bacteria | 15046 |
| 8 | JGI25154J39366_1000011 | 3300002738 | Bacteria | 296007 |
| 9 | JGI25154J39366_1007551 | 3300002738 | Bacteria | 1475 |
| 10 | JGI25158J39367_1000133 | 3300002739 | Bacteria | 17330 |
| 11 | JGI25158J39367_1000148 | 3300002739 | Bacteria | 16461 |
| 12 | JGI25157J39369_1000030 | 3300002741 | Bacteria | 146112 |
| 13 | JGI25157J39369_1001617 | 3300002741 | Bacteria | 7805 |
| 14 | JGI25152J39213_1000470 | 3300002773 | Bacteria | 23536 |
| 15 | JGI25152J39213_1000568 | 3300002773 | Bacteria | 20156 |
| 16 | JGI25152J39213_1003760 | 3300002773 | Bacteria | 5054 |
| 17 | JGI25152J39213_1004211 | 3300002773 | Bacteria | 4611 |
| 18 | JGI25152J39213_1009965 | 3300002773 | Bacteria | 2211 |
| 19 | JGI25150J39212_1000010 | 3300002774 | Bacteria | 236260 |
| 20 | JGI25159J45721_1000007 | 3300002987 | Bacteria | 176362 |
| 21 | JGI25159J45721_1000410 | 3300002987 | Bacteria | 19908 |
| 22 | JGI25159J45721_1002339 | 3300002987 | Bacteria | 7261 |
| 23 | JGI25151J46595_10000026 | 3300003187 | Bacteria | 211045 |
| 24 | JGI25151J46595_10000134 | 3300003187 | Bacteria | 98987 |
| 25 | JGI25151J46595_10013406 | 3300003187 | Bacteria | 3688 |
| 26 | JGI25151J46595_10019572 | 3300003187 | Bacteria | 2874 |
| 27 | JGI25151J46595_10032559 | 3300003187 | Bacteria | 2019 |
| 28 | JGI25151J46595_10049507 | 3300003187 | Bacteria | 1441 |
| 29 | JGI25406J46586_10030139 | 3300003203 | Bacteria | 2045 |
| 30 | JGI25165J46597_1000087 | 3300003214 | Bacteria | 170335 |
| 31 | JGI25165J46597_1000139 | 3300003214 | Bacteria | 121216 |
| 32 | JGI25165J46597_1000449 | 3300003214 | Bacteria | 41467 |
| 33 | JGI25153J46596_10000110 | 3300003215 | Bacteria | 93591 |
| 34 | JGI25153J46596_10000263 | 3300003215 | Bacteria | 41900 |
| 35 | JGI25153J46596_10001408 | 3300003215 | Bacteria | 14433 |
| 36 | JGI25153J46596_10003170 | 3300003215 | Bacteria | 9267 |
| 37 | JGI25153J46596_10004512 | 3300003215 | Bacteria | 7492 |
| 38 | JGI25153J46596_10022980 | 3300003215 | Bacteria | 2284 |
| 39 | JGI25153J46596_10060883 | 3300003215 | Bacteria | 1025 |
| 40 | rootH1_10066326 | 3300003316 | Bacteria | 3990 |
| 41 | rootH2_10116711 | 3300003320 | Bacteria | 6741 |
| 42 | rootL2_10046034 | 3300003322 | Bacteria | 10531 |
| 43 | rootH1_10128595 | 3300003323 | Bacteria | 3068 |
| 44 | JGI25160J50197_1000010 | 3300003354 | Bacteria | 279365 |
| 45 | JGI25160J50197_1000011 | 3300003354 | Bacteria | 275577 |
| 46 | JGI25160J50197_1000649 | 3300003354 | Bacteria | 19328 |
| 47 | JGI25161J50226_1000006 | 3300003374 | Bacteria | 279563 |
| 48 | JGI25161J50226_1000108 | 3300003374 | Bacteria | 65159 |
| 49 | JGI25161J50226_1000282 | 3300003374 | Bacteria | 29080 |
| 50 | JGI25161J50226_1000672 | 3300003374 | Bacteria | 13590 |
| 51 | JGI25161J50226_1004351 | 3300003374 | Bacteria | 2982 |
| 52 | Ga0055542_1000852 | 3300003762 | Bacteria | 21386 |
| 53 | Ga0055529_1006783 | 3300003763 | Bacteria | 1581 |
| 54 | Ga0055526_1000191 | 3300003771 | Bacteria | 53302 |
| 55 | Ga0055526_1001796 | 3300003771 | Bacteria | 14855 |
| 56 | Ga0055526_1005965 | 3300003771 | Bacteria | 6782 |
| 57 | Ga0055526_1007156 | 3300003771 | Bacteria | 5875 |
| 58 | Ga0055526_1027613 | 3300003771 | Bacteria | 1747 |
| 59 | Ga0055526_1029311 | 3300003771 | Bacteria | 1638 |
| 60 | Ga0055524_1000520 | 3300003775 | Bacteria | 29623 |
| 61 | Ga0055524_1004687 | 3300003775 | Bacteria | 6264 |
| 62 | Ga0055524_1008693 | 3300003775 | Bacteria | 4199 |
| 63 | Ga0055524_1012051 | 3300003775 | Bacteria | 3341 |
| 64 | Ga0055536_1003670 | 3300003781 | Bacteria | 8162 |
| 65 | Ga0055536_1033987 | 3300003781 | Bacteria | 1294 |
| 66 | Ga0055528_1001039 | 3300003790 | Bacteria | 18346 |
| 67 | Ga0055528_1001510 | 3300003790 | Bacteria | 14086 |
| 68 | Ga0055528_1003797 | 3300003790 | Bacteria | 7444 |
| 69 | Ga0055528_1006531 | 3300003790 | Bacteria | 5283 |
| 70 | Ga0055528_1009799 | 3300003790 | Bacteria | 3967 |
| 71 | Ga0055528_1013610 | 3300003790 | Bacteria | 3070 |
| 72 | Ga0055528_1016265 | 3300003790 | Bacteria | 2640 |
| 73 | Ga0055530_10009365 | 3300003791 | Bacteria | 3774 |
| 74 | Ga0055540_1000201 | 3300003792 | Bacteria | 57758 |
| 75 | Ga0055540_1002986 | 3300003792 | Bacteria | 8481 |
| 76 | Ga0055540_1006629 | 3300003792 | Bacteria | 4549 |
| 77 | Ga0055531_10008315 | 3300003794 | Bacteria | 5500 |
| 78 | Ga0055531_10009401 | 3300003794 | Bacteria | 4996 |
| 79 | Ga0055531_10019893 | 3300003794 | Bacteria | 2687 |
| 80 | Ga0058692_1000843 | 3300003856 | Bacteria | 12129 |
| 81 | Ga0058692_1001796 | 3300003856 | Bacteria | 7580 |
| 82 | Ga0055543_1000020 | 3300004625 | Bacteria | 150535 |
| 83 | Ga0055543_1000117 | 3300004625 | Bacteria | 67816 |
| 84 | Ga0055543_1000171 | 3300004625 | Bacteria | 54400 |
| 85 | Ga0055543_1000599 | 3300004625 | Bacteria | 19565 |
| 86 | Ga0055543_1002843 | 3300004625 | Bacteria | 5459 |
| 87 | Ga0065165_1000018 | 3300005262 | Bacteria | 275082 |
| 88 | Ga0065165_1000485 | 3300005262 | Bacteria | 61473 |
| 89 | Ga0065165_1004034 | 3300005262 | Bacteria | 9552 |
| 90 | Ga0065165_1004569 | 3300005262 | Bacteria | 8453 |
| 91 | Ga0065165_1028168 | 3300005262 | Bacteria | 1817 |
| 92 | Ga0068869_100397513 | 3300005334 | Bacteria | 1133 |
| 93 | Ga0070666_10236772 | 3300005335 | Bacteria | 1290 |
| 94 | Ga0070680_100066818 | 3300005336 | Bacteria | 2949 |
| 95 | Ga0070682_100062957 | 3300005337 | Unclassified | 2351 |
| 96 | Ga0070660_100013552 | 3300005339 | Bacteria | 5852 |
| 97 | Ga0070660_100157699 | 3300005339 | Bacteria | 1828 |
| 98 | Ga0070668_100454789 | 3300005347 | Bacteria | 1101 |
| 99 | Ga0070671_100076097 | 3300005355 | Bacteria | 2804 |
| 100 | Ga0070671_100103037 | 3300005355 | Bacteria | 2394 |
| 101 | Ga0070674_100045424 | 3300005356 | Bacteria | 3002 |
| 102 | Ga0070673_100010267 | 3300005364 | Bacteria | 6331 |
| 103 | Ga0070659_100166152 | 3300005366 | Bacteria | 1806 |
| 104 | Ga0070659_100394898 | 3300005366 | Bacteria | 1167 |
| 105 | Ga0070709_10094639 | 3300005434 | Bacteria | 1977 |
| 106 | Ga0070711_100120096 | 3300005439 | Bacteria | 1942 |
| 107 | Ga0070705_100022516 | 3300005440 | Bacteria | 3368 |
| 108 | Ga0070694_100058295 | 3300005444 | Bacteria | 2627 |
| 109 | Ga0070663_100007733 | 3300005455 | Bacteria | 6564 |
| 110 | Ga0070663_100077820 | 3300005455 | Bacteria | 2429 |
| 111 | Ga0070663_100491468 | 3300005455 | Bacteria | 1018 |
| 112 | Ga0070678_100038765 | 3300005456 | Bacteria | 3357 |
| 113 | Ga0070662_100246244 | 3300005457 | Bacteria | 1435 |
| 114 | Ga0070681_10041151 | 3300005458 | Bacteria | 4630 |
| 115 | Ga0068867_100446713 | 3300005459 | Bacteria | 1101 |
| 116 | Ga0070679_100124290 | 3300005530 | Unclassified | 2563 |
| 117 | Ga0068853_100008598 | 3300005539 | Bacteria | 8208 |
| 118 | Ga0068853_100054361 | 3300005539 | Bacteria | 3450 |
| 119 | Ga0068853_100555889 | 3300005539 | Bacteria | 1087 |
| 120 | Ga0070672_100097229 | 3300005543 | Bacteria | 2383 |
| 121 | Ga0070695_100007331 | 3300005545 | Bacteria | 6539 |
| 122 | Ga0070696_100007479 | 3300005546 | Bacteria | 7307 |
| 123 | Ga0070665_100014927 | 3300005548 | Bacteria | 7798 |
| 124 | Ga0070665_100172527 | 3300005548 | Bacteria | 2163 |
| 125 | Ga0070665_100577499 | 3300005548 | Bacteria | 1137 |
| 126 | Ga0070704_100192281 | 3300005549 | Bacteria | 1641 |
| 127 | Ga0068855_100412190 | 3300005563 | Bacteria | 1479 |
| 128 | Ga0068857_100229458 | 3300005577 | Bacteria | 1698 |
| 129 | Ga0068857_100267173 | 3300005577 | Bacteria | 1571 |
| 130 | Ga0068856_100153459 | 3300005614 | Bacteria | 2312 |
| 131 | Ga0068856_100188014 | 3300005614 | Bacteria | 2079 |
| 132 | Ga0068856_100336098 | 3300005614 | Bacteria | 1528 |
| 133 | Ga0070702_100005850 | 3300005615 | Bacteria | 5767 |
| 134 | Ga0068859_100461043 | 3300005617 | Bacteria | 1367 |
| 135 | Ga0068864_100542261 | 3300005618 | Bacteria | 1123 |
| 136 | Ga0068861_100549835 | 3300005719 | Bacteria | 1052 |
| 137 | Ga0068858_100134898 | 3300005842 | Bacteria | 2316 |
| 138 | Ga0068858_100497021 | 3300005842 | Bacteria | 1178 |
| 139 | Ga0068860_100034267 | 3300005843 | Bacteria | 4869 |
| 140 | Ga0068862_100344208 | 3300005844 | Bacteria | 1382 |
| 141 | Ga0068862_100388974 | 3300005844 | Bacteria | 1302 |
| 142 | Ga0081455_10000419 | 3300005937 | Bacteria | 55807 |
| 143 | Ga0081540_1045128 | 3300005983 | Bacteria | 2242 |
| 144 | Ga0081539_10001646 | 3300005985 | Bacteria | 36279 |
| 145 | Ga0070717_10225787 | 3300006028 | Bacteria | 1647 |
| 146 | Ga0075365_10003753 | 3300006038 | Bacteria | 7902 |
| 147 | Ga0075365_10005402 | 3300006038 | Bacteria | 6886 |
| 148 | Ga0075365_10034425 | 3300006038 | Bacteria | 3271 |
| 149 | Ga0075365_10113648 | 3300006038 | Bacteria | 1863 |
| 150 | Ga0075365_10230296 | 3300006038 | Bacteria | 1300 |
| 151 | Ga0075368_10001469 | 3300006042 | Bacteria | 7545 |
| 152 | Ga0075368_10005197 | 3300006042 | Bacteria | 4464 |
| 153 | Ga0075364_10001264 | 3300006051 | Bacteria | 13592 |
| 154 | Ga0075364_10002512 | 3300006051 | Bacteria | 10272 |
| 155 | Ga0075364_10004863 | 3300006051 | Bacteria | 7782 |
| 156 | Ga0075364_10014961 | 3300006051 | Bacteria | 4802 |
| 157 | Ga0075364_10022670 | 3300006051 | Bacteria | 3969 |
| 158 | Ga0075364_10023991 | 3300006051 | Bacteria | 3867 |
| 159 | Ga0075364_10093302 | 3300006051 | Bacteria | 1999 |
| 160 | Ga0075364_10150001 | 3300006051 | Bacteria | 1571 |
| 161 | Ga0070715_10119369 | 3300006163 | Bacteria | 1255 |
| 162 | Ga0075362_10002890 | 3300006177 | Bacteria | 5880 |
| 163 | Ga0075362_10021642 | 3300006177 | Bacteria | 2702 |
| 164 | Ga0075362_10037867 | 3300006177 | Bacteria | 2117 |
| 165 | Ga0075367_10001099 | 3300006178 | Bacteria | 11174 |
| 166 | Ga0075367_10005656 | 3300006178 | Bacteria | 6236 |
| 167 | Ga0075367_10051610 | 3300006178 | Bacteria | 2431 |
| 168 | Ga0075367_10100969 | 3300006178 | Bacteria | 1764 |
| 169 | Ga0075367_10110186 | 3300006178 | Bacteria | 1689 |
| 170 | Ga0075367_10247917 | 3300006178 | Bacteria | 1117 |
| 171 | Ga0075369_10002370 | 3300006186 | Bacteria | 6718 |
| 172 | Ga0075369_10002384 | 3300006186 | Bacteria | 6705 |
| 173 | Ga0075369_10004127 | 3300006186 | Bacteria | 5345 |
| 174 | Ga0075369_10070313 | 3300006186 | Bacteria | 1540 |
| 175 | Ga0075369_10106086 | 3300006186 | Bacteria | 1263 |
| 176 | Ga0075366_10000417 | 3300006195 | Bacteria | 19914 |
| 177 | Ga0075366_10116420 | 3300006195 | Bacteria | 1609 |
| 178 | Ga0075366_10263173 | 3300006195 | Bacteria | 1053 |
| 179 | Ga0075370_10004513 | 3300006353 | Bacteria | 6774 |
| 180 | Ga0075370_10047088 | 3300006353 | Bacteria | 2441 |
| 181 | Ga0075370_10057908 | 3300006353 | Bacteria | 2203 |
| 182 | Ga0075434_100129911 | 3300006871 | Bacteria | 2538 |
| 183 | Ga0097620_100461040 | 3300006931 | Bacteria | 1367 |
| 184 | Ga0079104_1000022 | 3300006946 | Bacteria | 223522 |
| 185 | Ga0079104_1002441 | 3300006946 | Bacteria | 10037 |
| 186 | Ga0079104_1007269 | 3300006946 | Bacteria | 4048 |
| 187 | Ga0099826_10000088 | 3300006948 | Bacteria | 46140 |
| 188 | Ga0099826_10006034 | 3300006948 | Bacteria | 8775 |
| 189 | Ga0075435_100059145 | 3300007076 | Bacteria | 3106 |
| 190 | Ga0075435_100082393 | 3300007076 | Bacteria | 2644 |
| 191 | Ga0075435_100314964 | 3300007076 | Bacteria | 1339 |
| 192 | Ga0105244_10084900 | 3300009036 | Bacteria | 1563 |
| 193 | Ga0105240_10000005 | 3300009093 | Bacteria | 702630 |
| 194 | Ga0105240_10252034 | 3300009093 | Bacteria | 2041 |
| 195 | Ga0105240_10295384 | 3300009093 | Bacteria | 1855 |
| 196 | Ga0105240_10443969 | 3300009093 | Bacteria | 1453 |
| 197 | Ga0105240_10472042 | 3300009093 | Bacteria | 1400 |
| 198 | Ga0111539_10408817 | 3300009094 | Bacteria | 1581 |
| 199 | Ga0105243_10006823 | 3300009148 | Bacteria | 8801 |
| 200 | Ga0105241_10606601 | 3300009174 | Bacteria | 989 |
| 201 | Ga0105248_10036988 | 3300009177 | Bacteria | 5459 |
| 202 | Ga0105248_10210616 | 3300009177 | Bacteria | 2190 |
| 203 | Ga0105237_10005428 | 3300009545 | Bacteria | 14395 |
| 204 | Ga0105237_10012219 | 3300009545 | Bacteria | 9054 |
| 205 | Ga0105237_10444322 | 3300009545 | Bacteria | 1303 |
| 206 | Ga0105237_10619111 | 3300009545 | Bacteria | 1089 |
| 207 | Ga0105237_10834477 | 3300009545 | Bacteria | 928 |
| 208 | Ga0105238_10031563 | 3300009551 | Bacteria | 5394 |
| 209 | Ga0105238_10059607 | 3300009551 | Bacteria | 3823 |
| 210 | Ga0105249_10121557 | 3300009553 | Unclassified | 2482 |
| 211 | Ga0123341_1000004 | 3300009765 | Bacteria | 153727 |
| 212 | Ga0123342_1006529 | 3300009766 | Bacteria | 16099 |
| 213 | Ga0105239_10129746 | 3300010375 | Bacteria | 2803 |
| 214 | Ga0105239_10205613 | 3300010375 | Bacteria | 2206 |
| 215 | Ga0105239_10249422 | 3300010375 | Bacteria | 1994 |
| 216 | Ga0105239_10271995 | 3300010375 | Bacteria | 1906 |
| 217 | Ga0105239_10396976 | 3300010375 | Bacteria | 1561 |
| 218 | Ga0105246_10133274 | 3300011119 | Bacteria | 1859 |
| 219 | Ga0105246_10178956 | 3300011119 | Bacteria | 1631 |
| 220 | Ga0105246_10737895 | 3300011119 | Bacteria | 867 |
| 221 | Ga0157373_10029332 | 3300013100 | Bacteria | 3962 |
| 222 | Ga0157373_10051238 | 3300013100 | Bacteria | 2941 |
| 223 | Ga0157371_10000015 | 3300013102 | Bacteria | 339838 |
| 224 | Ga0157371_10038034 | 3300013102 | Bacteria | 3444 |
| 225 | Ga0157370_10000861 | 3300013104 | Bacteria | 38538 |
| 226 | Ga0157370_10001194 | 3300013104 | Bacteria | 32395 |
| 227 | Ga0157370_10111552 | 3300013104 | Bacteria | 2556 |
| 228 | Ga0157370_10367694 | 3300013104 | Bacteria | 1325 |
| 229 | Ga0157369_10187868 | 3300013105 | Bacteria | 2172 |
| 230 | Ga0171463_1008 | 3300013249 | Bacteria | 299022 |
| 231 | Ga0157374_10299973 | 3300013296 | Bacteria | 1589 |
| 232 | Ga0157378_10500894 | 3300013297 | Bacteria | 1213 |
| 233 | Ga0163162_10932151 | 3300013306 | Bacteria | 980 |
| 234 | Ga0182008_10095506 | 3300014497 | Bacteria | 1467 |
| 235 | Ga0157379_10250380 | 3300014968 | Bacteria | 1608 |
| 236 | Ga0157379_10343555 | 3300014968 | Bacteria | 1365 |
| 237 | Ga0182006_1056158 | 3300015261 | Bacteria | 1500 |
| 238 | Ga0182007_10001955 | 3300015262 | Bacteria | 10657 |
| 239 | Ga0182005_1002400 | 3300015265 | Bacteria | 6734 |
| 240 | Ga0183363_1265 | 3300015690 | Bacteria | 8492 |
| 241 | Ga0163161_10196113 | 3300017792 | Bacteria | 1554 |
| 242 | Ga0214544_1000691 | 3300021320 | Bacteria | 64943 |
| 243 | Ga0214542_1000019 | 3300021321 | Bacteria | 199445 |
| 244 | Ga0214542_1024306 | 3300021321 | Bacteria | 3416 |
| 245 | Ga0214543_1000010 | 3300021327 | Bacteria | 364844 |
| 246 | Ga0214543_1000011 | 3300021327 | Bacteria | 344093 |
| 247 | Ga0228711_1000007 | 3300022739 | Bacteria | 202413 |
| 248 | Ga0228710_1000007 | 3300022740 | Bacteria | 189104 |
| 249 | Ga0228598_1002460 | 3300024227 | Bacteria | 4035 |
| 250 | Ga0209435_100012 | 3300025206 | Bacteria | 401621 |
| 251 | Ga0209760_102779 | 3300025207 | Bacteria | 1605 |
| 252 | Ga0209436_100439 | 3300025208 | Bacteria | 18629 |
| 253 | Ga0209436_100870 | 3300025208 | Bacteria | 12074 |
| 254 | Ga0209437_100047 | 3300025233 | Bacteria | 405163 |
| 255 | Ga0209437_100165 | 3300025233 | Bacteria | 145009 |
| 256 | Ga0207425_1000010 | 3300025245 | Bacteria | 572898 |
| 257 | Ga0207425_1001496 | 3300025245 | Bacteria | 9692 |
| 258 | Ga0207425_1004946 | 3300025245 | Bacteria | 3891 |
| 259 | Ga0207425_1036123 | 3300025245 | Bacteria | 960 |
| 260 | Ga0209646_1000026 | 3300025246 | Bacteria | 401621 |
| 261 | Ga0209646_1004022 | 3300025246 | Bacteria | 2759 |
| 262 | Ga0209026_1000002 | 3300025250 | Bacteria | 1136158 |
| 263 | Ga0209026_1000014 | 3300025250 | Bacteria | 401621 |
| 264 | Ga0209677_101402 | 3300025253 | Bacteria | 10466 |
| 265 | Ga0209148_1000072 | 3300025254 | Bacteria | 325292 |
| 266 | Ga0209759_1000012 | 3300025256 | Bacteria | 401621 |
| 267 | Ga0209759_1000062 | 3300025256 | Bacteria | 197996 |
| 268 | Ga0209129_1000069 | 3300025258 | Bacteria | 212790 |
| 269 | Ga0209129_1000197 | 3300025258 | Bacteria | 78908 |
| 270 | Ga0209129_1000817 | 3300025258 | Bacteria | 19602 |
| 271 | Ga0209129_1000939 | 3300025258 | Bacteria | 17583 |
| 272 | Ga0209129_1001103 | 3300025258 | Bacteria | 15735 |
| 273 | Ga0209129_1010409 | 3300025258 | Bacteria | 2321 |
| 274 | Ga0209233_1000027 | 3300025261 | Bacteria | 652089 |
| 275 | Ga0209233_1000048 | 3300025261 | Bacteria | 453669 |
| 276 | Ga0209233_1000069 | 3300025261 | Bacteria | 367639 |
| 277 | Ga0209233_1000195 | 3300025261 | Bacteria | 125863 |
| 278 | Ga0209455_1000329 | 3300025272 | Bacteria | 45659 |
| 279 | Ga0209673_1000013 | 3300025273 | Bacteria | 571633 |
| 280 | Ga0209673_1000048 | 3300025273 | Bacteria | 287976 |
| 281 | Ga0209673_1000552 | 3300025273 | Bacteria | 60264 |
| 282 | Ga0209673_1000959 | 3300025273 | Bacteria | 36010 |
| 283 | Ga0209673_1003109 | 3300025273 | Bacteria | 10161 |
| 284 | Ga0209673_1010825 | 3300025273 | Bacteria | 3811 |
| 285 | Ga0209673_1047577 | 3300025273 | Bacteria | 1162 |
| 286 | Ga0209130_1000004 | 3300025284 | Bacteria | 633436 |
| 287 | Ga0209130_1000021 | 3300025284 | Bacteria | 374278 |
| 288 | Ga0209130_1000029 | 3300025284 | Bacteria | 323399 |
| 289 | Ga0209676_1012295 | 3300025292 | Bacteria | 3378 |
| 290 | Ga0209025_1000022 | 3300025294 | Bacteria | 574487 |
| 291 | Ga0209025_1000033 | 3300025294 | Bacteria | 414511 |
| 292 | Ga0209025_1000094 | 3300025294 | Bacteria | 241080 |
| 293 | Ga0209025_1000119 | 3300025294 | Bacteria | 210606 |
| 294 | Ga0209025_1000166 | 3300025294 | Bacteria | 164692 |
| 295 | Ga0209025_1001272 | 3300025294 | Bacteria | 34703 |
| 296 | Ga0209025_1010738 | 3300025294 | Bacteria | 6158 |
| 297 | Ga0209025_1015850 | 3300025294 | Bacteria | 4502 |
| 298 | Ga0209025_1028708 | 3300025294 | Bacteria | 2716 |
| 299 | Ga0209025_1035421 | 3300025294 | Bacteria | 2256 |
| 300 | Ga0209025_1052144 | 3300025294 | Bacteria | 1618 |
| 301 | Ga0209564_1000273 | 3300025295 | Bacteria | 108165 |
| 302 | Ga0209564_1000288 | 3300025295 | Bacteria | 102088 |
| 303 | Ga0209564_1000469 | 3300025295 | Bacteria | 67659 |
| 304 | Ga0209564_1001482 | 3300025295 | Bacteria | 23692 |
| 305 | Ga0209564_1021130 | 3300025295 | Bacteria | 2354 |
| 306 | Ga0209758_1000075 | 3300025297 | Bacteria | 271585 |
| 307 | Ga0209758_1000086 | 3300025297 | Bacteria | 254778 |
| 308 | Ga0209758_1000087 | 3300025297 | Bacteria | 254384 |
| 309 | Ga0209758_1000218 | 3300025297 | Bacteria | 124300 |
| 310 | Ga0209758_1000384 | 3300025297 | Bacteria | 76474 |
| 311 | Ga0209758_1000629 | 3300025297 | Bacteria | 54026 |
| 312 | Ga0209758_1000749 | 3300025297 | Bacteria | 47284 |
| 313 | Ga0209758_1001310 | 3300025297 | Bacteria | 30349 |
| 314 | Ga0209758_1005350 | 3300025297 | Bacteria | 9954 |
| 315 | Ga0209758_1014353 | 3300025297 | Bacteria | 4221 |
| 316 | Ga0209758_1028882 | 3300025297 | Bacteria | 2334 |
| 317 | Ga0209050_1005022 | 3300025298 | Bacteria | 8593 |
| 318 | Ga0209050_1011079 | 3300025298 | Bacteria | 4332 |
| 319 | Ga0209256_1000194 | 3300025299 | Bacteria | 116709 |
| 320 | Ga0209256_1000371 | 3300025299 | Bacteria | 72192 |
| 321 | Ga0209256_1001625 | 3300025299 | Bacteria | 21916 |
| 322 | Ga0209256_1002003 | 3300025299 | Bacteria | 18218 |
| 323 | Ga0209256_1002513 | 3300025299 | Bacteria | 14748 |
| 324 | Ga0209256_1003035 | 3300025299 | Bacteria | 12390 |
| 325 | Ga0209256_1010879 | 3300025299 | Bacteria | 3735 |
| 326 | Ga0207426_1000003 | 3300025302 | Bacteria | 1063212 |
| 327 | Ga0207426_1000010 | 3300025302 | Bacteria | 796003 |
| 328 | Ga0207426_1000039 | 3300025302 | Bacteria | 439937 |
| 329 | Ga0207426_1000074 | 3300025302 | Bacteria | 323399 |
| 330 | Ga0207426_1001010 | 3300025302 | Bacteria | 27314 |
| 331 | Ga0207426_1001731 | 3300025302 | Bacteria | 16650 |
| 332 | Ga0207426_1042112 | 3300025302 | Bacteria | 1411 |
| 333 | Ga0209051_1000142 | 3300025303 | Bacteria | 135337 |
| 334 | Ga0209051_1000723 | 3300025303 | Bacteria | 35964 |
| 335 | Ga0209051_1001634 | 3300025303 | Bacteria | 18181 |
| 336 | Ga0209051_1008600 | 3300025303 | Bacteria | 5382 |
| 337 | Ga0209051_1033591 | 3300025303 | Bacteria | 1937 |
| 338 | Ga0209051_1045978 | 3300025303 | Bacteria | 1505 |
| 339 | Ga0209257_1000795 | 3300025304 | Bacteria | 46064 |
| 340 | Ga0209257_1001864 | 3300025304 | Bacteria | 22869 |
| 341 | Ga0209257_1003242 | 3300025304 | Bacteria | 14301 |
| 342 | Ga0209257_1014247 | 3300025304 | Bacteria | 3433 |
| 343 | Ga0209257_1022999 | 3300025304 | Bacteria | 2205 |
| 344 | Ga0207688_10241251 | 3300025901 | Bacteria | 1093 |
| 345 | Ga0207647_10008647 | 3300025904 | Bacteria | 7277 |
| 346 | Ga0207699_10154046 | 3300025906 | Bacteria | 1524 |
| 347 | Ga0207645_10141288 | 3300025907 | Bacteria | 1569 |
| 348 | Ga0207645_10293898 | 3300025907 | Bacteria | 1081 |
| 349 | Ga0207707_10076955 | 3300025912 | Bacteria | 2912 |
| 350 | Ga0207695_10000011 | 3300025913 | Bacteria | 910221 |
| 351 | Ga0207695_10125922 | 3300025913 | Bacteria | 2524 |
| 352 | Ga0207695_10152526 | 3300025913 | Bacteria | 2249 |
| 353 | Ga0207695_10238269 | 3300025913 | Bacteria | 1721 |
| 354 | Ga0207671_10000804 | 3300025914 | Bacteria | 39792 |
| 355 | Ga0207671_10115590 | 3300025914 | Bacteria | 2046 |
| 356 | Ga0207693_10153669 | 3300025915 | Bacteria | 1810 |
| 357 | Ga0207663_10033876 | 3300025916 | Bacteria | 3047 |
| 358 | Ga0207660_10023384 | 3300025917 | Bacteria | 4173 |
| 359 | Ga0207657_10019384 | 3300025919 | Bacteria | 6462 |
| 360 | Ga0207657_10055298 | 3300025919 | Bacteria | 3429 |
| 361 | Ga0207694_10121901 | 3300025924 | Bacteria | 2082 |
| 362 | Ga0207694_10122626 | 3300025924 | Bacteria | 2076 |
| 363 | Ga0207687_10141056 | 3300025927 | Bacteria | 1828 |
| 364 | Ga0207700_10271993 | 3300025928 | Bacteria | 1454 |
| 365 | Ga0207664_10073102 | 3300025929 | Bacteria | 2766 |
| 366 | Ga0207644_10038112 | 3300025931 | Bacteria | 3384 |
| 367 | Ga0207644_10046328 | 3300025931 | Bacteria | 3097 |
| 368 | Ga0207690_10034852 | 3300025932 | Bacteria | 3246 |
| 369 | Ga0207690_10208170 | 3300025932 | Bacteria | 1489 |
| 370 | Ga0207706_10149500 | 3300025933 | Bacteria | 2054 |
| 371 | Ga0207691_10066544 | 3300025940 | Bacteria | 3260 |
| 372 | Ga0207711_10082775 | 3300025941 | Bacteria | 2806 |
| 373 | Ga0207689_10384522 | 3300025942 | Bacteria | 1169 |
| 374 | Ga0207689_10578837 | 3300025942 | Bacteria | 944 |
| 375 | Ga0207661_10501699 | 3300025944 | Bacteria | 1109 |
| 376 | Ga0207679_10168546 | 3300025945 | Bacteria | 1800 |
| 377 | Ga0207667_10368231 | 3300025949 | Bacteria | 1465 |
| 378 | Ga0207651_10069164 | 3300025960 | Bacteria | 2492 |
| 379 | Ga0207712_10288509 | 3300025961 | Bacteria | 1342 |
| 380 | Ga0207712_10290128 | 3300025961 | Bacteria | 1338 |
| 381 | Ga0207668_10165588 | 3300025972 | Bacteria | 1728 |
| 382 | Ga0207668_10168636 | 3300025972 | Bacteria | 1715 |
| 383 | Ga0207668_10448162 | 3300025972 | Bacteria | 1101 |
| 384 | Ga0207668_10497691 | 3300025972 | Bacteria | 1048 |
| 385 | Ga0207658_10241812 | 3300025986 | Bacteria | 1530 |
| 386 | Ga0207703_10111849 | 3300026035 | Unclassified | 2332 |
| 387 | Ga0207703_10206470 | 3300026035 | Bacteria | 1749 |
| 388 | Ga0207703_10352652 | 3300026035 | Bacteria | 1355 |
| 389 | Ga0207703_10483042 | 3300026035 | Bacteria | 1161 |
| 390 | Ga0207639_10091893 | 3300026041 | Bacteria | 2431 |
| 391 | Ga0207639_10389234 | 3300026041 | Bacteria | 1254 |
| 392 | Ga0207639_10642175 | 3300026041 | Bacteria | 981 |
| 393 | Ga0207678_10002469 | 3300026067 | Bacteria | 16796 |
| 394 | Ga0207678_10018602 | 3300026067 | Bacteria | 6099 |
| 395 | Ga0207678_10027650 | 3300026067 | Bacteria | 4950 |
| 396 | Ga0207678_10078531 | 3300026067 | Bacteria | 2827 |
| 397 | Ga0207678_10083182 | 3300026067 | Bacteria | 2738 |
| 398 | Ga0207678_10153009 | 3300026067 | Bacteria | 1970 |
| 399 | Ga0207702_10119691 | 3300026078 | Bacteria | 2355 |
| 400 | Ga0207702_10152250 | 3300026078 | Bacteria | 2105 |
| 401 | Ga0207648_10243476 | 3300026089 | Bacteria | 1602 |
| 402 | Ga0207674_10077701 | 3300026116 | Bacteria | 3325 |
| 403 | Ga0207674_10107388 | 3300026116 | Unclassified | 2768 |
| 404 | Ga0207674_10618452 | 3300026116 | Bacteria | 1046 |
| 405 | Ga0207675_100097538 | 3300026118 | Bacteria | 2768 |
| 406 | Ga0207683_10059560 | 3300026121 | Bacteria | 3354 |
| 407 | Ga0207698_10079523 | 3300026142 | Bacteria | 2637 |
| 408 | Ga0209281_1000128 | 3300027111 | Bacteria | 199265 |
| 409 | Ga0209281_1000538 | 3300027111 | Bacteria | 47771 |
| 410 | Ga0209281_1000864 | 3300027111 | Bacteria | 26486 |
| 411 | Ga0209371_1000178 | 3300027312 | Bacteria | 93894 |
| 412 | Ga0209371_1000621 | 3300027312 | Bacteria | 31605 |
| 413 | Ga0209371_1005448 | 3300027312 | Bacteria | 5053 |
| 414 | Ga0209282_1000034 | 3300027666 | Bacteria | 140100 |
| 415 | Ga0209282_1000372 | 3300027666 | Bacteria | 21889 |
| 416 | Ga0209282_1004392 | 3300027666 | Bacteria | 8488 |
| 417 | Ga0209813_10005200 | 3300027866 | Bacteria | 3147 |
| 418 | Ga0268266_10017817 | 3300028379 | Bacteria | 6053 |
| 419 | Ga0268266_10050734 | 3300028379 | Bacteria | 3560 |
| 420 | Ga0307515_10000198 | 3300028794 | Bacteria | 147738 |
| 421 | Ga0307515_10000656 | 3300028794 | Bacteria | 79816 |
| 422 | Ga0307515_10007800 | 3300028794 | Bacteria | 21064 |
| 423 | Ga0307515_10015486 | 3300028794 | Bacteria | 14044 |
| 424 | Ga0268256_1001287 | 3300030500 | Bacteria | 15519 |
| 425 | Ga0268256_1004786 | 3300030500 | Bacteria | 5501 |
| 426 | Ga0268256_1005356 | 3300030500 | Bacteria | 5053 |
| 427 | Ga0316181_1240954 | 3300030744 | Bacteria | 3022 |
| 428 | Ga0307513_10019835 | 3300031456 | Bacteria | 7991 |
| 429 | Ga0307408_100125221 | 3300031548 | Bacteria | 1997 |
| 430 | Ga0307408_100306544 | 3300031548 | Bacteria | 1332 |
| 431 | Ga0307408_100405441 | 3300031548 | Bacteria | 1172 |
| 432 | Ga0316575_10015584 | 3300031665 | Bacteria | 2867 |
| 433 | Ga0265314_10015665 | 3300031711 | Bacteria | 6009 |
| 434 | Ga0316576_10267750 | 3300031727 | Bacteria | 1281 |
| 435 | Ga0316578_10013064 | 3300031728 | Bacteria | 4392 |
| 436 | Ga0307405_10005745 | 3300031731 | Bacteria | 6029 |
| 437 | Ga0307405_10097793 | 3300031731 | Bacteria | 1961 |
| 438 | Ga0307405_10117606 | 3300031731 | Bacteria | 1813 |
| 439 | Ga0307412_10000449 | 3300031911 | Bacteria | 24913 |
| 440 | Ga0307412_10433599 | 3300031911 | Bacteria | 1078 |
| 441 | Ga0315914_1000010 | 3300031967 | Bacteria | 171642 |
| 442 | Ga0307409_100382880 | 3300031995 | Bacteria | 1338 |
| 443 | Ga0307416_100208919 | 3300032002 | Bacteria | 1860 |
| 444 | Ga0307414_10240394 | 3300032004 | Bacteria | 1499 |
| 445 | Ga0316583_10016742 | 3300032133 | Bacteria | 2636 |
| 446 | Ga0315913_1000005 | 3300033430 | Bacteria | 171651 |
| 447 | Ga0315915_1000012 | 3300033464 | Bacteria | 199284 |
| 448 | Ga0373929_0016640 | 3300035085 | Bacteria | 1443 |
| 449 | Ga0373936_0001937 | 3300035113 | Bacteria | 7654 |
| 450 | Ga0373936_0035998 | 3300035113 | Bacteria | 1972 |
| 451 | Ga0373945_0001585 | 3300035116 | Bacteria | 6968 |
| 452 | Ga0373945_0012768 | 3300035116 | Bacteria | 2795 |
| 453 | Ga0373953_0001305 | 3300035117 | Bacteria | 7138 |
| 454 | Ga0373953_0011755 | 3300035117 | Bacteria | 3083 |
| 455 | Ga0373953_0030857 | 3300035117 | Bacteria | 2081 |
| 456 | Ga0373954_0018425 | 3300035118 | Bacteria | 3143 |
| 457 | Ga0373956_0004598 | 3300035119 | Bacteria | 5515 |
| 458 | Ga0373956_0013030 | 3300035119 | Bacteria | 3457 |
| 459 | Ga0373957_0019954 | 3300035120 | Bacteria | 2364 |
| 460 | Ga0373946_0123186 | 3300035171 | Bacteria | 1185 |
| 461 | Ga0373946_0139516 | 3300035171 | Bacteria | 1122 |
| 462 | Ga0373955_0000213 | 3300035172 | Bacteria | 24300 |
| 463 | Ga0373955_0147427 | 3300035172 | Bacteria | 1383 |
| 464 | Ga0316574_0007201 | 3300035398 | Bacteria | 6080 |
| 465 | Ga0316574_0366422 | 3300035398 | Bacteria | 910 |
| 466 | Ga0373931_0345240 | 3300035691 | Bacteria | 930 |
| 467 | Ga0373935_0000131 | 3300035692 | Bacteria | 34019 |
| 468 | Ga0373935_0009153 | 3300035692 | Bacteria | 5927 |
| 469 | Ga0373935_0024391 | 3300035692 | Bacteria | 3723 |
| 470 | Ga0373935_0030875 | 3300035692 | Bacteria | 3322 |
| 471 | Ga0373935_0042425 | 3300035692 | Bacteria | 2861 |
| 472 | Ga0373935_0060761 | 3300035692 | Bacteria | 2418 |
| 473 | Ga0373927_0000147 | 3300035695 | Bacteria | 55399 |
| 474 | Ga0373927_0014897 | 3300035695 | Bacteria | 5143 |
| 475 | Ga0373927_0025227 | 3300035695 | Bacteria | 3885 |
| 476 | Ga0373933_0003159 | 3300035724 | Bacteria | 9200 |
| 477 | Ga0373933_0014822 | 3300035724 | Bacteria | 4337 |
| 478 | Ga0373933_0053964 | 3300035724 | Bacteria | 2407 |
| 479 | Ga0373947_0002523 | 3300035725 | Bacteria | 11003 |
| 480 | Ga0373947_0023677 | 3300035725 | Bacteria | 3574 |
| 481 | Ga0373947_0279101 | 3300035725 | Bacteria | 1110 |
| 482 | Ga0373937_0000293 | 3300036401 | Bacteria | 47507 |
| 483 | Ga0373937_0001336 | 3300036401 | Bacteria | 20629 |
| 484 | Ga0373937_0024713 | 3300036401 | Bacteria | 5421 |
| 485 | Ga0373937_0026411 | 3300036401 | Bacteria | 5247 |
| 486 | Ga0373937_0067560 | 3300036401 | Bacteria | 3294 |
| 487 | Ga0373937_0177870 | 3300036401 | Bacteria | 1997 |
| 488 | Ga0373937_0805842 | 3300036401 | Bacteria | 887 |
| 489 | Ga0316582_0144311 | 3300036647 | Bacteria | 1606 |
| 490 | Ga0316584_0016716 | 3300036712 | Bacteria | 5264 |
| 491 | Ga0373925_0000087 | 3300037068 | Bacteria | 99043 |
| 492 | Ga0373925_0007077 | 3300037068 | Bacteria | 8198 |
| 493 | Ga0373925_0041897 | 3300037068 | Bacteria | 3396 |
| 494 | Ga0373925_0214808 | 3300037068 | Bacteria | 1533 |
| 495 | Ga0395899_0000073 | 3300037312 | Bacteria | 181387 |
| 496 | Ga0395899_0235955 | 3300037312 | Bacteria | 1261 |
| 497 | Ga0395899_0402979 | 3300037312 | Bacteria | 905 |
| 498 | Ga0395900_0000027 | 3300037418 | Bacteria | 285957 |
| 499 | Ga0395900_0136486 | 3300037418 | Bacteria | 2513 |
| 500 | Ga0395900_0289467 | 3300037418 | Bacteria | 1627 |
| 501 | Ga0395898_0000043 | 3300037466 | Bacteria | 301783 |
| 502 | Ga0395898_0294943 | 3300037466 | Bacteria | 1547 |
| 503 | Ga0395905_0000032 | 3300037471 | Bacteria | 285932 |
| 504 | Ga0395905_0005236 | 3300037471 | Bacteria | 13273 |
| 505 | Ga0395905_0041067 | 3300037471 | Bacteria | 4340 |
| 506 | Ga0395905_0062219 | 3300037471 | Bacteria | 3491 |
| 507 | Ga0395905_0181248 | 3300037471 | Bacteria | 1977 |
| 508 | Ga0395905_0281100 | 3300037471 | Bacteria | 1550 |
| 509 | Ga0395905_0358766 | 3300037471 | Bacteria | 1350 |
| 510 | Ga0436364_1553897 | 3300037853 | Bacteria | 2217 |
| 511 | Ga0395901_0000056 | 3300038443 | Bacteria | 154356 |
| 512 | Ga0395901_0096884 | 3300038443 | Bacteria | 3092 |
| 513 | Ga0395901_0178660 | 3300038443 | Bacteria | 2226 |
| 514 | Ga0395901_0187019 | 3300038443 | Bacteria | 2172 |
| 515 | Ga0395901_0267695 | 3300038443 | Bacteria | 1778 |
| 516 | Ga0400486_12421 | 3300038742 | Bacteria | 1289 |
| 517 | Ga0436365_1820406 | 3300039437 | Bacteria | 4408 |
| 518 | Ga0436360_0982192 | 3300039438 | Bacteria | 2517 |
| 519 | Ga0439438_047014 | 3300041405 | Bacteria | 1107 |
| 520 | Ga0439439_0039344 | 3300041406 | Bacteria | 1222 |
| 521 | Ga0439439_0040060 | 3300041406 | Bacteria | 1212 |
| 522 | Ga0439466_0058972 | 3300041411 | Bacteria | 1241 |
| 523 | Ga0439465_0003539 | 3300041413 | Bacteria | 5090 |
| 524 | Ga0439465_0009350 | 3300041413 | Bacteria | 3088 |
| 525 | Ga0439465_0094901 | 3300041413 | Bacteria | 1024 |
| 526 | Ga0451787_223311 | 3300041441 | Bacteria | 3821 |
| 527 | Ga0451793_1350958 | 3300041452 | Bacteria | 1419 |
| 528 | Ga0451795_1607243 | 3300041456 | Bacteria | 1182 |
| 529 | Ga0451798_0200031 | 3300041458 | Bacteria | 3660 |
| 530 | Ga0451833_1421423 | 3300041491 | Bacteria | 1809 |
| 531 | Ga0451835_0113922 | 3300041492 | Bacteria | 1481 |
| 532 | Ga0451839_0358112 | 3300041496 | Bacteria | 2727 |
| 533 | Ga0451841_0003394 | 3300041498 | Bacteria | 941 |
| 534 | Ga0451845_0403951 | 3300041501 | Bacteria | 2133 |
| 535 | Ga0452268_09468 | 3300041907 | Bacteria | 1743 |
| 536 | Ga0439449_0074392 | 3300042007 | Bacteria | 1252 |
| 537 | Ga0466961_0142275 | 3300044693 | Bacteria | 1501 |
| 538 | Ga0466963_0091702 | 3300044694 | Bacteria | 2070 |
| 539 | Ga0466963_0206435 | 3300044694 | Bacteria | 1374 |
| 540 | Ga0466970_0003056 | 3300044765 | Bacteria | 8124 |
| 541 | Ga0466959_0039377 | 3300045049 | Bacteria | 3493 |
| 542 | Ga0451576_0455335 | 3300045051 | Bacteria | 1343 |
| 543 | Ga0466967_0093353 | 3300045976 | Bacteria | 2738 |
| 544 | Ga0495592_0000001 | 3300046454 | Bacteria | 305819 |
| 545 | Ga0495592_0013394 | 3300046454 | Bacteria | 6241 |
| 546 | Ga0495592_0191825 | 3300046454 | Bacteria | 1384 |
| 547 | Ga0495592_0242406 | 3300046454 | Bacteria | 1195 |
| 548 | Ga0495603_0041109 | 3300046455 | Bacteria | 2765 |
| 549 | Ga0495603_0104030 | 3300046455 | Bacteria | 1657 |
| 550 | Ga0495590_0038560 | 3300046457 | Bacteria | 1666 |
| 551 | Ga0495629_0000401 | 3300046459 | Bacteria | 36430 |
| 552 | Ga0495629_0010498 | 3300046459 | Bacteria | 6737 |
| 553 | Ga0495629_0011315 | 3300046459 | Bacteria | 6482 |
| 554 | Ga0495638_0000145 | 3300046460 | Bacteria | 112275 |
| 555 | Ga0495638_0002113 | 3300046460 | Bacteria | 16763 |
| 556 | Ga0495638_0013340 | 3300046460 | Bacteria | 5600 |
| 557 | Ga0495638_0023397 | 3300046460 | Bacteria | 4040 |
| 558 | Ga0495638_0035740 | 3300046460 | Bacteria | 3166 |
| 559 | Ga0495638_0113396 | 3300046460 | Bacteria | 1608 |
| 560 | Ga0495651_0001675 | 3300046462 | Bacteria | 17143 |
| 561 | Ga0495651_0119946 | 3300046462 | Bacteria | 1934 |
| 562 | Ga0495651_0128903 | 3300046462 | Bacteria | 1849 |
| 563 | Ga0495653_0000015 | 3300046463 | Bacteria | 213697 |
| 564 | Ga0495653_0073254 | 3300046463 | Bacteria | 2556 |
| 565 | Ga0495653_0073882 | 3300046463 | Bacteria | 2543 |
| 566 | Ga0495650_0040565 | 3300046471 | Bacteria | 1997 |
| 567 | Ga0495582_0168722 | 3300046473 | Bacteria | 1246 |
| 568 | Ga0495605_0000715 | 3300046474 | Bacteria | 24441 |
| 569 | Ga0495662_0000957 | 3300046476 | Bacteria | 14125 |
| 570 | Ga0495664_0000001 | 3300046477 | Bacteria | 757730 |
| 571 | Ga0495585_0015627 | 3300046492 | Bacteria | 4409 |
| 572 | Ga0495585_0055210 | 3300046492 | Bacteria | 2195 |
| 573 | Ga0495594_0011198 | 3300046499 | Bacteria | 4657 |
| 574 | Ga0495583_0004528 | 3300046506 | Bacteria | 9897 |
| 575 | Ga0495583_0061171 | 3300046506 | Bacteria | 1681 |
| 576 | Ga0495606_0001788 | 3300046507 | Bacteria | 27355 |
| 577 | Ga0495606_0182851 | 3300046507 | Bacteria | 1207 |
| 578 | Ga0495606_0218901 | 3300046507 | Bacteria | 1074 |
| 579 | Ga0495608_0000066 | 3300046511 | Bacteria | 81664 |
| 580 | Ga0495608_0000442 | 3300046511 | Bacteria | 28963 |
| 581 | Ga0495608_0067504 | 3300046511 | Bacteria | 2339 |
| 582 | Ga0495610_0003504 | 3300046512 | Bacteria | 12191 |
| 583 | Ga0495610_0052350 | 3300046512 | Bacteria | 1982 |
| 584 | Ga0495616_0004639 | 3300046513 | Bacteria | 8628 |
| 585 | Ga0495618_0000021 | 3300046514 | Bacteria | 129750 |
| 586 | Ga0495620_0021715 | 3300046515 | Bacteria | 3110 |
| 587 | Ga0495628_0000005 | 3300046516 | Bacteria | 420969 |
| 588 | Ga0495628_0111604 | 3300046516 | Bacteria | 2102 |
| 589 | Ga0495630_0000254 | 3300046517 | Bacteria | 43049 |
| 590 | Ga0495630_0058818 | 3300046517 | Bacteria | 2882 |
| 591 | Ga0495631_0001131 | 3300046518 | Bacteria | 16535 |
| 592 | Ga0495632_0008494 | 3300046519 | Bacteria | 6295 |
| 593 | Ga0495632_0008869 | 3300046519 | Bacteria | 6115 |
| 594 | Ga0495632_0100761 | 3300046519 | Bacteria | 1362 |
| 595 | Ga0495637_0036141 | 3300046520 | Bacteria | 2154 |
| 596 | Ga0495643_0014754 | 3300046522 | Bacteria | 4640 |
| 597 | Ga0495643_0018816 | 3300046522 | Bacteria | 4002 |
| 598 | Ga0495648_0005337 | 3300046524 | Bacteria | 10711 |
| 599 | Ga0495648_0019014 | 3300046524 | Bacteria | 4845 |
| 600 | Ga0495648_0034773 | 3300046524 | Bacteria | 3275 |
| 601 | Ga0495648_0140771 | 3300046524 | Bacteria | 1270 |
| 602 | Ga0495648_0149306 | 3300046524 | Bacteria | 1221 |
| 603 | Ga0495652_0000001 | 3300046529 | Bacteria | 1045081 |
| 604 | Ga0495652_0177606 | 3300046529 | Bacteria | 1637 |
| 605 | Ga0495654_0000315 | 3300046530 | Bacteria | 42530 |
| 606 | Ga0495654_0096625 | 3300046530 | Bacteria | 1365 |
| 607 | Ga0495640_0000006 | 3300046533 | Bacteria | 285419 |
| 608 | Ga0495640_0060368 | 3300046533 | Bacteria | 2579 |
| 609 | Ga0495640_0299459 | 3300046533 | Bacteria | 999 |
| 610 | Ga0495587_0000012 | 3300046536 | Bacteria | 197088 |
| 611 | Ga0495587_0044458 | 3300046536 | Bacteria | 2642 |
| 612 | Ga0495587_0071017 | 3300046536 | Bacteria | 2025 |
| 613 | Ga0495609_0078224 | 3300046538 | Bacteria | 1448 |
| 614 | Ga0495597_0028981 | 3300046542 | Bacteria | 2530 |
| 615 | Ga0495645_0000041 | 3300046543 | Bacteria | 92278 |
| 616 | Ga0495622_0069319 | 3300046557 | Bacteria | 1628 |
| 617 | Ga0495667_0000001 | 3300046559 | Bacteria | 834831 |
| 618 | Ga0495667_0041089 | 3300046559 | Bacteria | 3068 |
| 619 | Ga0495667_0056015 | 3300046559 | Bacteria | 2593 |
| 620 | Ga0495656_0492283 | 3300046615 | Bacteria | 649 |
| 621 | Ga0495668_0043818 | 3300046616 | Bacteria | 2487 |
| 622 | Ga0495668_0104353 | 3300046616 | Bacteria | 1551 |
| 623 | Ga0495634_0000624 | 3300046642 | Bacteria | 34336 |
| 624 | Ga0495611_0008325 | 3300046648 | Bacteria | 4392 |
| 625 | Ga0495625_0002190 | 3300046660 | Bacteria | 21683 |
| 626 | Ga0495625_0059346 | 3300046660 | Bacteria | 2715 |
| 627 | Ga0495625_0147457 | 3300046660 | Bacteria | 1583 |
| 628 | Ga0495625_0237881 | 3300046660 | Bacteria | 1187 |
| 629 | Ga0495625_0327300 | 3300046660 | Bacteria | 974 |
| 630 | Ga0495635_0000007 | 3300046663 | Bacteria | 278786 |
| 631 | Ga0495635_0019774 | 3300046663 | Bacteria | 4691 |
| 632 | Ga0495635_0062717 | 3300046663 | Bacteria | 2553 |
| 633 | Ga0495635_0063779 | 3300046663 | Bacteria | 2530 |
| 634 | Ga0495635_0311267 | 3300046663 | Bacteria | 1055 |
| 635 | Ga0495588_0041178 | 3300046674 | Bacteria | 2358 |
| 636 | Ga0495588_0241404 | 3300046674 | Bacteria | 953 |
| 637 | Ga0495657_0000047 | 3300046675 | Bacteria | 104362 |
| 638 | Ga0495657_0040502 | 3300046675 | Bacteria | 3195 |
| 639 | Ga0495657_0081415 | 3300046675 | Bacteria | 2094 |
| 640 | Ga0495657_0112356 | 3300046675 | Bacteria | 1725 |
| 641 | Ga0495657_0265480 | 3300046675 | Bacteria | 1030 |
| 642 | Ga0495599_0000002 | 3300046678 | Bacteria | 348168 |
| 643 | Ga0495599_0073355 | 3300046678 | Bacteria | 2136 |
| 644 | Ga0495623_0000023 | 3300046679 | Bacteria | 96650 |
| 645 | Ga0495623_0198428 | 3300046679 | Bacteria | 1155 |
| 646 | Ga0495646_0000024 | 3300046680 | Bacteria | 107836 |
| 647 | Ga0495646_0010351 | 3300046680 | Bacteria | 5932 |
| 648 | Ga0495658_0000265 | 3300046683 | Bacteria | 29770 |
| 649 | Ga0495613_0170939 | 3300046689 | Bacteria | 1542 |
| 650 | Ga0495624_0011265 | 3300046690 | Bacteria | 6150 |
| 651 | Ga0495670_0068696 | 3300046691 | Bacteria | 1791 |
| 652 | Ga0495671_0197205 | 3300046692 | Bacteria | 977 |
| 653 | Ga0495600_0000013 | 3300046809 | Bacteria | 119404 |
| 654 | Ga0495581_0009849 | 3300047315 | Bacteria | 5530 |
| 655 | Ga0495604_0000007 | 3300047317 | Bacteria | 412174 |
| 656 | Ga0495604_0006585 | 3300047317 | Bacteria | 9206 |
| 657 | Ga0495604_0024912 | 3300047317 | Bacteria | 4771 |
| 658 | Ga0495604_0183907 | 3300047317 | Bacteria | 1460 |
| 659 | Ga0495674_0000001 | 3300047319 | Bacteria | 778665 |
| 660 | Ga0495674_0049741 | 3300047319 | Bacteria | 3702 |
| 661 | Ga0495674_0123895 | 3300047319 | Bacteria | 2182 |
| 662 | Ga0495672_0006422 | 3300047320 | Bacteria | 9109 |
| 663 | Ga0495672_0019795 | 3300047320 | Bacteria | 4429 |
| 664 | Ga0495672_0155244 | 3300047320 | Bacteria | 1183 |
| 665 | Ga0495676_0031404 | 3300047321 | Bacteria | 4493 |
| 666 | Ga0495680_0001437 | 3300047322 | Bacteria | 25662 |
| 667 | Ga0495680_0030613 | 3300047322 | Bacteria | 4393 |
| 668 | Ga0495680_0058117 | 3300047322 | Bacteria | 2989 |
| 669 | Ga0495680_0105083 | 3300047322 | Bacteria | 2100 |
| 670 | Ga0495675_0000014 | 3300047444 | Bacteria | 137646 |
| 671 | Ga0495675_0016294 | 3300047444 | Bacteria | 4701 |
| 672 | Ga0495685_047916 | 3300047447 | Bacteria | 1453 |
| 673 | Ga0495681_0004088 | 3300047470 | Bacteria | 10039 |
| 674 | Ga0495684_0000027 | 3300047471 | Bacteria | 124367 |
| 675 | Ga0495684_0133030 | 3300047471 | Bacteria | 1867 |
| 676 | Ga0495684_0148862 | 3300047471 | Bacteria | 1751 |
| 677 | Ga0495684_0183592 | 3300047471 | Bacteria | 1550 |
| 678 | Ga0495686_0000761 | 3300047472 | Bacteria | 42521 |
| 679 | Ga0495686_0035591 | 3300047472 | Bacteria | 3199 |
| 680 | Ga0495686_0044364 | 3300047472 | Bacteria | 2815 |
| 681 | Ga0495593_0002819 | 3300047673 | Bacteria | 10465 |
| 682 | Ga0495593_0051458 | 3300047673 | Bacteria | 2179 |
| 683 | Ga0495602_0000004 | 3300048088 | Bacteria | 326932 |
| 684 | Ga0495602_0024539 | 3300048088 | Bacteria | 5850 |
| 685 | Ga0495602_0037412 | 3300048088 | Bacteria | 4505 |
| 686 | Ga0495602_0162113 | 3300048088 | Bacteria | 1745 |
| 687 | Ga0495614_0137373 | 3300048089 | Bacteria | 1085 |
| 688 | Ga0495615_0023537 | 3300048090 | Bacteria | 1412 |
| 689 | Ga0495615_0073354 | 3300048090 | Bacteria | 926 |
| 690 | Ga0496100_0074169 | 3300048903 | Unclassified | 2279 |
| 691 | Ga0496100_0154624 | 3300048903 | Bacteria | 1639 |
| 692 | Ga0496100_0210136 | 3300048903 | Bacteria | 1423 |
| 693 | Ga0496100_0233027 | 3300048903 | Bacteria | 1355 |
| 694 | Ga0496101_0117487 | 3300048904 | Bacteria | 2008 |
| 695 | Ga0496101_0177400 | 3300048904 | Bacteria | 1639 |
| 696 | Ga0496101_0213875 | 3300048904 | Bacteria | 1494 |
| 697 | Ga0496102_0208481 | 3300048905 | Bacteria | 1842 |
| 698 | Ga0496102_0379779 | 3300048905 | Bacteria | 1330 |
| 699 | Ga0496102_0710548 | 3300048905 | Bacteria | 928 |
| 700 | Ga0496103_0001223 | 3300048906 | Bacteria | 17609 |
| 701 | Ga0496103_0200609 | 3300048906 | Bacteria | 1283 |
| 702 | Ga0496103_0210581 | 3300048906 | Bacteria | 1250 |
| 703 | Ga0496104_0003761 | 3300048907 | Bacteria | 13118 |
| 704 | Ga0496104_0068429 | 3300048907 | Bacteria | 3374 |
| 705 | Ga0496104_0079760 | 3300048907 | Bacteria | 3120 |
| 706 | Ga0496104_0195967 | 3300048907 | Bacteria | 1932 |
| 707 | Ga0496104_0740274 | 3300048907 | Bacteria | 890 |
| 708 | Ga0496105_0033637 | 3300048908 | Bacteria | 4212 |
| 709 | Ga0496105_0054115 | 3300048908 | Bacteria | 3314 |
| 710 | Ga0496105_0480245 | 3300048908 | Bacteria | 978 |
| 711 | Ga0496106_0000125 | 3300048909 | Bacteria | 59031 |
| 712 | Ga0496106_0014060 | 3300048909 | Bacteria | 5914 |
| 713 | Ga0496106_0015871 | 3300048909 | Bacteria | 5572 |
| 714 | Ga0496106_0421694 | 3300048909 | Bacteria | 1072 |
| 715 | Ga0496107_0063116 | 3300048910 | Unclassified | 2684 |
| 716 | Ga0496107_0141897 | 3300048910 | Bacteria | 1775 |
| 717 | Ga0496107_0247403 | 3300048910 | Bacteria | 1327 |
| 718 | Ga0496108_0160575 | 3300048911 | Bacteria | 1942 |
| 719 | Ga0496109_0131999 | 3300048912 | Bacteria | 2331 |
| 720 | Ga0496109_0142061 | 3300048912 | Bacteria | 2245 |
| 721 | Ga0496110_0016493 | 3300048913 | Bacteria | 6168 |
| 722 | Ga0496110_0033360 | 3300048913 | Bacteria | 4453 |
| 723 | Ga0496110_0252922 | 3300048913 | Bacteria | 1604 |
| 724 | Ga0496110_0379011 | 3300048913 | Bacteria | 1289 |
| 725 | Ga0496110_0469187 | 3300048913 | Bacteria | 1147 |
| 726 | Ga0496111_0000701 | 3300048914 | Bacteria | 17721 |
| 727 | Ga0496112_0024527 | 3300048915 | Bacteria | 5777 |
| 728 | Ga0496112_0044012 | 3300048915 | Bacteria | 4372 |
| 729 | Ga0496112_0064226 | 3300048915 | Bacteria | 3622 |
| 730 | Ga0496113_0235653 | 3300048916 | Bacteria | 1460 |
| 731 | Ga0496114_0148890 | 3300048917 | Bacteria | 2030 |
| 732 | Ga0496114_0182909 | 3300048917 | Bacteria | 1831 |
| 733 | Ga0496114_0274070 | 3300048917 | Bacteria | 1487 |
| 734 | Ga0496115_0057816 | 3300048918 | Bacteria | 3120 |
| 735 | Ga0496115_0094320 | 3300048918 | Unclassified | 2448 |
| 736 | Ga0496115_0259045 | 3300048918 | Bacteria | 1431 |
| 737 | Ga0496115_0283293 | 3300048918 | Bacteria | 1360 |
| 738 | Ga0496116_0003130 | 3300048919 | Bacteria | 16610 |
| 739 | Ga0496116_0009520 | 3300048919 | Bacteria | 8272 |
| 740 | Ga0496116_0018287 | 3300048919 | Bacteria | 5408 |
| 741 | Ga0496116_0100104 | 3300048919 | Bacteria | 1734 |
| 742 | Ga0496117_0000002 | 3300048920 | Bacteria | 2483758 |
| 743 | Ga0496117_0000878 | 3300048920 | Bacteria | 46410 |
| 744 | Ga0496117_0016796 | 3300048920 | Bacteria | 6151 |
| 745 | Ga0496117_0105321 | 3300048920 | Bacteria | 1773 |
| 746 | Ga0496117_0115494 | 3300048920 | Bacteria | 1661 |
| 747 | Ga0496117_0119910 | 3300048920 | Bacteria | 1618 |
| 748 | Ga0496117_0155074 | 3300048920 | Bacteria | 1349 |
| 749 | Ga0496117_0263502 | 3300048920 | Bacteria | 933 |
| 750 | Ga0496118_0001855 | 3300048921 | Bacteria | 30243 |
| 751 | Ga0496118_0004791 | 3300048921 | Bacteria | 15800 |
| 752 | Ga0496118_0008798 | 3300048921 | Bacteria | 10344 |
| 753 | Ga0496118_0013135 | 3300048921 | Bacteria | 7861 |
| 754 | Ga0496118_0016459 | 3300048921 | Bacteria | 6783 |
| 755 | Ga0496118_0025089 | 3300048921 | Bacteria | 5124 |
| 756 | Ga0496118_0056264 | 3300048921 | Bacteria | 2959 |
| 757 | Ga0496118_0064435 | 3300048921 | Bacteria | 2689 |
| 758 | Ga0496119_0008779 | 3300048922 | Bacteria | 8806 |
| 759 | Ga0496119_0014680 | 3300048922 | Bacteria | 6102 |
| 760 | Ga0496119_0066578 | 3300048922 | Bacteria | 2128 |
| 761 | Ga0496119_0096074 | 3300048922 | Bacteria | 1673 |
| 762 | Ga0496120_0000078 | 3300048923 | Bacteria | 162312 |
| 763 | Ga0496120_0002707 | 3300048923 | Bacteria | 17363 |
| 764 | Ga0496120_0015555 | 3300048923 | Bacteria | 5012 |
| 765 | Ga0496120_0034513 | 3300048923 | Bacteria | 3029 |
| 766 | Ga0496120_0154817 | 3300048923 | Bacteria | 1148 |
| 767 | Ga0496121_0000001 | 3300048924 | Bacteria | 1830318 |
| 768 | Ga0496121_0000959 | 3300048924 | Bacteria | 52098 |
| 769 | Ga0496121_0003355 | 3300048924 | Bacteria | 22973 |
| 770 | Ga0496121_0011499 | 3300048924 | Bacteria | 9812 |
| 771 | Ga0496121_0012773 | 3300048924 | Bacteria | 9097 |
| 772 | Ga0496121_0025174 | 3300048924 | Bacteria | 5659 |
| 773 | Ga0496121_0034679 | 3300048924 | Bacteria | 4538 |
| 774 | Ga0496121_0049492 | 3300048924 | Bacteria | 3563 |
| 775 | Ga0496121_0051550 | 3300048924 | Bacteria | 3464 |
| 776 | Ga0496121_0092891 | 3300048924 | Bacteria | 2351 |
| 777 | Ga0496121_0304089 | 3300048924 | Bacteria | 1081 |
| 778 | Ga0496121_0342526 | 3300048924 | Bacteria | 998 |
| 779 | Ga0496122_0000001 | 3300048925 | Bacteria | 1827766 |
| 780 | Ga0496122_0000025 | 3300048925 | Bacteria | 362915 |
| 781 | Ga0496122_0000992 | 3300048925 | Bacteria | 50592 |
| 782 | Ga0496122_0008019 | 3300048925 | Bacteria | 11533 |
| 783 | Ga0496122_0010790 | 3300048925 | Bacteria | 9362 |
| 784 | Ga0496122_0021071 | 3300048925 | Bacteria | 5854 |
| 785 | Ga0496122_0039541 | 3300048925 | Bacteria | 3760 |
| 786 | Ga0496122_0045620 | 3300048925 | Bacteria | 3404 |
| 787 | Ga0496122_0055173 | 3300048925 | Bacteria | 2976 |
| 788 | Ga0496122_0155754 | 3300048925 | Bacteria | 1402 |
| 789 | Ga0496123_0000001 | 3300048926 | Bacteria | 1831497 |
| 790 | Ga0496123_0000032 | 3300048926 | Bacteria | 285282 |
| 791 | Ga0496123_0000552 | 3300048926 | Bacteria | 64124 |
| 792 | Ga0496123_0007805 | 3300048926 | Bacteria | 9962 |
| 793 | Ga0496123_0010385 | 3300048926 | Bacteria | 8237 |
| 794 | Ga0496123_0016379 | 3300048926 | Bacteria | 6023 |
| 795 | Ga0496123_0041233 | 3300048926 | Bacteria | 3203 |
| 796 | Ga0496123_0098600 | 3300048926 | Bacteria | 1708 |
| 797 | Ga0496124_0000740 | 3300048927 | Bacteria | 53495 |
| 798 | Ga0496124_0002623 | 3300048927 | Bacteria | 23151 |
| 799 | Ga0496124_0004853 | 3300048927 | Bacteria | 15467 |
| 800 | Ga0496124_0010792 | 3300048927 | Bacteria | 9206 |
| 801 | Ga0496124_0010996 | 3300048927 | Bacteria | 9095 |
| 802 | Ga0496124_0015632 | 3300048927 | Bacteria | 7264 |
| 803 | Ga0496124_0027905 | 3300048927 | Bacteria | 5055 |
| 804 | Ga0496124_0028283 | 3300048927 | Bacteria | 5018 |
| 805 | Ga0496124_0047659 | 3300048927 | Bacteria | 3665 |
| 806 | Ga0496124_0100308 | 3300048927 | Bacteria | 2347 |
| 807 | Ga0496124_0248539 | 3300048927 | Bacteria | 1317 |
| 808 | Ga0496125_0000001 | 3300048928 | Bacteria | 1766138 |
| 809 | Ga0496125_0000063 | 3300048928 | Bacteria | 250260 |
| 810 | Ga0496125_0000394 | 3300048928 | Bacteria | 81230 |
| 811 | Ga0496125_0000829 | 3300048928 | Bacteria | 49885 |
| 812 | Ga0496125_0017863 | 3300048928 | Bacteria | 6749 |
| 813 | Ga0496125_0019884 | 3300048928 | Bacteria | 6316 |
| 814 | Ga0496125_0100465 | 3300048928 | Bacteria | 2132 |
| 815 | Ga0496125_0230067 | 3300048928 | Bacteria | 1186 |
| 816 | Ga0496126_0000788 | 3300048929 | Bacteria | 57185 |
| 817 | Ga0496126_0005149 | 3300048929 | Bacteria | 15124 |
| 818 | Ga0496126_0011177 | 3300048929 | Bacteria | 9318 |
| 819 | Ga0496126_0081636 | 3300048929 | Bacteria | 2857 |
| 820 | Ga0496126_0108949 | 3300048929 | Bacteria | 2414 |
| 821 | Ga0496126_0127939 | 3300048929 | Bacteria | 2197 |
| 822 | Ga0496126_0481256 | 3300048929 | Bacteria | 995 |
| 823 | Ga0495678_027150 | 3300049459 | Bacteria | 2432 |
| 824 | Ga0501031_0000019 | 3300049568 | Bacteria | 104793 |
| 825 | Ga0501031_0015055 | 3300049568 | Bacteria | 5023 |
| 826 | Ga0501031_0066253 | 3300049568 | Bacteria | 2353 |
| 827 | Ga0501031_0075753 | 3300049568 | Bacteria | 2191 |
| 828 | Ga0501031_0303856 | 3300049568 | Bacteria | 1034 |
| 829 | Ga0501032_0000009 | 3300049569 | Bacteria | 228107 |
| 830 | Ga0501032_0000312 | 3300049569 | Bacteria | 40889 |
| 831 | Ga0501032_0006976 | 3300049569 | Bacteria | 8281 |
| 832 | Ga0501032_0027515 | 3300049569 | Bacteria | 3907 |
| 833 | Ga0501032_0046515 | 3300049569 | Bacteria | 2933 |
| 834 | Ga0501032_0053046 | 3300049569 | Bacteria | 2732 |
| 835 | Ga0501032_0218384 | 3300049569 | Bacteria | 1241 |
| 836 | Ga0501033_0000019 | 3300049570 | Bacteria | 204699 |
| 837 | Ga0501033_0000752 | 3300049570 | Bacteria | 29825 |
| 838 | Ga0501033_0002156 | 3300049570 | Bacteria | 17025 |
| 839 | Ga0501033_0007943 | 3300049570 | Bacteria | 8219 |
| 840 | Ga0501033_0015322 | 3300049570 | Bacteria | 5815 |
| 841 | Ga0501033_0024710 | 3300049570 | Bacteria | 4530 |
| 842 | Ga0501033_0026725 | 3300049570 | Bacteria | 4342 |
| 843 | Ga0501033_0035599 | 3300049570 | Bacteria | 3732 |
| 844 | Ga0501033_0107723 | 3300049570 | Bacteria | 2030 |
| 845 | Ga0501033_0172096 | 3300049570 | Bacteria | 1555 |
| 846 | Ga0501034_0000044 | 3300049571 | Bacteria | 227982 |
| 847 | Ga0501034_0002486 | 3300049571 | Bacteria | 22142 |
| 848 | Ga0501034_0003827 | 3300049571 | Bacteria | 16957 |
| 849 | Ga0501034_0023964 | 3300049571 | Bacteria | 6212 |
| 850 | Ga0501034_0025143 | 3300049571 | Bacteria | 6060 |
| 851 | Ga0501034_0060256 | 3300049571 | Bacteria | 3813 |
| 852 | Ga0501034_0061223 | 3300049571 | Bacteria | 3780 |
| 853 | Ga0501034_0105050 | 3300049571 | Bacteria | 2817 |
| 854 | Ga0501034_0117026 | 3300049571 | Bacteria | 2653 |
| 855 | Ga0501034_0191407 | 3300049571 | Bacteria | 2008 |
| 856 | Ga0501034_0340306 | 3300049571 | Bacteria | 1430 |
| 857 | Ga0501034_0363280 | 3300049571 | Bacteria | 1375 |
| 858 | Ga0501036_0000008 | 3300049572 | Bacteria | 228106 |
| 859 | Ga0501036_0001112 | 3300049572 | Bacteria | 20410 |
| 860 | Ga0501036_0020356 | 3300049572 | Bacteria | 5573 |
| 861 | Ga0501036_0058962 | 3300049572 | Bacteria | 3252 |
| 862 | Ga0501036_0241096 | 3300049572 | Bacteria | 1516 |
| 863 | Ga0501036_0257097 | 3300049572 | Bacteria | 1463 |
| 864 | Ga0501036_0273426 | 3300049572 | Bacteria | 1414 |
| 865 | Ga0501037_0000055 | 3300049573 | Bacteria | 109790 |
| 866 | Ga0501037_0000118 | 3300049573 | Bacteria | 73584 |
| 867 | Ga0501037_0000857 | 3300049573 | Bacteria | 22686 |
| 868 | Ga0501037_0006217 | 3300049573 | Bacteria | 8731 |
| 869 | Ga0501037_0023099 | 3300049573 | Bacteria | 4600 |
| 870 | Ga0501037_0122415 | 3300049573 | Bacteria | 1869 |
| 871 | Ga0501037_0196838 | 3300049573 | Bacteria | 1425 |
| 872 | Ga0501038_0000006 | 3300049574 | Bacteria | 228107 |
| 873 | Ga0501038_0000248 | 3300049574 | Bacteria | 45662 |
| 874 | Ga0501038_0011040 | 3300049574 | Bacteria | 8247 |
| 875 | Ga0501038_0028283 | 3300049574 | Bacteria | 4981 |
| 876 | Ga0501038_0052588 | 3300049574 | Bacteria | 3511 |
| 877 | Ga0501038_0069500 | 3300049574 | Bacteria | 2991 |
| 878 | Ga0501038_0210218 | 3300049574 | Bacteria | 1557 |
| 879 | Ga0501039_0000014 | 3300049575 | Bacteria | 228107 |
| 880 | Ga0501039_0000048 | 3300049575 | Bacteria | 102012 |
| 881 | Ga0501039_0030683 | 3300049575 | Bacteria | 4145 |
| 882 | Ga0501039_0098634 | 3300049575 | Bacteria | 2279 |
| 883 | Ga0501039_0153399 | 3300049575 | Bacteria | 1809 |
| 884 | Ga0501039_0361676 | 3300049575 | Bacteria | 1140 |
| 885 | Ga0501040_0002131 | 3300049576 | Bacteria | 12761 |
| 886 | Ga0501041_0058195 | 3300049577 | Bacteria | 2364 |
| 887 | Ga0501042_0102107 | 3300049578 | Bacteria | 2063 |
| 888 | Ga0501043_0000107 | 3300049579 | Bacteria | 77469 |
| 889 | Ga0501043_0000639 | 3300049579 | Bacteria | 30943 |
| 890 | Ga0501043_0001366 | 3300049579 | Bacteria | 21372 |
| 891 | Ga0501043_0012772 | 3300049579 | Bacteria | 6565 |
| 892 | Ga0501043_0019526 | 3300049579 | Bacteria | 5320 |
| 893 | Ga0501043_0024816 | 3300049579 | Bacteria | 4704 |
| 894 | Ga0501043_0230588 | 3300049579 | Bacteria | 1430 |
| 895 | Ga0501043_0468686 | 3300049579 | Bacteria | 944 |
| 896 | Ga0501046_0044412 | 3300049580 | Bacteria | 3534 |
| 897 | Ga0501046_0049181 | 3300049580 | Bacteria | 3336 |
| 898 | Ga0501046_0058235 | 3300049580 | Bacteria | 3029 |
| 899 | Ga0501046_0100950 | 3300049580 | Bacteria | 2214 |
| 900 | Ga0501046_0136083 | 3300049580 | Bacteria | 1861 |
| 901 | Ga0501047_0001105 | 3300049581 | Bacteria | 26770 |
| 902 | Ga0501047_0017404 | 3300049581 | Bacteria | 6883 |
| 903 | Ga0501047_0031991 | 3300049581 | Bacteria | 5076 |
| 904 | Ga0501047_0045004 | 3300049581 | Bacteria | 4266 |
| 905 | Ga0501047_0062837 | 3300049581 | Bacteria | 3582 |
| 906 | Ga0501047_0085517 | 3300049581 | Bacteria | 3030 |
| 907 | Ga0501047_0100575 | 3300049581 | Bacteria | 2770 |
| 908 | Ga0501047_0202133 | 3300049581 | Bacteria | 1848 |
| 909 | Ga0501047_0209212 | 3300049581 | Bacteria | 1809 |
| 910 | Ga0501047_0269147 | 3300049581 | Bacteria | 1550 |
| 911 | Ga0501048_0003551 | 3300049582 | Bacteria | 11855 |
| 912 | Ga0501048_0102175 | 3300049582 | Bacteria | 2022 |
| 913 | Ga0501048_0118797 | 3300049582 | Bacteria | 1868 |
| 914 | Ga0501067_0050531 | 3300049583 | Bacteria | 2304 |
| 915 | Ga0501067_0063660 | 3300049583 | Bacteria | 2042 |
| 916 | Ga0501068_0028700 | 3300049584 | Bacteria | 3292 |
| 917 | Ga0501068_0053868 | 3300049584 | Bacteria | 2437 |
| 918 | Ga0501069_0001348 | 3300049585 | Bacteria | 12039 |
| 919 | Ga0501069_0028971 | 3300049585 | Bacteria | 3037 |
| 920 | Ga0501069_0116980 | 3300049585 | Bacteria | 1521 |
| 921 | Ga0501070_0000132 | 3300049586 | Bacteria | 67092 |
| 922 | Ga0501070_0000631 | 3300049586 | Bacteria | 32396 |
| 923 | Ga0501070_0028755 | 3300049586 | Bacteria | 4660 |
| 924 | Ga0501070_0031602 | 3300049586 | Bacteria | 4435 |
| 925 | Ga0501070_0044320 | 3300049586 | Bacteria | 3702 |
| 926 | Ga0501070_0049649 | 3300049586 | Bacteria | 3484 |
| 927 | Ga0501070_0049997 | 3300049586 | Bacteria | 3471 |
| 928 | Ga0501070_0495630 | 3300049586 | Bacteria | 982 |
| 929 | Ga0501070_0543356 | 3300049586 | Bacteria | 931 |
| 930 | Ga0501071_0017228 | 3300049587 | Bacteria | 4980 |
| 931 | Ga0501071_0041634 | 3300049587 | Bacteria | 3290 |
| 932 | Ga0501071_0101804 | 3300049587 | Bacteria | 2118 |
| 933 | Ga0501072_0010225 | 3300049588 | Bacteria | 7148 |
| 934 | Ga0501072_0386373 | 3300049588 | Bacteria | 1111 |
| 935 | Ga0501073_0009343 | 3300049589 | Bacteria | 7235 |
| 936 | Ga0501073_0020718 | 3300049589 | Bacteria | 4742 |
| 937 | Ga0501073_0033412 | 3300049589 | Bacteria | 3663 |
| 938 | Ga0501073_0270038 | 3300049589 | Bacteria | 1174 |
| 939 | Ga0501074_0000088 | 3300049590 | Bacteria | 44911 |
| 940 | Ga0501075_0094127 | 3300049591 | Bacteria | 2274 |
| 941 | Ga0501076_0058409 | 3300049592 | Bacteria | 3066 |
| 942 | Ga0501076_0092799 | 3300049592 | Bacteria | 2429 |
| 943 | Ga0501080_0000128 | 3300049742 | Bacteria | 53662 |
| 944 | Ga0501080_0017979 | 3300049742 | Bacteria | 6545 |
| 945 | Ga0501080_0040601 | 3300049742 | Bacteria | 4339 |
| 946 | Ga0501080_0124777 | 3300049742 | Bacteria | 2385 |
| 947 | Ga0501080_0231255 | 3300049742 | Bacteria | 1690 |
| 948 | Ga0501080_0538651 | 3300049742 | Bacteria | 1041 |
| 949 | Ga0501081_0063804 | 3300049743 | Bacteria | 2557 |
| 950 | Ga0501083_0000065 | 3300049744 | Bacteria | 73075 |
| 951 | Ga0501083_0023789 | 3300049744 | Bacteria | 4248 |
| 952 | Ga0501083_0139735 | 3300049744 | Bacteria | 1586 |
| 953 | Ga0501083_0145701 | 3300049744 | Bacteria | 1550 |
| 954 | Ga0501083_0242108 | 3300049744 | Bacteria | 1174 |
| 955 | Ga0501035_0000096 | 3300049822 | Bacteria | 110635 |
| 956 | Ga0501035_0000118 | 3300049822 | Bacteria | 95482 |
| 957 | Ga0501035_0000185 | 3300049822 | Bacteria | 76291 |
| 958 | Ga0501035_0000245 | 3300049822 | Bacteria | 65283 |
| 959 | Ga0501035_0002121 | 3300049822 | Bacteria | 19738 |
| 960 | Ga0501035_0002402 | 3300049822 | Bacteria | 18354 |
| 961 | Ga0501035_0011321 | 3300049822 | Bacteria | 8268 |
| 962 | Ga0501035_0014314 | 3300049822 | Bacteria | 7322 |
| 963 | Ga0501035_0021609 | 3300049822 | Bacteria | 5918 |
| 964 | Ga0501035_0077476 | 3300049822 | Bacteria | 2937 |
| 965 | Ga0501035_0079908 | 3300049822 | Bacteria | 2888 |
| 966 | Ga0501035_0082161 | 3300049822 | Bacteria | 2843 |
| 967 | Ga0501035_0456323 | 3300049822 | Bacteria | 1057 |
| 968 | Ga0501035_0522428 | 3300049822 | Bacteria | 975 |
| 969 | Ga0501044_0000003 | 3300049823 | Bacteria | 345647 |
| 970 | Ga0501044_0000017 | 3300049823 | Bacteria | 228107 |
| 971 | Ga0501044_0021082 | 3300049823 | Bacteria | 6957 |
| 972 | Ga0501044_0056837 | 3300049823 | Bacteria | 4017 |
| 973 | Ga0501044_0061755 | 3300049823 | Bacteria | 3832 |
| 974 | Ga0501044_0082243 | 3300049823 | Bacteria | 3259 |
| 975 | Ga0501044_0112084 | 3300049823 | Bacteria | 2735 |
| 976 | Ga0501044_0112933 | 3300049823 | Bacteria | 2724 |
| 977 | Ga0501044_0127508 | 3300049823 | Bacteria | 2541 |
| 978 | Ga0501044_0186250 | 3300049823 | Bacteria | 2040 |
| 979 | Ga0501044_0277489 | 3300049823 | Bacteria | 1610 |
| 980 | Ga0501044_0428036 | 3300049823 | Bacteria | 1233 |
| 981 | Ga0501045_0069803 | 3300049824 | Bacteria | 2584 |
| 982 | Ga0501045_0096237 | 3300049824 | Bacteria | 2190 |
| 983 | nmdc:mga03683_564_c1 | 3300050489 | Bacteria | 10675 |
| 984 | nmdc:mga03n38_146186_c1 | 3300050490 | Bacteria | 1185 |
| 985 | nmdc:mga03n38_2724_c1 | 3300050490 | Bacteria | 5532 |
| 986 | nmdc:mga00v17_14099_c1 | 3300050491 | Bacteria | 4455 |
| 987 | nmdc:mga00v17_236505_c1 | 3300050491 | Bacteria | 1184 |
| 988 | nmdc:mga00v17_53493_c1 | 3300050491 | Bacteria | 2461 |
| 989 | nmdc:mga00v17_56095_c1 | 3300050491 | Bacteria | 2408 |
| 990 | nmdc:mga0yw44_157926_c1 | 3300050492 | Bacteria | 1483 |
| 991 | nmdc:mga0yw44_276826_c1 | 3300050492 | Bacteria | 1121 |
| 992 | nmdc:mga0yw44_349_c1 | 3300050492 | Bacteria | 16248 |
| 993 | nmdc:mga0yw44_35770_c1 | 3300050492 | Bacteria | 2921 |
| 994 | nmdc:mga0yw44_3818_c1 | 3300050492 | Bacteria | 3160 |
| 995 | nmdc:mga0yw44_4313_c1 | 3300050492 | Bacteria | 6494 |
| 996 | nmdc:mga0yw44_64458_c1 | 3300050492 | Bacteria | 2255 |
| 997 | nmdc:mga0yw44_7216_c2 | 3300050492 | Bacteria | 2954 |
| 998 | nmdc:mga0k408_36016_c1 | 3300050493 | Bacteria | 2839 |
| 999 | nmdc:mga0k408_4188_c1 | 3300050493 | Bacteria | 7653 |
| 1000 | nmdc:mga0k408_51532_c1 | 3300050493 | Bacteria | 2385 |
| 1001 | nmdc:mga06z11_2403_c1 | 3300050494 | Bacteria | 7134 |
| 1002 | nmdc:mga06z11_242580_c1 | 3300050494 | Bacteria | 1059 |
| 1003 | nmdc:mga06z11_344468_c1 | 3300050494 | Bacteria | 891 |
| 1004 | nmdc:mga06z11_52752_c1 | 3300050494 | Bacteria | 2088 |
| 1005 | nmdc:mga06z11_71168_c1 | 3300050494 | Bacteria | 1841 |
| 1006 | nmdc:mga04h51_28645_c1 | 3300050495 | Bacteria | 1739 |
| 1007 | nmdc:mga04h51_73035_c1 | 3300050495 | Bacteria | 1202 |
| 1008 | nmdc:mga07m45_155605_c1 | 3300050496 | Bacteria | 1326 |
| 1009 | nmdc:mga07m45_4076_c1 | 3300050496 | Bacteria | 7124 |
| 1010 | nmdc:mga07m45_93014_c1 | 3300050496 | Bacteria | 1728 |
| 1011 | nmdc:mga0n895_128829_c1 | 3300050512 | Bacteria | 2555 |
| 1012 | nmdc:mga0n895_745588_c1 | 3300050512 | Bacteria | 973 |
| 1013 | nmdc:mga0rr50_15118_c1 | 3300050513 | Bacteria | 5087 |
| 1014 | nmdc:mga0rr50_276565_c1 | 3300050513 | Bacteria | 1400 |
| 1015 | nmdc:mga0rr50_58788_c1 | 3300050513 | Bacteria | 2883 |
| 1016 | nmdc:mga0sz30_23726_c1 | 3300050516 | Bacteria | 2499 |
| 1017 | nmdc:mga0sz30_3205_c2 | 3300050516 | Bacteria | 1633 |
| 1018 | nmdc:mga0sz30_34318_c2 | 3300050516 | Bacteria | 1224 |
| 1019 | nmdc:mga0sz30_45262_c1 | 3300050516 | Bacteria | 1856 |
| 1020 | Ga0495601_0000006 | 3300053077 | Bacteria | 373770 |
| 1021 | Ga0495601_0000549 | 3300053077 | Bacteria | 19855 |
| 1022 | Ga0495601_0015181 | 3300053077 | Bacteria | 4654 |
| 1023 | Ga0495601_0043124 | 3300053077 | Bacteria | 2833 |
| 1024 | Ga0495612_0000004 | 3300053078 | Bacteria | 286946 |
| 1025 | Ga0495612_0011648 | 3300053078 | Bacteria | 3544 |
| 1026 | Ga0495612_0015944 | 3300053078 | Bacteria | 3011 |
| 1027 | Ga0495612_0071201 | 3300053078 | Bacteria | 1450 |
| 1028 | Ga0500635_0015076 | 3300053080 | Bacteria | 2277 |
| 1029 | Ga0495655_0056967 | 3300053083 | Bacteria | 1053 |
| 1030 | Ga0495595_0000006 | 3300053084 | Bacteria | 231295 |
| 1031 | Ga0495595_0002822 | 3300053084 | Bacteria | 6832 |
| 1032 | Ga0495595_0003722 | 3300053084 | Bacteria | 6063 |
| 1033 | Ga0495595_0030084 | 3300053084 | Bacteria | 2433 |
| 1034 | Ga0495619_0000011 | 3300053085 | Bacteria | 287128 |
| 1035 | Ga0495619_0000164 | 3300053085 | Bacteria | 48672 |
| 1036 | Ga0495619_0001121 | 3300053085 | Bacteria | 17592 |
| 1037 | Ga0495619_0162164 | 3300053085 | Bacteria | 1544 |
| 1038 | Ga0500578_0107045 | 3300053086 | Bacteria | 1765 |
| 1039 | Ga0500578_0174366 | 3300053086 | Bacteria | 1328 |
| 1040 | Ga0500643_000037 | 3300053087 | Bacteria | 180821 |
| 1041 | Ga0500643_024125 | 3300053087 | Bacteria | 1935 |
| 1042 | Ga0500643_039564 | 3300053087 | Bacteria | 1392 |
| 1043 | Ga0500644_0005437 | 3300053088 | Bacteria | 3217 |
| 1044 | Ga0500646_0033849 | 3300053090 | Bacteria | 1415 |
| 1045 | Ga0500583_0008901 | 3300053092 | Bacteria | 3637 |
| 1046 | Ga0500566_0000335 | 3300053094 | Bacteria | 25676 |
| 1047 | Ga0500555_015557 | 3300053103 | Bacteria | 2194 |
| 1048 | Ga0500557_000047 | 3300053105 | Bacteria | 59226 |
| 1049 | Ga0500560_004671 | 3300053107 | Bacteria | 2942 |
| 1050 | Ga0500562_033078 | 3300053108 | Bacteria | 1366 |
| 1051 | Ga0500569_000857 | 3300053109 | Bacteria | 5395 |
| 1052 | Ga0500593_013096 | 3300053117 | Bacteria | 3534 |
| 1053 | Ga0500594_0000615 | 3300053118 | Bacteria | 7613 |
| 1054 | Ga0500608_074631 | 3300053122 | Bacteria | 1608 |
| 1055 | Ga0500618_000084 | 3300053125 | Bacteria | 76331 |
| 1056 | Ga0500618_000592 | 3300053125 | Bacteria | 22323 |
| 1057 | Ga0500618_004461 | 3300053125 | Bacteria | 4468 |
| 1058 | Ga0500618_011663 | 3300053125 | Bacteria | 2324 |
| 1059 | Ga0500642_0158018 | 3300053130 | Bacteria | 1063 |
| 1060 | Ga0500658_0000636 | 3300053134 | Bacteria | 14557 |
| 1061 | Ga0500658_0057747 | 3300053134 | Bacteria | 1605 |
| 1062 | Ga0500559_0002896 | 3300053136 | Bacteria | 8645 |
| 1063 | Ga0500559_0053236 | 3300053136 | Bacteria | 1791 |
| 1064 | Ga0500561_0001272 | 3300053137 | Bacteria | 4098 |
| 1065 | Ga0500568_0000056 | 3300053139 | Bacteria | 109531 |
| 1066 | Ga0500568_0000846 | 3300053139 | Bacteria | 21547 |
| 1067 | Ga0500568_0002227 | 3300053139 | Bacteria | 11640 |
| 1068 | Ga0500568_0008272 | 3300053139 | Bacteria | 5030 |
| 1069 | Ga0500568_0027980 | 3300053139 | Bacteria | 2353 |
| 1070 | Ga0500573_0000429 | 3300053140 | Bacteria | 17964 |
| 1071 | Ga0500577_0000032 | 3300053142 | Bacteria | 33173 |
| 1072 | Ga0500577_0060322 | 3300053142 | Bacteria | 1456 |
| 1073 | Ga0500604_0031096 | 3300053151 | Bacteria | 1565 |
| 1074 | Ga0500616_0000084 | 3300053153 | Bacteria | 195562 |
| 1075 | Ga0500616_0000551 | 3300053153 | Bacteria | 46529 |
| 1076 | Ga0500616_0000917 | 3300053153 | Bacteria | 32210 |
| 1077 | Ga0500620_000830 | 3300053155 | Bacteria | 5363 |
| 1078 | Ga0500620_009455 | 3300053155 | Bacteria | 2518 |
| 1079 | Ga0500622_0000159 | 3300053156 | Bacteria | 71047 |
| 1080 | Ga0500622_0000425 | 3300053156 | Bacteria | 40013 |
| 1081 | Ga0500624_000255 | 3300053157 | Bacteria | 18774 |
| 1082 | Ga0500624_005173 | 3300053157 | Bacteria | 1729 |
| 1083 | Ga0500627_0022426 | 3300053158 | Bacteria | 2561 |
| 1084 | Ga0500627_0038752 | 3300053158 | Bacteria | 2039 |
| 1085 | Ga0500627_0076805 | 3300053158 | Bacteria | 1485 |
| 1086 | Ga0500627_0084823 | 3300053158 | Bacteria | 1414 |
| 1087 | Ga0500627_0113291 | 3300053158 | Bacteria | 1221 |
| 1088 | Ga0500634_0054534 | 3300053161 | Bacteria | 2142 |
| 1089 | Ga0500634_0063075 | 3300053161 | Bacteria | 1961 |
| 1090 | Ga0500636_0000015 | 3300053177 | Bacteria | 123980 |
| 1091 | Ga0500636_0012938 | 3300053177 | Bacteria | 4896 |
| 1092 | Ga0500611_005646 | 3300053727 | Bacteria | 1774 |
| 1093 | Ga0500599_000444 | 3300053736 | Bacteria | 4272 |
| 1094 | Ga0500601_000014 | 3300053737 | Bacteria | 41972 |
| 1095 | Ga0501084_0032546 | 3300054114 | Bacteria | 4362 |
| 1096 | Ga0501084_0083485 | 3300054114 | Bacteria | 2681 |
| 1097 | Ga0501084_0137227 | 3300054114 | Bacteria | 2059 |
| 1098 | Ga0530510_0261203 | 3300061734 | Bacteria | 1291 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046457 | Ga0495590_0038560 | Ga0495590_0038560_10_630 | 203 |
| 2 | 3300046615 | Ga0495656_0492283 | Ga0495656_0492283_17_637 | 203 |
| 3 | 3300053105 | Ga0500557_000047 | Ga0500557_000047_28597_29364 | 215 |
| 4 | 3300006195 | Ga0075366_10116420 | Ga0075366_101164202 | 216 |
| 5 | 3300050493 | nmdc:mga0k408_36016_c1 | nmdc:mga0k408_36016_c1_57_827 | 216 |
| 6 | 3300025302 | Ga0207426_1042112 | Ga0207426_10421121 | 220 |
| 7 | 3300004625 | Ga0055543_1002843 | Ga0055543_10028435 | 224 |
| 8 | 3300050492 | nmdc:mga0yw44_35770_c1 | nmdc:mga0yw44_35770_c1_326_1093 | 224 |
| 9 | 3300047471 | Ga0495684_0183592 | Ga0495684_0183592_741_1442 | 225 |
| 10 | 3300046455 | Ga0495603_0104030 | Ga0495603_0104030_13_717 | 228 |
| 11 | 3300046538 | Ga0495609_0078224 | Ga0495609_0078224_444_1211 | 228 |
| 12 | 3300037312 | Ga0395899_0402979 | Ga0395899_0402979_30_797 | 229 |
| 13 | 3300005455 | Ga0070663_100491468 | Ga0070663_1004914682 | 230 |
| 14 | 3300025919 | Ga0207657_10055298 | Ga0207657_100552982 | 230 |
| 15 | 3300026067 | Ga0207678_10078531 | Ga0207678_100785311 | 230 |
| 16 | 3300041452 | Ga0451793_1350958 | Ga0451793_1350958_374_1141 | 230 |
| 17 | 3300046460 | Ga0495638_0013340 | Ga0495638_0013340_3419_4180 | 230 |
| 18 | 3300046524 | Ga0495648_0034773 | Ga0495648_0034773_1725_2486 | 230 |
| 19 | 3300005262 | Ga0065165_1004569 | Ga0065165_10045695 | 231 |
| 20 | 3300025302 | Ga0207426_1001010 | Ga0207426_100101015 | 231 |
| 21 | 3300048903 | Ga0496100_0074169 | Ga0496100_0074169_16_720 | 231 |
| 22 | 3300048905 | Ga0496102_0208481 | Ga0496102_0208481_12_716 | 231 |
| 23 | 3300053087 | Ga0500643_000037 | Ga0500643_000037_87245_88012 | 231 |
| 24 | 3300053092 | Ga0500583_0008901 | Ga0500583_0008901_1062_1829 | 231 |
| 25 | 3300053103 | Ga0500555_015557 | Ga0500555_015557_484_1251 | 231 |
| 26 | 3300053134 | Ga0500658_0057747 | Ga0500658_0057747_154_921 | 231 |
| 27 | 3300053139 | Ga0500568_0008272 | Ga0500568_0008272_1815_2582 | 231 |
| 28 | 3300053142 | Ga0500577_0060322 | Ga0500577_0060322_222_989 | 231 |
| 29 | 3300053158 | Ga0500627_0038752 | Ga0500627_0038752_268_1035 | 231 |
| 30 | 3300053161 | Ga0500634_0054534 | Ga0500634_0054534_502_1269 | 231 |
| 31 | 3300053737 | Ga0500601_000014 | Ga0500601_000014_5873_6640 | 231 |
| 32 | 3300053080 | Ga0500635_0015076 | Ga0500635_0015076_430_1197 | 235 |
| 33 | 3300053736 | Ga0500599_000444 | Ga0500599_000444_2192_2959 | 235 |
| 34 | iso_pu_bacteria | 2977971508 | 2977978292 | 235 |
| 35 | 3300021320 | Ga0214544_1000691 | Ga0214544_100069110 | 237 |
| 36 | 3300021321 | Ga0214542_1000019 | Ga0214542_100001962 | 237 |
| 37 | 3300021327 | Ga0214543_1000010 | Ga0214543_1000010218 | 237 |
| 38 | 3300049582 | Ga0501048_0003551 | Ga0501048_0003551_2745_3470 | 238 |
| 39 | 3300035085 | Ga0373929_0016640 | Ga0373929_0016640_14_754 | 240 |
| 40 | 3300048913 | Ga0496110_0016493 | Ga0496110_0016493_30_770 | 240 |
| 41 | 3300048924 | Ga0496121_0051550 | Ga0496121_0051550_1717_2484 | 240 |
| 42 | 3300053094 | Ga0500566_0000335 | Ga0500566_0000335_6257_7024 | 240 |
| 43 | 3300003215 | JGI25153J46596_10000263 | JGI25153J46596_1000026317 | 242 |
| 44 | 3300025297 | Ga0209758_1000087 | Ga0209758_1000087175 | 242 |
| 45 | 3300038443 | Ga0395901_0178660 | Ga0395901_0178660_726_1493 | 242 |
| 46 | 3300048905 | Ga0496102_0710548 | Ga0496102_0710548_159_905 | 242 |
| 47 | 3300050512 | nmdc:mga0n895_745588_c1 | nmdc:mga0n895_745588_c1_68_814 | 242 |
| 48 | 3300041456 | Ga0451795_1607243 | Ga0451795_1607243_221_961 | 244 |
| 49 | 3300048918 | Ga0496115_0094320 | Ga0496115_0094320_1660_2409 | 246 |
| 50 | 3300049586 | Ga0501070_0495630 | Ga0501070_0495630_43_864 | 246 |
| 51 | iso_pu_bacteria | 2513237139 | 2513877738 | 248 |
| 52 | iso_pu_bacteria | 2513237161 | 2514015070 | 248 |
| 53 | iso_pu_bacteria | 2528768022 | 2528852309 | 248 |
| 54 | iso_pu_bacteria | 2617270735 | 2617350000 | 248 |
| 55 | iso_pu_bacteria | 2802429603 | 2805917133 | 248 |
| 56 | iso_pu_bacteria | 2824671348 | 2824675881 | 248 |
| 57 | iso_pu_bacteria | 2824687955 | 2824692003 | 248 |
| 58 | iso_pu_bacteria | 2824696289 | 2824696605 | 248 |
| 59 | iso_pu_bacteria | 2824773399 | 2824776760 | 248 |
| 60 | iso_pu_bacteria | 2838122688 | 2838125417 | 248 |
| 61 | iso_pu_bacteria | 2841941048 | 2841941923 | 248 |
| 62 | iso_pu_bacteria | 2841949485 | 2841951357 | 248 |
| 63 | iso_pu_bacteria | 2841974524 | 2841976155 | 248 |
| 64 | iso_pu_bacteria | 2841983080 | 2841987520 | 248 |
| 65 | iso_pu_bacteria | 2847939898 | 2847944708 | 248 |
| 66 | iso_pu_bacteria | 2849076700 | 2849081064 | 248 |
| 67 | iso_pu_bacteria | 2874612657 | 2874612920 | 248 |
| 68 | iso_pu_bacteria | 2874628541 | 2874634752 | 248 |
| 69 | iso_pu_bacteria | 2932784394 | 2932793128 | 248 |
| 70 | iso_pu_bacteria | 2932809354 | 2932814566 | 248 |
| 71 | iso_pu_bacteria | 2932818245 | 2932824631 | 248 |
| 72 | iso_pu_bacteria | 2935616580 | 2935623321 | 248 |
| 73 | iso_pu_bacteria | 2935638405 | 2935646681 | 248 |
| 74 | iso_pu_bacteria | 2935665750 | 2935672649 | 248 |
| 75 | iso_pu_bacteria | 2935675223 | 2935682522 | 248 |
| 76 | iso_pu_bacteria | 2935777560 | 2935784917 | 248 |
| 77 | iso_pu_bacteria | 2935827899 | 2935835948 | 248 |
| 78 | iso_pu_bacteria | 2935837841 | 2935844928 | 248 |
| 79 | iso_pu_bacteria | 2935855204 | 2935861679 | 248 |
| 80 | iso_pu_bacteria | 2935864058 | 2935870718 | 248 |
| 81 | iso_pu_bacteria | 2935873716 | 2935881409 | 248 |
| 82 | iso_pu_bacteria | 2935992306 | 2936000409 | 248 |
| 83 | iso_pu_bacteria | 2941538514 | 2941546735 | 248 |
| 84 | iso_pu_bacteria | 3005506211 | 3005512168 | 248 |
| 85 | 3300041405 | Ga0439438_047014 | Ga0439438_047014_16_867 | 249 |
| 86 | 3300041498 | Ga0451841_0003394 | Ga0451841_0003394_19_849 | 249 |
| 87 | 3300003215 | JGI25153J46596_10000110 | JGI25153J46596_1000011021 | 250 |
| 88 | 3300003794 | Ga0055531_10008315 | Ga0055531_100083157 | 250 |
| 89 | 3300005719 | Ga0068861_100549835 | Ga0068861_1005498352 | 250 |
| 90 | 3300005844 | Ga0068862_100344208 | Ga0068862_1003442082 | 250 |
| 91 | 3300006163 | Ga0070715_10119369 | Ga0070715_101193691 | 250 |
| 92 | 3300009093 | Ga0105240_10295384 | Ga0105240_102953842 | 250 |
| 93 | 3300009545 | Ga0105237_10834477 | Ga0105237_108344772 | 250 |
| 94 | 3300025297 | Ga0209758_1000075 | Ga0209758_1000075103 | 250 |
| 95 | 3300025299 | Ga0209256_1003035 | Ga0209256_10030351 | 250 |
| 96 | 3300025304 | Ga0209257_1000795 | Ga0209257_10007957 | 250 |
| 97 | 3300025913 | Ga0207695_10238269 | Ga0207695_102382692 | 250 |
| 98 | 3300025942 | Ga0207689_10384522 | Ga0207689_103845222 | 250 |
| 99 | 3300025945 | Ga0207679_10168546 | Ga0207679_101685462 | 250 |
| 100 | 3300026035 | Ga0207703_10206470 | Ga0207703_102064701 | 250 |
| 101 | 3300026118 | Ga0207675_100097538 | Ga0207675_1000975382 | 250 |
| 102 | 3300036401 | Ga0373937_0805842 | Ga0373937_0805842_15_782 | 250 |
| 103 | 3300046674 | Ga0495588_0041178 | Ga0495588_0041178_1416_2183 | 250 |
| 104 | 3300048903 | Ga0496100_0233027 | Ga0496100_0233027_475_1242 | 250 |
| 105 | 3300048904 | Ga0496101_0177400 | Ga0496101_0177400_747_1514 | 250 |
| 106 | 3300048906 | Ga0496103_0200609 | Ga0496103_0200609_150_959 | 250 |
| 107 | 3300048906 | Ga0496103_0210581 | Ga0496103_0210581_444_1211 | 250 |
| 108 | 3300048907 | Ga0496104_0068429 | Ga0496104_0068429_1467_2234 | 250 |
| 109 | 3300048908 | Ga0496105_0054115 | Ga0496105_0054115_1914_2681 | 250 |
| 110 | 3300048909 | Ga0496106_0421694 | Ga0496106_0421694_254_1021 | 250 |
| 111 | 3300048913 | Ga0496110_0469187 | Ga0496110_0469187_47_814 | 250 |
| 112 | 3300048916 | Ga0496113_0235653 | Ga0496113_0235653_315_1082 | 250 |
| 113 | 3300048917 | Ga0496114_0148890 | Ga0496114_0148890_255_1022 | 250 |
| 114 | 3300048918 | Ga0496115_0283293 | Ga0496115_0283293_259_1026 | 250 |
| 115 | 3300048924 | Ga0496121_0034679 | Ga0496121_0034679_716_1483 | 250 |
| 116 | 3300048929 | Ga0496126_0127939 | Ga0496126_0127939_354_1121 | 250 |
| 117 | 3300053177 | Ga0500636_0000015 | Ga0500636_0000015_98102_98935 | 250 |
| 118 | iso_pu_bacteria | 2738543024 | 2739308037 | 250 |
| 119 | iso_pu_bacteria | 2921296804 | 2921297339 | 250 |
| 120 | 3300002705 | JGI25156J39149_1004074 | JGI25156J39149_10040743 | 251 |
| 121 | 3300002741 | JGI25157J39369_1001617 | JGI25157J39369_10016173 | 251 |
| 122 | 3300005355 | Ga0070671_100103037 | Ga0070671_1001030372 | 251 |
| 123 | 3300005364 | Ga0070673_100010267 | Ga0070673_1000102675 | 251 |
| 124 | 3300005366 | Ga0070659_100394898 | Ga0070659_1003948981 | 251 |
| 125 | 3300005434 | Ga0070709_10094639 | Ga0070709_100946392 | 251 |
| 126 | 3300005439 | Ga0070711_100120096 | Ga0070711_1001200962 | 251 |
| 127 | 3300005543 | Ga0070672_100097229 | Ga0070672_1000972292 | 251 |
| 128 | 3300005548 | Ga0070665_100577499 | Ga0070665_1005774992 | 251 |
| 129 | 3300005842 | Ga0068858_100497021 | Ga0068858_1004970212 | 251 |
| 130 | 3300006028 | Ga0070717_10225787 | Ga0070717_102257872 | 251 |
| 131 | 3300006051 | Ga0075364_10014961 | Ga0075364_100149612 | 251 |
| 132 | 3300010375 | Ga0105239_10205613 | Ga0105239_102056132 | 251 |
| 133 | 3300011119 | Ga0105246_10178956 | Ga0105246_101789562 | 251 |
| 134 | 3300014968 | Ga0157379_10250380 | Ga0157379_102503802 | 251 |
| 135 | 3300024227 | Ga0228598_1002460 | Ga0228598_10024603 | 251 |
| 136 | 3300025250 | Ga0209026_1000002 | Ga0209026_1000002272 | 251 |
| 137 | 3300025256 | Ga0209759_1000062 | Ga0209759_100006244 | 251 |
| 138 | 3300025906 | Ga0207699_10154046 | Ga0207699_101540462 | 251 |
| 139 | 3300025915 | Ga0207693_10153669 | Ga0207693_101536692 | 251 |
| 140 | 3300025916 | Ga0207663_10033876 | Ga0207663_100338762 | 251 |
| 141 | 3300025927 | Ga0207687_10141056 | Ga0207687_101410562 | 251 |
| 142 | 3300025931 | Ga0207644_10046328 | Ga0207644_100463283 | 251 |
| 143 | 3300025933 | Ga0207706_10149500 | Ga0207706_101495002 | 251 |
| 144 | 3300025940 | Ga0207691_10066544 | Ga0207691_100665443 | 251 |
| 145 | 3300025960 | Ga0207651_10069164 | Ga0207651_100691643 | 251 |
| 146 | 3300026035 | Ga0207703_10352652 | Ga0207703_103526522 | 251 |
| 147 | 3300028379 | Ga0268266_10050734 | Ga0268266_100507343 | 251 |
| 148 | 3300035117 | Ga0373953_0030857 | Ga0373953_0030857_99_863 | 251 |
| 149 | 3300036401 | Ga0373937_0177870 | Ga0373937_0177870_938_1702 | 251 |
| 150 | 3300046454 | Ga0495592_0242406 | Ga0495592_0242406_343_1107 | 251 |
| 151 | 3300046463 | Ga0495653_0073254 | Ga0495653_0073254_1696_2460 | 251 |
| 152 | 3300046511 | Ga0495608_0067504 | Ga0495608_0067504_499_1263 | 251 |
| 153 | 3300046516 | Ga0495628_0111604 | Ga0495628_0111604_128_892 | 251 |
| 154 | 3300046536 | Ga0495587_0071017 | Ga0495587_0071017_330_1094 | 251 |
| 155 | 3300046559 | Ga0495667_0041089 | Ga0495667_0041089_1892_2656 | 251 |
| 156 | 3300046663 | Ga0495635_0062717 | Ga0495635_0062717_848_1612 | 251 |
| 157 | 3300046675 | Ga0495657_0112356 | Ga0495657_0112356_14_778 | 251 |
| 158 | 3300046678 | Ga0495599_0073355 | Ga0495599_0073355_196_960 | 251 |
| 159 | 3300047317 | Ga0495604_0183907 | Ga0495604_0183907_630_1394 | 251 |
| 160 | 3300047471 | Ga0495684_0148862 | Ga0495684_0148862_807_1571 | 251 |
| 161 | 3300048088 | Ga0495602_0024539 | Ga0495602_0024539_3008_3772 | 251 |
| 162 | 3300048903 | Ga0496100_0154624 | Ga0496100_0154624_815_1579 | 251 |
| 163 | 3300048904 | Ga0496101_0213875 | Ga0496101_0213875_588_1352 | 251 |
| 164 | 3300048907 | Ga0496104_0195967 | Ga0496104_0195967_706_1470 | 251 |
| 165 | 3300048912 | Ga0496109_0131999 | Ga0496109_0131999_1168_1932 | 251 |
| 166 | 3300048913 | Ga0496110_0379011 | Ga0496110_0379011_199_963 | 251 |
| 167 | 3300048915 | Ga0496112_0064226 | Ga0496112_0064226_264_1028 | 251 |
| 168 | 3300050491 | nmdc:mga00v17_14099_c1 | nmdc:mga00v17_14099_c1_934_1818 | 251 |
| 169 | 3300053084 | Ga0495595_0030084 | Ga0495595_0030084_1581_2345 | 251 |
| 170 | iso_pu_bacteria | 2643221651 | 2644287664 | 251 |
| 171 | 3300054114 | Ga0501084_0083485 | Ga0501084_0083485_54_830 | 252 |
| 172 | iso_pu_bacteria | 2891373044 | 2891373070 | 252 |
| 173 | 3300005335 | Ga0070666_10236772 | Ga0070666_102367722 | 253 |
| 174 | 3300026035 | Ga0207703_10483042 | Ga0207703_104830422 | 253 |
| 175 | 3300032004 | Ga0307414_10240394 | Ga0307414_102403942 | 253 |
| 176 | 3300035724 | Ga0373933_0003159 | Ga0373933_0003159_1158_1946 | 253 |
| 177 | 3300036401 | Ga0373937_0001336 | Ga0373937_0001336_6930_7718 | 253 |
| 178 | 3300037853 | Ga0436364_1553897 | Ga0436364_1553897_1062_1835 | 253 |
| 179 | 3300038742 | Ga0400486_12421 | Ga0400486_12421_141_920 | 253 |
| 180 | 3300039437 | Ga0436365_1820406 | Ga0436365_1820406_1054_1827 | 253 |
| 181 | 3300046511 | Ga0495608_0000442 | Ga0495608_0000442_17809_18597 | 253 |
| 182 | 3300046524 | Ga0495648_0005337 | Ga0495648_0005337_379_1149 | 253 |
| 183 | 3300046675 | Ga0495657_0265480 | Ga0495657_0265480_225_1013 | 253 |
| 184 | 3300046680 | Ga0495646_0010351 | Ga0495646_0010351_1523_2311 | 253 |
| 185 | 3300047320 | Ga0495672_0019795 | Ga0495672_0019795_44_814 | 253 |
| 186 | 3300048924 | Ga0496121_0012773 | Ga0496121_0012773_6375_7145 | 253 |
| 187 | 3300048924 | Ga0496121_0092891 | Ga0496121_0092891_472_1242 | 253 |
| 188 | 3300048928 | Ga0496125_0000063 | Ga0496125_0000063_165029_165799 | 253 |
| 189 | 3300048928 | Ga0496125_0000829 | Ga0496125_0000829_47056_47826 | 253 |
| 190 | 3300048929 | Ga0496126_0081636 | Ga0496126_0081636_63_833 | 253 |
| 191 | 3300049568 | Ga0501031_0303856 | Ga0501031_0303856_41_817 | 253 |
| 192 | 3300049569 | Ga0501032_0027515 | Ga0501032_0027515_830_1606 | 253 |
| 193 | 3300049570 | Ga0501033_0107723 | Ga0501033_0107723_625_1401 | 253 |
| 194 | 3300049572 | Ga0501036_0058962 | Ga0501036_0058962_1192_1968 | 253 |
| 195 | 3300049574 | Ga0501038_0028283 | Ga0501038_0028283_273_1040 | 253 |
| 196 | 3300049589 | Ga0501073_0020718 | Ga0501073_0020718_2533_3309 | 253 |
| 197 | 3300049589 | Ga0501073_0270038 | Ga0501073_0270038_218_985 | 253 |
| 198 | 3300049744 | Ga0501083_0139735 | Ga0501083_0139735_98_874 | 253 |
| 199 | 3300049822 | Ga0501035_0021609 | Ga0501035_0021609_3476_4243 | 253 |
| 200 | 3300049822 | Ga0501035_0456323 | Ga0501035_0456323_232_999 | 253 |
| 201 | 3300050491 | nmdc:mga00v17_236505_c1 | nmdc:mga00v17_236505_c1_215_985 | 253 |
| 202 | 3300053077 | Ga0495601_0043124 | Ga0495601_0043124_629_1417 | 253 |
| 203 | 3300053087 | Ga0500643_039564 | Ga0500643_039564_401_1168 | 253 |
| 204 | 3300053139 | Ga0500568_0027980 | Ga0500568_0027980_198_971 | 253 |
| 205 | 3300053142 | Ga0500577_0000032 | Ga0500577_0000032_18747_19517 | 253 |
| 206 | 3300053153 | Ga0500616_0000084 | Ga0500616_0000084_63189_63959 | 253 |
| 207 | iso_pu_bacteria | 8054558443 | 8054562616 | 253 |
| 208 | 3300005844 | Ga0068862_100388974 | Ga0068862_1003889742 | 254 |
| 209 | 3300005937 | Ga0081455_10000419 | Ga0081455_1000041937 | 254 |
| 210 | 3300007076 | Ga0075435_100059145 | Ga0075435_1000591453 | 254 |
| 211 | 3300035113 | Ga0373936_0001937 | Ga0373936_0001937_471_1253 | 254 |
| 212 | 3300035116 | Ga0373945_0001585 | Ga0373945_0001585_821_1603 | 254 |
| 213 | 3300035116 | Ga0373945_0012768 | Ga0373945_0012768_211_993 | 254 |
| 214 | 3300035117 | Ga0373953_0001305 | Ga0373953_0001305_3994_4776 | 254 |
| 215 | 3300035118 | Ga0373954_0018425 | Ga0373954_0018425_1210_1992 | 254 |
| 216 | 3300035119 | Ga0373956_0013030 | Ga0373956_0013030_801_1583 | 254 |
| 217 | 3300035120 | Ga0373957_0019954 | Ga0373957_0019954_380_1162 | 254 |
| 218 | 3300035171 | Ga0373946_0123186 | Ga0373946_0123186_174_956 | 254 |
| 219 | 3300035171 | Ga0373946_0139516 | Ga0373946_0139516_219_1001 | 254 |
| 220 | 3300035172 | Ga0373955_0000213 | Ga0373955_0000213_20675_21457 | 254 |
| 221 | 3300035692 | Ga0373935_0000131 | Ga0373935_0000131_11511_12293 | 254 |
| 222 | 3300035692 | Ga0373935_0024391 | Ga0373935_0024391_108_890 | 254 |
| 223 | 3300035692 | Ga0373935_0030875 | Ga0373935_0030875_411_1190 | 254 |
| 224 | 3300035695 | Ga0373927_0014897 | Ga0373927_0014897_2334_3116 | 254 |
| 225 | 3300035695 | Ga0373927_0025227 | Ga0373927_0025227_605_1387 | 254 |
| 226 | 3300035724 | Ga0373933_0053964 | Ga0373933_0053964_792_1574 | 254 |
| 227 | 3300035725 | Ga0373947_0002523 | Ga0373947_0002523_8379_9161 | 254 |
| 228 | 3300035725 | Ga0373947_0023677 | Ga0373947_0023677_1438_2220 | 254 |
| 229 | 3300036401 | Ga0373937_0000293 | Ga0373937_0000293_35050_35832 | 254 |
| 230 | 3300036401 | Ga0373937_0067560 | Ga0373937_0067560_1204_1983 | 254 |
| 231 | 3300037068 | Ga0373925_0000087 | Ga0373925_0000087_66331_67113 | 254 |
| 232 | 3300037068 | Ga0373925_0041897 | Ga0373925_0041897_955_1737 | 254 |
| 233 | 3300044694 | Ga0466963_0091702 | Ga0466963_0091702_1027_1812 | 254 |
| 234 | 3300045976 | Ga0466967_0093353 | Ga0466967_0093353_1632_2417 | 254 |
| 235 | 3300046454 | Ga0495592_0000001 | Ga0495592_0000001_277649_278431 | 254 |
| 236 | 3300046455 | Ga0495603_0041109 | Ga0495603_0041109_1916_2698 | 254 |
| 237 | 3300046459 | Ga0495629_0000401 | Ga0495629_0000401_10357_11139 | 254 |
| 238 | 3300046459 | Ga0495629_0010498 | Ga0495629_0010498_5153_5935 | 254 |
| 239 | 3300046462 | Ga0495651_0001675 | Ga0495651_0001675_6762_7544 | 254 |
| 240 | 3300046463 | Ga0495653_0000015 | Ga0495653_0000015_41957_42739 | 254 |
| 241 | 3300046473 | Ga0495582_0168722 | Ga0495582_0168722_311_1093 | 254 |
| 242 | 3300046476 | Ga0495662_0000957 | Ga0495662_0000957_3272_4054 | 254 |
| 243 | 3300046477 | Ga0495664_0000001 | Ga0495664_0000001_37929_38711 | 254 |
| 244 | 3300046499 | Ga0495594_0011198 | Ga0495594_0011198_1245_2027 | 254 |
| 245 | 3300046511 | Ga0495608_0000066 | Ga0495608_0000066_14440_15222 | 254 |
| 246 | 3300046514 | Ga0495618_0000021 | Ga0495618_0000021_6839_7621 | 254 |
| 247 | 3300046516 | Ga0495628_0000005 | Ga0495628_0000005_289930_290712 | 254 |
| 248 | 3300046517 | Ga0495630_0000254 | Ga0495630_0000254_7651_8433 | 254 |
| 249 | 3300046529 | Ga0495652_0000001 | Ga0495652_0000001_788454_789236 | 254 |
| 250 | 3300046533 | Ga0495640_0000006 | Ga0495640_0000006_236090_236872 | 254 |
| 251 | 3300046536 | Ga0495587_0000012 | Ga0495587_0000012_130095_130877 | 254 |
| 252 | 3300046543 | Ga0495645_0000041 | Ga0495645_0000041_23577_24359 | 254 |
| 253 | 3300046559 | Ga0495667_0000001 | Ga0495667_0000001_628422_629204 | 254 |
| 254 | 3300046642 | Ga0495634_0000624 | Ga0495634_0000624_8560_9342 | 254 |
| 255 | 3300046663 | Ga0495635_0000007 | Ga0495635_0000007_62463_63245 | 254 |
| 256 | 3300046663 | Ga0495635_0311267 | Ga0495635_0311267_121_903 | 254 |
| 257 | 3300046675 | Ga0495657_0000047 | Ga0495657_0000047_79793_80575 | 254 |
| 258 | 3300046678 | Ga0495599_0000002 | Ga0495599_0000002_129515_130297 | 254 |
| 259 | 3300046679 | Ga0495623_0000023 | Ga0495623_0000023_68369_69151 | 254 |
| 260 | 3300046680 | Ga0495646_0000024 | Ga0495646_0000024_69278_70060 | 254 |
| 261 | 3300046683 | Ga0495658_0000265 | Ga0495658_0000265_19654_20436 | 254 |
| 262 | 3300046689 | Ga0495613_0170939 | Ga0495613_0170939_297_1079 | 254 |
| 263 | 3300046690 | Ga0495624_0011265 | Ga0495624_0011265_914_1696 | 254 |
| 264 | 3300046809 | Ga0495600_0000013 | Ga0495600_0000013_99306_100088 | 254 |
| 265 | 3300047315 | Ga0495581_0009849 | Ga0495581_0009849_279_1061 | 254 |
| 266 | 3300047317 | Ga0495604_0000007 | Ga0495604_0000007_155504_156286 | 254 |
| 267 | 3300047319 | Ga0495674_0000001 | Ga0495674_0000001_237866_238648 | 254 |
| 268 | 3300047319 | Ga0495674_0123895 | Ga0495674_0123895_191_970 | 254 |
| 269 | 3300047321 | Ga0495676_0031404 | Ga0495676_0031404_2888_3670 | 254 |
| 270 | 3300047322 | Ga0495680_0001437 | Ga0495680_0001437_17972_18754 | 254 |
| 271 | 3300047322 | Ga0495680_0030613 | Ga0495680_0030613_3271_4053 | 254 |
| 272 | 3300047444 | Ga0495675_0000014 | Ga0495675_0000014_110043_110825 | 254 |
| 273 | 3300047471 | Ga0495684_0000027 | Ga0495684_0000027_56286_57068 | 254 |
| 274 | 3300047673 | Ga0495593_0002819 | Ga0495593_0002819_1842_2624 | 254 |
| 275 | 3300047673 | Ga0495593_0051458 | Ga0495593_0051458_1355_2137 | 254 |
| 276 | 3300048088 | Ga0495602_0000004 | Ga0495602_0000004_130138_130920 | 254 |
| 277 | 3300048089 | Ga0495614_0137373 | Ga0495614_0137373_152_934 | 254 |
| 278 | 3300048907 | Ga0496104_0740274 | Ga0496104_0740274_34_816 | 254 |
| 279 | 3300048918 | Ga0496115_0057816 | Ga0496115_0057816_1320_2102 | 254 |
| 280 | 3300050513 | nmdc:mga0rr50_15118_c1 | nmdc:mga0rr50_15118_c1_3909_4691 | 254 |
| 281 | 3300053077 | Ga0495601_0000006 | Ga0495601_0000006_77916_78698 | 254 |
| 282 | 3300053078 | Ga0495612_0000004 | Ga0495612_0000004_235962_236744 | 254 |
| 283 | 3300053084 | Ga0495595_0000006 | Ga0495595_0000006_163408_164190 | 254 |
| 284 | 3300053085 | Ga0495619_0000011 | Ga0495619_0000011_195987_196769 | 254 |
| 285 | 3300053085 | Ga0495619_0000164 | Ga0495619_0000164_8346_9128 | 254 |
| 286 | iso_pu_bacteria | 2989349275 | 2989349331 | 254 |
| 287 | 3300006871 | Ga0075434_100129911 | Ga0075434_1001299112 | 255 |
| 288 | 3300009551 | Ga0105238_10059607 | Ga0105238_100596073 | 255 |
| 289 | 3300025924 | Ga0207694_10122626 | Ga0207694_101226262 | 255 |
| 290 | 3300025928 | Ga0207700_10271993 | Ga0207700_102719932 | 255 |
| 291 | 3300025929 | Ga0207664_10073102 | Ga0207664_100731022 | 255 |
| 292 | 3300031665 | Ga0316575_10015584 | Ga0316575_100155842 | 255 |
| 293 | 3300031727 | Ga0316576_10267750 | Ga0316576_102677502 | 255 |
| 294 | 3300031728 | Ga0316578_10013064 | Ga0316578_100130643 | 255 |
| 295 | 3300035113 | Ga0373936_0035998 | Ga0373936_0035998_655_1434 | 255 |
| 296 | 3300035398 | Ga0316574_0007201 | Ga0316574_0007201_3610_4392 | 255 |
| 297 | 3300036647 | Ga0316582_0144311 | Ga0316582_0144311_217_999 | 255 |
| 298 | 3300036712 | Ga0316584_0016716 | Ga0316584_0016716_808_1590 | 255 |
| 299 | 3300046660 | Ga0495625_0327300 | Ga0495625_0327300_100_876 | 255 |
| 300 | 3300048907 | Ga0496104_0003761 | Ga0496104_0003761_8140_8928 | 255 |
| 301 | 3300048908 | Ga0496105_0033637 | Ga0496105_0033637_3215_4003 | 255 |
| 302 | 3300048909 | Ga0496106_0015871 | Ga0496106_0015871_206_994 | 255 |
| 303 | 3300048910 | Ga0496107_0247403 | Ga0496107_0247403_412_1197 | 255 |
| 304 | 3300048911 | Ga0496108_0160575 | Ga0496108_0160575_997_1785 | 255 |
| 305 | 3300048912 | Ga0496109_0142061 | Ga0496109_0142061_816_1604 | 255 |
| 306 | 3300048913 | Ga0496110_0252922 | Ga0496110_0252922_796_1584 | 255 |
| 307 | 3300048915 | Ga0496112_0024527 | Ga0496112_0024527_4450_5238 | 255 |
| 308 | 3300050512 | nmdc:mga0n895_128829_c1 | nmdc:mga0n895_128829_c1_1731_2513 | 255 |
| 309 | iso_pu_bacteria | 2856328259 | 2856329015 | 255 |
| 310 | iso_pu_bacteria | 2869234852 | 2869240120 | 255 |
| 311 | iso_pu_bacteria | 2869264136 | 2869265924 | 255 |
| 312 | iso_pu_bacteria | 2871435913 | 2871439906 | 255 |
| 313 | iso_pu_bacteria | 2871451962 | 2871452468 | 255 |
| 314 | iso_pu_bacteria | 2874109183 | 2874114458 | 255 |
| 315 | iso_pu_bacteria | 2874131515 | 2874136198 | 255 |
| 316 | iso_pu_bacteria | 2874162495 | 2874166133 | 255 |
| 317 | iso_pu_bacteria | 2876399893 | 2876405722 | 255 |
| 318 | iso_pu_bacteria | 2878730984 | 2878734058 | 255 |
| 319 | iso_pu_bacteria | 2903513507 | 2903517564 | 255 |
| 320 | iso_pu_bacteria | 2906363423 | 2906364898 | 255 |
| 321 | iso_pu_bacteria | 2906370794 | 2906375731 | 255 |
| 322 | iso_pu_bacteria | 2906386501 | 2906393157 | 255 |
| 323 | iso_pu_bacteria | 2906408224 | 2906410316 | 255 |
| 324 | iso_pu_bacteria | 2922172374 | 2922175360 | 255 |
| 325 | iso_pu_bacteria | 2924733363 | 2924737073 | 255 |
| 326 | iso_pu_bacteria | 2924748358 | 2924750747 | 255 |
| 327 | iso_pu_bacteria | 3003930520 | 3003933680 | 255 |
| 328 | 3300003187 | JGI25151J46595_10019572 | JGI25151J46595_100195722 | 256 |
| 329 | 3300005334 | Ga0068869_100397513 | Ga0068869_1003975132 | 256 |
| 330 | 3300005617 | Ga0068859_100461043 | Ga0068859_1004610432 | 256 |
| 331 | 3300006931 | Ga0097620_100461040 | Ga0097620_1004610402 | 256 |
| 332 | 3300025294 | Ga0209025_1000119 | Ga0209025_1000119176 | 256 |
| 333 | 3300025942 | Ga0207689_10578837 | Ga0207689_105788372 | 256 |
| 334 | 3300032133 | Ga0316583_10016742 | Ga0316583_100167423 | 256 |
| 335 | 3300035117 | Ga0373953_0011755 | Ga0373953_0011755_180_986 | 256 |
| 336 | 3300035119 | Ga0373956_0004598 | Ga0373956_0004598_1641_2426 | 256 |
| 337 | 3300035724 | Ga0373933_0014822 | Ga0373933_0014822_2031_2816 | 256 |
| 338 | 3300036401 | Ga0373937_0024713 | Ga0373937_0024713_2297_3082 | 256 |
| 339 | 3300036401 | Ga0373937_0026411 | Ga0373937_0026411_2911_3696 | 256 |
| 340 | 3300037471 | Ga0395905_0358766 | Ga0395905_0358766_548_1333 | 256 |
| 341 | 3300046454 | Ga0495592_0013394 | Ga0495592_0013394_2452_3258 | 256 |
| 342 | 3300046462 | Ga0495651_0119946 | Ga0495651_0119946_985_1770 | 256 |
| 343 | 3300046463 | Ga0495653_0073882 | Ga0495653_0073882_958_1743 | 256 |
| 344 | 3300046517 | Ga0495630_0058818 | Ga0495630_0058818_1128_1934 | 256 |
| 345 | 3300046529 | Ga0495652_0177606 | Ga0495652_0177606_765_1550 | 256 |
| 346 | 3300046533 | Ga0495640_0060368 | Ga0495640_0060368_625_1410 | 256 |
| 347 | 3300046533 | Ga0495640_0299459 | Ga0495640_0299459_59_844 | 256 |
| 348 | 3300046536 | Ga0495587_0044458 | Ga0495587_0044458_1549_2334 | 256 |
| 349 | 3300046559 | Ga0495667_0056015 | Ga0495667_0056015_951_1736 | 256 |
| 350 | 3300046663 | Ga0495635_0019774 | Ga0495635_0019774_3040_3825 | 256 |
| 351 | 3300046675 | Ga0495657_0040502 | Ga0495657_0040502_1060_1845 | 256 |
| 352 | 3300046675 | Ga0495657_0081415 | Ga0495657_0081415_1191_1976 | 256 |
| 353 | 3300046679 | Ga0495623_0198428 | Ga0495623_0198428_148_933 | 256 |
| 354 | 3300047317 | Ga0495604_0006585 | Ga0495604_0006585_51_836 | 256 |
| 355 | 3300047319 | Ga0495674_0049741 | Ga0495674_0049741_1501_2286 | 256 |
| 356 | 3300047322 | Ga0495680_0058117 | Ga0495680_0058117_1456_2241 | 256 |
| 357 | 3300047322 | Ga0495680_0105083 | Ga0495680_0105083_938_1723 | 256 |
| 358 | 3300047444 | Ga0495675_0016294 | Ga0495675_0016294_955_1761 | 256 |
| 359 | 3300047471 | Ga0495684_0133030 | Ga0495684_0133030_747_1532 | 256 |
| 360 | 3300048088 | Ga0495602_0037412 | Ga0495602_0037412_403_1188 | 256 |
| 361 | 3300048088 | Ga0495602_0162113 | Ga0495602_0162113_534_1319 | 256 |
| 362 | 3300048925 | Ga0496122_0000992 | Ga0496122_0000992_32553_33332 | 256 |
| 363 | 3300048926 | Ga0496123_0000552 | Ga0496123_0000552_31847_32626 | 256 |
| 364 | 3300048928 | Ga0496125_0000394 | Ga0496125_0000394_47678_48457 | 256 |
| 365 | 3300049570 | Ga0501033_0002156 | Ga0501033_0002156_3917_4699 | 256 |
| 366 | 3300049822 | Ga0501035_0002402 | Ga0501035_0002402_3903_4685 | 256 |
| 367 | 3300049822 | Ga0501035_0522428 | Ga0501035_0522428_143_925 | 256 |
| 368 | 3300053077 | Ga0495601_0000549 | Ga0495601_0000549_12937_13722 | 256 |
| 369 | 3300053077 | Ga0495601_0015181 | Ga0495601_0015181_1934_2719 | 256 |
| 370 | 3300053078 | Ga0495612_0011648 | Ga0495612_0011648_1208_1993 | 256 |
| 371 | 3300053078 | Ga0495612_0015944 | Ga0495612_0015944_958_1743 | 256 |
| 372 | 3300053084 | Ga0495595_0002822 | Ga0495595_0002822_4467_5252 | 256 |
| 373 | 3300053084 | Ga0495595_0003722 | Ga0495595_0003722_4674_5459 | 256 |
| 374 | 3300053085 | Ga0495619_0001121 | Ga0495619_0001121_4236_5021 | 256 |
| 375 | 3300053085 | Ga0495619_0162164 | Ga0495619_0162164_393_1178 | 256 |
| 376 | iso_pu_bacteria | 2643221564 | 2643837826 | 256 |
| 377 | 3300035398 | Ga0316574_0366422 | Ga0316574_0366422_48_839 | 257 |
| 378 | 3300035692 | Ga0373935_0060761 | Ga0373935_0060761_389_1177 | 257 |
| 379 | 3300035725 | Ga0373947_0279101 | Ga0373947_0279101_153_941 | 257 |
| 380 | 3300037068 | Ga0373925_0214808 | Ga0373925_0214808_657_1445 | 257 |
| 381 | 3300049575 | Ga0501039_0030683 | Ga0501039_0030683_1311_2105 | 257 |
| 382 | 3300049575 | Ga0501039_0361676 | Ga0501039_0361676_21_806 | 257 |
| 383 | 3300049580 | Ga0501046_0100950 | Ga0501046_0100950_310_1104 | 257 |
| 384 | 3300049582 | Ga0501048_0118797 | Ga0501048_0118797_683_1477 | 257 |
| 385 | 3300049588 | Ga0501072_0010225 | Ga0501072_0010225_4740_5534 | 257 |
| 386 | 3300049591 | Ga0501075_0094127 | Ga0501075_0094127_793_1587 | 257 |
| 387 | 3300049592 | Ga0501076_0058409 | Ga0501076_0058409_1651_2445 | 257 |
| 388 | 3300049742 | Ga0501080_0231255 | Ga0501080_0231255_27_821 | 257 |
| 389 | 3300054114 | Ga0501084_0032546 | Ga0501084_0032546_2231_3025 | 257 |
| 390 | 3300061734 | Ga0530510_0261203 | Ga0530510_0261203_360_1154 | 257 |
| 391 | iso_pu_bacteria | 2513237138 | 2513864653 | 257 |
| 392 | iso_pu_bacteria | 2582581867 | 2585402020 | 257 |
| 393 | iso_pu_bacteria | 2585427590 | 2585821805 | 257 |
| 394 | 3300005336 | Ga0070680_100066818 | Ga0070680_1000668182 | 258 |
| 395 | 3300005337 | Ga0070682_100062957 | Ga0070682_1000629572 | 258 |
| 396 | 3300005339 | Ga0070660_100013552 | Ga0070660_1000135522 | 258 |
| 397 | 3300005366 | Ga0070659_100166152 | Ga0070659_1001661522 | 258 |
| 398 | 3300005440 | Ga0070705_100022516 | Ga0070705_1000225162 | 258 |
| 399 | 3300005444 | Ga0070694_100058295 | Ga0070694_1000582952 | 258 |
| 400 | 3300005455 | Ga0070663_100007733 | Ga0070663_1000077337 | 258 |
| 401 | 3300005456 | Ga0070678_100038765 | Ga0070678_1000387653 | 258 |
| 402 | 3300005458 | Ga0070681_10041151 | Ga0070681_100411512 | 258 |
| 403 | 3300005530 | Ga0070679_100124290 | Ga0070679_1001242903 | 258 |
| 404 | 3300005539 | Ga0068853_100008598 | Ga0068853_1000085985 | 258 |
| 405 | 3300005545 | Ga0070695_100007331 | Ga0070695_1000073316 | 258 |
| 406 | 3300005546 | Ga0070696_100007479 | Ga0070696_1000074794 | 258 |
| 407 | 3300005549 | Ga0070704_100192281 | Ga0070704_1001922812 | 258 |
| 408 | 3300005615 | Ga0070702_100005850 | Ga0070702_1000058506 | 258 |
| 409 | 3300005618 | Ga0068864_100542261 | Ga0068864_1005422611 | 258 |
| 410 | 3300005842 | Ga0068858_100134898 | Ga0068858_1001348983 | 258 |
| 411 | 3300005843 | Ga0068860_100034267 | Ga0068860_1000342672 | 258 |
| 412 | 3300009545 | Ga0105237_10012219 | Ga0105237_100122196 | 258 |
| 413 | 3300011119 | Ga0105246_10133274 | Ga0105246_101332742 | 258 |
| 414 | 3300025912 | Ga0207707_10076955 | Ga0207707_100769551 | 258 |
| 415 | 3300025914 | Ga0207671_10115590 | Ga0207671_101155902 | 258 |
| 416 | 3300025917 | Ga0207660_10023384 | Ga0207660_100233843 | 258 |
| 417 | 3300025919 | Ga0207657_10019384 | Ga0207657_100193845 | 258 |
| 418 | 3300025932 | Ga0207690_10208170 | Ga0207690_102081702 | 258 |
| 419 | 3300025944 | Ga0207661_10501699 | Ga0207661_105016992 | 258 |
| 420 | 3300025972 | Ga0207668_10448162 | Ga0207668_104481622 | 258 |
| 421 | 3300026035 | Ga0207703_10111849 | Ga0207703_101118491 | 258 |
| 422 | 3300026041 | Ga0207639_10091893 | Ga0207639_100918932 | 258 |
| 423 | 3300026067 | Ga0207678_10002469 | Ga0207678_1000246914 | 258 |
| 424 | 3300026116 | Ga0207674_10107388 | Ga0207674_101073883 | 258 |
| 425 | 3300026121 | Ga0207683_10059560 | Ga0207683_100595603 | 258 |
| 426 | 3300031711 | Ga0265314_10015665 | Ga0265314_100156653 | 258 |
| 427 | 3300035691 | Ga0373931_0345240 | Ga0373931_0345240_47_844 | 258 |
| 428 | 3300044693 | Ga0466961_0142275 | Ga0466961_0142275_13_828 | 258 |
| 429 | 3300045049 | Ga0466959_0039377 | Ga0466959_0039377_1332_2147 | 258 |
| 430 | 3300048920 | Ga0496117_0000878 | Ga0496117_0000878_21221_22006 | 258 |
| 431 | 3300048927 | Ga0496124_0010792 | Ga0496124_0010792_2210_2995 | 258 |
| 432 | 3300048928 | Ga0496125_0230067 | Ga0496125_0230067_266_1051 | 258 |
| 433 | 3300048929 | Ga0496126_0000788 | Ga0496126_0000788_12197_12982 | 258 |
| 434 | 3300048929 | Ga0496126_0011177 | Ga0496126_0011177_8284_9069 | 258 |
| 435 | 3300049568 | Ga0501031_0066253 | Ga0501031_0066253_1201_1986 | 258 |
| 436 | 3300049571 | Ga0501034_0025143 | Ga0501034_0025143_2199_2990 | 258 |
| 437 | 3300049572 | Ga0501036_0273426 | Ga0501036_0273426_296_1081 | 258 |
| 438 | 3300049574 | Ga0501038_0069500 | Ga0501038_0069500_367_1152 | 258 |
| 439 | 3300049579 | Ga0501043_0019526 | Ga0501043_0019526_3226_4011 | 258 |
| 440 | 3300049579 | Ga0501043_0230588 | Ga0501043_0230588_525_1316 | 258 |
| 441 | 3300049581 | Ga0501047_0085517 | Ga0501047_0085517_1429_2220 | 258 |
| 442 | iso_pu_bacteria | 2657244999 | 2657685440 | 258 |
| 443 | iso_pu_bacteria | 2791355082 | 2792581897 | 258 |
| 444 | iso_pu_bacteria | 2802429268 | 2804752262 | 258 |
| 445 | iso_pu_bacteria | 2913295892 | 2913300677 | 258 |
| 446 | iso_pu_bacteria | 2995392953 | 2995392991 | 258 |
| 447 | iso_pu_bacteria | 8049293176 | 8049294828 | 258 |
| 448 | 3300025304 | Ga0209257_1022999 | Ga0209257_10229992 | 259 |
| 449 | 3300047447 | Ga0495685_047916 | Ga0495685_047916_655_1440 | 259 |
| 450 | 3300049569 | Ga0501032_0218384 | Ga0501032_0218384_88_933 | 259 |
| 451 | 3300049572 | Ga0501036_0241096 | Ga0501036_0241096_298_1143 | 259 |
| 452 | 3300049577 | Ga0501041_0058195 | Ga0501041_0058195_355_1152 | 259 |
| 453 | 3300049578 | Ga0501042_0102107 | Ga0501042_0102107_611_1408 | 259 |
| 454 | 3300049579 | Ga0501043_0468686 | Ga0501043_0468686_37_834 | 259 |
| 455 | 3300049580 | Ga0501046_0136083 | Ga0501046_0136083_349_1146 | 259 |
| 456 | 3300049587 | Ga0501071_0101804 | Ga0501071_0101804_1157_1954 | 259 |
| 457 | 3300049592 | Ga0501076_0092799 | Ga0501076_0092799_401_1198 | 259 |
| 458 | 3300049742 | Ga0501080_0124777 | Ga0501080_0124777_759_1604 | 259 |
| 459 | 3300049743 | Ga0501081_0063804 | Ga0501081_0063804_401_1198 | 259 |
| 460 | 3300049744 | Ga0501083_0145701 | Ga0501083_0145701_622_1467 | 259 |
| 461 | 3300049824 | Ga0501045_0069803 | Ga0501045_0069803_392_1189 | 259 |
| 462 | 3300054114 | Ga0501084_0137227 | Ga0501084_0137227_92_889 | 259 |
| 463 | iso_pu_bacteria | 2512875026 | 2512971260 | 259 |
| 464 | iso_pu_bacteria | 2513237089 | 2513603970 | 259 |
| 465 | iso_pu_bacteria | 2513237156 | 2513984408 | 259 |
| 466 | iso_pu_bacteria | 2513237160 | 2514006196 | 259 |
| 467 | iso_pu_bacteria | 2517487022 | 2517569858 | 259 |
| 468 | iso_pu_bacteria | 2643221550 | 2643774280 | 259 |
| 469 | iso_pu_bacteria | 2802428858 | 2802719132 | 259 |
| 470 | iso_pu_bacteria | 2802428859 | 2802727363 | 259 |
| 471 | iso_pu_bacteria | 2802428860 | 2802732145 | 259 |
| 472 | iso_pu_bacteria | 2802428861 | 2802739075 | 259 |
| 473 | iso_pu_bacteria | 2802428862 | 2802744975 | 259 |
| 474 | iso_pu_bacteria | 2802428863 | 2802752250 | 259 |
| 475 | iso_pu_bacteria | 2856364286 | 2856368791 | 259 |
| 476 | iso_pu_bacteria | 2857349434 | 2857350249 | 259 |
| 477 | iso_pu_bacteria | 2869285874 | 2869291286 | 259 |
| 478 | iso_pu_bacteria | 2871429161 | 2871433566 | 259 |
| 479 | iso_pu_bacteria | 2874146452 | 2874153167 | 259 |
| 480 | iso_pu_bacteria | 2874155637 | 2874160432 | 259 |
| 481 | iso_pu_bacteria | 2876413966 | 2876419458 | 259 |
| 482 | iso_pu_bacteria | 2878745973 | 2878751177 | 259 |
| 483 | iso_pu_bacteria | 2903492973 | 2903501675 | 259 |
| 484 | iso_pu_bacteria | 2906308376 | 2906313118 | 259 |
| 485 | iso_pu_bacteria | 2906321335 | 2906325829 | 259 |
| 486 | iso_pu_bacteria | 2915980308 | 2915981616 | 259 |
| 487 | iso_pu_bacteria | 2916061851 | 2916065253 | 259 |
| 488 | iso_pu_bacteria | 2920760137 | 2920766186 | 259 |
| 489 | iso_pu_bacteria | 2921250672 | 2921255143 | 259 |
| 490 | iso_pu_bacteria | 2937029754 | 2937034781 | 259 |
| 491 | iso_pu_bacteria | 2937036028 | 2937041878 | 259 |
| 492 | iso_pu_bacteria | 2937078374 | 2937079286 | 259 |
| 493 | iso_pu_bacteria | 2937084907 | 2937088410 | 259 |
| 494 | iso_pu_bacteria | 2937813078 | 2937820731 | 259 |
| 495 | iso_pu_bacteria | 2957375807 | 2957381508 | 259 |
| 496 | iso_pu_bacteria | 2957437181 | 2957441100 | 259 |
| 497 | iso_pu_bacteria | 2958130278 | 2958135686 | 259 |
| 498 | iso_pu_bacteria | 2958179912 | 2958185177 | 259 |
| 499 | iso_pu_bacteria | 2960591022 | 2960597284 | 259 |
| 500 | iso_pu_bacteria | 2960631154 | 2960631864 | 259 |
| 501 | iso_pu_bacteria | 2960680706 | 2960687236 | 259 |
| 502 | iso_pu_bacteria | 2960693952 | 2960698439 | 259 |
| 503 | iso_pu_bacteria | 2961077736 | 2961083444 | 259 |
| 504 | iso_pu_bacteria | 2967686174 | 2967690069 | 259 |
| 505 | iso_pu_bacteria | 2967728569 | 2967732766 | 259 |
| 506 | iso_pu_bacteria | 2970026789 | 2970030874 | 259 |
| 507 | iso_pu_bacteria | 2970122695 | 2970126686 | 259 |
| 508 | iso_pu_bacteria | 2970143518 | 2970148122 | 259 |
| 509 | iso_pu_bacteria | 2977530762 | 2977534769 | 259 |
| 510 | iso_pu_bacteria | 2977544691 | 2977547795 | 259 |
| 511 | iso_pu_bacteria | 2977843712 | 2977849029 | 259 |
| 512 | iso_pu_bacteria | 2977942078 | 2977948289 | 259 |
| 513 | iso_pu_bacteria | 2987636660 | 2987637437 | 259 |
| 514 | iso_pu_bacteria | 2996336353 | 2996337862 | 259 |
| 515 | iso_pu_bacteria | 3004203850 | 3004206166 | 259 |
| 516 | iso_pu_bacteria | 8003999396 | 8004001223 | 259 |
| 517 | iso_pu_bacteria | 8004387939 | 8004394158 | 259 |
| 518 | iso_pu_bacteria | 8004640170 | 8004646631 | 259 |
| 519 | iso_pu_bacteria | 8004714634 | 8004719375 | 259 |
| 520 | 3300006038 | Ga0075365_10113648 | Ga0075365_101136482 | 260 |
| 521 | 3300006042 | Ga0075368_10005197 | Ga0075368_100051974 | 260 |
| 522 | 3300006051 | Ga0075364_10022670 | Ga0075364_100226703 | 260 |
| 523 | 3300031548 | Ga0307408_100405441 | Ga0307408_1004054412 | 260 |
| 524 | 3300035172 | Ga0373955_0147427 | Ga0373955_0147427_503_1312 | 260 |
| 525 | 3300035692 | Ga0373935_0042425 | Ga0373935_0042425_533_1342 | 260 |
| 526 | 3300045051 | Ga0451576_0455335 | Ga0451576_0455335_302_1108 | 260 |
| 527 | 3300048929 | Ga0496126_0481256 | Ga0496126_0481256_130_927 | 260 |
| 528 | 3300050495 | nmdc:mga04h51_73035_c1 | nmdc:mga04h51_73035_c1_365_1192 | 260 |
| 529 | 3300050496 | nmdc:mga07m45_93014_c1 | nmdc:mga07m45_93014_c1_24_851 | 260 |
| 530 | 3300053078 | Ga0495612_0071201 | Ga0495612_0071201_465_1274 | 260 |
| 531 | iso_pu_bacteria | 2503198000 | 2503202181 | 260 |
| 532 | iso_pu_bacteria | 2508501122 | 2509107512 | 260 |
| 533 | iso_pu_bacteria | 2508501123 | 2509118644 | 260 |
| 534 | iso_pu_bacteria | 2509276019 | 2509375847 | 260 |
| 535 | iso_pu_bacteria | 2509276022 | 2509396827 | 260 |
| 536 | iso_pu_bacteria | 2510065057 | 2510303382 | 260 |
| 537 | iso_pu_bacteria | 2511231052 | 2511501803 | 260 |
| 538 | iso_pu_bacteria | 2512047086 | 2512533240 | 260 |
| 539 | iso_pu_bacteria | 2512875016 | 2512930920 | 260 |
| 540 | iso_pu_bacteria | 2513237086 | 2513584663 | 260 |
| 541 | iso_pu_bacteria | 2513237090 | 2513609959 | 260 |
| 542 | iso_pu_bacteria | 2513237091 | 2513615372 | 260 |
| 543 | iso_pu_bacteria | 2513237140 | 2513881160 | 260 |
| 544 | iso_pu_bacteria | 2513237143 | 2513905699 | 260 |
| 545 | iso_pu_bacteria | 2515154107 | 2515608666 | 260 |
| 546 | iso_pu_bacteria | 2516143018 | 2516209591 | 260 |
| 547 | iso_pu_bacteria | 2516653046 | 2516893099 | 260 |
| 548 | iso_pu_bacteria | 2524023207 | 2524448930 | 260 |
| 549 | iso_pu_bacteria | 2551306084 | 2551678007 | 260 |
| 550 | iso_pu_bacteria | 2551306085 | 2551686720 | 260 |
| 551 | iso_pu_bacteria | 2551306086 | 2551696231 | 260 |
| 552 | iso_pu_bacteria | 2551306087 | 2551697956 | 260 |
| 553 | iso_pu_bacteria | 2551306089 | 2551714727 | 260 |
| 554 | iso_pu_bacteria | 2551306090 | 2551723102 | 260 |
| 555 | iso_pu_bacteria | 2551306091 | 2551730570 | 260 |
| 556 | iso_pu_bacteria | 2551306092 | 2551737084 | 260 |
| 557 | iso_pu_bacteria | 2551306093 | 2551744416 | 260 |
| 558 | iso_pu_bacteria | 2558860100 | 2558868118 | 260 |
| 559 | iso_pu_bacteria | 2588253730 | 2588516605 | 260 |
| 560 | iso_pu_bacteria | 2599185301 | 2599938119 | 260 |
| 561 | iso_pu_bacteria | 2643221618 | 2644107823 | 260 |
| 562 | iso_pu_bacteria | 2643221626 | 2644148504 | 260 |
| 563 | iso_pu_bacteria | 2643221655 | 2644309217 | 260 |
| 564 | iso_pu_bacteria | 2643221659 | 2644333044 | 260 |
| 565 | iso_pu_bacteria | 2643221698 | 2644545784 | 260 |
| 566 | iso_pu_bacteria | 2643221712 | 2644615159 | 260 |
| 567 | iso_pu_bacteria | 2690316117 | 2692315939 | 260 |
| 568 | iso_pu_bacteria | 2693429783 | 2694632251 | 260 |
| 569 | iso_pu_bacteria | 2693429784 | 2694634342 | 260 |
| 570 | iso_pu_bacteria | 2751185821 | 2753458788 | 260 |
| 571 | iso_pu_bacteria | 2791355091 | 2792620065 | 260 |
| 572 | iso_pu_bacteria | 2791355092 | 2792626516 | 260 |
| 573 | iso_pu_bacteria | 2791355094 | 2792639448 | 260 |
| 574 | iso_pu_bacteria | 2838074704 | 2838078903 | 260 |
| 575 | iso_pu_bacteria | 2844163670 | 2844167452 | 260 |
| 576 | iso_pu_bacteria | 2847417321 | 2847418994 | 260 |
| 577 | iso_pu_bacteria | 2847670302 | 2847676271 | 260 |
| 578 | iso_pu_bacteria | 2848992105 | 2848994027 | 260 |
| 579 | iso_pu_bacteria | 2850079185 | 2850082039 | 260 |
| 580 | iso_pu_bacteria | 2855825444 | 2855825899 | 260 |
| 581 | iso_pu_bacteria | 2855839649 | 2855841247 | 260 |
| 582 | iso_pu_bacteria | 2855872281 | 2855876670 | 260 |
| 583 | iso_pu_bacteria | 2856314179 | 2856316058 | 260 |
| 584 | iso_pu_bacteria | 2856320880 | 2856325815 | 260 |
| 585 | iso_pu_bacteria | 2856349417 | 2856352824 | 260 |
| 586 | iso_pu_bacteria | 2858800743 | 2858802226 | 260 |
| 587 | iso_pu_bacteria | 2869278585 | 2869279432 | 260 |
| 588 | iso_pu_bacteria | 2874123672 | 2874126025 | 260 |
| 589 | iso_pu_bacteria | 2874139085 | 2874145180 | 260 |
| 590 | iso_pu_bacteria | 2874168670 | 2874176168 | 260 |
| 591 | iso_pu_bacteria | 2876363079 | 2876366008 | 260 |
| 592 | iso_pu_bacteria | 2876377896 | 2876384075 | 260 |
| 593 | iso_pu_bacteria | 2878035449 | 2878040326 | 260 |
| 594 | iso_pu_bacteria | 2878738818 | 2878743377 | 260 |
| 595 | iso_pu_bacteria | 2881155292 | 2881156390 | 260 |
| 596 | iso_pu_bacteria | 2881853255 | 2881857080 | 260 |
| 597 | iso_pu_bacteria | 2885342637 | 2885350458 | 260 |
| 598 | iso_pu_bacteria | 2885350715 | 2885352904 | 260 |
| 599 | iso_pu_bacteria | 2888337043 | 2888340109 | 260 |
| 600 | iso_pu_bacteria | 2888350351 | 2888356513 | 260 |
| 601 | iso_pu_bacteria | 2889010040 | 2889011423 | 260 |
| 602 | iso_pu_bacteria | 2889016732 | 2889016848 | 260 |
| 603 | iso_pu_bacteria | 2889790730 | 2889791845 | 260 |
| 604 | iso_pu_bacteria | 2889914905 | 2889918882 | 260 |
| 605 | iso_pu_bacteria | 2891048133 | 2891051784 | 260 |
| 606 | iso_pu_bacteria | 2896384573 | 2896390771 | 260 |
| 607 | iso_pu_bacteria | 2903448605 | 2903455575 | 260 |
| 608 | iso_pu_bacteria | 2903521522 | 2903522764 | 260 |
| 609 | iso_pu_bacteria | 2903528002 | 2903532954 | 260 |
| 610 | iso_pu_bacteria | 2906354277 | 2906361443 | 260 |
| 611 | iso_pu_bacteria | 2906414383 | 2906416195 | 260 |
| 612 | iso_pu_bacteria | 2915986958 | 2915988417 | 260 |
| 613 | iso_pu_bacteria | 2915993759 | 2915999077 | 260 |
| 614 | iso_pu_bacteria | 2916000859 | 2916005338 | 260 |
| 615 | iso_pu_bacteria | 2916007675 | 2916013756 | 260 |
| 616 | iso_pu_bacteria | 2916014648 | 2916017398 | 260 |
| 617 | iso_pu_bacteria | 2916021584 | 2916023983 | 260 |
| 618 | iso_pu_bacteria | 2916028427 | 2916033256 | 260 |
| 619 | iso_pu_bacteria | 2916035215 | 2916036685 | 260 |
| 620 | iso_pu_bacteria | 2916041962 | 2916044250 | 260 |
| 621 | iso_pu_bacteria | 2916048683 | 2916052188 | 260 |
| 622 | iso_pu_bacteria | 2916055098 | 2916055509 | 260 |
| 623 | iso_pu_bacteria | 2916068649 | 2916071594 | 260 |
| 624 | iso_pu_bacteria | 2916076590 | 2916081205 | 260 |
| 625 | iso_pu_bacteria | 2921201388 | 2921207402 | 260 |
| 626 | iso_pu_bacteria | 2921208531 | 2921214390 | 260 |
| 627 | iso_pu_bacteria | 2921237296 | 2921241858 | 260 |
| 628 | iso_pu_bacteria | 2921244191 | 2921246606 | 260 |
| 629 | iso_pu_bacteria | 2921257292 | 2921259566 | 260 |
| 630 | iso_pu_bacteria | 2921263974 | 2921267002 | 260 |
| 631 | iso_pu_bacteria | 2921282425 | 2921288292 | 260 |
| 632 | iso_pu_bacteria | 2921289301 | 2921290531 | 260 |
| 633 | iso_pu_bacteria | 2922185730 | 2922192542 | 260 |
| 634 | iso_pu_bacteria | 2924144063 | 2924145962 | 260 |
| 635 | iso_pu_bacteria | 2924150972 | 2924154580 | 260 |
| 636 | iso_pu_bacteria | 2924158325 | 2924162302 | 260 |
| 637 | iso_pu_bacteria | 2924165586 | 2924166990 | 260 |
| 638 | iso_pu_bacteria | 2924172951 | 2924176308 | 260 |
| 639 | iso_pu_bacteria | 2924179722 | 2924184362 | 260 |
| 640 | iso_pu_bacteria | 2924186466 | 2924189811 | 260 |
| 641 | iso_pu_bacteria | 2924193448 | 2924196509 | 260 |
| 642 | iso_pu_bacteria | 2924200457 | 2924205793 | 260 |
| 643 | iso_pu_bacteria | 2924207177 | 2924211256 | 260 |
| 644 | iso_pu_bacteria | 2924214083 | 2924215132 | 260 |
| 645 | iso_pu_bacteria | 2924221636 | 2924224992 | 260 |
| 646 | iso_pu_bacteria | 2924228884 | 2924231476 | 260 |
| 647 | iso_pu_bacteria | 2924762789 | 2924765076 | 260 |
| 648 | iso_pu_bacteria | 2924776078 | 2924781189 | 260 |
| 649 | iso_pu_bacteria | 2936996657 | 2936999619 | 260 |
| 650 | iso_pu_bacteria | 2937002841 | 2937006019 | 260 |
| 651 | iso_pu_bacteria | 2937009748 | 2937013309 | 260 |
| 652 | iso_pu_bacteria | 2937016420 | 2937019306 | 260 |
| 653 | iso_pu_bacteria | 2937023124 | 2937028879 | 260 |
| 654 | iso_pu_bacteria | 2937042894 | 2937044329 | 260 |
| 655 | iso_pu_bacteria | 2937049772 | 2937054679 | 260 |
| 656 | iso_pu_bacteria | 2937056579 | 2937057301 | 260 |
| 657 | iso_pu_bacteria | 2937063883 | 2937068058 | 260 |
| 658 | iso_pu_bacteria | 2937071275 | 2937077523 | 260 |
| 659 | iso_pu_bacteria | 2937091812 | 2937093629 | 260 |
| 660 | iso_pu_bacteria | 2937098957 | 2937099668 | 260 |
| 661 | iso_pu_bacteria | 2937106411 | 2937107247 | 260 |
| 662 | iso_pu_bacteria | 2937113482 | 2937115188 | 260 |
| 663 | iso_pu_bacteria | 2937119839 | 2937120290 | 260 |
| 664 | iso_pu_bacteria | 2937126314 | 2937129078 | 260 |
| 665 | iso_pu_bacteria | 2937848649 | 2937849167 | 260 |
| 666 | iso_pu_bacteria | 2937877337 | 2937877612 | 260 |
| 667 | iso_pu_bacteria | 2937972304 | 2937975303 | 260 |
| 668 | iso_pu_bacteria | 2938014810 | 2938015400 | 260 |
| 669 | iso_pu_bacteria | 2941499720 | 2941503670 | 260 |
| 670 | iso_pu_bacteria | 2957382221 | 2957387476 | 260 |
| 671 | iso_pu_bacteria | 2957388812 | 2957391756 | 260 |
| 672 | iso_pu_bacteria | 2957395598 | 2957399980 | 260 |
| 673 | iso_pu_bacteria | 2957402308 | 2957404848 | 260 |
| 674 | iso_pu_bacteria | 2957408893 | 2957410885 | 260 |
| 675 | iso_pu_bacteria | 2957415311 | 2957420985 | 260 |
| 676 | iso_pu_bacteria | 2957422303 | 2957425965 | 260 |
| 677 | iso_pu_bacteria | 2957430029 | 2957433961 | 260 |
| 678 | iso_pu_bacteria | 2957443900 | 2957445668 | 260 |
| 679 | iso_pu_bacteria | 2957450854 | 2957454603 | 260 |
| 680 | iso_pu_bacteria | 2957457609 | 2957464279 | 260 |
| 681 | iso_pu_bacteria | 2957464669 | 2957467793 | 260 |
| 682 | iso_pu_bacteria | 2957471148 | 2957472482 | 260 |
| 683 | iso_pu_bacteria | 2957478035 | 2957480751 | 260 |
| 684 | iso_pu_bacteria | 2957484790 | 2957488504 | 260 |
| 685 | iso_pu_bacteria | 2957491536 | 2957494382 | 260 |
| 686 | iso_pu_bacteria | 2957498199 | 2957502694 | 260 |
| 687 | iso_pu_bacteria | 2957505466 | 2957508766 | 260 |
| 688 | iso_pu_bacteria | 2958034702 | 2958035571 | 260 |
| 689 | iso_pu_bacteria | 2958041894 | 2958043758 | 260 |
| 690 | iso_pu_bacteria | 2958064165 | 2958066960 | 260 |
| 691 | iso_pu_bacteria | 2958084443 | 2958084720 | 260 |
| 692 | iso_pu_bacteria | 2958092219 | 2958096455 | 260 |
| 693 | iso_pu_bacteria | 2958100919 | 2958107012 | 260 |
| 694 | iso_pu_bacteria | 2958144490 | 2958147061 | 260 |
| 695 | iso_pu_bacteria | 2958172287 | 2958176532 | 260 |
| 696 | iso_pu_bacteria | 2960584000 | 2960590833 | 260 |
| 697 | iso_pu_bacteria | 2960597568 | 2960598228 | 260 |
| 698 | iso_pu_bacteria | 2960603979 | 2960609097 | 260 |
| 699 | iso_pu_bacteria | 2960610863 | 2960615857 | 260 |
| 700 | iso_pu_bacteria | 2960617483 | 2960623535 | 260 |
| 701 | iso_pu_bacteria | 2960624210 | 2960627625 | 260 |
| 702 | iso_pu_bacteria | 2960637947 | 2960645434 | 260 |
| 703 | iso_pu_bacteria | 2960645483 | 2960649064 | 260 |
| 704 | iso_pu_bacteria | 2960652885 | 2960659276 | 260 |
| 705 | iso_pu_bacteria | 2960660292 | 2960662215 | 260 |
| 706 | iso_pu_bacteria | 2960667422 | 2960672752 | 260 |
| 707 | iso_pu_bacteria | 2960674078 | 2960677127 | 260 |
| 708 | iso_pu_bacteria | 2960687367 | 2960689880 | 260 |
| 709 | iso_pu_bacteria | 2961127735 | 2961132610 | 260 |
| 710 | iso_pu_bacteria | 2963644680 | 2963648305 | 260 |
| 711 | iso_pu_bacteria | 2964607997 | 2964614532 | 260 |
| 712 | iso_pu_bacteria | 2964615318 | 2964616891 | 260 |
| 713 | iso_pu_bacteria | 2964621998 | 2964624651 | 260 |
| 714 | iso_pu_bacteria | 2964628898 | 2964631141 | 260 |
| 715 | iso_pu_bacteria | 2964636051 | 2964637521 | 260 |
| 716 | iso_pu_bacteria | 2964643177 | 2964646414 | 260 |
| 717 | iso_pu_bacteria | 2964649959 | 2964651633 | 260 |
| 718 | iso_pu_bacteria | 2964656573 | 2964662384 | 260 |
| 719 | iso_pu_bacteria | 2964663802 | 2964669856 | 260 |
| 720 | iso_pu_bacteria | 2964670856 | 2964675870 | 260 |
| 721 | iso_pu_bacteria | 2964678106 | 2964683761 | 260 |
| 722 | iso_pu_bacteria | 2964685014 | 2964686843 | 260 |
| 723 | iso_pu_bacteria | 2964691889 | 2964694431 | 260 |
| 724 | iso_pu_bacteria | 2964698721 | 2964699682 | 260 |
| 725 | iso_pu_bacteria | 2964705432 | 2964710701 | 260 |
| 726 | iso_pu_bacteria | 2964712639 | 2964715671 | 260 |
| 727 | iso_pu_bacteria | 2964719344 | 2964723489 | 260 |
| 728 | iso_pu_bacteria | 2965119406 | 2965124433 | 260 |
| 729 | iso_pu_bacteria | 2967664464 | 2967665218 | 260 |
| 730 | iso_pu_bacteria | 2967671571 | 2967675565 | 260 |
| 731 | iso_pu_bacteria | 2967678726 | 2967681536 | 260 |
| 732 | iso_pu_bacteria | 2967693043 | 2967699590 | 260 |
| 733 | iso_pu_bacteria | 2967699805 | 2967700023 | 260 |
| 734 | iso_pu_bacteria | 2967706974 | 2967709016 | 260 |
| 735 | iso_pu_bacteria | 2967714385 | 2967716785 | 260 |
| 736 | iso_pu_bacteria | 2967721400 | 2967728151 | 260 |
| 737 | iso_pu_bacteria | 2967735183 | 2967741367 | 260 |
| 738 | iso_pu_bacteria | 2967742019 | 2967745747 | 260 |
| 739 | iso_pu_bacteria | 2967748971 | 2967753782 | 260 |
| 740 | iso_pu_bacteria | 2967755722 | 2967758655 | 260 |
| 741 | iso_pu_bacteria | 2967762386 | 2967762818 | 260 |
| 742 | iso_pu_bacteria | 2967769361 | 2967770882 | 260 |
| 743 | iso_pu_bacteria | 2967775926 | 2967779309 | 260 |
| 744 | iso_pu_bacteria | 2968016561 | 2968017881 | 260 |
| 745 | iso_pu_bacteria | 2968083720 | 2968084819 | 260 |
| 746 | iso_pu_bacteria | 2968117919 | 2968123138 | 260 |
| 747 | iso_pu_bacteria | 2970019648 | 2970024622 | 260 |
| 748 | iso_pu_bacteria | 2970033650 | 2970036958 | 260 |
| 749 | iso_pu_bacteria | 2970040964 | 2970046540 | 260 |
| 750 | iso_pu_bacteria | 2970047711 | 2970048895 | 260 |
| 751 | iso_pu_bacteria | 2970054988 | 2970057133 | 260 |
| 752 | iso_pu_bacteria | 2970061556 | 2970062592 | 260 |
| 753 | iso_pu_bacteria | 2970068827 | 2970070894 | 260 |
| 754 | iso_pu_bacteria | 2970076120 | 2970082641 | 260 |
| 755 | iso_pu_bacteria | 2970082768 | 2970083652 | 260 |
| 756 | iso_pu_bacteria | 2970088815 | 2970090489 | 260 |
| 757 | iso_pu_bacteria | 2970095765 | 2970099155 | 260 |
| 758 | iso_pu_bacteria | 2970102677 | 2970107405 | 260 |
| 759 | iso_pu_bacteria | 2970109326 | 2970111607 | 260 |
| 760 | iso_pu_bacteria | 2970116247 | 2970121896 | 260 |
| 761 | iso_pu_bacteria | 2970129317 | 2970130357 | 260 |
| 762 | iso_pu_bacteria | 2970136068 | 2970136353 | 260 |
| 763 | iso_pu_bacteria | 2970149975 | 2970155877 | 260 |
| 764 | iso_pu_bacteria | 2970156795 | 2970157501 | 260 |
| 765 | iso_pu_bacteria | 2970164137 | 2970168211 | 260 |
| 766 | iso_pu_bacteria | 2970170962 | 2970174677 | 260 |
| 767 | iso_pu_bacteria | 2970177841 | 2970180500 | 260 |
| 768 | iso_pu_bacteria | 2970184632 | 2970190466 | 260 |
| 769 | iso_pu_bacteria | 2970191845 | 2970195771 | 260 |
| 770 | iso_pu_bacteria | 2970469710 | 2970471944 | 260 |
| 771 | iso_pu_bacteria | 2970593180 | 2970594027 | 260 |
| 772 | iso_pu_bacteria | 2977516862 | 2977522866 | 260 |
| 773 | iso_pu_bacteria | 2977523885 | 2977530707 | 260 |
| 774 | iso_pu_bacteria | 2977537788 | 2977542607 | 260 |
| 775 | iso_pu_bacteria | 2977551784 | 2977555882 | 260 |
| 776 | iso_pu_bacteria | 2977558990 | 2977561023 | 260 |
| 777 | iso_pu_bacteria | 2977565890 | 2977567875 | 260 |
| 778 | iso_pu_bacteria | 2977572785 | 2977575144 | 260 |
| 779 | iso_pu_bacteria | 2977579622 | 2977586111 | 260 |
| 780 | iso_pu_bacteria | 2977922695 | 2977923054 | 260 |
| 781 | iso_pu_bacteria | 2977986579 | 2977990369 | 260 |
| 782 | iso_pu_bacteria | 2979710463 | 2979712098 | 260 |
| 783 | iso_pu_bacteria | 2979742915 | 2979743953 | 260 |
| 784 | iso_pu_bacteria | 2987652177 | 2987653195 | 260 |
| 785 | iso_pu_bacteria | 2987666974 | 2987672369 | 260 |
| 786 | iso_pu_bacteria | 2989771324 | 2989774923 | 260 |
| 787 | iso_pu_bacteria | 2996348954 | 2996350877 | 260 |
| 788 | iso_pu_bacteria | 3004211236 | 3004211716 | 260 |
| 789 | iso_pu_bacteria | 3004218560 | 3004218963 | 260 |
| 790 | iso_pu_bacteria | 3004275668 | 3004277575 | 260 |
| 791 | iso_pu_bacteria | 3004334049 | 3004341044 | 260 |
| 792 | iso_pu_bacteria | 637000159 | 637073964 | 260 |
| 793 | iso_pu_bacteria | 643692032 | 643825884 | 260 |
| 794 | iso_pu_bacteria | 648276728 | 648737468 | 260 |
| 795 | iso_pu_bacteria | 8003992118 | 8003993753 | 260 |
| 796 | 3300005262 | Ga0065165_1028168 | Ga0065165_10281682 | 261 |
| 797 | 3300006186 | Ga0075369_10002384 | Ga0075369_100023846 | 261 |
| 798 | 3300037418 | Ga0395900_0136486 | Ga0395900_0136486_985_1794 | 261 |
| 799 | 3300048918 | Ga0496115_0259045 | Ga0496115_0259045_83_886 | 261 |
| 800 | iso_pu_bacteria | 2643221607 | 2644049152 | 261 |
| 801 | iso_pu_bacteria | 2643221636 | 2644204503 | 261 |
| 802 | iso_pu_bacteria | 2643221686 | 2644482186 | 261 |
| 803 | iso_pu_bacteria | 2885312484 | 2885317084 | 261 |
| 804 | 3300003203 | JGI25406J46586_10030139 | JGI25406J46586_100301392 | 262 |
| 805 | 3300005985 | Ga0081539_10001646 | Ga0081539_100016465 | 262 |
| 806 | 3300009094 | Ga0111539_10408817 | Ga0111539_104088172 | 262 |
| 807 | 3300013306 | Ga0163162_10932151 | Ga0163162_109321512 | 262 |
| 808 | 3300041413 | Ga0439465_0094901 | Ga0439465_0094901_144_995 | 262 |
| 809 | 3300042007 | Ga0439449_0074392 | Ga0439449_0074392_78_929 | 262 |
| 810 | 3300046460 | Ga0495638_0035740 | Ga0495638_0035740_943_1749 | 262 |
| 811 | 3300049571 | Ga0501034_0191407 | Ga0501034_0191407_278_1087 | 262 |
| 812 | 3300053088 | Ga0500644_0005437 | Ga0500644_0005437_700_1506 | 262 |
| 813 | 3300053090 | Ga0500646_0033849 | Ga0500646_0033849_506_1312 | 262 |
| 814 | 3300053122 | Ga0500608_074631 | Ga0500608_074631_623_1429 | 262 |
| 815 | 3300053156 | Ga0500622_0000159 | Ga0500622_0000159_47988_48794 | 262 |
| 816 | iso_pu_bacteria | 2508501127 | 2509145007 | 262 |
| 817 | iso_pu_bacteria | 2513237305 | 2514422681 | 262 |
| 818 | iso_pu_bacteria | 2643221551 | 2643775362 | 262 |
| 819 | iso_pu_bacteria | 2643221555 | 2643793808 | 262 |
| 820 | iso_pu_bacteria | 2721755686 | 2723576416 | 262 |
| 821 | iso_pu_bacteria | 2847686936 | 2847692923 | 262 |
| 822 | iso_pu_bacteria | 2856356410 | 2856360326 | 262 |
| 823 | iso_pu_bacteria | 2871444079 | 2871450789 | 262 |
| 824 | iso_pu_bacteria | 2871488783 | 2871495812 | 262 |
| 825 | iso_pu_bacteria | 2871495908 | 2871503018 | 262 |
| 826 | iso_pu_bacteria | 2874102143 | 2874106317 | 262 |
| 827 | iso_pu_bacteria | 2876369609 | 2876373440 | 262 |
| 828 | iso_pu_bacteria | 2876392853 | 2876394942 | 262 |
| 829 | iso_pu_bacteria | 2878753008 | 2878753389 | 262 |
| 830 | iso_pu_bacteria | 2878760144 | 2878766907 | 262 |
| 831 | iso_pu_bacteria | 2878767105 | 2878774105 | 262 |
| 832 | iso_pu_bacteria | 2881147464 | 2881152901 | 262 |
| 833 | iso_pu_bacteria | 2881161766 | 2881168280 | 262 |
| 834 | iso_pu_bacteria | 2881845957 | 2881848825 | 262 |
| 835 | iso_pu_bacteria | 2881861095 | 2881863361 | 262 |
| 836 | iso_pu_bacteria | 2882632389 | 2882637910 | 262 |
| 837 | iso_pu_bacteria | 2882912400 | 2882917074 | 262 |
| 838 | iso_pu_bacteria | 2885305155 | 2885310269 | 262 |
| 839 | iso_pu_bacteria | 2885318864 | 2885322952 | 262 |
| 840 | iso_pu_bacteria | 2903492973 | 2903495244 | 262 |
| 841 | iso_pu_bacteria | 2903540706 | 2903548207 | 262 |
| 842 | iso_pu_bacteria | 2904659560 | 2904661573 | 262 |
| 843 | iso_pu_bacteria | 2906328253 | 2906335328 | 262 |
| 844 | iso_pu_bacteria | 2922158528 | 2922161636 | 262 |
| 845 | iso_pu_bacteria | 2924726620 | 2924733169 | 262 |
| 846 | iso_pu_bacteria | 2924784321 | 2924789697 | 262 |
| 847 | iso_pu_bacteria | 2937822353 | 2937827337 | 262 |
| 848 | iso_pu_bacteria | 2937891427 | 2937897014 | 262 |
| 849 | iso_pu_bacteria | 2937994558 | 2938002032 | 262 |
| 850 | iso_pu_bacteria | 2958115193 | 2958122229 | 262 |
| 851 | iso_pu_bacteria | 2958165035 | 2958172086 | 262 |
| 852 | iso_pu_bacteria | 2961114664 | 2961116726 | 262 |
| 853 | iso_pu_bacteria | 2961163497 | 2961170533 | 262 |
| 854 | iso_pu_bacteria | 2961170736 | 2961177833 | 262 |
| 855 | iso_pu_bacteria | 2965018300 | 2965025280 | 262 |
| 856 | iso_pu_bacteria | 2965062239 | 2965065391 | 262 |
| 857 | iso_pu_bacteria | 2967996073 | 2968003100 | 262 |
| 858 | iso_pu_bacteria | 2968003550 | 2968003926 | 262 |
| 859 | iso_pu_bacteria | 2968091066 | 2968096038 | 262 |
| 860 | iso_pu_bacteria | 2968097103 | 2968097526 | 262 |
| 861 | iso_pu_bacteria | 2968110612 | 2968112633 | 262 |
| 862 | iso_pu_bacteria | 2968128360 | 2968130928 | 262 |
| 863 | iso_pu_bacteria | 2968171901 | 2968178919 | 262 |
| 864 | iso_pu_bacteria | 2970503327 | 2970510509 | 262 |
| 865 | iso_pu_bacteria | 2970554993 | 2970561763 | 262 |
| 866 | iso_pu_bacteria | 2977821940 | 2977822671 | 262 |
| 867 | iso_pu_bacteria | 2977828996 | 2977835139 | 262 |
| 868 | iso_pu_bacteria | 2977858184 | 2977863278 | 262 |
| 869 | iso_pu_bacteria | 2977864932 | 2977872479 | 262 |
| 870 | iso_pu_bacteria | 2979779861 | 2979785075 | 262 |
| 871 | iso_pu_bacteria | 2979808191 | 2979815383 | 262 |
| 872 | iso_pu_bacteria | 2987659509 | 2987666773 | 262 |
| 873 | iso_pu_bacteria | 2996341866 | 2996344957 | 262 |
| 874 | iso_pu_bacteria | 3004188549 | 3004195776 | 262 |
| 875 | iso_pu_bacteria | 8004374579 | 8004374961 | 262 |
| 876 | iso_pu_bacteria | 8004445564 | 8004452175 | 262 |
| 877 | iso_pu_bacteria | 8004703790 | 8004713663 | 262 |
| 878 | 3300006186 | Ga0075369_10106086 | Ga0075369_101060862 | 263 |
| 879 | 3300006946 | Ga0079104_1002441 | Ga0079104_100244110 | 263 |
| 880 | 3300009177 | Ga0105248_10210616 | Ga0105248_102106162 | 263 |
| 881 | 3300022739 | Ga0228711_1000007 | Ga0228711_100000746 | 263 |
| 882 | 3300022740 | Ga0228710_1000007 | Ga0228710_100000733 | 263 |
| 883 | 3300027111 | Ga0209281_1000128 | Ga0209281_1000128158 | 263 |
| 884 | 3300027666 | Ga0209282_1000034 | Ga0209282_100003492 | 263 |
| 885 | 3300031731 | Ga0307405_10117606 | Ga0307405_101176062 | 263 |
| 886 | 3300031967 | Ga0315914_1000010 | Ga0315914_1000010130 | 263 |
| 887 | 3300033430 | Ga0315913_1000005 | Ga0315913_1000005130 | 263 |
| 888 | 3300033464 | Ga0315915_1000012 | Ga0315915_100001233 | 263 |
| 889 | 3300041411 | Ga0439466_0058972 | Ga0439466_0058972_212_1039 | 263 |
| 890 | 3300049568 | Ga0501031_0000019 | Ga0501031_0000019_7208_8020 | 263 |
| 891 | 3300049568 | Ga0501031_0075753 | Ga0501031_0075753_853_1665 | 263 |
| 892 | 3300049569 | Ga0501032_0000009 | Ga0501032_0000009_119968_120780 | 263 |
| 893 | 3300049570 | Ga0501033_0000019 | Ga0501033_0000019_107328_108140 | 263 |
| 894 | 3300049570 | Ga0501033_0015322 | Ga0501033_0015322_4859_5671 | 263 |
| 895 | 3300049570 | Ga0501033_0035599 | Ga0501033_0035599_719_1531 | 263 |
| 896 | 3300049571 | Ga0501034_0000044 | Ga0501034_0000044_119968_120780 | 263 |
| 897 | 3300049571 | Ga0501034_0061223 | Ga0501034_0061223_145_957 | 263 |
| 898 | 3300049571 | Ga0501034_0363280 | Ga0501034_0363280_491_1303 | 263 |
| 899 | 3300049572 | Ga0501036_0000008 | Ga0501036_0000008_119968_120780 | 263 |
| 900 | 3300049573 | Ga0501037_0000055 | Ga0501037_0000055_74314_75126 | 263 |
| 901 | 3300049573 | Ga0501037_0122415 | Ga0501037_0122415_938_1750 | 263 |
| 902 | 3300049574 | Ga0501038_0000006 | Ga0501038_0000006_119968_120780 | 263 |
| 903 | 3300049574 | Ga0501038_0210218 | Ga0501038_0210218_196_1008 | 263 |
| 904 | 3300049575 | Ga0501039_0000014 | Ga0501039_0000014_107328_108140 | 263 |
| 905 | 3300049575 | Ga0501039_0153399 | Ga0501039_0153399_853_1665 | 263 |
| 906 | 3300049576 | Ga0501040_0002131 | Ga0501040_0002131_524_1336 | 263 |
| 907 | 3300049579 | Ga0501043_0001366 | Ga0501043_0001366_10857_11669 | 263 |
| 908 | 3300049580 | Ga0501046_0044412 | Ga0501046_0044412_2352_3164 | 263 |
| 909 | 3300049581 | Ga0501047_0001105 | Ga0501047_0001105_2137_2949 | 263 |
| 910 | 3300049581 | Ga0501047_0202133 | Ga0501047_0202133_625_1437 | 263 |
| 911 | 3300049581 | Ga0501047_0209212 | Ga0501047_0209212_853_1665 | 263 |
| 912 | 3300049582 | Ga0501048_0102175 | Ga0501048_0102175_179_991 | 263 |
| 913 | 3300049584 | Ga0501068_0028700 | Ga0501068_0028700_480_1292 | 263 |
| 914 | 3300049585 | Ga0501069_0116980 | Ga0501069_0116980_695_1507 | 263 |
| 915 | 3300049586 | Ga0501070_0031602 | Ga0501070_0031602_3049_3861 | 263 |
| 916 | 3300049586 | Ga0501070_0049649 | Ga0501070_0049649_2492_3304 | 263 |
| 917 | 3300049586 | Ga0501070_0543356 | Ga0501070_0543356_12_824 | 263 |
| 918 | 3300049588 | Ga0501072_0386373 | Ga0501072_0386373_90_899 | 263 |
| 919 | 3300049589 | Ga0501073_0033412 | Ga0501073_0033412_2470_3282 | 263 |
| 920 | 3300049744 | Ga0501083_0023789 | Ga0501083_0023789_795_1607 | 263 |
| 921 | 3300049822 | Ga0501035_0000096 | Ga0501035_0000096_35482_36294 | 263 |
| 922 | 3300049822 | Ga0501035_0077476 | Ga0501035_0077476_199_1011 | 263 |
| 923 | 3300049822 | Ga0501035_0079908 | Ga0501035_0079908_70_882 | 263 |
| 924 | 3300049823 | Ga0501044_0000017 | Ga0501044_0000017_107328_108140 | 263 |
| 925 | 3300049823 | Ga0501044_0112084 | Ga0501044_0112084_971_1783 | 263 |
| 926 | 3300049824 | Ga0501045_0096237 | Ga0501045_0096237_527_1339 | 263 |
| 927 | 3300050516 | nmdc:mga0sz30_34318_c2 | nmdc:mga0sz30_34318_c2_390_1202 | 263 |
| 928 | 3300053087 | Ga0500643_024125 | Ga0500643_024125_768_1595 | 263 |
| 929 | iso_pu_bacteria | 2509276018 | 2509370748 | 263 |
| 930 | iso_pu_bacteria | 2510065059 | 2510317536 | 263 |
| 931 | iso_pu_bacteria | 2512875024 | 2512958648 | 263 |
| 932 | iso_pu_bacteria | 2513237164 | 2514034938 | 263 |
| 933 | iso_pu_bacteria | 2513237351 | 2514590148 | 263 |
| 934 | iso_pu_bacteria | 2597489875 | 2597814128 | 263 |
| 935 | iso_pu_bacteria | 2599185352 | 2600193206 | 263 |
| 936 | iso_pu_bacteria | 2643221557 | 2643803703 | 263 |
| 937 | iso_pu_bacteria | 2643221595 | 2643989357 | 263 |
| 938 | iso_pu_bacteria | 2643221610 | 2644067672 | 263 |
| 939 | iso_pu_bacteria | 2643221627 | 2644152929 | 263 |
| 940 | iso_pu_bacteria | 2643221668 | 2644375350 | 263 |
| 941 | iso_pu_bacteria | 2643221675 | 2644418726 | 263 |
| 942 | iso_pu_bacteria | 2643221680 | 2644452092 | 263 |
| 943 | iso_pu_bacteria | 2643221723 | 2644672582 | 263 |
| 944 | iso_pu_bacteria | 2643221726 | 2644690855 | 263 |
| 945 | iso_pu_bacteria | 2687453392 | 2688599463 | 263 |
| 946 | iso_pu_bacteria | 2756170246 | 2756675935 | 263 |
| 947 | iso_pu_bacteria | 2791355123 | 2792748571 | 263 |
| 948 | iso_pu_bacteria | 2841734538 | 2841739980 | 263 |
| 949 | iso_pu_bacteria | 2844002411 | 2844006404 | 263 |
| 950 | iso_pu_bacteria | 2844009547 | 2844014736 | 263 |
| 951 | iso_pu_bacteria | 2856334872 | 2856335062 | 263 |
| 952 | iso_pu_bacteria | 2856342000 | 2856348339 | 263 |
| 953 | iso_pu_bacteria | 2857367948 | 2857372742 | 263 |
| 954 | iso_pu_bacteria | 2869162929 | 2869165226 | 263 |
| 955 | iso_pu_bacteria | 2869169390 | 2869170425 | 263 |
| 956 | iso_pu_bacteria | 2869242130 | 2869245221 | 263 |
| 957 | iso_pu_bacteria | 2869249662 | 2869249799 | 263 |
| 958 | iso_pu_bacteria | 2869256925 | 2869259676 | 263 |
| 959 | iso_pu_bacteria | 2869271264 | 2869276333 | 263 |
| 960 | iso_pu_bacteria | 2871459585 | 2871465996 | 263 |
| 961 | iso_pu_bacteria | 2871466892 | 2871469267 | 263 |
| 962 | iso_pu_bacteria | 2871474448 | 2871477270 | 263 |
| 963 | iso_pu_bacteria | 2871481445 | 2871484521 | 263 |
| 964 | iso_pu_bacteria | 2874116593 | 2874119197 | 263 |
| 965 | iso_pu_bacteria | 2876386047 | 2876392323 | 263 |
| 966 | iso_pu_bacteria | 2876420981 | 2876422440 | 263 |
| 967 | iso_pu_bacteria | 2878774303 | 2878776977 | 263 |
| 968 | iso_pu_bacteria | 2878781027 | 2878784704 | 263 |
| 969 | iso_pu_bacteria | 2878788777 | 2878794568 | 263 |
| 970 | iso_pu_bacteria | 2888343758 | 2888347434 | 263 |
| 971 | iso_pu_bacteria | 2906378014 | 2906378806 | 263 |
| 972 | iso_pu_bacteria | 2906393657 | 2906398979 | 263 |
| 973 | iso_pu_bacteria | 2906401398 | 2906404614 | 263 |
| 974 | iso_pu_bacteria | 2906427513 | 2906429937 | 263 |
| 975 | iso_pu_bacteria | 2920822456 | 2920824607 | 263 |
| 976 | iso_pu_bacteria | 2922151315 | 2922152874 | 263 |
| 977 | iso_pu_bacteria | 2924741084 | 2924745822 | 263 |
| 978 | iso_pu_bacteria | 2924754689 | 2924761847 | 263 |
| 979 | iso_pu_bacteria | 2937836603 | 2937839774 | 263 |
| 980 | iso_pu_bacteria | 2937861824 | 2937866608 | 263 |
| 981 | iso_pu_bacteria | 2937868953 | 2937873407 | 263 |
| 982 | iso_pu_bacteria | 2937980651 | 2937987169 | 263 |
| 983 | iso_pu_bacteria | 2958071322 | 2958077474 | 263 |
| 984 | iso_pu_bacteria | 2958108152 | 2958109485 | 263 |
| 985 | iso_pu_bacteria | 2958122699 | 2958123841 | 263 |
| 986 | iso_pu_bacteria | 2961136820 | 2961142140 | 263 |
| 987 | iso_pu_bacteria | 2961183825 | 2961186367 | 263 |
| 988 | iso_pu_bacteria | 2965025482 | 2965029564 | 263 |
| 989 | iso_pu_bacteria | 2965032056 | 2965032079 | 263 |
| 990 | iso_pu_bacteria | 2965040258 | 2965046462 | 263 |
| 991 | iso_pu_bacteria | 2965047637 | 2965053794 | 263 |
| 992 | iso_pu_bacteria | 2965089291 | 2965094255 | 263 |
| 993 | iso_pu_bacteria | 2965102966 | 2965105390 | 263 |
| 994 | iso_pu_bacteria | 2965110997 | 2965111444 | 263 |
| 995 | iso_pu_bacteria | 2970489779 | 2970492736 | 263 |
| 996 | iso_pu_bacteria | 2970510686 | 2970518186 | 263 |
| 997 | iso_pu_bacteria | 2970540015 | 2970541176 | 263 |
| 998 | iso_pu_bacteria | 2970547951 | 2970549997 | 263 |
| 999 | iso_pu_bacteria | 2970619444 | 2970620884 | 263 |
| 1000 | iso_pu_bacteria | 2970627176 | 2970631636 | 263 |
| 1001 | iso_pu_bacteria | 2977851361 | 2977858052 | 263 |
| 1002 | iso_pu_bacteria | 2977872689 | 2977875172 | 263 |
| 1003 | iso_pu_bacteria | 2977907340 | 2977911227 | 263 |
| 1004 | iso_pu_bacteria | 2977915119 | 2977917768 | 263 |
| 1005 | iso_pu_bacteria | 2977935797 | 2977939637 | 263 |
| 1006 | iso_pu_bacteria | 2977950692 | 2977955324 | 263 |
| 1007 | iso_pu_bacteria | 2977957713 | 2977960911 | 263 |
| 1008 | iso_pu_bacteria | 2979764755 | 2979771622 | 263 |
| 1009 | iso_pu_bacteria | 2979793036 | 2979795595 | 263 |
| 1010 | iso_pu_bacteria | 2987645492 | 2987648473 | 263 |
| 1011 | iso_pu_bacteria | 2987673487 | 2987674961 | 263 |
| 1012 | iso_pu_bacteria | 2989776772 | 2989779040 | 263 |
| 1013 | iso_pu_bacteria | 2996310559 | 2996310713 | 263 |
| 1014 | iso_pu_bacteria | 2996386984 | 2996392529 | 263 |
| 1015 | iso_pu_bacteria | 3000135777 | 3000138522 | 263 |
| 1016 | iso_pu_bacteria | 3004167301 | 3004169549 | 263 |
| 1017 | iso_pu_bacteria | 3004195979 | 3004196422 | 263 |
| 1018 | iso_pu_bacteria | 3004232784 | 3004237132 | 263 |
| 1019 | iso_pu_bacteria | 3004248173 | 3004251980 | 263 |
| 1020 | iso_pu_bacteria | 3004268573 | 3004275162 | 263 |
| 1021 | iso_pu_bacteria | 649633066 | 649873967 | 263 |
| 1022 | iso_pu_bacteria | 8004300914 | 8004302312 | 263 |
| 1023 | iso_pu_bacteria | 8004312739 | 8004319294 | 263 |
| 1024 | iso_pu_bacteria | 8004361976 | 8004367952 | 263 |
| 1025 | iso_pu_bacteria | 8004633249 | 8004634109 | 263 |
| 1026 | iso_pu_bacteria | 8004695233 | 8004695502 | 263 |
| 1027 | iso_pu_bacteria | 8004727605 | 8004727855 | 263 |
| 1028 | iso_pu_bacteria | 8055617313 | 8055621495 | 263 |
| 1029 | 3300002067 | JGI24735J21928_10012420 | JGI24735J21928_100124202 | 264 |
| 1030 | 3300003214 | JGI25165J46597_1000087 | JGI25165J46597_100008712 | 264 |
| 1031 | 3300003214 | JGI25165J46597_1000139 | JGI25165J46597_100013995 | 264 |
| 1032 | 3300003762 | Ga0055542_1000852 | Ga0055542_10008526 | 264 |
| 1033 | 3300003763 | Ga0055529_1006783 | Ga0055529_10067832 | 264 |
| 1034 | 3300005339 | Ga0070660_100157699 | Ga0070660_1001576992 | 264 |
| 1035 | 3300005459 | Ga0068867_100446713 | Ga0068867_1004467131 | 264 |
| 1036 | 3300005539 | Ga0068853_100054361 | Ga0068853_1000543611 | 264 |
| 1037 | 3300005539 | Ga0068853_100555889 | Ga0068853_1005558892 | 264 |
| 1038 | 3300005548 | Ga0070665_100172527 | Ga0070665_1001725272 | 264 |
| 1039 | 3300005577 | Ga0068857_100229458 | Ga0068857_1002294582 | 264 |
| 1040 | 3300005577 | Ga0068857_100267173 | Ga0068857_1002671732 | 264 |
| 1041 | 3300005614 | Ga0068856_100153459 | Ga0068856_1001534592 | 264 |
| 1042 | 3300005614 | Ga0068856_100336098 | Ga0068856_1003360982 | 264 |
| 1043 | 3300005983 | Ga0081540_1045128 | Ga0081540_10451282 | 264 |
| 1044 | 3300006038 | Ga0075365_10230296 | Ga0075365_102302961 | 264 |
| 1045 | 3300006051 | Ga0075364_10002512 | Ga0075364_100025125 | 264 |
| 1046 | 3300006051 | Ga0075364_10023991 | Ga0075364_100239913 | 264 |
| 1047 | 3300006051 | Ga0075364_10150001 | Ga0075364_101500012 | 264 |
| 1048 | 3300006178 | Ga0075367_10100969 | Ga0075367_101009691 | 264 |
| 1049 | 3300006178 | Ga0075367_10247917 | Ga0075367_102479172 | 264 |
| 1050 | 3300006186 | Ga0075369_10070313 | Ga0075369_100703132 | 264 |
| 1051 | 3300006195 | Ga0075366_10263173 | Ga0075366_102631732 | 264 |
| 1052 | 3300006946 | Ga0079104_1007269 | Ga0079104_10072693 | 264 |
| 1053 | 3300009093 | Ga0105240_10252034 | Ga0105240_102520342 | 264 |
| 1054 | 3300009093 | Ga0105240_10443969 | Ga0105240_104439692 | 264 |
| 1055 | 3300009093 | Ga0105240_10472042 | Ga0105240_104720422 | 264 |
| 1056 | 3300009174 | Ga0105241_10606601 | Ga0105241_106066012 | 264 |
| 1057 | 3300009545 | Ga0105237_10619111 | Ga0105237_106191112 | 264 |
| 1058 | 3300009551 | Ga0105238_10031563 | Ga0105238_100315634 | 264 |
| 1059 | 3300010375 | Ga0105239_10271995 | Ga0105239_102719952 | 264 |
| 1060 | 3300013104 | Ga0157370_10367694 | Ga0157370_103676942 | 264 |
| 1061 | 3300013296 | Ga0157374_10299973 | Ga0157374_102999732 | 264 |
| 1062 | 3300014968 | Ga0157379_10343555 | Ga0157379_103435552 | 264 |
| 1063 | 3300015261 | Ga0182006_1056158 | Ga0182006_10561582 | 264 |
| 1064 | 3300021321 | Ga0214542_1024306 | Ga0214542_10243064 | 264 |
| 1065 | 3300021327 | Ga0214543_1000011 | Ga0214543_100001150 | 264 |
| 1066 | 3300025254 | Ga0209148_1000072 | Ga0209148_1000072294 | 264 |
| 1067 | 3300025261 | Ga0209233_1000027 | Ga0209233_1000027273 | 264 |
| 1068 | 3300025272 | Ga0209455_1000329 | Ga0209455_100032911 | 264 |
| 1069 | 3300025297 | Ga0209758_1005350 | Ga0209758_10053505 | 264 |
| 1070 | 3300025904 | Ga0207647_10008647 | Ga0207647_100086475 | 264 |
| 1071 | 3300025907 | Ga0207645_10293898 | Ga0207645_102938981 | 264 |
| 1072 | 3300025913 | Ga0207695_10125922 | Ga0207695_101259222 | 264 |
| 1073 | 3300025913 | Ga0207695_10152526 | Ga0207695_101525262 | 264 |
| 1074 | 3300025924 | Ga0207694_10121901 | Ga0207694_101219012 | 264 |
| 1075 | 3300025961 | Ga0207712_10288509 | Ga0207712_102885092 | 264 |
| 1076 | 3300025986 | Ga0207658_10241812 | Ga0207658_102418122 | 264 |
| 1077 | 3300026041 | Ga0207639_10642175 | Ga0207639_106421751 | 264 |
| 1078 | 3300026067 | Ga0207678_10153009 | Ga0207678_101530092 | 264 |
| 1079 | 3300026078 | Ga0207702_10119691 | Ga0207702_101196912 | 264 |
| 1080 | 3300026089 | Ga0207648_10243476 | Ga0207648_102434762 | 264 |
| 1081 | 3300026116 | Ga0207674_10077701 | Ga0207674_100777013 | 264 |
| 1082 | 3300026142 | Ga0207698_10079523 | Ga0207698_100795233 | 264 |
| 1083 | 3300027111 | Ga0209281_1000864 | Ga0209281_100086417 | 264 |
| 1084 | 3300028794 | Ga0307515_10000656 | Ga0307515_100006565 | 264 |
| 1085 | 3300031548 | Ga0307408_100306544 | Ga0307408_1003065442 | 264 |
| 1086 | 3300031731 | Ga0307405_10097793 | Ga0307405_100977932 | 264 |
| 1087 | 3300031911 | Ga0307412_10433599 | Ga0307412_104335991 | 264 |
| 1088 | 3300037312 | Ga0395899_0235955 | Ga0395899_0235955_189_1001 | 264 |
| 1089 | 3300037418 | Ga0395900_0289467 | Ga0395900_0289467_254_1066 | 264 |
| 1090 | 3300037466 | Ga0395898_0294943 | Ga0395898_0294943_598_1416 | 264 |
| 1091 | 3300037471 | Ga0395905_0041067 | Ga0395905_0041067_2190_3008 | 264 |
| 1092 | 3300037471 | Ga0395905_0181248 | Ga0395905_0181248_393_1205 | 264 |
| 1093 | 3300037471 | Ga0395905_0281100 | Ga0395905_0281100_683_1495 | 264 |
| 1094 | 3300038443 | Ga0395901_0096884 | Ga0395901_0096884_1255_2067 | 264 |
| 1095 | 3300038443 | Ga0395901_0187019 | Ga0395901_0187019_546_1358 | 264 |
| 1096 | 3300046460 | Ga0495638_0002113 | Ga0495638_0002113_14190_15014 | 264 |
| 1097 | 3300046460 | Ga0495638_0023397 | Ga0495638_0023397_1157_1975 | 264 |
| 1098 | 3300046519 | Ga0495632_0100761 | Ga0495632_0100761_210_1022 | 264 |
| 1099 | 3300048905 | Ga0496102_0379779 | Ga0496102_0379779_495_1307 | 264 |
| 1100 | 3300048915 | Ga0496112_0044012 | Ga0496112_0044012_1311_2120 | 264 |
| 1101 | 3300048917 | Ga0496114_0274070 | Ga0496114_0274070_487_1335 | 264 |
| 1102 | 3300048920 | Ga0496117_0263502 | Ga0496117_0263502_36_848 | 264 |
| 1103 | 3300048923 | Ga0496120_0154817 | Ga0496120_0154817_239_1048 | 264 |
| 1104 | 3300048924 | Ga0496121_0304089 | Ga0496121_0304089_90_902 | 264 |
| 1105 | 3300049742 | Ga0501080_0538651 | Ga0501080_0538651_189_1001 | 264 |
| 1106 | 3300050492 | nmdc:mga0yw44_157926_c1 | nmdc:mga0yw44_157926_c1_496_1308 | 264 |
| 1107 | 3300050492 | nmdc:mga0yw44_4313_c1 | nmdc:mga0yw44_4313_c1_2115_2924 | 264 |
| 1108 | 3300050494 | nmdc:mga06z11_242580_c1 | nmdc:mga06z11_242580_c1_117_926 | 264 |
| 1109 | 3300050516 | nmdc:mga0sz30_23726_c1 | nmdc:mga0sz30_23726_c1_319_1128 | 264 |
| 1110 | 3300050516 | nmdc:mga0sz30_45262_c1 | nmdc:mga0sz30_45262_c1_834_1646 | 264 |
| 1111 | 3300053083 | Ga0495655_0056967 | Ga0495655_0056967_219_1031 | 264 |
| 1112 | 3300053108 | Ga0500562_033078 | Ga0500562_033078_318_1142 | 264 |
| 1113 | 3300053117 | Ga0500593_013096 | Ga0500593_013096_1616_2467 | 264 |
| 1114 | 3300053136 | Ga0500559_0053236 | Ga0500559_0053236_132_944 | 264 |
| 1115 | 3300053139 | Ga0500568_0000056 | Ga0500568_0000056_70629_71453 | 264 |
| 1116 | iso_pu_bacteria | 2558860983 | 2561466333 | 264 |
| 1117 | iso_pu_bacteria | 2643221623 | 2644132221 | 264 |
| 1118 | iso_pu_bacteria | 2738541317 | 2738946229 | 264 |
| 1119 | iso_pu_bacteria | 2838736955 | 2838738308 | 264 |
| 1120 | iso_pu_bacteria | 2841840854 | 2841841322 | 264 |
| 1121 | iso_pu_bacteria | 2842140634 | 2842141100 | 264 |
| 1122 | iso_pu_bacteria | 2857531043 | 2857534375 | 264 |
| 1123 | iso_pu_bacteria | 2913308742 | 2913311185 | 264 |
| 1124 | iso_pu_bacteria | 2970524798 | 2970531678 | 264 |
| 1125 | iso_pu_bacteria | 8002285264 | 8002286248 | 264 |
| 1126 | iso_pu_bacteria | 8055431914 | 8055435940 | 264 |
| 1127 | iso_pu_bacteria | 8056875544 | 8056877526 | 264 |
| 1128 | 3300005356 | Ga0070674_100045424 | Ga0070674_1000454242 | 265 |
| 1129 | 3300006038 | Ga0075365_10034425 | Ga0075365_100344252 | 265 |
| 1130 | 3300006051 | Ga0075364_10093302 | Ga0075364_100933022 | 265 |
| 1131 | 3300006177 | Ga0075362_10037867 | Ga0075362_100378672 | 265 |
| 1132 | 3300007076 | Ga0075435_100314964 | Ga0075435_1003149642 | 265 |
| 1133 | 3300010375 | Ga0105239_10396976 | Ga0105239_103969762 | 265 |
| 1134 | 3300011119 | Ga0105246_10737895 | Ga0105246_107378951 | 265 |
| 1135 | 3300013297 | Ga0157378_10500894 | Ga0157378_105008942 | 265 |
| 1136 | 3300025907 | Ga0207645_10141288 | Ga0207645_101412882 | 265 |
| 1137 | 3300025972 | Ga0207668_10168636 | Ga0207668_101686362 | 265 |
| 1138 | 3300025972 | Ga0207668_10497691 | Ga0207668_104976911 | 265 |
| 1139 | 3300026041 | Ga0207639_10389234 | Ga0207639_103892342 | 265 |
| 1140 | 3300026067 | Ga0207678_10083182 | Ga0207678_100831822 | 265 |
| 1141 | 3300026116 | Ga0207674_10618452 | Ga0207674_106184522 | 265 |
| 1142 | 3300028379 | Ga0268266_10017817 | Ga0268266_100178173 | 265 |
| 1143 | 3300035692 | Ga0373935_0009153 | Ga0373935_0009153_4486_5301 | 265 |
| 1144 | 3300035695 | Ga0373927_0000147 | Ga0373927_0000147_4871_5686 | 265 |
| 1145 | 3300037068 | Ga0373925_0007077 | Ga0373925_0007077_4445_5260 | 265 |
| 1146 | 3300037312 | Ga0395899_0000073 | Ga0395899_0000073_32317_33135 | 265 |
| 1147 | 3300037418 | Ga0395900_0000027 | Ga0395900_0000027_136887_137705 | 265 |
| 1148 | 3300037466 | Ga0395898_0000043 | Ga0395898_0000043_284661_285479 | 265 |
| 1149 | 3300037471 | Ga0395905_0000032 | Ga0395905_0000032_148228_149046 | 265 |
| 1150 | 3300038443 | Ga0395901_0000056 | Ga0395901_0000056_136887_137705 | 265 |
| 1151 | 3300046520 | Ga0495637_0036141 | Ga0495637_0036141_998_1813 | 265 |
| 1152 | 3300046616 | Ga0495668_0104353 | Ga0495668_0104353_300_1118 | 265 |
| 1153 | 3300046660 | Ga0495625_0147457 | Ga0495625_0147457_433_1248 | 265 |
| 1154 | 3300047320 | Ga0495672_0155244 | Ga0495672_0155244_322_1149 | 265 |
| 1155 | 3300048908 | Ga0496105_0480245 | Ga0496105_0480245_40_861 | 265 |
| 1156 | 3300048922 | Ga0496119_0008779 | Ga0496119_0008779_6462_7295 | 265 |
| 1157 | 3300048923 | Ga0496120_0002707 | Ga0496120_0002707_2330_3163 | 265 |
| 1158 | 3300049569 | Ga0501032_0000312 | Ga0501032_0000312_2228_3064 | 265 |
| 1159 | 3300049570 | Ga0501033_0000752 | Ga0501033_0000752_26716_27552 | 265 |
| 1160 | 3300049571 | Ga0501034_0002486 | Ga0501034_0002486_2275_3111 | 265 |
| 1161 | 3300049571 | Ga0501034_0023964 | Ga0501034_0023964_2482_3306 | 265 |
| 1162 | 3300049572 | Ga0501036_0001112 | Ga0501036_0001112_2045_2881 | 265 |
| 1163 | 3300049573 | Ga0501037_0000118 | Ga0501037_0000118_70568_71404 | 265 |
| 1164 | 3300049573 | Ga0501037_0023099 | Ga0501037_0023099_2152_2988 | 265 |
| 1165 | 3300049574 | Ga0501038_0000248 | Ga0501038_0000248_42548_43384 | 265 |
| 1166 | 3300049575 | Ga0501039_0000048 | Ga0501039_0000048_56414_57250 | 265 |
| 1167 | 3300049579 | Ga0501043_0000639 | Ga0501043_0000639_10948_11784 | 265 |
| 1168 | 3300049580 | Ga0501046_0049181 | Ga0501046_0049181_1776_2612 | 265 |
| 1169 | 3300049581 | Ga0501047_0269147 | Ga0501047_0269147_295_1131 | 265 |
| 1170 | 3300049822 | Ga0501035_0000118 | Ga0501035_0000118_19060_19896 | 265 |
| 1171 | 3300049823 | Ga0501044_0056837 | Ga0501044_0056837_2360_3196 | 265 |
| 1172 | 3300049823 | Ga0501044_0428036 | Ga0501044_0428036_372_1187 | 265 |
| 1173 | 3300050492 | nmdc:mga0yw44_276826_c1 | nmdc:mga0yw44_276826_c1_230_1051 | 265 |
| 1174 | 3300050492 | nmdc:mga0yw44_64458_c1 | nmdc:mga0yw44_64458_c1_46_867 | 265 |
| 1175 | 3300050494 | nmdc:mga06z11_344468_c1 | nmdc:mga06z11_344468_c1_26_850 | 265 |
| 1176 | 3300050513 | nmdc:mga0rr50_276565_c1 | nmdc:mga0rr50_276565_c1_131_967 | 265 |
| 1177 | 3300053151 | Ga0500604_0031096 | Ga0500604_0031096_249_1067 | 265 |
| 1178 | 3300053155 | Ga0500620_000830 | Ga0500620_000830_770_1594 | 265 |
| 1179 | 3300053155 | Ga0500620_009455 | Ga0500620_009455_589_1407 | 265 |
| 1180 | 3300053158 | Ga0500627_0076805 | Ga0500627_0076805_86_907 | 265 |
| 1181 | 3300053158 | Ga0500627_0084823 | Ga0500627_0084823_442_1269 | 265 |
| 1182 | 3300053727 | Ga0500611_005646 | Ga0500611_005646_264_1082 | 265 |
| 1183 | iso_pu_bacteria | 2510461069 | 2510840578 | 265 |
| 1184 | iso_pu_bacteria | 2775507049 | 2776913704 | 265 |
| 1185 | iso_pu_bacteria | 2818991272 | 2819241624 | 265 |
| 1186 | iso_pu_bacteria | 8005301065 | 8005302569 | 265 |
| 1187 | iso_pu_bacteria | 8005658619 | 8005659690 | 265 |
| 1188 | 3300005347 | Ga0070668_100454789 | Ga0070668_1004547892 | 266 |
| 1189 | 3300009553 | Ga0105249_10121557 | Ga0105249_101215573 | 266 |
| 1190 | 3300017792 | Ga0163161_10196113 | Ga0163161_101961132 | 266 |
| 1191 | 3300025901 | Ga0207688_10241251 | Ga0207688_102412512 | 266 |
| 1192 | 3300025961 | Ga0207712_10290128 | Ga0207712_102901282 | 266 |
| 1193 | 3300048906 | Ga0496103_0001223 | Ga0496103_0001223_7214_8050 | 266 |
| 1194 | 3300048909 | Ga0496106_0014060 | Ga0496106_0014060_3655_4491 | 266 |
| 1195 | 3300048910 | Ga0496107_0063116 | Ga0496107_0063116_1823_2659 | 266 |
| 1196 | 3300048922 | Ga0496119_0066578 | Ga0496119_0066578_556_1377 | 266 |
| 1197 | 3300049571 | Ga0501034_0003827 | Ga0501034_0003827_14215_15045 | 266 |
| 1198 | 3300049571 | Ga0501034_0060256 | Ga0501034_0060256_503_1333 | 266 |
| 1199 | 3300053125 | Ga0500618_000592 | Ga0500618_000592_529_1368 | 266 |
| 1200 | iso_pu_bacteria | 2643221653 | 2644298511 | 266 |
| 1201 | iso_pu_bacteria | 2643221719 | 2644656740 | 266 |
| 1202 | iso_pu_bacteria | 2757320392 | 2757569531 | 266 |
| 1203 | iso_pu_bacteria | 2854896431 | 2854899544 | 266 |
| 1204 | iso_pu_bacteria | 2899803654 | 2899807677 | 266 |
| 1205 | iso_pu_bacteria | 8005246636 | 8005248595 | 266 |
| 1206 | 3300002987 | JGI25159J45721_1000007 | JGI25159J45721_100000739 | 267 |
| 1207 | 3300003187 | JGI25151J46595_10032559 | JGI25151J46595_100325591 | 267 |
| 1208 | 3300003354 | JGI25160J50197_1000011 | JGI25160J50197_100001184 | 267 |
| 1209 | 3300003374 | JGI25161J50226_1000672 | JGI25161J50226_100067216 | 267 |
| 1210 | 3300003771 | Ga0055526_1005965 | Ga0055526_10059652 | 267 |
| 1211 | 3300003781 | Ga0055536_1003670 | Ga0055536_10036702 | 267 |
| 1212 | 3300003794 | Ga0055531_10019893 | Ga0055531_100198932 | 267 |
| 1213 | 3300004625 | Ga0055543_1000117 | Ga0055543_100011737 | 267 |
| 1214 | 3300005262 | Ga0065165_1000018 | Ga0065165_100001884 | 267 |
| 1215 | 3300007076 | Ga0075435_100082393 | Ga0075435_1000823932 | 267 |
| 1216 | 3300013249 | Ga0171463_1008 | Ga0171463_1008243 | 267 |
| 1217 | 3300015690 | Ga0183363_1265 | Ga0183363_126511 | 267 |
| 1218 | 3300025208 | Ga0209436_100870 | Ga0209436_10087012 | 267 |
| 1219 | 3300025284 | Ga0209130_1000029 | Ga0209130_1000029169 | 267 |
| 1220 | 3300025294 | Ga0209025_1000033 | Ga0209025_100003325 | 267 |
| 1221 | 3300025295 | Ga0209564_1000288 | Ga0209564_100028819 | 267 |
| 1222 | 3300025298 | Ga0209050_1011079 | Ga0209050_10110793 | 267 |
| 1223 | 3300025299 | Ga0209256_1000194 | Ga0209256_100019418 | 267 |
| 1224 | 3300025299 | Ga0209256_1002513 | Ga0209256_100251312 | 267 |
| 1225 | 3300025302 | Ga0207426_1000074 | Ga0207426_1000074129 | 267 |
| 1226 | 3300025303 | Ga0209051_1033591 | Ga0209051_10335912 | 267 |
| 1227 | 3300048921 | Ga0496118_0064435 | Ga0496118_0064435_193_1047 | 267 |
| 1228 | 3300048923 | Ga0496120_0034513 | Ga0496120_0034513_1176_2030 | 267 |
| 1229 | 3300048926 | Ga0496123_0007805 | Ga0496123_0007805_3254_4069 | 267 |
| 1230 | 3300048928 | Ga0496125_0000001 | Ga0496125_0000001_1438445_1439299 | 267 |
| 1231 | 3300049568 | Ga0501031_0015055 | Ga0501031_0015055_244_1077 | 267 |
| 1232 | 3300049569 | Ga0501032_0006976 | Ga0501032_0006976_5889_6722 | 267 |
| 1233 | 3300049570 | Ga0501033_0024710 | Ga0501033_0024710_1269_2102 | 267 |
| 1234 | 3300049571 | Ga0501034_0105050 | Ga0501034_0105050_1556_2389 | 267 |
| 1235 | 3300049572 | Ga0501036_0020356 | Ga0501036_0020356_2476_3309 | 267 |
| 1236 | 3300049573 | Ga0501037_0006217 | Ga0501037_0006217_1881_2714 | 267 |
| 1237 | 3300049574 | Ga0501038_0011040 | Ga0501038_0011040_5759_6592 | 267 |
| 1238 | 3300049575 | Ga0501039_0098634 | Ga0501039_0098634_1223_2056 | 267 |
| 1239 | 3300049581 | Ga0501047_0031991 | Ga0501047_0031991_1579_2412 | 267 |
| 1240 | 3300049586 | Ga0501070_0028755 | Ga0501070_0028755_1421_2254 | 267 |
| 1241 | 3300049822 | Ga0501035_0014314 | Ga0501035_0014314_1219_2052 | 267 |
| 1242 | 3300049823 | Ga0501044_0061755 | Ga0501044_0061755_1176_2009 | 267 |
| 1243 | 3300050513 | nmdc:mga0rr50_58788_c1 | nmdc:mga0rr50_58788_c1_1319_2161 | 267 |
| 1244 | iso_pu_bacteria | 2821123053 | 2821127884 | 267 |
| 1245 | 3300046691 | Ga0495670_0068696 | Ga0495670_0068696_596_1468 | 268 |
| 1246 | 3300053125 | Ga0500618_011663 | Ga0500618_011663_886_1758 | 268 |
| 1247 | iso_pu_bacteria | 2537561587 | 2537873923 | 268 |
| 1248 | iso_pu_bacteria | 2554235003 | 2554247722 | 268 |
| 1249 | iso_pu_bacteria | 2558860242 | 2559294855 | 268 |
| 1250 | iso_pu_bacteria | 2599185210 | 2599604117 | 268 |
| 1251 | iso_pu_bacteria | 2600255279 | 2601608086 | 268 |
| 1252 | iso_pu_bacteria | 2600255308 | 2601744861 | 268 |
| 1253 | iso_pu_bacteria | 2643221558 | 2643811721 | 268 |
| 1254 | iso_pu_bacteria | 2643221582 | 2643919344 | 268 |
| 1255 | iso_pu_bacteria | 2643221693 | 2644522248 | 268 |
| 1256 | iso_pu_bacteria | 2808606387 | 2808985374 | 268 |
| 1257 | iso_pu_bacteria | 2818991439 | 2819559810 | 268 |
| 1258 | iso_pu_bacteria | 2838675328 | 2838676218 | 268 |
| 1259 | iso_pu_bacteria | 2838714209 | 2838715100 | 268 |
| 1260 | iso_pu_bacteria | 2838719591 | 2838721100 | 268 |
| 1261 | iso_pu_bacteria | 2838724970 | 2838725859 | 268 |
| 1262 | iso_pu_bacteria | 2841846520 | 2841848057 | 268 |
| 1263 | iso_pu_bacteria | 2841859092 | 2841859396 | 268 |
| 1264 | iso_pu_bacteria | 2842124991 | 2842125913 | 268 |
| 1265 | iso_pu_bacteria | 2842130223 | 2842131112 | 268 |
| 1266 | iso_pu_bacteria | 2842152218 | 2842153718 | 268 |
| 1267 | iso_pu_bacteria | 2842170452 | 2842171343 | 268 |
| 1268 | iso_pu_bacteria | 2842175837 | 2842177338 | 268 |
| 1269 | iso_pu_bacteria | 2842187318 | 2842188208 | 268 |
| 1270 | iso_pu_bacteria | 2842211629 | 2842212519 | 268 |
| 1271 | iso_pu_bacteria | 2842224351 | 2842225862 | 268 |
| 1272 | iso_pu_bacteria | 2842515876 | 2842516180 | 268 |
| 1273 | iso_pu_bacteria | 2899792073 | 2899796182 | 268 |
| 1274 | iso_pu_bacteria | 2899845264 | 2899849203 | 268 |
| 1275 | iso_pu_bacteria | 2919114240 | 2919115192 | 268 |
| 1276 | iso_pu_bacteria | 2926754445 | 2926756237 | 268 |
| 1277 | iso_pu_bacteria | 2926760298 | 2926760468 | 268 |
| 1278 | iso_pu_bacteria | 2933006813 | 2933008365 | 268 |
| 1279 | iso_pu_bacteria | 2933011516 | 2933013177 | 268 |
| 1280 | iso_pu_bacteria | 2933594066 | 2933597873 | 268 |
| 1281 | iso_pu_bacteria | 2937843397 | 2937847398 | 268 |
| 1282 | iso_pu_bacteria | 2979089926 | 2979094254 | 268 |
| 1283 | iso_pu_bacteria | 2979095461 | 2979098365 | 268 |
| 1284 | iso_pu_bacteria | 2979100975 | 2979106257 | 268 |
| 1285 | iso_pu_bacteria | 2984509177 | 2984511944 | 268 |
| 1286 | iso_pu_bacteria | 2984518228 | 2984521695 | 268 |
| 1287 | iso_pu_bacteria | 2984537506 | 2984540991 | 268 |
| 1288 | iso_pu_bacteria | 2984601300 | 2984603274 | 268 |
| 1289 | iso_pu_bacteria | 650716007 | 650740110 | 268 |
| 1290 | iso_pu_bacteria | 8003570095 | 8003571112 | 268 |
| 1291 | 3300009148 | Ga0105243_10006823 | Ga0105243_100068235 | 269 |
| 1292 | 3300013100 | Ga0157373_10029332 | Ga0157373_100293322 | 269 |
| 1293 | 3300013102 | Ga0157371_10000015 | Ga0157371_10000015163 | 269 |
| 1294 | 3300013104 | Ga0157370_10000861 | Ga0157370_1000086116 | 269 |
| 1295 | iso_pu_bacteria | 2643221568 | 2643857748 | 269 |
| 1296 | iso_pu_bacteria | 2838016132 | 2838021461 | 269 |
| 1297 | iso_pu_bacteria | 2838048938 | 2838052413 | 269 |
| 1298 | iso_pu_bacteria | 2838061910 | 2838067729 | 269 |
| 1299 | iso_pu_bacteria | 2838068647 | 2838073596 | 269 |
| 1300 | iso_pu_bacteria | 2838668709 | 2838672019 | 269 |
| 1301 | iso_pu_bacteria | 2838701080 | 2838704701 | 269 |
| 1302 | iso_pu_bacteria | 2842110456 | 2842110488 | 269 |
| 1303 | iso_pu_bacteria | 2842146304 | 2842148559 | 269 |
| 1304 | iso_pu_bacteria | 2842192696 | 2842194500 | 269 |
| 1305 | iso_pu_bacteria | 2842205361 | 2842206031 | 269 |
| 1306 | iso_pu_bacteria | 2842250916 | 2842254381 | 269 |
| 1307 | iso_pu_bacteria | 2842264693 | 2842266037 | 269 |
| 1308 | iso_pu_bacteria | 2842278818 | 2842279488 | 269 |
| 1309 | iso_pu_bacteria | 2842285085 | 2842286135 | 269 |
| 1310 | iso_pu_bacteria | 2842311132 | 2842316715 | 269 |
| 1311 | iso_pu_bacteria | 2842317721 | 2842317897 | 269 |
| 1312 | iso_pu_bacteria | 2842402390 | 2842403495 | 269 |
| 1313 | iso_pu_bacteria | 2842409023 | 2842409132 | 269 |
| 1314 | iso_pu_bacteria | 2842415677 | 2842415786 | 269 |
| 1315 | iso_pu_bacteria | 2842422224 | 2842428081 | 269 |
| 1316 | iso_pu_bacteria | 2842428310 | 2842429326 | 269 |
| 1317 | iso_pu_bacteria | 2842434925 | 2842435939 | 269 |
| 1318 | iso_pu_bacteria | 2842441272 | 2842442286 | 269 |
| 1319 | iso_pu_bacteria | 2842447887 | 2842450577 | 269 |
| 1320 | iso_pu_bacteria | 2842462802 | 2842463747 | 269 |
| 1321 | iso_pu_bacteria | 2842469257 | 2842470268 | 269 |
| 1322 | iso_pu_bacteria | 2842489311 | 2842490033 | 269 |
| 1323 | iso_pu_bacteria | 2842495871 | 2842496167 | 269 |
| 1324 | iso_pu_bacteria | 2854916844 | 2854918367 | 269 |
| 1325 | iso_pu_bacteria | 2857516855 | 2857518725 | 269 |
| 1326 | iso_pu_bacteria | 2919166419 | 2919167928 | 269 |
| 1327 | iso_pu_bacteria | 2919171160 | 2919175230 | 269 |
| 1328 | iso_pu_bacteria | 2978969890 | 2978974379 | 269 |
| 1329 | iso_pu_bacteria | 2984587000 | 2984589719 | 269 |
| 1330 | 3300028794 | Ga0307515_10000198 | Ga0307515_10000198123 | 270 |
| 1331 | 3300031456 | Ga0307513_10019835 | Ga0307513_100198354 | 270 |
| 1332 | 3300048907 | Ga0496104_0079760 | Ga0496104_0079760_13_861 | 270 |
| 1333 | 3300048913 | Ga0496110_0033360 | Ga0496110_0033360_3327_4175 | 270 |
| 1334 | 3300048917 | Ga0496114_0182909 | Ga0496114_0182909_739_1587 | 270 |
| 1335 | 3300048927 | Ga0496124_0000740 | Ga0496124_0000740_34326_35180 | 270 |
| 1336 | iso_pu_bacteria | 2838022645 | 2838027854 | 270 |
| 1337 | iso_pu_bacteria | 2842198810 | 2842203830 | 270 |
| 1338 | iso_pu_bacteria | 2842395702 | 2842401878 | 270 |
| 1339 | 3300005455 | Ga0070663_100077820 | Ga0070663_1000778202 | 271 |
| 1340 | 3300006946 | Ga0079104_1000022 | Ga0079104_1000022165 | 271 |
| 1341 | 3300025932 | Ga0207690_10034852 | Ga0207690_100348522 | 271 |
| 1342 | 3300026067 | Ga0207678_10027650 | Ga0207678_100276504 | 271 |
| 1343 | 3300027111 | Ga0209281_1000538 | Ga0209281_100053819 | 271 |
| 1344 | 3300031548 | Ga0307408_100125221 | Ga0307408_1001252212 | 271 |
| 1345 | 3300032002 | Ga0307416_100208919 | Ga0307416_1002089192 | 271 |
| 1346 | 3300038443 | Ga0395901_0267695 | Ga0395901_0267695_310_1161 | 271 |
| 1347 | 3300039438 | Ga0436360_0982192 | Ga0436360_0982192_175_1029 | 271 |
| 1348 | 3300048925 | Ga0496122_0045620 | Ga0496122_0045620_787_1641 | 271 |
| 1349 | 3300049569 | Ga0501032_0053046 | Ga0501032_0053046_1336_2196 | 271 |
| 1350 | 3300049570 | Ga0501033_0007943 | Ga0501033_0007943_1457_2317 | 271 |
| 1351 | 3300049571 | Ga0501034_0340306 | Ga0501034_0340306_450_1310 | 271 |
| 1352 | 3300049572 | Ga0501036_0257097 | Ga0501036_0257097_65_925 | 271 |
| 1353 | 3300049573 | Ga0501037_0000857 | Ga0501037_0000857_16491_17351 | 271 |
| 1354 | 3300049579 | Ga0501043_0000107 | Ga0501043_0000107_15913_16773 | 271 |
| 1355 | 3300049579 | Ga0501043_0012772 | Ga0501043_0012772_3215_4075 | 271 |
| 1356 | 3300049580 | Ga0501046_0058235 | Ga0501046_0058235_1881_2741 | 271 |
| 1357 | 3300049581 | Ga0501047_0100575 | Ga0501047_0100575_1160_2020 | 271 |
| 1358 | 3300049583 | Ga0501067_0063660 | Ga0501067_0063660_883_1743 | 271 |
| 1359 | 3300049584 | Ga0501068_0053868 | Ga0501068_0053868_355_1215 | 271 |
| 1360 | 3300049585 | Ga0501069_0001348 | Ga0501069_0001348_330_1190 | 271 |
| 1361 | 3300049586 | Ga0501070_0000132 | Ga0501070_0000132_59726_60586 | 271 |
| 1362 | 3300049586 | Ga0501070_0049997 | Ga0501070_0049997_1795_2655 | 271 |
| 1363 | 3300049587 | Ga0501071_0017228 | Ga0501071_0017228_3610_4470 | 271 |
| 1364 | 3300049589 | Ga0501073_0009343 | Ga0501073_0009343_160_1020 | 271 |
| 1365 | 3300049590 | Ga0501074_0000088 | Ga0501074_0000088_19341_20201 | 271 |
| 1366 | 3300049742 | Ga0501080_0040601 | Ga0501080_0040601_2891_3751 | 271 |
| 1367 | 3300049744 | Ga0501083_0000065 | Ga0501083_0000065_40069_40929 | 271 |
| 1368 | 3300049744 | Ga0501083_0242108 | Ga0501083_0242108_18_878 | 271 |
| 1369 | 3300049822 | Ga0501035_0000185 | Ga0501035_0000185_16303_17163 | 271 |
| 1370 | 3300049822 | Ga0501035_0082161 | Ga0501035_0082161_971_1831 | 271 |
| 1371 | 3300049823 | Ga0501044_0000003 | Ga0501044_0000003_19343_20203 | 271 |
| 1372 | 3300049823 | Ga0501044_0277489 | Ga0501044_0277489_378_1238 | 271 |
| 1373 | iso_pu_bacteria | 2513237085 | 2513577290 | 271 |
| 1374 | iso_pu_bacteria | 2515154114 | 2515639782 | 271 |
| 1375 | iso_pu_bacteria | 2599185236 | 2599721085 | 271 |
| 1376 | iso_pu_bacteria | 2643221637 | 2644210312 | 271 |
| 1377 | iso_pu_bacteria | 2643221718 | 2644653864 | 271 |
| 1378 | iso_pu_bacteria | 2838686498 | 2838689504 | 271 |
| 1379 | iso_pu_bacteria | 2838729681 | 2838730838 | 271 |
| 1380 | iso_pu_bacteria | 2838742623 | 2838743779 | 271 |
| 1381 | iso_pu_bacteria | 2841851746 | 2841857854 | 271 |
| 1382 | iso_pu_bacteria | 2841864319 | 2841864552 | 271 |
| 1383 | iso_pu_bacteria | 2842156927 | 2842157409 | 271 |
| 1384 | iso_pu_bacteria | 2842163707 | 2842164600 | 271 |
| 1385 | iso_pu_bacteria | 2842180545 | 2842181006 | 271 |
| 1386 | iso_pu_bacteria | 2842217011 | 2842217240 | 271 |
| 1387 | iso_pu_bacteria | 2842229732 | 2842230935 | 271 |
| 1388 | iso_pu_bacteria | 2842243621 | 2842244958 | 271 |
| 1389 | iso_pu_bacteria | 2842257432 | 2842258771 | 271 |
| 1390 | iso_pu_bacteria | 2842271015 | 2842273524 | 271 |
| 1391 | iso_pu_bacteria | 2842304105 | 2842304301 | 271 |
| 1392 | iso_pu_bacteria | 2842341865 | 2842345829 | 271 |
| 1393 | iso_pu_bacteria | 2842363717 | 2842364540 | 271 |
| 1394 | iso_pu_bacteria | 2844454524 | 2844459155 | 271 |
| 1395 | iso_pu_bacteria | 2904578770 | 2904580879 | 271 |
| 1396 | iso_pu_bacteria | 2919119836 | 2919121406 | 271 |
| 1397 | iso_pu_bacteria | 8005556819 | 8005557710 | 271 |
| 1398 | iso_pu_bacteria | 8018163183 | 8018166796 | 271 |
| 1399 | iso_pu_bacteria | 8023680758 | 8023685383 | 271 |
| 1400 | iso_pu_bacteria | 8057874678 | 8057875061 | 271 |
| 1401 | 3300003187 | JGI25151J46595_10049507 | JGI25151J46595_100495072 | 272 |
| 1402 | 3300003856 | Ga0058692_1000843 | Ga0058692_10008434 | 272 |
| 1403 | 3300003856 | Ga0058692_1001796 | Ga0058692_10017964 | 272 |
| 1404 | 3300005548 | Ga0070665_100014927 | Ga0070665_1000149274 | 272 |
| 1405 | 3300006042 | Ga0075368_10001469 | Ga0075368_100014695 | 272 |
| 1406 | 3300006051 | Ga0075364_10001264 | Ga0075364_100012645 | 272 |
| 1407 | 3300006178 | Ga0075367_10051610 | Ga0075367_100516103 | 272 |
| 1408 | 3300006178 | Ga0075367_10110186 | Ga0075367_101101862 | 272 |
| 1409 | 3300006353 | Ga0075370_10057908 | Ga0075370_100579082 | 272 |
| 1410 | 3300006948 | Ga0099826_10000088 | Ga0099826_100000889 | 272 |
| 1411 | 3300006948 | Ga0099826_10006034 | Ga0099826_100060345 | 272 |
| 1412 | 3300013104 | Ga0157370_10111552 | Ga0157370_101115522 | 272 |
| 1413 | 3300025294 | Ga0209025_1000094 | Ga0209025_1000094233 | 272 |
| 1414 | 3300027312 | Ga0209371_1000178 | Ga0209371_100017888 | 272 |
| 1415 | 3300027312 | Ga0209371_1000621 | Ga0209371_100062122 | 272 |
| 1416 | 3300027666 | Ga0209282_1000372 | Ga0209282_100037215 | 272 |
| 1417 | 3300027666 | Ga0209282_1004392 | Ga0209282_10043922 | 272 |
| 1418 | 3300027866 | Ga0209813_10005200 | Ga0209813_100052004 | 272 |
| 1419 | 3300030500 | Ga0268256_1001287 | Ga0268256_10012877 | 272 |
| 1420 | 3300030500 | Ga0268256_1004786 | Ga0268256_10047863 | 272 |
| 1421 | 3300030744 | Ga0316181_1240954 | Ga0316181_12409543 | 272 |
| 1422 | 3300048924 | Ga0496121_0000959 | Ga0496121_0000959_28316_29158 | 272 |
| 1423 | 3300049570 | Ga0501033_0026725 | Ga0501033_0026725_2788_3651 | 272 |
| 1424 | 3300049570 | Ga0501033_0172096 | Ga0501033_0172096_190_1053 | 272 |
| 1425 | 3300049573 | Ga0501037_0196838 | Ga0501037_0196838_39_902 | 272 |
| 1426 | 3300049581 | Ga0501047_0017404 | Ga0501047_0017404_2754_3617 | 272 |
| 1427 | 3300049581 | Ga0501047_0045004 | Ga0501047_0045004_2683_3546 | 272 |
| 1428 | 3300049581 | Ga0501047_0062837 | Ga0501047_0062837_347_1210 | 272 |
| 1429 | 3300049585 | Ga0501069_0028971 | Ga0501069_0028971_389_1252 | 272 |
| 1430 | 3300049586 | Ga0501070_0000631 | Ga0501070_0000631_12311_13174 | 272 |
| 1431 | 3300049586 | Ga0501070_0044320 | Ga0501070_0044320_1610_2473 | 272 |
| 1432 | 3300049587 | Ga0501071_0041634 | Ga0501071_0041634_418_1281 | 272 |
| 1433 | 3300049742 | Ga0501080_0000128 | Ga0501080_0000128_8104_8967 | 272 |
| 1434 | 3300049742 | Ga0501080_0017979 | Ga0501080_0017979_4799_5662 | 272 |
| 1435 | 3300049822 | Ga0501035_0000245 | Ga0501035_0000245_33992_34855 | 272 |
| 1436 | 3300049822 | Ga0501035_0002121 | Ga0501035_0002121_3626_4489 | 272 |
| 1437 | 3300049822 | Ga0501035_0011321 | Ga0501035_0011321_3157_4020 | 272 |
| 1438 | 3300049823 | Ga0501044_0021082 | Ga0501044_0021082_4701_5564 | 272 |
| 1439 | 3300049823 | Ga0501044_0112933 | Ga0501044_0112933_1351_2214 | 272 |
| 1440 | 3300049823 | Ga0501044_0127508 | Ga0501044_0127508_1566_2429 | 272 |
| 1441 | 3300049823 | Ga0501044_0186250 | Ga0501044_0186250_540_1403 | 272 |
| 1442 | 3300053140 | Ga0500573_0000429 | Ga0500573_0000429_11190_12029 | 272 |
| 1443 | 3300053157 | Ga0500624_005173 | Ga0500624_005173_381_1229 | 272 |
| 1444 | 3300053161 | Ga0500634_0063075 | Ga0500634_0063075_844_1680 | 272 |
| 1445 | iso_pu_bacteria | 2600254933 | 2600374525 | 272 |
| 1446 | iso_pu_bacteria | 2818991461 | 2819687303 | 272 |
| 1447 | 3300003187 | JGI25151J46595_10000134 | JGI25151J46595_1000013450 | 273 |
| 1448 | 3300003215 | JGI25153J46596_10003170 | JGI25153J46596_100031705 | 273 |
| 1449 | 3300003215 | JGI25153J46596_10022980 | JGI25153J46596_100229801 | 273 |
| 1450 | 3300003354 | JGI25160J50197_1000649 | JGI25160J50197_10006497 | 273 |
| 1451 | 3300003374 | JGI25161J50226_1004351 | JGI25161J50226_10043513 | 273 |
| 1452 | 3300003771 | Ga0055526_1000191 | Ga0055526_100019126 | 273 |
| 1453 | 3300003771 | Ga0055526_1029311 | Ga0055526_10293112 | 273 |
| 1454 | 3300003775 | Ga0055524_1000520 | Ga0055524_10005205 | 273 |
| 1455 | 3300003775 | Ga0055524_1012051 | Ga0055524_10120512 | 273 |
| 1456 | 3300003781 | Ga0055536_1033987 | Ga0055536_10339872 | 273 |
| 1457 | 3300003790 | Ga0055528_1001039 | Ga0055528_10010399 | 273 |
| 1458 | 3300003790 | Ga0055528_1003797 | Ga0055528_10037971 | 273 |
| 1459 | 3300003790 | Ga0055528_1006531 | Ga0055528_10065312 | 273 |
| 1460 | 3300003791 | Ga0055530_10009365 | Ga0055530_100093652 | 273 |
| 1461 | 3300003792 | Ga0055540_1002986 | Ga0055540_10029862 | 273 |
| 1462 | 3300003794 | Ga0055531_10009401 | Ga0055531_100094014 | 273 |
| 1463 | 3300004625 | Ga0055543_1000599 | Ga0055543_10005997 | 273 |
| 1464 | 3300005262 | Ga0065165_1004034 | Ga0065165_10040344 | 273 |
| 1465 | 3300006038 | Ga0075365_10003753 | Ga0075365_100037534 | 273 |
| 1466 | 3300006177 | Ga0075362_10002890 | Ga0075362_100028902 | 273 |
| 1467 | 3300006178 | Ga0075367_10005656 | Ga0075367_100056565 | 273 |
| 1468 | 3300006186 | Ga0075369_10002370 | Ga0075369_100023702 | 273 |
| 1469 | 3300006195 | Ga0075366_10000417 | Ga0075366_100004177 | 273 |
| 1470 | 3300006353 | Ga0075370_10004513 | Ga0075370_100045133 | 273 |
| 1471 | 3300010375 | Ga0105239_10249422 | Ga0105239_102494222 | 273 |
| 1472 | 3300013102 | Ga0157371_10038034 | Ga0157371_100380342 | 273 |
| 1473 | 3300025245 | Ga0207425_1004946 | Ga0207425_10049464 | 273 |
| 1474 | 3300025273 | Ga0209673_1000013 | Ga0209673_1000013429 | 273 |
| 1475 | 3300025273 | Ga0209673_1000552 | Ga0209673_100055220 | 273 |
| 1476 | 3300025292 | Ga0209676_1012295 | Ga0209676_10122953 | 273 |
| 1477 | 3300025294 | Ga0209025_1000166 | Ga0209025_100016617 | 273 |
| 1478 | 3300025295 | Ga0209564_1000273 | Ga0209564_100027383 | 273 |
| 1479 | 3300025295 | Ga0209564_1000469 | Ga0209564_10004697 | 273 |
| 1480 | 3300025297 | Ga0209758_1000218 | Ga0209758_100021810 | 273 |
| 1481 | 3300025297 | Ga0209758_1000629 | Ga0209758_100062915 | 273 |
| 1482 | 3300025297 | Ga0209758_1028882 | Ga0209758_10288822 | 273 |
| 1483 | 3300025298 | Ga0209050_1005022 | Ga0209050_10050225 | 273 |
| 1484 | 3300025299 | Ga0209256_1000371 | Ga0209256_100037121 | 273 |
| 1485 | 3300025299 | Ga0209256_1002003 | Ga0209256_10020037 | 273 |
| 1486 | 3300025302 | Ga0207426_1000039 | Ga0207426_1000039110 | 273 |
| 1487 | 3300025303 | Ga0209051_1000723 | Ga0209051_100072318 | 273 |
| 1488 | 3300025303 | Ga0209051_1001634 | Ga0209051_10016347 | 273 |
| 1489 | 3300025304 | Ga0209257_1003242 | Ga0209257_10032423 | 273 |
| 1490 | 3300025972 | Ga0207668_10165588 | Ga0207668_101655882 | 273 |
| 1491 | 3300028794 | Ga0307515_10015486 | Ga0307515_1001548610 | 273 |
| 1492 | 3300037471 | Ga0395905_0005236 | Ga0395905_0005236_12040_12894 | 273 |
| 1493 | 3300037471 | Ga0395905_0062219 | Ga0395905_0062219_1284_2138 | 273 |
| 1494 | 3300041406 | Ga0439439_0039344 | Ga0439439_0039344_265_1104 | 273 |
| 1495 | 3300041406 | Ga0439439_0040060 | Ga0439439_0040060_144_995 | 273 |
| 1496 | 3300041413 | Ga0439465_0009350 | Ga0439465_0009350_341_1180 | 273 |
| 1497 | 3300046660 | Ga0495625_0059346 | Ga0495625_0059346_295_1146 | 273 |
| 1498 | 3300047470 | Ga0495681_0004088 | Ga0495681_0004088_582_1469 | 273 |
| 1499 | 3300048919 | Ga0496116_0100104 | Ga0496116_0100104_518_1405 | 273 |
| 1500 | 3300048920 | Ga0496117_0000002 | Ga0496117_0000002_963006_963893 | 273 |
| 1501 | 3300048921 | Ga0496118_0001855 | Ga0496118_0001855_22142_23029 | 273 |
| 1502 | 3300048921 | Ga0496118_0013135 | Ga0496118_0013135_2096_2935 | 273 |
| 1503 | 3300048922 | Ga0496119_0014680 | Ga0496119_0014680_4306_5193 | 273 |
| 1504 | 3300048923 | Ga0496120_0000078 | Ga0496120_0000078_20000_20887 | 273 |
| 1505 | 3300048924 | Ga0496121_0011499 | Ga0496121_0011499_59_913 | 273 |
| 1506 | 3300048925 | Ga0496122_0000001 | Ga0496122_0000001_269442_270329 | 273 |
| 1507 | 3300048926 | Ga0496123_0000001 | Ga0496123_0000001_273173_274060 | 273 |
| 1508 | 3300048927 | Ga0496124_0010996 | Ga0496124_0010996_357_1211 | 273 |
| 1509 | 3300048927 | Ga0496124_0027905 | Ga0496124_0027905_3702_4589 | 273 |
| 1510 | 3300048928 | Ga0496125_0019884 | Ga0496125_0019884_4063_4950 | 273 |
| 1511 | 3300048928 | Ga0496125_0100465 | Ga0496125_0100465_899_1786 | 273 |
| 1512 | 3300049571 | Ga0501034_0117026 | Ga0501034_0117026_1623_2483 | 273 |
| 1513 | 3300050489 | nmdc:mga03683_564_c1 | nmdc:mga03683_564_c1_5550_6389 | 273 |
| 1514 | 3300050490 | nmdc:mga03n38_2724_c1 | nmdc:mga03n38_2724_c1_536_1423 | 273 |
| 1515 | 3300050491 | nmdc:mga00v17_56095_c1 | nmdc:mga00v17_56095_c1_320_1207 | 273 |
| 1516 | 3300050492 | nmdc:mga0yw44_349_c1 | nmdc:mga0yw44_349_c1_9893_10732 | 273 |
| 1517 | 3300050492 | nmdc:mga0yw44_3818_c1 | nmdc:mga0yw44_3818_c1_295_1182 | 273 |
| 1518 | 3300050493 | nmdc:mga0k408_4188_c1 | nmdc:mga0k408_4188_c1_344_1183 | 273 |
| 1519 | 3300050493 | nmdc:mga0k408_51532_c1 | nmdc:mga0k408_51532_c1_1458_2345 | 273 |
| 1520 | 3300050494 | nmdc:mga06z11_2403_c1 | nmdc:mga06z11_2403_c1_5586_6425 | 273 |
| 1521 | 3300050494 | nmdc:mga06z11_52752_c1 | nmdc:mga06z11_52752_c1_537_1424 | 273 |
| 1522 | 3300050494 | nmdc:mga06z11_71168_c1 | nmdc:mga06z11_71168_c1_304_1191 | 273 |
| 1523 | 3300050495 | nmdc:mga04h51_28645_c1 | nmdc:mga04h51_28645_c1_357_1244 | 273 |
| 1524 | 3300050496 | nmdc:mga07m45_4076_c1 | nmdc:mga07m45_4076_c1_2560_3399 | 273 |
| 1525 | 3300050516 | nmdc:mga0sz30_3205_c2 | nmdc:mga0sz30_3205_c2_388_1227 | 273 |
| 1526 | 3300053107 | Ga0500560_004671 | Ga0500560_004671_584_1471 | 273 |
| 1527 | 3300053137 | Ga0500561_0001272 | Ga0500561_0001272_523_1410 | 273 |
| 1528 | 3300053153 | Ga0500616_0000551 | Ga0500616_0000551_21949_22794 | 273 |
| 1529 | 3300053157 | Ga0500624_000255 | Ga0500624_000255_4846_5733 | 273 |
| 1530 | 3300053158 | Ga0500627_0113291 | Ga0500627_0113291_168_1019 | 273 |
| 1531 | 3300053177 | Ga0500636_0012938 | Ga0500636_0012938_1443_2306 | 273 |
| 1532 | iso_pu_bacteria | 2509276033 | 2509443271 | 273 |
| 1533 | iso_pu_bacteria | 2510917026 | 2511172837 | 273 |
| 1534 | iso_pu_bacteria | 2510917028 | 2511183543 | 273 |
| 1535 | iso_pu_bacteria | 2513237088 | 2513594595 | 273 |
| 1536 | iso_pu_bacteria | 2513237144 | 2513912427 | 273 |
| 1537 | iso_pu_bacteria | 2513237146 | 2513926213 | 273 |
| 1538 | iso_pu_bacteria | 2513237159 | 2513997186 | 273 |
| 1539 | iso_pu_bacteria | 2519899620 | 2520379304 | 273 |
| 1540 | iso_pu_bacteria | 2534681796 | 2535516506 | 273 |
| 1541 | iso_pu_bacteria | 2582581283 | 2585166014 | 273 |
| 1542 | iso_pu_bacteria | 2582581294 | 2585200179 | 273 |
| 1543 | iso_pu_bacteria | 2582581299 | 2585233543 | 273 |
| 1544 | iso_pu_bacteria | 2582581306 | 2585268035 | 273 |
| 1545 | iso_pu_bacteria | 2582581865 | 2585386862 | 273 |
| 1546 | iso_pu_bacteria | 2582581866 | 2585396749 | 273 |
| 1547 | iso_pu_bacteria | 2585427528 | 2585537548 | 273 |
| 1548 | iso_pu_bacteria | 2585427593 | 2585835498 | 273 |
| 1549 | iso_pu_bacteria | 2585427633 | 2585995767 | 273 |
| 1550 | iso_pu_bacteria | 2585427634 | 2586000329 | 273 |
| 1551 | iso_pu_bacteria | 2599185170 | 2599417691 | 273 |
| 1552 | iso_pu_bacteria | 2615840624 | 2616292449 | 273 |
| 1553 | iso_pu_bacteria | 2643221643 | 2644239586 | 273 |
| 1554 | iso_pu_bacteria | 2643221689 | 2644501831 | 273 |
| 1555 | iso_pu_bacteria | 2718217927 | 2719385797 | 273 |
| 1556 | iso_pu_bacteria | 2718217997 | 2719665618 | 273 |
| 1557 | iso_pu_bacteria | 2718218199 | 2720492038 | 273 |
| 1558 | iso_pu_bacteria | 2718218232 | 2720613302 | 273 |
| 1559 | iso_pu_bacteria | 2718218233 | 2720620178 | 273 |
| 1560 | iso_pu_bacteria | 2718218235 | 2720631603 | 273 |
| 1561 | iso_pu_bacteria | 2718218269 | 2720775331 | 273 |
| 1562 | iso_pu_bacteria | 2718218423 | 2721399577 | 273 |
| 1563 | iso_pu_bacteria | 2721755556 | 2723026950 | 273 |
| 1564 | iso_pu_bacteria | 2721755684 | 2723560564 | 273 |
| 1565 | iso_pu_bacteria | 2721755685 | 2723567150 | 273 |
| 1566 | iso_pu_bacteria | 2721755809 | 2724038390 | 273 |
| 1567 | iso_pu_bacteria | 2721755819 | 2724089938 | 273 |
| 1568 | iso_pu_bacteria | 2721755822 | 2724104415 | 273 |
| 1569 | iso_pu_bacteria | 2721755823 | 2724110208 | 273 |
| 1570 | iso_pu_bacteria | 2728369352 | 2730107886 | 273 |
| 1571 | iso_pu_bacteria | 2738541333 | 2739036510 | 273 |
| 1572 | iso_pu_bacteria | 2765235942 | 2766063178 | 273 |
| 1573 | iso_pu_bacteria | 2791355256 | 2793294683 | 273 |
| 1574 | iso_pu_bacteria | 2791355259 | 2793312263 | 273 |
| 1575 | iso_pu_bacteria | 2791355262 | 2793335722 | 273 |
| 1576 | iso_pu_bacteria | 2791355265 | 2793353058 | 273 |
| 1577 | iso_pu_bacteria | 2802429605 | 2805925717 | 273 |
| 1578 | iso_pu_bacteria | 2802429606 | 2805933559 | 273 |
| 1579 | iso_pu_bacteria | 2802429633 | 2806046060 | 273 |
| 1580 | iso_pu_bacteria | 2802429634 | 2806054439 | 273 |
| 1581 | iso_pu_bacteria | 2802429635 | 2806060444 | 273 |
| 1582 | iso_pu_bacteria | 2802429636 | 2806065098 | 273 |
| 1583 | iso_pu_bacteria | 2802429637 | 2806072363 | 273 |
| 1584 | iso_pu_bacteria | 2838035591 | 2838038096 | 273 |
| 1585 | iso_pu_bacteria | 2838661181 | 2838667217 | 273 |
| 1586 | iso_pu_bacteria | 2842521101 | 2842522571 | 273 |
| 1587 | iso_pu_bacteria | 2923556063 | 2923557939 | 273 |
| 1588 | iso_pu_bacteria | 2933016740 | 2933023078 | 273 |
| 1589 | iso_pu_bacteria | 2933586486 | 2933586517 | 273 |
| 1590 | iso_pu_bacteria | 2933599457 | 2933603922 | 273 |
| 1591 | iso_pu_bacteria | 2996887358 | 2996891709 | 273 |
| 1592 | iso_pu_bacteria | 2996893221 | 2996894158 | 273 |
| 1593 | iso_pu_bacteria | 3005409236 | 3005415133 | 273 |
| 1594 | iso_pu_bacteria | 8005258706 | 8005263039 | 273 |
| 1595 | iso_pu_bacteria | 8005275841 | 8005280575 | 273 |
| 1596 | iso_pu_bacteria | 8005282627 | 8005283195 | 273 |
| 1597 | iso_pu_bacteria | 8005289223 | 8005290249 | 273 |
| 1598 | iso_pu_bacteria | 8005321885 | 8005326236 | 273 |
| 1599 | iso_pu_bacteria | 8005382845 | 8005388334 | 273 |
| 1600 | iso_pu_bacteria | 8005430974 | 8005432142 | 273 |
| 1601 | iso_pu_bacteria | 8005497431 | 8005500341 | 273 |
| 1602 | iso_pu_bacteria | 8005542996 | 8005545157 | 273 |
| 1603 | iso_pu_bacteria | 8005570704 | 8005574241 | 273 |
| 1604 | iso_pu_bacteria | 8005619151 | 8005621717 | 273 |
| 1605 | iso_pu_bacteria | 8005626139 | 8005626536 | 273 |
| 1606 | iso_pu_bacteria | 8005668836 | 8005671759 | 273 |
| 1607 | iso_pu_bacteria | 8018127388 | 8018129924 | 273 |
| 1608 | iso_pu_bacteria | 8018176218 | 8018179828 | 273 |
| 1609 | iso_pu_bacteria | 8024501048 | 8024506585 | 273 |
| 1610 | iso_pu_bacteria | 8056382006 | 8056387841 | 273 |
| 1611 | 3300009765 | Ga0123341_1000004 | Ga0123341_1000004116 | 274 |
| 1612 | 3300028794 | Ga0307515_10007800 | Ga0307515_100078004 | 274 |
| 1613 | 3300046524 | Ga0495648_0140771 | Ga0495648_0140771_194_1066 | 274 |
| 1614 | 3300048914 | Ga0496111_0000701 | Ga0496111_0000701_3159_3998 | 274 |
| 1615 | 3300048920 | Ga0496117_0105321 | Ga0496117_0105321_438_1328 | 274 |
| 1616 | 3300048921 | Ga0496118_0056264 | Ga0496118_0056264_906_1796 | 274 |
| 1617 | 3300048922 | Ga0496119_0096074 | Ga0496119_0096074_251_1141 | 274 |
| 1618 | 3300048925 | Ga0496122_0000025 | Ga0496122_0000025_212291_213145 | 274 |
| 1619 | 3300048925 | Ga0496122_0055173 | Ga0496122_0055173_375_1265 | 274 |
| 1620 | 3300048926 | Ga0496123_0000032 | Ga0496123_0000032_151068_151922 | 274 |
| 1621 | 3300048926 | Ga0496123_0098600 | Ga0496123_0098600_395_1285 | 274 |
| 1622 | 3300048927 | Ga0496124_0047659 | Ga0496124_0047659_1391_2230 | 274 |
| 1623 | 3300048929 | Ga0496126_0005149 | Ga0496126_0005149_11092_11982 | 274 |
| 1624 | 3300049574 | Ga0501038_0052588 | Ga0501038_0052588_538_1383 | 274 |
| 1625 | 3300049823 | Ga0501044_0082243 | Ga0501044_0082243_232_1077 | 274 |
| 1626 | 3300050490 | nmdc:mga03n38_146186_c1 | nmdc:mga03n38_146186_c1_253_1095 | 274 |
| 1627 | iso_pu_bacteria | 2515075009 | 2515112281 | 274 |
| 1628 | iso_pu_bacteria | 2529292951 | 2530645539 | 274 |
| 1629 | iso_pu_bacteria | 2582581304 | 2585254771 | 274 |
| 1630 | iso_pu_bacteria | 2585427594 | 2585846571 | 274 |
| 1631 | iso_pu_bacteria | 2643221599 | 2644005070 | 274 |
| 1632 | iso_pu_bacteria | 2643221634 | 2644192891 | 274 |
| 1633 | iso_pu_bacteria | 2643221688 | 2644491710 | 274 |
| 1634 | iso_pu_bacteria | 2718217882 | 2719181193 | 274 |
| 1635 | iso_pu_bacteria | 2718218009 | 2719731942 | 274 |
| 1636 | iso_pu_bacteria | 2718218363 | 2721147287 | 274 |
| 1637 | iso_pu_bacteria | 2718218365 | 2721158820 | 274 |
| 1638 | iso_pu_bacteria | 2718218366 | 2721164205 | 274 |
| 1639 | iso_pu_bacteria | 2721755514 | 2722840375 | 274 |
| 1640 | iso_pu_bacteria | 2721755810 | 2724044698 | 274 |
| 1641 | iso_pu_bacteria | 2728369365 | 2730164430 | 274 |
| 1642 | iso_pu_bacteria | 2728369397 | 2730298452 | 274 |
| 1643 | iso_pu_bacteria | 2738541293 | 2738801935 | 274 |
| 1644 | iso_pu_bacteria | 2791355260 | 2793322009 | 274 |
| 1645 | iso_pu_bacteria | 2791355261 | 2793331287 | 274 |
| 1646 | iso_pu_bacteria | 2791355264 | 2793349065 | 274 |
| 1647 | iso_pu_bacteria | 2842298080 | 2842302018 | 274 |
| 1648 | iso_pu_bacteria | 2842357229 | 2842357515 | 274 |
| 1649 | iso_pu_bacteria | 2842482326 | 2842484812 | 274 |
| 1650 | iso_pu_bacteria | 2852387548 | 2852389924 | 274 |
| 1651 | iso_pu_bacteria | 2936367885 | 2936372696 | 274 |
| 1652 | iso_pu_bacteria | 2936375103 | 2936378549 | 274 |
| 1653 | iso_pu_bacteria | 3005452660 | 3005454091 | 274 |
| 1654 | iso_pu_bacteria | 8005376324 | 8005379222 | 274 |
| 1655 | iso_pu_bacteria | 8005395548 | 8005397138 | 274 |
| 1656 | iso_pu_bacteria | 8005460587 | 8005462944 | 274 |
| 1657 | iso_pu_bacteria | 8005688590 | 8005694582 | 274 |
| 1658 | iso_pu_bacteria | 8005695170 | 8005700014 | 274 |
| 1659 | iso_pu_bacteria | 8024479707 | 8024483539 | 274 |
| 1660 | 3300003215 | JGI25153J46596_10004512 | JGI25153J46596_100045125 | 275 |
| 1661 | 3300003790 | Ga0055528_1016265 | Ga0055528_10162652 | 275 |
| 1662 | 3300025258 | Ga0209129_1010409 | Ga0209129_10104093 | 275 |
| 1663 | 3300025297 | Ga0209758_1014353 | Ga0209758_10143534 | 275 |
| 1664 | 3300041441 | Ga0451787_223311 | Ga0451787_223311_1267_2112 | 275 |
| 1665 | 3300041458 | Ga0451798_0200031 | Ga0451798_0200031_1216_2061 | 275 |
| 1666 | 3300041491 | Ga0451833_1421423 | Ga0451833_1421423_660_1505 | 275 |
| 1667 | 3300041492 | Ga0451835_0113922 | Ga0451835_0113922_294_1139 | 275 |
| 1668 | 3300041496 | Ga0451839_0358112 | Ga0451839_0358112_1784_2629 | 275 |
| 1669 | 3300041501 | Ga0451845_0403951 | Ga0451845_0403951_380_1225 | 275 |
| 1670 | 3300041907 | Ga0452268_09468 | Ga0452268_09468_582_1427 | 275 |
| 1671 | 3300046460 | Ga0495638_0113396 | Ga0495638_0113396_53_898 | 275 |
| 1672 | 3300046471 | Ga0495650_0040565 | Ga0495650_0040565_363_1208 | 275 |
| 1673 | 3300046492 | Ga0495585_0055210 | Ga0495585_0055210_228_1073 | 275 |
| 1674 | 3300046515 | Ga0495620_0021715 | Ga0495620_0021715_1385_2230 | 275 |
| 1675 | 3300046519 | Ga0495632_0008494 | Ga0495632_0008494_2809_3654 | 275 |
| 1676 | 3300046524 | Ga0495648_0019014 | Ga0495648_0019014_2790_3635 | 275 |
| 1677 | 3300046530 | Ga0495654_0096625 | Ga0495654_0096625_276_1121 | 275 |
| 1678 | 3300046542 | Ga0495597_0028981 | Ga0495597_0028981_1525_2370 | 275 |
| 1679 | 3300048090 | Ga0495615_0023537 | Ga0495615_0023537_421_1266 | 275 |
| 1680 | 3300053086 | Ga0500578_0107045 | Ga0500578_0107045_124_969 | 275 |
| 1681 | 3300053134 | Ga0500658_0000636 | Ga0500658_0000636_6184_7029 | 275 |
| 1682 | 3300053136 | Ga0500559_0002896 | Ga0500559_0002896_4133_4993 | 275 |
| 1683 | iso_pu_bacteria | 2509276021 | 2509386673 | 275 |
| 1684 | iso_pu_bacteria | 2509276021 | 2509392918 | 275 |
| 1685 | iso_pu_bacteria | 2510065019 | 2510133322 | 275 |
| 1686 | iso_pu_bacteria | 2510461076 | 2510894691 | 275 |
| 1687 | iso_pu_bacteria | 2513237084 | 2513572491 | 275 |
| 1688 | iso_pu_bacteria | 2513237093 | 2513636047 | 275 |
| 1689 | iso_pu_bacteria | 2513237103 | 2513708722 | 275 |
| 1690 | iso_pu_bacteria | 2513237162 | 2514021640 | 275 |
| 1691 | iso_pu_bacteria | 2515154113 | 2515637556 | 275 |
| 1692 | iso_pu_bacteria | 2515154116 | 2515657428 | 275 |
| 1693 | iso_pu_bacteria | 2515154134 | 2515738568 | 275 |
| 1694 | iso_pu_bacteria | 2516653077 | 2517036014 | 275 |
| 1695 | iso_pu_bacteria | 2516653085 | 2517076407 | 275 |
| 1696 | iso_pu_bacteria | 2517093000 | 2517095165 | 275 |
| 1697 | iso_pu_bacteria | 2517287029 | 2517406794 | 275 |
| 1698 | iso_pu_bacteria | 2585427526 | 2585527649 | 275 |
| 1699 | iso_pu_bacteria | 2724679232 | 2725950636 | 275 |
| 1700 | iso_pu_bacteria | 2765235802 | 2765464889 | 275 |
| 1701 | iso_pu_bacteria | 2767802442 | 2770195184 | 275 |
| 1702 | iso_pu_bacteria | 2791355253 | 2793279691 | 275 |
| 1703 | iso_pu_bacteria | 2791355263 | 2793341529 | 275 |
| 1704 | iso_pu_bacteria | 2791355266 | 2793361160 | 275 |
| 1705 | iso_pu_bacteria | 2791355267 | 2793369250 | 275 |
| 1706 | iso_pu_bacteria | 2838042994 | 2838043449 | 275 |
| 1707 | iso_pu_bacteria | 2838680041 | 2838682203 | 275 |
| 1708 | iso_pu_bacteria | 2838694306 | 2838696774 | 275 |
| 1709 | iso_pu_bacteria | 2838707686 | 2838709986 | 275 |
| 1710 | iso_pu_bacteria | 2839993093 | 2839994813 | 275 |
| 1711 | iso_pu_bacteria | 2842077413 | 2842078159 | 275 |
| 1712 | iso_pu_bacteria | 2842118031 | 2842119332 | 275 |
| 1713 | iso_pu_bacteria | 2842237096 | 2842239398 | 275 |
| 1714 | iso_pu_bacteria | 2842291075 | 2842291822 | 275 |
| 1715 | iso_pu_bacteria | 2842370503 | 2842372769 | 275 |
| 1716 | iso_pu_bacteria | 2842377471 | 2842378218 | 275 |
| 1717 | iso_pu_bacteria | 2842384541 | 2842385841 | 275 |
| 1718 | iso_pu_bacteria | 2933570622 | 2933571577 | 275 |
| 1719 | iso_pu_bacteria | 2935894831 | 2935897370 | 275 |
| 1720 | iso_pu_bacteria | 2935901341 | 2935904750 | 275 |
| 1721 | iso_pu_bacteria | 2936381700 | 2936384973 | 275 |
| 1722 | iso_pu_bacteria | 639633055 | 639648537 | 275 |
| 1723 | iso_pu_bacteria | 8005307578 | 8005311185 | 275 |
| 1724 | iso_pu_bacteria | 8005563573 | 8005568883 | 275 |
| 1725 | iso_pu_bacteria | 8056375014 | 8056376631 | 275 |
| 1726 | 3300002739 | JGI25158J39367_1000133 | JGI25158J39367_10001336 | 276 |
| 1727 | 3300002739 | JGI25158J39367_1000148 | JGI25158J39367_10001485 | 276 |
| 1728 | 3300002773 | JGI25152J39213_1009965 | JGI25152J39213_10099652 | 276 |
| 1729 | 3300002987 | JGI25159J45721_1002339 | JGI25159J45721_10023395 | 276 |
| 1730 | 3300003187 | JGI25151J46595_10013406 | JGI25151J46595_100134062 | 276 |
| 1731 | 3300003374 | JGI25161J50226_1000108 | JGI25161J50226_100010847 | 276 |
| 1732 | 3300003374 | JGI25161J50226_1000282 | JGI25161J50226_100028213 | 276 |
| 1733 | 3300003771 | Ga0055526_1001796 | Ga0055526_10017966 | 276 |
| 1734 | 3300003771 | Ga0055526_1027613 | Ga0055526_10276132 | 276 |
| 1735 | 3300003775 | Ga0055524_1008693 | Ga0055524_10086933 | 276 |
| 1736 | 3300003790 | Ga0055528_1001510 | Ga0055528_10015109 | 276 |
| 1737 | 3300003790 | Ga0055528_1009799 | Ga0055528_10097993 | 276 |
| 1738 | 3300003792 | Ga0055540_1000201 | Ga0055540_10002019 | 276 |
| 1739 | 3300003792 | Ga0055540_1006629 | Ga0055540_10066293 | 276 |
| 1740 | 3300004625 | Ga0055543_1000020 | Ga0055543_100002038 | 276 |
| 1741 | 3300006051 | Ga0075364_10004863 | Ga0075364_100048635 | 276 |
| 1742 | 3300006353 | Ga0075370_10047088 | Ga0075370_100470882 | 276 |
| 1743 | 3300009036 | Ga0105244_10084900 | Ga0105244_100849002 | 276 |
| 1744 | 3300013100 | Ga0157373_10051238 | Ga0157373_100512383 | 276 |
| 1745 | 3300025208 | Ga0209436_100439 | Ga0209436_1004396 | 276 |
| 1746 | 3300025258 | Ga0209129_1000069 | Ga0209129_1000069116 | 276 |
| 1747 | 3300025258 | Ga0209129_1000817 | Ga0209129_10008173 | 276 |
| 1748 | 3300025273 | Ga0209673_1000048 | Ga0209673_1000048198 | 276 |
| 1749 | 3300025273 | Ga0209673_1000959 | Ga0209673_10009598 | 276 |
| 1750 | 3300025284 | Ga0209130_1000004 | Ga0209130_1000004201 | 276 |
| 1751 | 3300025294 | Ga0209025_1001272 | Ga0209025_10012726 | 276 |
| 1752 | 3300025294 | Ga0209025_1010738 | Ga0209025_10107382 | 276 |
| 1753 | 3300025294 | Ga0209025_1052144 | Ga0209025_10521442 | 276 |
| 1754 | 3300025295 | Ga0209564_1001482 | Ga0209564_10014826 | 276 |
| 1755 | 3300025295 | Ga0209564_1021130 | Ga0209564_10211302 | 276 |
| 1756 | 3300025297 | Ga0209758_1000384 | Ga0209758_100038440 | 276 |
| 1757 | 3300025299 | Ga0209256_1001625 | Ga0209256_10016256 | 276 |
| 1758 | 3300025302 | Ga0207426_1000003 | Ga0207426_1000003527 | 276 |
| 1759 | 3300025303 | Ga0209051_1000142 | Ga0209051_100014295 | 276 |
| 1760 | 3300025303 | Ga0209051_1008600 | Ga0209051_10086004 | 276 |
| 1761 | 3300025303 | Ga0209051_1045978 | Ga0209051_10459782 | 276 |
| 1762 | 3300025304 | Ga0209257_1001864 | Ga0209257_100186412 | 276 |
| 1763 | 3300025304 | Ga0209257_1014247 | Ga0209257_10142473 | 276 |
| 1764 | 3300046530 | Ga0495654_0000315 | Ga0495654_0000315_36107_36973 | 276 |
| 1765 | 3300046692 | Ga0495671_0197205 | Ga0495671_0197205_78_917 | 276 |
| 1766 | 3300048910 | Ga0496107_0141897 | Ga0496107_0141897_161_1009 | 276 |
| 1767 | 3300048920 | Ga0496117_0115494 | Ga0496117_0115494_164_1018 | 276 |
| 1768 | 3300048924 | Ga0496121_0000001 | Ga0496121_0000001_1279366_1280220 | 276 |
| 1769 | 3300048924 | Ga0496121_0342526 | Ga0496121_0342526_102_950 | 276 |
| 1770 | 3300048925 | Ga0496122_0155754 | Ga0496122_0155754_493_1341 | 276 |
| 1771 | 3300048927 | Ga0496124_0015632 | Ga0496124_0015632_4356_5210 | 276 |
| 1772 | 3300048927 | Ga0496124_0248539 | Ga0496124_0248539_125_973 | 276 |
| 1773 | 3300050491 | nmdc:mga00v17_53493_c1 | nmdc:mga00v17_53493_c1_1015_1869 | 276 |
| 1774 | 3300050496 | nmdc:mga07m45_155605_c1 | nmdc:mga07m45_155605_c1_381_1229 | 276 |
| 1775 | 3300053125 | Ga0500618_000084 | Ga0500618_000084_49192_50055 | 276 |
| 1776 | iso_pu_bacteria | 2775506902 | 2776270916 | 276 |
| 1777 | iso_pu_bacteria | 2775506904 | 2776282807 | 276 |
| 1778 | iso_pu_bacteria | 2842871566 | 2842871686 | 276 |
| 1779 | iso_pu_bacteria | 2894652903 | 2894656248 | 276 |
| 1780 | iso_pu_bacteria | 2928521798 | 2928523626 | 276 |
| 1781 | iso_pu_bacteria | 2929138655 | 2929139897 | 276 |
| 1782 | iso_pu_bacteria | 2954011201 | 2954015907 | 276 |
| 1783 | iso_pu_bacteria | 3002141150 | 3002144427 | 276 |
| 1784 | 3300002773 | JGI25152J39213_1003760 | JGI25152J39213_10037602 | 277 |
| 1785 | 3300002773 | JGI25152J39213_1004211 | JGI25152J39213_10042111 | 277 |
| 1786 | 3300003215 | JGI25153J46596_10060883 | JGI25153J46596_100608831 | 277 |
| 1787 | 3300003771 | Ga0055526_1007156 | Ga0055526_10071563 | 277 |
| 1788 | 3300003775 | Ga0055524_1004687 | Ga0055524_10046874 | 277 |
| 1789 | 3300003790 | Ga0055528_1013610 | Ga0055528_10136103 | 277 |
| 1790 | 3300005355 | Ga0070671_100076097 | Ga0070671_1000760973 | 277 |
| 1791 | 3300005457 | Ga0070662_100246244 | Ga0070662_1002462442 | 277 |
| 1792 | 3300006038 | Ga0075365_10005402 | Ga0075365_100054023 | 277 |
| 1793 | 3300006177 | Ga0075362_10021642 | Ga0075362_100216423 | 277 |
| 1794 | 3300006178 | Ga0075367_10001099 | Ga0075367_100010994 | 277 |
| 1795 | 3300009177 | Ga0105248_10036988 | Ga0105248_100369883 | 277 |
| 1796 | 3300009766 | Ga0123342_1006529 | Ga0123342_100652911 | 277 |
| 1797 | 3300025245 | Ga0207425_1001496 | Ga0207425_10014966 | 277 |
| 1798 | 3300025245 | Ga0207425_1036123 | Ga0207425_10361232 | 277 |
| 1799 | 3300025258 | Ga0209129_1000939 | Ga0209129_10009397 | 277 |
| 1800 | 3300025258 | Ga0209129_1001103 | Ga0209129_10011039 | 277 |
| 1801 | 3300025273 | Ga0209673_1003109 | Ga0209673_10031094 | 277 |
| 1802 | 3300025273 | Ga0209673_1047577 | Ga0209673_10475772 | 277 |
| 1803 | 3300025294 | Ga0209025_1015850 | Ga0209025_10158505 | 277 |
| 1804 | 3300025294 | Ga0209025_1028708 | Ga0209025_10287082 | 277 |
| 1805 | 3300025294 | Ga0209025_1035421 | Ga0209025_10354212 | 277 |
| 1806 | 3300025297 | Ga0209758_1000749 | Ga0209758_100074922 | 277 |
| 1807 | 3300025297 | Ga0209758_1001310 | Ga0209758_100131019 | 277 |
| 1808 | 3300025299 | Ga0209256_1010879 | Ga0209256_10108791 | 277 |
| 1809 | 3300025302 | Ga0207426_1001731 | Ga0207426_10017312 | 277 |
| 1810 | 3300025931 | Ga0207644_10038112 | Ga0207644_100381123 | 277 |
| 1811 | 3300025941 | Ga0207711_10082775 | Ga0207711_100827753 | 277 |
| 1812 | 3300026067 | Ga0207678_10018602 | Ga0207678_100186025 | 277 |
| 1813 | 3300041413 | Ga0439465_0003539 | Ga0439465_0003539_2039_2887 | 277 |
| 1814 | 3300046460 | Ga0495638_0000145 | Ga0495638_0000145_81203_82051 | 277 |
| 1815 | 3300046474 | Ga0495605_0000715 | Ga0495605_0000715_20743_21591 | 277 |
| 1816 | 3300046492 | Ga0495585_0015627 | Ga0495585_0015627_461_1309 | 277 |
| 1817 | 3300046506 | Ga0495583_0061171 | Ga0495583_0061171_486_1334 | 277 |
| 1818 | 3300046507 | Ga0495606_0182851 | Ga0495606_0182851_333_1181 | 277 |
| 1819 | 3300046512 | Ga0495610_0052350 | Ga0495610_0052350_562_1434 | 277 |
| 1820 | 3300046513 | Ga0495616_0004639 | Ga0495616_0004639_7451_8299 | 277 |
| 1821 | 3300046518 | Ga0495631_0001131 | Ga0495631_0001131_5899_6747 | 277 |
| 1822 | 3300046519 | Ga0495632_0008869 | Ga0495632_0008869_1279_2127 | 277 |
| 1823 | 3300046522 | Ga0495643_0014754 | Ga0495643_0014754_1733_2605 | 277 |
| 1824 | 3300046522 | Ga0495643_0018816 | Ga0495643_0018816_371_1219 | 277 |
| 1825 | 3300046524 | Ga0495648_0149306 | Ga0495648_0149306_33_881 | 277 |
| 1826 | 3300046616 | Ga0495668_0043818 | Ga0495668_0043818_427_1275 | 277 |
| 1827 | 3300046648 | Ga0495611_0008325 | Ga0495611_0008325_2267_3115 | 277 |
| 1828 | 3300046660 | Ga0495625_0002190 | Ga0495625_0002190_237_1085 | 277 |
| 1829 | 3300047320 | Ga0495672_0006422 | Ga0495672_0006422_7333_8181 | 277 |
| 1830 | 3300048920 | Ga0496117_0119910 | Ga0496117_0119910_95_955 | 277 |
| 1831 | 3300048924 | Ga0496121_0025174 | Ga0496121_0025174_4382_5254 | 277 |
| 1832 | 3300049569 | Ga0501032_0046515 | Ga0501032_0046515_246_1127 | 277 |
| 1833 | 3300049579 | Ga0501043_0024816 | Ga0501043_0024816_365_1246 | 277 |
| 1834 | 3300049583 | Ga0501067_0050531 | Ga0501067_0050531_802_1683 | 277 |
| 1835 | 3300050492 | nmdc:mga0yw44_7216_c2 | nmdc:mga0yw44_7216_c2_1205_2083 | 277 |
| 1836 | 3300053086 | Ga0500578_0174366 | Ga0500578_0174366_423_1271 | 277 |
| 1837 | 3300053109 | Ga0500569_000857 | Ga0500569_000857_3777_4625 | 277 |
| 1838 | 3300053118 | Ga0500594_0000615 | Ga0500594_0000615_3868_4716 | 277 |
| 1839 | 3300053130 | Ga0500642_0158018 | Ga0500642_0158018_137_985 | 277 |
| 1840 | 3300053139 | Ga0500568_0000846 | Ga0500568_0000846_215_1063 | 277 |
| 1841 | 3300053153 | Ga0500616_0000917 | Ga0500616_0000917_7116_7964 | 277 |
| 1842 | 3300053156 | Ga0500622_0000425 | Ga0500622_0000425_33205_34056 | 277 |
| 1843 | 3300053158 | Ga0500627_0022426 | Ga0500627_0022426_575_1423 | 277 |
| 1844 | iso_pu_bacteria | 2582581298 | 2585224356 | 277 |
| 1845 | iso_pu_bacteria | 2585427529 | 2585546477 | 277 |
| 1846 | iso_pu_bacteria | 2840764183 | 2840767676 | 277 |
| 1847 | iso_pu_bacteria | 3005445848 | 3005447531 | 277 |
| 1848 | 3300002773 | JGI25152J39213_1000470 | JGI25152J39213_100047011 | 278 |
| 1849 | 3300002773 | JGI25152J39213_1000568 | JGI25152J39213_100056811 | 278 |
| 1850 | 3300002774 | JGI25150J39212_1000010 | JGI25150J39212_1000010212 | 278 |
| 1851 | 3300003187 | JGI25151J46595_10000026 | JGI25151J46595_10000026192 | 278 |
| 1852 | 3300003215 | JGI25153J46596_10001408 | JGI25153J46596_100014088 | 278 |
| 1853 | 3300025245 | Ga0207425_1000010 | Ga0207425_1000010539 | 278 |
| 1854 | 3300025258 | Ga0209129_1000197 | Ga0209129_100019744 | 278 |
| 1855 | 3300025273 | Ga0209673_1010825 | Ga0209673_10108252 | 278 |
| 1856 | 3300025294 | Ga0209025_1000022 | Ga0209025_100002244 | 278 |
| 1857 | 3300025297 | Ga0209758_1000086 | Ga0209758_1000086215 | 278 |
| 1858 | 3300031731 | Ga0307405_10005745 | Ga0307405_100057455 | 278 |
| 1859 | 3300031911 | Ga0307412_10000449 | Ga0307412_1000044915 | 278 |
| 1860 | 3300031995 | Ga0307409_100382880 | Ga0307409_1003828802 | 278 |
| 1861 | 3300046506 | Ga0495583_0004528 | Ga0495583_0004528_4450_5298 | 278 |
| 1862 | 3300046507 | Ga0495606_0001788 | Ga0495606_0001788_8572_9447 | 278 |
| 1863 | 3300046512 | Ga0495610_0003504 | Ga0495610_0003504_5471_6319 | 278 |
| 1864 | 3300046660 | Ga0495625_0237881 | Ga0495625_0237881_223_1071 | 278 |
| 1865 | 3300046674 | Ga0495588_0241404 | Ga0495588_0241404_79_927 | 278 |
| 1866 | 3300047472 | Ga0495686_0044364 | Ga0495686_0044364_1685_2533 | 278 |
| 1867 | 3300048090 | Ga0495615_0073354 | Ga0495615_0073354_29_877 | 278 |
| 1868 | 3300048904 | Ga0496101_0117487 | Ga0496101_0117487_49_897 | 278 |
| 1869 | 3300048909 | Ga0496106_0000125 | Ga0496106_0000125_40770_41654 | 278 |
| 1870 | 3300048919 | Ga0496116_0003130 | Ga0496116_0003130_12977_13825 | 278 |
| 1871 | 3300048919 | Ga0496116_0009520 | Ga0496116_0009520_1373_2221 | 278 |
| 1872 | 3300048919 | Ga0496116_0018287 | Ga0496116_0018287_3393_4241 | 278 |
| 1873 | 3300048920 | Ga0496117_0016796 | Ga0496117_0016796_1028_1876 | 278 |
| 1874 | 3300048921 | Ga0496118_0016459 | Ga0496118_0016459_61_909 | 278 |
| 1875 | 3300048921 | Ga0496118_0025089 | Ga0496118_0025089_4242_5090 | 278 |
| 1876 | 3300048924 | Ga0496121_0049492 | Ga0496121_0049492_245_1120 | 278 |
| 1877 | 3300048925 | Ga0496122_0021071 | Ga0496122_0021071_925_1773 | 278 |
| 1878 | 3300048925 | Ga0496122_0039541 | Ga0496122_0039541_1710_2558 | 278 |
| 1879 | 3300048926 | Ga0496123_0016379 | Ga0496123_0016379_2131_2979 | 278 |
| 1880 | 3300048926 | Ga0496123_0041233 | Ga0496123_0041233_1415_2263 | 278 |
| 1881 | 3300048927 | Ga0496124_0002623 | Ga0496124_0002623_20173_21021 | 278 |
| 1882 | 3300048927 | Ga0496124_0004853 | Ga0496124_0004853_4300_5148 | 278 |
| 1883 | 3300048928 | Ga0496125_0017863 | Ga0496125_0017863_4413_5261 | 278 |
| 1884 | 3300049459 | Ga0495678_027150 | Ga0495678_027150_1484_2332 | 278 |
| 1885 | 3300053125 | Ga0500618_004461 | Ga0500618_004461_1294_2142 | 278 |
| 1886 | 3300053139 | Ga0500568_0002227 | Ga0500568_0002227_366_1250 | 278 |
| 1887 | iso_pu_bacteria | 2510917030 | 2511200318 | 278 |
| 1888 | 3300006186 | Ga0075369_10004127 | Ga0075369_100041275 | 280 |
| 1889 | 3300048921 | Ga0496118_0004791 | Ga0496118_0004791_5612_6502 | 280 |
| 1890 | 3300048925 | Ga0496122_0010790 | Ga0496122_0010790_7266_8156 | 280 |
| 1891 | 3300048926 | Ga0496123_0010385 | Ga0496123_0010385_3820_4710 | 280 |
| 1892 | 3300048927 | Ga0496124_0028283 | Ga0496124_0028283_111_1001 | 280 |
| 1893 | iso_pu_bacteria | 2842922631 | 2842923880 | 280 |
| 1894 | iso_pu_bacteria | 2919100787 | 2919106649 | 280 |
| 1895 | iso_pu_bacteria | 8046767195 | 8046773766 | 280 |
| 1896 | iso_pu_bacteria | 2585427608 | 2585897965 | 282 |
| 1897 | iso_pu_bacteria | 2510917022 | 2511135139 | 283 |
| 1898 | iso_pu_bacteria | 2524023209 | 2524460255 | 283 |
| 1899 | iso_pu_bacteria | 2582581307 | 2585270879 | 283 |
| 1900 | iso_pu_bacteria | 2582581308 | 2585277226 | 283 |
| 1901 | iso_pu_bacteria | 2582581315 | 2585323765 | 283 |
| 1902 | iso_pu_bacteria | 2582581316 | 2585331744 | 283 |
| 1903 | iso_pu_bacteria | 2585427527 | 2585534038 | 283 |
| 1904 | iso_pu_bacteria | 2585427530 | 2585552111 | 283 |
| 1905 | iso_pu_bacteria | 2585427531 | 2585558603 | 283 |
| 1906 | iso_pu_bacteria | 2585427609 | 2585904428 | 283 |
| 1907 | iso_pu_bacteria | 2585428125 | 2587980455 | 283 |
| 1908 | iso_pu_bacteria | 2615840626 | 2616308604 | 283 |
| 1909 | iso_pu_bacteria | 2615840698 | 2616557091 | 283 |
| 1910 | iso_pu_bacteria | 2617270742 | 2617385643 | 283 |
| 1911 | iso_pu_bacteria | 2667528174 | 2671111692 | 283 |
| 1912 | iso_pu_bacteria | 2775507266 | 2778174042 | 283 |
| 1913 | iso_pu_bacteria | 2818991448 | 2819612772 | 283 |
| 1914 | iso_pu_bacteria | 2818991453 | 2819637885 | 283 |
| 1915 | iso_pu_bacteria | 2838029111 | 2838030066 | 283 |
| 1916 | iso_pu_bacteria | 2842475841 | 2842476649 | 283 |
| 1917 | iso_pu_bacteria | 2842502639 | 2842503594 | 283 |
| 1918 | iso_pu_bacteria | 2842509118 | 2842511410 | 283 |
| 1919 | iso_pu_bacteria | 2919408235 | 2919411664 | 283 |
| 1920 | iso_pu_bacteria | 3005416602 | 3005420081 | 283 |
| 1921 | iso_pu_bacteria | 8005314921 | 8005317032 | 283 |
| 1922 | iso_pu_bacteria | 8005484373 | 8005485173 | 283 |
| 1923 | iso_pu_bacteria | 8005645114 | 8005645336 | 283 |
| 1924 | iso_pu_bacteria | 8005682033 | 8005683163 | 283 |
| 1925 | iso_pu_bacteria | 8024486573 | 8024492240 | 283 |
| 1926 | iso_pu_bacteria | 8057575449 | 8057576859 | 283 |
| 1927 | 3300048903 | Ga0496100_0210136 | Ga0496100_0210136_494_1363 | 286 |
| 1928 | 3300001979 | JGI24740J21852_10000166 | JGI24740J21852_1000016614 | 287 |
| 1929 | 3300002704 | JGI25155J39150_1000001 | JGI25155J39150_100000141 | 287 |
| 1930 | 3300002705 | JGI25156J39149_1000001 | JGI25156J39149_1000001291 | 287 |
| 1931 | 3300002737 | JGI25162J39368_1000331 | JGI25162J39368_100033123 | 287 |
| 1932 | 3300002737 | JGI25162J39368_1001207 | JGI25162J39368_10012072 | 287 |
| 1933 | 3300002738 | JGI25154J39366_1000011 | JGI25154J39366_100001192 | 287 |
| 1934 | 3300002738 | JGI25154J39366_1007551 | JGI25154J39366_10075512 | 287 |
| 1935 | 3300002741 | JGI25157J39369_1000030 | JGI25157J39369_100003093 | 287 |
| 1936 | 3300002987 | JGI25159J45721_1000410 | JGI25159J45721_100041012 | 287 |
| 1937 | 3300003214 | JGI25165J46597_1000449 | JGI25165J46597_100044923 | 287 |
| 1938 | 3300003316 | rootH1_10066326 | rootH1_100663261 | 287 |
| 1939 | 3300003320 | rootH2_10116711 | rootH2_101167115 | 287 |
| 1940 | 3300003322 | rootL2_10046034 | rootL2_100460344 | 287 |
| 1941 | 3300003323 | rootH1_10128595 | rootH1_101285952 | 287 |
| 1942 | 3300003354 | JGI25160J50197_1000010 | JGI25160J50197_100001078 | 287 |
| 1943 | 3300003374 | JGI25161J50226_1000006 | JGI25161J50226_100000678 | 287 |
| 1944 | 3300004625 | Ga0055543_1000171 | Ga0055543_100017111 | 287 |
| 1945 | 3300005262 | Ga0065165_1000485 | Ga0065165_100048543 | 287 |
| 1946 | 3300005563 | Ga0068855_100412190 | Ga0068855_1004121902 | 287 |
| 1947 | 3300005614 | Ga0068856_100188014 | Ga0068856_1001880142 | 287 |
| 1948 | 3300009093 | Ga0105240_10000005 | Ga0105240_10000005619 | 287 |
| 1949 | 3300009545 | Ga0105237_10005428 | Ga0105237_100054289 | 287 |
| 1950 | 3300009545 | Ga0105237_10444322 | Ga0105237_104443222 | 287 |
| 1951 | 3300010375 | Ga0105239_10129746 | Ga0105239_101297463 | 287 |
| 1952 | 3300013104 | Ga0157370_10001194 | Ga0157370_100011947 | 287 |
| 1953 | 3300013105 | Ga0157369_10187868 | Ga0157369_101878682 | 287 |
| 1954 | 3300014497 | Ga0182008_10095506 | Ga0182008_100955061 | 287 |
| 1955 | 3300015262 | Ga0182007_10001955 | Ga0182007_100019555 | 287 |
| 1956 | 3300015265 | Ga0182005_1002400 | Ga0182005_10024004 | 287 |
| 1957 | 3300025206 | Ga0209435_100012 | Ga0209435_10001291 | 287 |
| 1958 | 3300025207 | Ga0209760_102779 | Ga0209760_1027792 | 287 |
| 1959 | 3300025233 | Ga0209437_100047 | Ga0209437_100047203 | 287 |
| 1960 | 3300025233 | Ga0209437_100165 | Ga0209437_100165106 | 287 |
| 1961 | 3300025246 | Ga0209646_1000026 | Ga0209646_100002691 | 287 |
| 1962 | 3300025246 | Ga0209646_1004022 | Ga0209646_10040222 | 287 |
| 1963 | 3300025250 | Ga0209026_1000014 | Ga0209026_100001491 | 287 |
| 1964 | 3300025253 | Ga0209677_101402 | Ga0209677_1014024 | 287 |
| 1965 | 3300025256 | Ga0209759_1000012 | Ga0209759_100001291 | 287 |
| 1966 | 3300025261 | Ga0209233_1000048 | Ga0209233_1000048199 | 287 |
| 1967 | 3300025261 | Ga0209233_1000069 | Ga0209233_1000069236 | 287 |
| 1968 | 3300025261 | Ga0209233_1000195 | Ga0209233_100019536 | 287 |
| 1969 | 3300025284 | Ga0209130_1000021 | Ga0209130_1000021189 | 287 |
| 1970 | 3300025302 | Ga0207426_1000010 | Ga0207426_1000010169 | 287 |
| 1971 | 3300025913 | Ga0207695_10000011 | Ga0207695_10000011299 | 287 |
| 1972 | 3300025914 | Ga0207671_10000804 | Ga0207671_1000080415 | 287 |
| 1973 | 3300025949 | Ga0207667_10368231 | Ga0207667_103682312 | 287 |
| 1974 | 3300026078 | Ga0207702_10152250 | Ga0207702_101522502 | 287 |
| 1975 | 3300027312 | Ga0209371_1005448 | Ga0209371_10054484 | 287 |
| 1976 | 3300030500 | Ga0268256_1005356 | Ga0268256_10053563 | 287 |
| 1977 | 3300044694 | Ga0466963_0206435 | Ga0466963_0206435_389_1252 | 287 |
| 1978 | 3300044765 | Ga0466970_0003056 | Ga0466970_0003056_2893_3756 | 287 |
| 1979 | 3300046454 | Ga0495592_0191825 | Ga0495592_0191825_278_1156 | 287 |
| 1980 | 3300046459 | Ga0495629_0011315 | Ga0495629_0011315_5285_6163 | 287 |
| 1981 | 3300046462 | Ga0495651_0128903 | Ga0495651_0128903_472_1350 | 287 |
| 1982 | 3300046507 | Ga0495606_0218901 | Ga0495606_0218901_53_931 | 287 |
| 1983 | 3300046557 | Ga0495622_0069319 | Ga0495622_0069319_501_1379 | 287 |
| 1984 | 3300046663 | Ga0495635_0063779 | Ga0495635_0063779_1045_1923 | 287 |
| 1985 | 3300047317 | Ga0495604_0024912 | Ga0495604_0024912_2814_3713 | 287 |
| 1986 | 3300047472 | Ga0495686_0000761 | Ga0495686_0000761_13350_14228 | 287 |
| 1987 | 3300047472 | Ga0495686_0035591 | Ga0495686_0035591_1769_2641 | 287 |
| 1988 | 3300048920 | Ga0496117_0155074 | Ga0496117_0155074_23_895 | 287 |
| 1989 | 3300048921 | Ga0496118_0008798 | Ga0496118_0008798_6102_6974 | 287 |
| 1990 | 3300048923 | Ga0496120_0015555 | Ga0496120_0015555_1518_2390 | 287 |
| 1991 | 3300048924 | Ga0496121_0003355 | Ga0496121_0003355_16051_16923 | 287 |
| 1992 | 3300048925 | Ga0496122_0008019 | Ga0496122_0008019_10039_10902 | 287 |
| 1993 | 3300048927 | Ga0496124_0100308 | Ga0496124_0100308_694_1557 | 287 |
| 1994 | 3300048929 | Ga0496126_0108949 | Ga0496126_0108949_591_1463 | 287 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7ch8-assembly1.cif.gz_J | cryo-em structure of p.aeruginosa mlafebd with adp-v | 0.9677 | 19 | 259 |
| 7ch8-assembly1.cif.gz_I | cryo-em structure of p.aeruginosa mlafebd with adp-v | 0.9657 | 19 | 259 |
| 8fee-assembly1.cif.gz_H | structure of mce1 transporter from mycobacterium smegmatis in the absence of lucb (map2) | 0.9522 | 19 | 259 |
| 3tuj-assembly1.cif.gz_C | inward facing conformations of the metni methionine abc transporter: dm crystal form | 0.9411 | 20 | 258 |
| 2pcj-assembly1.cif.gz_B | crystal structure of abc transporter (aq_297) from aquifex aeolicus vf5 | 0.9383 | 19 | 241 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WQL5_26_341_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9702 | 21 | 256 | 3.40.50.300 |
| af_P63386_5_251_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.959 | 19 | 260 | 3.40.50.300 |
| af_P33360_1_239_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9515 | 21 | 257 | 3.40.50.300 |
| af_Q2G1F8_275_530_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.947 | 19 | 259 | 3.40.50.300 |
| af_P75957_1_229_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9417 | 17 | 236 | 3.40.50.300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A522AFW5-F1-model_v4 | ATP-binding cassette domain-containing protein | 0.9822 | 17 | 267 |
GO:0005524
GO:0016887 |
| AF-A0A355T0Z8-F1-model_v4 | ABC transporter ATP-binding protein | 0.9718 | 17 | 165 |
GO:0005524
GO:0016887 |
| AF-A0A522AFW5-F1-model_v4 | ATP-binding cassette domain-containing protein | 0.9707 | 17 | 267 |
GO:0005524
GO:0016887 |
| AF-A0A831UKK4-F1-model_v4 | ATP-binding cassette domain-containing protein | 0.968 | 19 | 180 |
GO:0005524
GO:0016887 |
| AF-A0A096ZN85-F1-model_v4 | Invasion associated marker | 0.9675 | 37 | 188 |
GO:0005524
GO:0016887 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar