F496162

General Info

Members Datasets Scaffolds Average Seq Length
1966 673 1791 222

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2558860280|2559429350
Length 267
Sequence KKSSNRAKQGRGRAFSWAGDRQARAGGGTEATRPRVRAVVIARVTSFAVRLVIARCQVDYVGRLTAHLPMANRLLLIKADGSVSVHSDDRAYKPLNWMSPPCWLIEDPGVWTVQNKAGEKLVISVEEVMHDSKHELGIEPGLVKDGVEAHLQVLLAEHVTTLGDGWSLVRREFPTAIGPVDLMCRDHDGVSVAVEIKRRGEIDGVEQLTRYLELLNRDPLLAPVKGVFAAQQIKPQARTLAEDRGIRCVTLDYDALKGTDSDEFRLF

Samples

Sample ID Description Type Environment
1 2527291629 Frankia sp. BMG5.23 Isolate Nodule
2 2546825537 Frankia sp. CcI6 Isolate Rhizoplane
3 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
4 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
5 2558860280 Kutzneria sp. 744 Isolate Unclassified
6 2565956761 Rhodococcus qingshengii BKS 20-40 Isolate Rhizosphere
7 2579778521 Frankia torreyi CpI1-S Isolate Unclassified
8 2582580736 Prauserella sp. Am3 Isolate Unclassified
9 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
10 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
11 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
12 2585427649 Amycolatopsis japonica MG417-CF17, DSM 44213 Isolate Unclassified
13 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
14 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
15 2619618881 Frankia sp. ACN1ag Isolate Unclassified
16 2619619003 Frankia sp. CpI1-P Isolate Nodule
17 2626541554 Frankia sp. AvcI.1 Isolate Nodule
18 2643221548 Streptomyces sp. Root55 Isolate Unclassified
19 2643221576 Nocardioides sp. Root614 Isolate Unclassified
20 2643221578 Streptomyces sp. Root63 Isolate Unclassified
21 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
22 2643221590 Nocardioides sp. Root682 Isolate Unclassified
23 2643221615 Nocardioides sp. Root224 Isolate Unclassified
24 2643221617 Nocardioides sp. Root79 Isolate Unclassified
25 2643221620 Nocardioides sp. Root240 Isolate Unclassified
26 2643221641 Nocardioides sp. Root122 Isolate Unclassified
27 2643221647 Streptomyces sp. Root369 Isolate Unclassified
28 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
29 2643221670 Streptomyces sp. Root431 Isolate Unclassified
30 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
31 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
32 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
33 2643221714 Streptomyces sp. Root264 Isolate Unclassified
34 2643221715 Mycobacterium sp. Root265 Isolate Unclassified
35 2675903060 Nonomuraea wenchangensis CGMCC 4.5598 Isolate Rhizosphere
36 2684623036 Frankia sp. CgIM4 Isolate Nodule
37 2738541274 Mycobacterium sp. YR708 Isolate Unclassified
38 2738541305 Nocardioides sp. CF167 Isolate Unclassified
39 2738543011 Rhodococcus sp. OK611 Isolate Unclassified
40 2738543028 Mycobacterium sp. YR782 Isolate Unclassified
41 2739367898 Nocardioides sp. CF479 Isolate Unclassified
42 2751185725 Microbispora sp. NRRL B-24597 Isolate Unclassified
43 2751185734 Saccharothrix sp. NRRL B-16314 Isolate Rhizosphere
44 2751185792 Kitasatospora arboriphila NRRL B-24581 Isolate Unclassified
45 2767802112 Streptomyces avicenniae NRRL B-24776 Isolate Rhizosphere
46 2773857762 Nocardioides sp. SAI-095 Isolate Unclassified
47 2773857924 Frankia sp. CgIS1 Isolate Nodule
48 2775506925 Saccharopolyspora phatthalungensis NRRL B-24798 Isolate Rhizosphere
49 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
50 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
51 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
52 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
53 2791354901 Actinophytocola xanthii 11-183 Isolate Rhizosphere
54 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
55 2795385470 Labedaea rhizosphaerae DSM 45361 Isolate Rhizosphere
56 2802429296 Streptomyces sampsonii KJ40 Isolate Rhizosphere
57 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
58 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
59 2808606439 Nocardioides sp. SLBN-172 Isolate Unclassified
60 2808606448 Streptomyces sp. 193411 Isolate Unclassified
61 2808606522 Amycolatopsis sp. BJA-103 Isolate Unclassified
62 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
63 2811994874 Nocardioides sp. SLBN-35 Isolate Unclassified
64 2811994878 Nocardioides sp. SLBN-169 Isolate Unclassified
65 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
66 2816332119 Kribbella amoyensis DSM 24683 Isolate Rhizosphere
67 2816332139 Pseudonocardia kunmingensis DSM 45301 Isolate Unclassified
68 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
69 2818991472 Kitasatospora viridis DSM 44826 Isolate Rhizosphere
70 2842134933 Mycolicibacterium obuense SEMIA 442 Isolate Nodule
71 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
72 2855386786 Nocardioides ferulae EGI 63112 Isolate Unclassified
73 2856741275 Microbispora triticiradicis NEAU-HRDPA2-9 Isolate Unclassified
74 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
75 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
76 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
77 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
78 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
79 2862574272 Streptomyces sp. AcE210 Isolate Nodule
80 2862705112 Streptomyces triticirhizae NEAU-YY642 Isolate Rhizosphere
81 2863067949 Saccharopolyspora phatthalungensis DSM 45584 (Annotation) (version 2) Isolate Rhizosphere
82 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
83 2866612099 Amycolatopsis suaedae 8-3EHSu Isolate Unclassified
84 2867346516 Streptomyces radicis AZ1-7 Isolate Unclassified
85 2867369537 Streptomyces sp. Z26 Isolate Unclassified
86 2867428634 Streptomyces sp. RP5T Isolate Unclassified
87 2867475112 Streptomyces sp. TM32 Isolate Unclassified
88 2868088558 Phytoactinopolyspora endophytica EGI 60009 Isolate Unclassified
89 2870721527 Saccharothrix ecbatanensis DSM 45486 Isolate Rhizosphere
90 2870782633 Pseudonocardia eucalypti DSM 45351 Isolate Unclassified
91 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
92 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
93 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
94 2887478801 Catellatospora paridis NEAU-CL2 Isolate Rhizosphere
95 2889300758 Rhodococcus sp. PvR099 Isolate Rhizosphere
96 2891395885 Microbispora catharanthi CR1-09 Isolate Unclassified
97 2891554331 Microbispora sp. CL1-1 Isolate Unclassified
98 2891562705 Microbispora tritici MT50 Isolate Unclassified
99 2891968417 Nocardioides luteus SAI-037 Isolate Unclassified
100 2895427314 Nonomuraea sp. PA05 Isolate Unclassified
101 2899359706 Amycolatopsis anabasis EGI 650086 Isolate Unclassified
102 2899370129 Amycolatopsis alkalitolerans SYSUP0005 Isolate Stem Tuber
103 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
104 2904535858 Rhodococcus erythropolis 2017 Isolate Unclassified
105 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
106 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
107 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
108 2915358134 Pseudonocardia pini CAP47R Isolate Unclassified
109 2915768154 Amycolatopsis pittospori PIP199 Isolate Unclassified
110 2917736166 Amycolatopsis dendrobii DR6-1 Isolate Unclassified
111 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
112 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
113 2919713450 Nocardia kruczakiae 4272 Isolate Rhizosphere
114 2922554459 Rhodococcus sp. 66b Isolate Unclassified
115 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified
116 2932398195 Dietzia sp. 2505 Isolate Rhizosphere
117 2935390628 Streptomyces sp. PvR034 Isolate Rhizosphere
118 2939743619 Rhodococcus sp. PvR044 Isolate Rhizosphere
119 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
120 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
121 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
122 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
123 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
124 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
125 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
126 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
127 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
128 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
129 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
130 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
131 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
132 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
133 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
134 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
135 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
136 2984576629 Nocardioides zeae SORGH_AS913 Isolate Aerial Root
137 2990044586 Streptomyces sedi JCM 16909 Isolate Unclassified
138 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
139 2990088156 Streptomyces albidus CAP 215 Isolate Unclassified
140 2990256926 Nocardioides zeae SORGH_AS885 Isolate Aerial Root
141 2995463766 Streptacidiphilus fuscans NEAU-YB345 Isolate Unclassified
142 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
143 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
144 3006321560 Actinacidiphila epipremni PRB2-1 Isolate Unclassified
145 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
146 3006425503 Streptomyces zingiberis PLAI1-29 Isolate Unclassified
147 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
148 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
149 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
150 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
151 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
152 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
153 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
154 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
155 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
156 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
157 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
158 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
159 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
160 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
161 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
162 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
163 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
164 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
165 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
166 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
167 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
168 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
169 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
170 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
171 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
172 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
173 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
174 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
175 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
176 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
177 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
178 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
179 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
180 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
181 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
182 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
183 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
184 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
185 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
186 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
187 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
188 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
189 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
190 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
191 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
192 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
193 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
194 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
195 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
196 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
197 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
198 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
199 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
200 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
201 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
202 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
203 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
204 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
205 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
206 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
207 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
208 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
209 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
210 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
211 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
212 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
213 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
214 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
215 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
216 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
217 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
218 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
219 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
220 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
221 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
222 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
223 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
224 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
225 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
226 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
227 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
228 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
229 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
230 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
231 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
232 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
233 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
234 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
235 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
236 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
237 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
238 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
239 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
240 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
241 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
242 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
243 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
244 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
245 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
246 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
247 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
248 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
249 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
250 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
251 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
252 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
253 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
254 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
255 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
256 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
257 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
258 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
259 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
260 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
261 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
262 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
263 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
264 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
265 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
266 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
267 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
268 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
269 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
270 3300012505 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 Metagenome Rhizosphere
271 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
272 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
273 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
274 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
275 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
276 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
277 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
278 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
279 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
280 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
281 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
282 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
283 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
284 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
285 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
286 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
287 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
288 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
289 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
290 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
291 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
292 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
293 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
294 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
295 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
296 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
297 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
298 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
299 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
300 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
301 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
302 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
303 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
304 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
305 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
306 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
307 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
308 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
309 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
310 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
311 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
312 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
313 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
314 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
315 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
316 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
317 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
318 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
319 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
320 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
321 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
322 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
323 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
324 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
325 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
326 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
327 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
328 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
329 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
330 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
331 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
332 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
333 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
334 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
335 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
336 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
337 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
338 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
339 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
340 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
341 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
342 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
343 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
344 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
345 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
346 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
347 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
348 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
349 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
350 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
351 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
352 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
353 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
354 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
355 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
356 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
357 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
358 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
359 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
360 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
361 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
362 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
363 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
364 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
365 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
366 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
367 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
368 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
369 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
370 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
371 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
372 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
373 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
374 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
375 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
376 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
377 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
378 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
379 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
380 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
381 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
382 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
383 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
384 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
385 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
386 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
387 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
388 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
389 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
390 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
391 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
392 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
393 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
394 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
395 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
396 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
397 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
398 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
399 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
400 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
401 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
402 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
403 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
404 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
405 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
406 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
407 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
408 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
409 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
410 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
411 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
412 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
413 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
414 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
415 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
416 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
417 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
418 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
419 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
420 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
421 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
422 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
423 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
424 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
425 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
426 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
427 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
428 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
429 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
430 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
431 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
432 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
433 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
434 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
435 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
436 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
437 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
438 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
439 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
440 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
441 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
442 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
443 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
444 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
445 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
446 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
447 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
448 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
449 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
450 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
451 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
452 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
453 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
454 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
455 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
456 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
457 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
458 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
459 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
460 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
461 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
462 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
463 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
464 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
465 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
466 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
467 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
468 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
469 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
470 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
471 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
472 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
473 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
474 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
475 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
476 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
477 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
478 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
479 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
480 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
481 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
482 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
483 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
484 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
485 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
486 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
487 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
488 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
489 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
490 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
491 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
492 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
493 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
494 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
495 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
496 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
497 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
498 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
499 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
500 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
501 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
502 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
503 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
504 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
505 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
506 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
507 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
508 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
509 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
510 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
511 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
512 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
513 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
514 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
515 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
516 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
517 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
518 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
519 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
520 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
521 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
522 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
523 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
524 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
525 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
526 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
527 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
528 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
529 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
530 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
531 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
532 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
533 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
534 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
535 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
536 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
537 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
538 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
539 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
540 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
541 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
542 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
543 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
544 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
545 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
546 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
547 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
548 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
549 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
550 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
551 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
552 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
553 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
554 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
555 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
556 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
557 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
558 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
559 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
560 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
561 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
562 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
563 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
564 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
565 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
566 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
567 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
568 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
569 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
570 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
571 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
572 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
573 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
574 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
575 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
576 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
577 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
578 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
579 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
580 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
581 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
582 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
583 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
584 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
585 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
586 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
587 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
588 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
589 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
590 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
591 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
592 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
593 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
594 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
595 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
596 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
597 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
598 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
599 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
600 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
601 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
602 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
603 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
604 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
605 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
606 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
607 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
608 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
609 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
610 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
611 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
612 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
613 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
614 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
615 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
616 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
617 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
618 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
619 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
620 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
621 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
622 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
623 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
624 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
625 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
626 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
627 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
628 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
629 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
630 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
631 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
632 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
633 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
634 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
635 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
636 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
637 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
638 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
639 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
640 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
641 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
642 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
643 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
644 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
645 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
646 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
647 637000116 Frankia casuarinae CcI3 Isolate Nodule
648 8003314358 Amycolatopsis sp. MtRt-6 Isolate Unclassified
649 8008485437 Streptomyces mimosae 3MP-10 Isolate Unclassified
650 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
651 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
652 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
653 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere
654 8025524527 Streptomyces sp. 3MP-14 Isolate Unclassified
655 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
656 8033684223 Streptomyces phytophilus PIP175 Isolate Unclassified
657 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
658 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
659 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
660 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
661 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
662 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
663 8053945823 Actinomadura terrae OS3-83 Isolate Rhizosphere
664 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere
665 8054609563 Nocardioides astragali CGMCC 4.7327 Isolate Nodule
666 8054913762 Frankia gtarii Agncl-10 Isolate Nodule
667 8054920844 Frankia tisae Agncl-8 Isolate Nodule
668 8055157932 Frankia umida Ag45/Mut15 Isolate Nodule
669 8056207758 Saccharopolyspora indica KCTC 29208 Isolate Rhizosphere
670 8056447290 Streptomyces huiliensis SCA2-4 Isolate Rhizosphere
671 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere
672 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere
673 8057568493 Actinorhabdospora filicis NBRC 111898 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 90.9
Metatranscriptomes 0.2
Isolates 8.9

Biome Distribution

Category Percentage (%)
Aerial Root 0.1
Bulb 0
Endosphere 5.44
Nodule 0.71
Rhizoplane 6.31
Rhizosphere 78.48
Stem 0
Stem Tuber 0.05
Unclassified 8.9

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJNas_1002234 3300000546 Bacteria 2401
2 JGI24739J22299_10018981 3300001989 Bacteria 2466
3 JGI24739J22299_10038054 3300001989 Bacteria 1618
4 JGI24743J22301_10024147 3300001991 Bacteria 1173
5 JGI24735J21928_10027825 3300002067 Bacteria 1692
6 JGI24745J21846_1007568 3300002073 Bacteria 1217
7 JGI24744J21845_10000482 3300002077 Bacteria 7071
8 JGI24744J21845_10029918 3300002077 Bacteria 1045
9 JGI24742J22300_10018246 3300002244 Bacteria 1189
10 JGI24751J29686_10001221 3300002459 Bacteria 5439
11 JGI25406J46586_10001005 3300003203 Bacteria 13222
12 rootH2_10046720 3300003320 Bacteria 4257
13 Ga0006562J51391_1049494 3300003578 Bacteria 2259
14 Ga0070658_10129507 3300005327 Bacteria 2102
15 Ga0070658_10348255 3300005327 Bacteria 1268
16 Ga0070658_10522255 3300005327 Bacteria 1026
17 Ga0070676_10041661 3300005328 Bacteria 2663
18 Ga0070683_100021585 3300005329 Bacteria 5747
19 Ga0070683_100052263 3300005329 Bacteria 3785
20 Ga0070683_100088071 3300005329 Bacteria 2912
21 Ga0070683_100233237 3300005329 Bacteria 1750
22 Ga0070683_100246068 3300005329 Bacteria 1701
23 Ga0070683_100575967 3300005329 Bacteria 1077
24 Ga0070690_100040683 3300005330 Bacteria 2941
25 Ga0070670_100187030 3300005331 Bacteria 1798
26 Ga0068869_100018867 3300005334 Bacteria 4702
27 Ga0068869_100212345 3300005334 Bacteria 1530
28 Ga0068869_100217591 3300005334 Bacteria 1512
29 Ga0068869_100330475 3300005334 Bacteria 1238
30 Ga0070666_10126500 3300005335 Bacteria 1774
31 Ga0070680_100039721 3300005336 Bacteria 3807
32 Ga0070680_100413841 3300005336 Bacteria 1150
33 Ga0070682_100038312 3300005337 Bacteria 2940
34 Ga0070682_100212268 3300005337 Bacteria 1372
35 Ga0070682_100222035 3300005337 Bacteria 1345
36 Ga0068868_100049822 3300005338 Bacteria 3287
37 Ga0068868_100182456 3300005338 Bacteria 1742
38 Ga0068868_100185491 3300005338 Bacteria 1728
39 Ga0068868_100316050 3300005338 Bacteria 1329
40 Ga0068868_100548048 3300005338 Bacteria 1019
41 Ga0070660_100064174 3300005339 Bacteria 2857
42 Ga0070660_100222588 3300005339 Bacteria 1534
43 Ga0070660_100324261 3300005339 Bacteria 1266
44 Ga0070691_10017872 3300005341 Bacteria 3263
45 Ga0070687_100201635 3300005343 Bacteria 1206
46 Ga0070687_100447300 3300005343 Bacteria 858
47 Ga0070692_10098436 3300005345 Bacteria 1600
48 Ga0070668_100017367 3300005347 Bacteria 5389
49 Ga0070668_100028430 3300005347 Bacteria 4245
50 Ga0070668_100047790 3300005347 Bacteria 3290
51 Ga0070668_100158257 3300005347 Bacteria 1836
52 Ga0070671_100027267 3300005355 Bacteria 4700
53 Ga0070671_100096836 3300005355 Bacteria 2474
54 Ga0070671_100130223 3300005355 Bacteria 2119
55 Ga0070671_100139122 3300005355 Bacteria 2048
56 Ga0070671_100180354 3300005355 Bacteria 1788
57 Ga0070674_100012179 3300005356 Bacteria 5275
58 Ga0070674_100258471 3300005356 Bacteria 1371
59 Ga0070673_100026683 3300005364 Bacteria 4270
60 Ga0070673_100155281 3300005364 Bacteria 1942
61 Ga0070688_100046284 3300005365 Bacteria 2693
62 Ga0070688_100110943 3300005365 Bacteria 1824
63 Ga0070688_100134045 3300005365 Bacteria 1675
64 Ga0070688_100415575 3300005365 Bacteria 999
65 Ga0070688_100509515 3300005365 Bacteria 909
66 Ga0070659_100009674 3300005366 Bacteria 7084
67 Ga0070659_100061405 3300005366 Bacteria 2970
68 Ga0070659_100125348 3300005366 Bacteria 2083
69 Ga0070667_100008049 3300005367 Bacteria 8745
70 Ga0070667_100008326 3300005367 Bacteria 8592
71 Ga0070667_100134337 3300005367 Bacteria 2162
72 Ga0070667_100287857 3300005367 Bacteria 1477
73 Ga0070667_100930914 3300005367 Bacteria 809
74 Ga0070709_10002886 3300005434 Bacteria 9266
75 Ga0070709_10028129 3300005434 Bacteria 3350
76 Ga0070709_10053484 3300005434 Bacteria 2542
77 Ga0070709_10164011 3300005434 Bacteria 1547
78 Ga0070714_100000106 3300005435 Bacteria 70067
79 Ga0070714_100016786 3300005435 Bacteria 5920
80 Ga0070714_100036126 3300005435 Bacteria 4143
81 Ga0070714_100039063 3300005435 Bacteria 3994
82 Ga0070714_100041771 3300005435 Bacteria 3872
83 Ga0070714_100078646 3300005435 Bacteria 2867
84 Ga0070714_100120047 3300005435 Bacteria 2338
85 Ga0070714_100139965 3300005435 Bacteria 2171
86 Ga0070714_100209099 3300005435 Bacteria 1788
87 Ga0070714_100721699 3300005435 Bacteria 962
88 Ga0070713_100000462 3300005436 Bacteria 25910
89 Ga0070713_100019461 3300005436 Bacteria 5184
90 Ga0070713_100078525 3300005436 Bacteria 2810
91 Ga0070713_100505353 3300005436 Bacteria 1141
92 Ga0070713_100812901 3300005436 Bacteria 896
93 Ga0070710_10000075 3300005437 Bacteria 44924
94 Ga0070710_10002567 3300005437 Bacteria 8621
95 Ga0070710_10032805 3300005437 Bacteria 2815
96 Ga0070710_10068259 3300005437 Bacteria 2042
97 Ga0070710_10069508 3300005437 Bacteria 2026
98 Ga0070701_10029223 3300005438 Bacteria 2716
99 Ga0070711_100000491 3300005439 Bacteria 20613
100 Ga0070711_100014320 3300005439 Bacteria 4996
101 Ga0070711_100130493 3300005439 Bacteria 1871
102 Ga0070711_100168711 3300005439 Bacteria 1666
103 Ga0070700_100003448 3300005441 Bacteria 8158
104 Ga0070700_100040434 3300005441 Bacteria 2854
105 Ga0070700_100151491 3300005441 Bacteria 1586
106 Ga0070708_100387523 3300005445 Bacteria 1318
107 Ga0070708_100452070 3300005445 Bacteria 1212
108 Ga0070663_100067966 3300005455 Bacteria 2586
109 Ga0070663_100158763 3300005455 Bacteria 1739
110 Ga0070663_100309770 3300005455 Bacteria 1266
111 Ga0070678_100009238 3300005456 Bacteria 5959
112 Ga0070678_100214016 3300005456 Bacteria 1598
113 Ga0070678_100406661 3300005456 Bacteria 1184
114 Ga0070662_100008744 3300005457 Bacteria 6604
115 Ga0070662_100350449 3300005457 Bacteria 1209
116 Ga0068867_100001230 3300005459 Bacteria 17630
117 Ga0068867_100138119 3300005459 Bacteria 1902
118 Ga0070685_10017354 3300005466 Bacteria 3851
119 Ga0070685_10260096 3300005466 Bacteria 1154
120 Ga0070706_100002590 3300005467 Bacteria 18142
121 Ga0070706_100005146 3300005467 Bacteria 12481
122 Ga0070706_100056749 3300005467 Bacteria 3613
123 Ga0070706_100227252 3300005467 Bacteria 1742
124 Ga0070706_100255250 3300005467 Bacteria 1637
125 Ga0070706_100486973 3300005467 Bacteria 1147
126 Ga0070706_100555550 3300005467 Bacteria 1068
127 Ga0070707_100006772 3300005468 Bacteria 10612
128 Ga0070707_100048333 3300005468 Bacteria 4076
129 Ga0070707_100087775 3300005468 Bacteria 3008
130 Ga0070707_100155691 3300005468 Bacteria 2226
131 Ga0070707_100204945 3300005468 Bacteria 1922
132 Ga0070707_100329862 3300005468 Bacteria 1483
133 Ga0070698_100001131 3300005471 Bacteria 29508
134 Ga0070698_100005631 3300005471 Bacteria 13706
135 Ga0070698_100025292 3300005471 Bacteria 6187
136 Ga0070698_100031377 3300005471 Bacteria 5510
137 Ga0070698_100224422 3300005471 Bacteria 1812
138 Ga0070698_100382253 3300005471 Bacteria 1340
139 Ga0070698_100549937 3300005471 Bacteria 1094
140 Ga0070699_100007971 3300005518 Bacteria 9197
141 Ga0070699_100336278 3300005518 Bacteria 1359
142 Ga0070679_100034271 3300005530 Bacteria 5031
143 Ga0070684_100000737 3300005535 Bacteria 22677
144 Ga0070684_100092266 3300005535 Bacteria 2694
145 Ga0070684_100419718 3300005535 Bacteria 1235
146 Ga0070697_100027312 3300005536 Bacteria 4566
147 Ga0070697_100093276 3300005536 Bacteria 2493
148 Ga0068853_100006449 3300005539 Bacteria 9327
149 Ga0068853_100047259 3300005539 Bacteria 3693
150 Ga0070672_100104658 3300005543 Bacteria 2299
151 Ga0070672_100252091 3300005543 Bacteria 1487
152 Ga0070672_100439267 3300005543 Bacteria 1123
153 Ga0070686_100145225 3300005544 Bacteria 1656
154 Ga0070686_100668053 3300005544 Bacteria 825
155 Ga0070695_100009168 3300005545 Bacteria 5884
156 Ga0070695_100227182 3300005545 Bacteria 1347
157 Ga0070695_100440489 3300005545 Bacteria 996
158 Ga0070696_100190938 3300005546 Bacteria 1524
159 Ga0070696_100331083 3300005546 Bacteria 1174
160 Ga0070693_100055738 3300005547 Bacteria 2278
161 Ga0070665_100000952 3300005548 Bacteria 36928
162 Ga0070665_100014993 3300005548 Bacteria 7779
163 Ga0070665_100092799 3300005548 Bacteria 3024
164 Ga0070665_100106886 3300005548 Bacteria 2800
165 Ga0070665_100179347 3300005548 Bacteria 2119
166 Ga0070665_100202051 3300005548 Bacteria 1988
167 Ga0070665_100251600 3300005548 Bacteria 1768
168 Ga0070665_100378423 3300005548 Bacteria 1423
169 Ga0070665_100461286 3300005548 Bacteria 1281
170 Ga0070665_100467993 3300005548 Bacteria 1271
171 Ga0070704_100114820 3300005549 Bacteria 2056
172 Ga0070704_100175610 3300005549 Bacteria 1708
173 Ga0070704_100404378 3300005549 Bacteria 1166
174 Ga0068855_100013371 3300005563 Bacteria 9899
175 Ga0068855_100030073 3300005563 Bacteria 6495
176 Ga0068855_100108712 3300005563 Bacteria 3185
177 Ga0068855_100227597 3300005563 Bacteria 2089
178 Ga0068855_100245461 3300005563 Bacteria 1999
179 Ga0068855_100263826 3300005563 Bacteria 1918
180 Ga0068855_100520288 3300005563 Bacteria 1291
181 Ga0068855_100741932 3300005563 Bacteria 1048
182 Ga0070664_100548792 3300005564 Bacteria 1068
183 Ga0068854_100017680 3300005578 Bacteria 4775
184 Ga0068854_100066956 3300005578 Bacteria 2615
185 Ga0068854_100538218 3300005578 Bacteria 989
186 Ga0068856_100029385 3300005614 Bacteria 5369
187 Ga0068856_100073865 3300005614 Bacteria 3376
188 Ga0068856_100108589 3300005614 Bacteria 2771
189 Ga0068856_100312675 3300005614 Bacteria 1588
190 Ga0070702_100002552 3300005615 Bacteria 7914
191 Ga0070702_100003974 3300005615 Bacteria 6707
192 Ga0070702_100036590 3300005615 Bacteria 2720
193 Ga0070702_100148510 3300005615 Bacteria 1502
194 Ga0068852_100088806 3300005616 Bacteria 2761
195 Ga0068852_100166246 3300005616 Bacteria 2064
196 Ga0068859_100019447 3300005617 Bacteria 6822
197 Ga0068859_100074156 3300005617 Bacteria 3441
198 Ga0068859_100299831 3300005617 Bacteria 1700
199 Ga0068864_100074462 3300005618 Bacteria 2963
200 Ga0068864_100079088 3300005618 Bacteria 2879
201 Ga0068864_100126877 3300005618 Bacteria 2287
202 Ga0068864_100804846 3300005618 Bacteria 924
203 Ga0068866_10070058 3300005718 Bacteria 1849
204 Ga0068866_10078301 3300005718 Bacteria 1768
205 Ga0068866_10088642 3300005718 Bacteria 1679
206 Ga0068861_100022214 3300005719 Bacteria 4568
207 Ga0068861_100084159 3300005719 Bacteria 2497
208 Ga0068861_100167201 3300005719 Bacteria 1819
209 Ga0068861_100189935 3300005719 Bacteria 1716
210 Ga0068861_100288222 3300005719 Bacteria 1417
211 Ga0068851_10165638 3300005834 Bacteria 1217
212 Ga0068870_10003234 3300005840 Bacteria 6877
213 Ga0068870_10135820 3300005840 Bacteria 1434
214 Ga0068863_100002439 3300005841 Bacteria 18463
215 Ga0068863_100022717 3300005841 Bacteria 5991
216 Ga0068863_100107283 3300005841 Bacteria 2657
217 Ga0068863_100189796 3300005841 Bacteria 1974
218 Ga0068858_100000032 3300005842 Bacteria 142794
219 Ga0068858_100090693 3300005842 Bacteria 2844
220 Ga0068858_100151031 3300005842 Bacteria 2184
221 Ga0068858_100232607 3300005842 Bacteria 1747
222 Ga0068858_100393566 3300005842 Bacteria 1331
223 Ga0068860_100000134 3300005843 Bacteria 120350
224 Ga0068860_100029872 3300005843 Bacteria 5243
225 Ga0068860_100036494 3300005843 Bacteria 4709
226 Ga0068860_100088242 3300005843 Bacteria 2952
227 Ga0068860_100096186 3300005843 Bacteria 2823
228 Ga0068860_100189175 3300005843 Bacteria 1992
229 Ga0068862_100020623 3300005844 Bacteria 5506
230 Ga0068862_100296054 3300005844 Bacteria 1487
231 Ga0068862_100540085 3300005844 Bacteria 1112
232 Ga0081455_10000070 3300005937 Bacteria 110926
233 Ga0081455_10000782 3300005937 Bacteria 40906
234 Ga0081455_10005937 3300005937 Bacteria 13256
235 Ga0081455_10029466 3300005937 Bacteria 5004
236 Ga0081455_10074548 3300005937 Bacteria 2802
237 Ga0081538_10000001 3300005981 Bacteria 249890
238 Ga0081538_10001676 3300005981 Bacteria 22565
239 Ga0081540_1000250 3300005983 Bacteria 56639
240 Ga0081540_1013422 3300005983 Bacteria 5322
241 Ga0081539_10000128 3300005985 Bacteria 179041
242 Ga0081539_10007650 3300005985 Bacteria 9731
243 Ga0070717_10000595 3300006028 Bacteria 23178
244 Ga0070717_10001224 3300006028 Bacteria 17449
245 Ga0070717_10048061 3300006028 Bacteria 3499
246 Ga0070717_10254202 3300006028 Bacteria 1553
247 Ga0070717_10376712 3300006028 Bacteria 1272
248 Ga0075365_10019569 3300006038 Bacteria 4181
249 Ga0075365_10024218 3300006038 Bacteria 3825
250 Ga0075365_10025950 3300006038 Bacteria 3714
251 Ga0075365_10027908 3300006038 Bacteria 3595
252 Ga0075365_10046145 3300006038 Bacteria 2861
253 Ga0075365_10654456 3300006038 Bacteria 743
254 Ga0075368_10012732 3300006042 Bacteria 3081
255 Ga0075368_10027373 3300006042 Bacteria 2199
256 Ga0075368_10093341 3300006042 Bacteria 1232
257 Ga0075363_100002601 3300006048 Bacteria 7434
258 Ga0075363_100002888 3300006048 Bacteria 7156
259 Ga0075363_100013133 3300006048 Bacteria 4005
260 Ga0075363_100024321 3300006048 Bacteria 3078
261 Ga0075363_100035938 3300006048 Bacteria 2596
262 Ga0075363_100042509 3300006048 Bacteria 2402
263 Ga0075363_100058264 3300006048 Bacteria 2075
264 Ga0075363_100075240 3300006048 Bacteria 1840
265 Ga0075363_100272464 3300006048 Bacteria 978
266 Ga0075364_10027184 3300006051 Bacteria 3653
267 Ga0075364_10040348 3300006051 Bacteria 3027
268 Ga0075364_10042036 3300006051 Bacteria 2969
269 Ga0075364_10043165 3300006051 Bacteria 2931
270 Ga0075364_10064987 3300006051 Bacteria 2395
271 Ga0075364_10566140 3300006051 Bacteria 777
272 Ga0070715_10055539 3300006163 Bacteria 1719
273 Ga0070715_10070388 3300006163 Bacteria 1561
274 Ga0070715_10359202 3300006163 Bacteria 798
275 Ga0070716_100002234 3300006173 Bacteria 8922
276 Ga0070716_100003420 3300006173 Bacteria 7464
277 Ga0070716_100011459 3300006173 Bacteria 4465
278 Ga0070716_100021084 3300006173 Bacteria 3429
279 Ga0070716_100038292 3300006173 Bacteria 2655
280 Ga0070716_100048735 3300006173 Bacteria 2396
281 Ga0070716_100074098 3300006173 Bacteria 2010
282 Ga0070712_100000461 3300006175 Bacteria 23352
283 Ga0070712_100007315 3300006175 Bacteria 6891
284 Ga0070712_100009935 3300006175 Bacteria 5999
285 Ga0070712_100125009 3300006175 Bacteria 1941
286 Ga0070712_100143627 3300006175 Bacteria 1824
287 Ga0075362_10113800 3300006177 Bacteria 1276
288 Ga0075367_10011939 3300006178 Bacteria 4615
289 Ga0075367_10028198 3300006178 Bacteria 3201
290 Ga0075367_10130382 3300006178 Bacteria 1554
291 Ga0075367_10187614 3300006178 Bacteria 1290
292 Ga0075367_10298907 3300006178 Bacteria 1013
293 Ga0075367_10523282 3300006178 Bacteria 753
294 Ga0075369_10001333 3300006186 Bacteria 8393
295 Ga0075369_10010428 3300006186 Bacteria 3634
296 Ga0075369_10025295 3300006186 Bacteria 2466
297 Ga0075369_10074907 3300006186 Bacteria 1494
298 Ga0075369_10077748 3300006186 Bacteria 1468
299 Ga0075369_10117158 3300006186 Bacteria 1204
300 Ga0075366_10097429 3300006195 Bacteria 1764
301 Ga0097621_100133318 3300006237 Bacteria 2116
302 Ga0075370_10003021 3300006353 Bacteria 7929
303 Ga0075370_10080071 3300006353 Bacteria 1877
304 Ga0075370_10099536 3300006353 Bacteria 1682
305 Ga0075370_10102539 3300006353 Bacteria 1657
306 Ga0075370_10123420 3300006353 Bacteria 1508
307 Ga0075370_10142330 3300006353 Bacteria 1402
308 Ga0075370_10336319 3300006353 Bacteria 901
309 Ga0068871_100130721 3300006358 Bacteria 2129
310 Ga0075428_100004401 3300006844 Bacteria 15552
311 Ga0075430_100033633 3300006846 Bacteria 4351
312 Ga0075430_100357475 3300006846 Bacteria 1206
313 Ga0075430_100480730 3300006846 Bacteria 1025
314 Ga0075431_100051511 3300006847 Bacteria 4245
315 Ga0075433_10046325 3300006852 Bacteria 3782
316 Ga0075434_100049869 3300006871 Bacteria 4157
317 Ga0075434_100277486 3300006871 Bacteria 1695
318 Ga0068865_100047173 3300006881 Bacteria 2959
319 Ga0068865_100157416 3300006881 Bacteria 1729
320 Ga0068865_100174082 3300006881 Bacteria 1652
321 Ga0068865_100893790 3300006881 Bacteria 772
322 Ga0075436_100085266 3300006914 Bacteria 2193
323 Ga0075436_100169258 3300006914 Bacteria 1542
324 Ga0075436_100206175 3300006914 Bacteria 1393
325 Ga0097620_100019448 3300006931 Bacteria 6822
326 Ga0097620_100074155 3300006931 Bacteria 3441
327 Ga0097620_100299819 3300006931 Bacteria 1700
328 Ga0075435_100075904 3300007076 Bacteria 2753
329 Ga0075435_100282303 3300007076 Bacteria 1418
330 Ga0075435_100385127 3300007076 Bacteria 1205
331 Ga0105251_10011572 3300009011 Bacteria 5034
332 Ga0105250_10072137 3300009092 Bacteria 1395
333 Ga0105250_10194455 3300009092 Bacteria 854
334 Ga0105240_10028626 3300009093 Bacteria 7273
335 Ga0105240_10266883 3300009093 Bacteria 1972
336 Ga0105240_10536743 3300009093 Bacteria 1296
337 Ga0111539_10681346 3300009094 Bacteria 1197
338 Ga0111539_11303293 3300009094 Bacteria 843
339 Ga0105245_10002311 3300009098 Bacteria 17257
340 Ga0105245_10068501 3300009098 Bacteria 3216
341 Ga0105245_10104748 3300009098 Bacteria 2623
342 Ga0105245_10120323 3300009098 Bacteria 2452
343 Ga0105245_10263866 3300009098 Bacteria 1677
344 Ga0105245_10369567 3300009098 Bacteria 1425
345 Ga0105245_10670643 3300009098 Bacteria 1068
346 Ga0105247_10008465 3300009101 Bacteria 6265
347 Ga0105247_10175098 3300009101 Bacteria 1429
348 Ga0114129_10323469 3300009147 Bacteria 2050
349 Ga0114129_10664836 3300009147 Bacteria 1343
350 Ga0105243_10019834 3300009148 Bacteria 5099
351 Ga0105243_10020757 3300009148 Bacteria 4984
352 Ga0105243_10112015 3300009148 Bacteria 2285
353 Ga0105243_10178280 3300009148 Bacteria 1846
354 Ga0105243_10411839 3300009148 Bacteria 1258
355 Ga0105243_10414652 3300009148 Bacteria 1254
356 Ga0105243_10736677 3300009148 Bacteria 965
357 Ga0105243_10759292 3300009148 Bacteria 951
358 Ga0105243_11012205 3300009148 Bacteria 834
359 Ga0105241_10004696 3300009174 Bacteria 10088
360 Ga0105241_10332511 3300009174 Bacteria 1314
361 Ga0105242_10002671 3300009176 Bacteria 13978
362 Ga0105242_10021206 3300009176 Bacteria 5099
363 Ga0105242_10061302 3300009176 Bacteria 3094
364 Ga0105242_10067924 3300009176 Bacteria 2948
365 Ga0105242_10105388 3300009176 Bacteria 2395
366 Ga0105242_10678424 3300009176 Bacteria 1005
367 Ga0105248_10000152 3300009177 Bacteria 80685
368 Ga0105248_10000603 3300009177 Bacteria 40905
369 Ga0105248_10037787 3300009177 Bacteria 5403
370 Ga0105248_10140365 3300009177 Bacteria 2726
371 Ga0105248_10159115 3300009177 Bacteria 2548
372 Ga0105248_10597936 3300009177 Bacteria 1245
373 Ga0105248_10637548 3300009177 Bacteria 1202
374 Ga0105237_10001807 3300009545 Bacteria 27611
375 Ga0105237_10636820 3300009545 Bacteria 1073
376 Ga0105238_10015709 3300009551 Bacteria 7664
377 Ga0105238_10071115 3300009551 Bacteria 3476
378 Ga0105238_10154229 3300009551 Bacteria 2271
379 Ga0105238_10181560 3300009551 Bacteria 2081
380 Ga0105238_10299146 3300009551 Bacteria 1592
381 Ga0105238_10500231 3300009551 Bacteria 1216
382 Ga0105238_10740519 3300009551 Bacteria 996
383 Ga0105249_10002470 3300009553 Bacteria 16018
384 Ga0105249_10056827 3300009553 Bacteria 3583
385 Ga0105249_10117111 3300009553 Bacteria 2526
386 Ga0105249_10134670 3300009553 Bacteria 2363
387 Ga0105249_10229717 3300009553 Bacteria 1829
388 Ga0105249_10776347 3300009553 Bacteria 1021
389 Ga0105249_11299314 3300009553 Bacteria 799
390 Ga0105249_11687553 3300009553 Bacteria 706
391 Ga0099796_10042679 3300010159 Bacteria 1542
392 Ga0105239_10003912 3300010375 Bacteria 18046
393 Ga0105239_10004470 3300010375 Bacteria 16713
394 Ga0105239_10054240 3300010375 Bacteria 4396
395 Ga0105239_10064325 3300010375 Bacteria 4027
396 Ga0105239_10161014 3300010375 Bacteria 2507
397 Ga0105239_10217555 3300010375 Bacteria 2142
398 Ga0105239_10385628 3300010375 Bacteria 1584
399 Ga0105239_11101258 3300010375 Bacteria 914
400 Ga0105246_10009301 3300011119 Bacteria 6051
401 Ga0105246_10452018 3300011119 Bacteria 1080
402 Ga0157339_1002414 3300012505 Bacteria 1260
403 Ga0157373_10240362 3300013100 Bacteria 1280
404 Ga0157369_10000755 3300013105 Bacteria 41695
405 Ga0157369_10025697 3300013105 Bacteria 6534
406 Ga0157369_10058042 3300013105 Bacteria 4175
407 Ga0157369_10288824 3300013105 Bacteria 1707
408 Ga0157369_10291991 3300013105 Bacteria 1697
409 Ga0157369_10410938 3300013105 Bacteria 1404
410 Ga0157369_10608606 3300013105 Bacteria 1128
411 Ga0157369_10750792 3300013105 Bacteria 1004
412 Ga0157369_10970809 3300013105 Bacteria 870
413 Ga0157374_10027664 3300013296 Bacteria 5119
414 Ga0157374_10162738 3300013296 Bacteria 2174
415 Ga0157374_10922230 3300013296 Bacteria 891
416 Ga0157378_10030818 3300013297 Bacteria 4735
417 Ga0157378_10187282 3300013297 Bacteria 1950
418 Ga0157378_10379793 3300013297 Bacteria 1387
419 Ga0163162_10029622 3300013306 Bacteria 5418
420 Ga0163162_10032889 3300013306 Bacteria 5151
421 Ga0163162_10041572 3300013306 Bacteria 4601
422 Ga0163162_10045256 3300013306 Bacteria 4410
423 Ga0163162_10388714 3300013306 Bacteria 1528
424 Ga0163162_10425805 3300013306 Bacteria 1459
425 Ga0163162_10478723 3300013306 Bacteria 1376
426 Ga0163162_10997425 3300013306 Bacteria 947
427 Ga0157372_10000057 3300013307 Bacteria 125915
428 Ga0157372_10024009 3300013307 Bacteria 6615
429 Ga0157372_10122114 3300013307 Bacteria 2993
430 Ga0157372_10167253 3300013307 Bacteria 2543
431 Ga0157372_10367583 3300013307 Bacteria 1676
432 Ga0157372_10556438 3300013307 Bacteria 1337
433 Ga0157372_10636783 3300013307 Bacteria 1242
434 Ga0157375_10002207 3300013308 Bacteria 16833
435 Ga0157375_10008324 3300013308 Bacteria 9083
436 Ga0157375_10100182 3300013308 Bacteria 2977
437 Ga0157375_10112130 3300013308 Bacteria 2827
438 Ga0157375_10138638 3300013308 Bacteria 2558
439 Ga0157375_10956041 3300013308 Bacteria 998
440 Ga0163163_10007532 3300014325 Bacteria 9611
441 Ga0163163_10012638 3300014325 Bacteria 7696
442 Ga0163163_10018689 3300014325 Bacteria 6494
443 Ga0163163_10018827 3300014325 Bacteria 6475
444 Ga0163163_10031953 3300014325 Bacteria 5083
445 Ga0163163_10049428 3300014325 Bacteria 4139
446 Ga0163163_10059570 3300014325 Bacteria 3778
447 Ga0163163_10297703 3300014325 Bacteria 1666
448 Ga0163163_10385466 3300014325 Bacteria 1459
449 Ga0163163_10673735 3300014325 Bacteria 1098
450 Ga0157380_10005890 3300014326 Bacteria 8576
451 Ga0157380_10084699 3300014326 Bacteria 2600
452 Ga0182008_10003296 3300014497 Bacteria 9827
453 Ga0182008_10017597 3300014497 Bacteria 3706
454 Ga0157377_10013698 3300014745 Bacteria 4110
455 Ga0157377_10033626 3300014745 Bacteria 2800
456 Ga0157379_10000139 3300014968 Bacteria 51968
457 Ga0157379_10047722 3300014968 Bacteria 3821
458 Ga0157379_10063345 3300014968 Bacteria 3306
459 Ga0157379_10222864 3300014968 Bacteria 1709
460 Ga0157379_10225656 3300014968 Bacteria 1698
461 Ga0157379_10340370 3300014968 Bacteria 1372
462 Ga0157379_11246859 3300014968 Bacteria 716
463 Ga0182006_1049148 3300015261 Bacteria 1629
464 Ga0182007_10021380 3300015262 Bacteria 2299
465 Ga0182005_1005205 3300015265 Bacteria 4089
466 Ga0183367_1002 3300015688 Bacteria 1101531
467 Ga0163161_10008851 3300017792 Bacteria 6961
468 Ga0163161_10044177 3300017792 Bacteria 3209
469 Ga0163161_10048885 3300017792 Bacteria 3056
470 Ga0206356_11114730 3300020070 Bacteria 3231
471 Ga0206354_11578533 3300020081 Bacteria 3189
472 Ga0206353_12041050 3300020082 Bacteria 1672
473 Ga0213873_10000035 3300021358 Bacteria 35581
474 Ga0213874_10071077 3300021377 Bacteria 1110
475 Ga0213876_10004888 3300021384 Bacteria 7432
476 Ga0213876_10005167 3300021384 Bacteria 7197
477 Ga0213875_10001597 3300021388 Bacteria 14361
478 Ga0213875_10004169 3300021388 Bacteria 8003
479 Ga0209758_1008145 3300025297 Bacteria 6889
480 Ga0207426_1001450 3300025302 Bacteria 19608
481 Ga0207426_1025097 3300025302 Bacteria 2011
482 Ga0207426_1034160 3300025302 Bacteria 1633
483 Ga0207656_10083705 3300025321 Bacteria 1438
484 Ga0207692_10000219 3300025898 Bacteria 19272
485 Ga0207692_10002504 3300025898 Bacteria 7050
486 Ga0207692_10005049 3300025898 Bacteria 5257
487 Ga0207692_10009781 3300025898 Bacteria 4017
488 Ga0207692_10027269 3300025898 Bacteria 2689
489 Ga0207642_10001826 3300025899 Bacteria 6581
490 Ga0207642_10003716 3300025899 Bacteria 4852
491 Ga0207642_10031115 3300025899 Bacteria 2231
492 Ga0207642_10065054 3300025899 Bacteria 1712
493 Ga0207710_10000082 3300025900 Bacteria 138091
494 Ga0207710_10000120 3300025900 Bacteria 96124
495 Ga0207710_10096215 3300025900 Bacteria 1392
496 Ga0207688_10002242 3300025901 Bacteria 10422
497 Ga0207688_10004245 3300025901 Bacteria 7812
498 Ga0207688_10009670 3300025901 Bacteria 5249
499 Ga0207688_10012855 3300025901 Bacteria 4551
500 Ga0207688_10014701 3300025901 Bacteria 4250
501 Ga0207680_10002130 3300025903 Bacteria 9269
502 Ga0207647_10003737 3300025904 Bacteria 11380
503 Ga0207647_10012119 3300025904 Bacteria 6016
504 Ga0207647_10015250 3300025904 Bacteria 5275
505 Ga0207685_10030871 3300025905 Bacteria 1913
506 Ga0207685_10061026 3300025905 Bacteria 1493
507 Ga0207699_10000107 3300025906 Bacteria 58818
508 Ga0207699_10012852 3300025906 Bacteria 4265
509 Ga0207699_10048359 3300025906 Bacteria 2498
510 Ga0207699_10052615 3300025906 Bacteria 2411
511 Ga0207645_10285012 3300025907 Bacteria 1097
512 Ga0207643_10009748 3300025908 Bacteria 5154
513 Ga0207643_10053346 3300025908 Bacteria 2297
514 Ga0207705_10230015 3300025909 Bacteria 1410
515 Ga0207705_10393656 3300025909 Bacteria 1071
516 Ga0207684_10008443 3300025910 Bacteria 9164
517 Ga0207684_10022385 3300025910 Bacteria 5393
518 Ga0207684_10024036 3300025910 Bacteria 5199
519 Ga0207684_10027532 3300025910 Bacteria 4841
520 Ga0207684_10033233 3300025910 Bacteria 4386
521 Ga0207654_10008291 3300025911 Bacteria 5249
522 Ga0207654_10032568 3300025911 Bacteria 2882
523 Ga0207654_10256258 3300025911 Bacteria 1174
524 Ga0207707_10251968 3300025912 Bacteria 1534
525 Ga0207707_10340839 3300025912 Bacteria 1292
526 Ga0207707_10375567 3300025912 Bacteria 1222
527 Ga0207695_10010754 3300025913 Bacteria 11164
528 Ga0207695_10019678 3300025913 Bacteria 7763
529 Ga0207695_10202854 3300025913 Bacteria 1897
530 Ga0207671_10004750 3300025914 Bacteria 12823
531 Ga0207671_10004875 3300025914 Bacteria 12621
532 Ga0207693_10000536 3300025915 Bacteria 34408
533 Ga0207693_10002466 3300025915 Bacteria 16076
534 Ga0207693_10016027 3300025915 Bacteria 5999
535 Ga0207663_10003233 3300025916 Bacteria 7937
536 Ga0207663_10004399 3300025916 Bacteria 6996
537 Ga0207663_10110443 3300025916 Bacteria 1865
538 Ga0207663_10134143 3300025916 Bacteria 1716
539 Ga0207663_10142302 3300025916 Bacteria 1672
540 Ga0207660_10158598 3300025917 Bacteria 1744
541 Ga0207660_10389315 3300025917 Bacteria 1121
542 Ga0207660_10425723 3300025917 Bacteria 1071
543 Ga0207662_10005906 3300025918 Bacteria 6569
544 Ga0207662_10017337 3300025918 Bacteria 4073
545 Ga0207662_10337861 3300025918 Bacteria 1009
546 Ga0207657_10011451 3300025919 Bacteria 8807
547 Ga0207657_10070007 3300025919 Bacteria 2974
548 Ga0207657_10112084 3300025919 Bacteria 2252
549 Ga0207657_10294189 3300025919 Bacteria 1287
550 Ga0207657_10468935 3300025919 Bacteria 987
551 Ga0207652_10438825 3300025921 Bacteria 1177
552 Ga0207652_10571104 3300025921 Bacteria 1015
553 Ga0207646_10013367 3300025922 Bacteria 7854
554 Ga0207646_10060719 3300025922 Bacteria 3375
555 Ga0207646_10067963 3300025922 Bacteria 3182
556 Ga0207646_10119621 3300025922 Bacteria 2366
557 Ga0207646_10155512 3300025922 Bacteria 2062
558 Ga0207646_10217921 3300025922 Bacteria 1724
559 Ga0207646_10365690 3300025922 Bacteria 1303
560 Ga0207694_10007071 3300025924 Bacteria 8522
561 Ga0207687_10010539 3300025927 Bacteria 6040
562 Ga0207687_10073268 3300025927 Bacteria 2452
563 Ga0207687_10176178 3300025927 Bacteria 1653
564 Ga0207687_10461736 3300025927 Bacteria 1055
565 Ga0207700_10000738 3300025928 Bacteria 18865
566 Ga0207700_10004439 3300025928 Bacteria 8273
567 Ga0207700_10103904 3300025928 Bacteria 2272
568 Ga0207700_10199728 3300025928 Bacteria 1684
569 Ga0207700_10270441 3300025928 Bacteria 1458
570 Ga0207700_10444566 3300025928 Bacteria 1142
571 Ga0207664_10000047 3300025929 Bacteria 139122
572 Ga0207664_10000271 3300025929 Bacteria 39054
573 Ga0207664_10001700 3300025929 Bacteria 14508
574 Ga0207664_10007656 3300025929 Bacteria 7494
575 Ga0207664_10020227 3300025929 Bacteria 4931
576 Ga0207664_10025960 3300025929 Bacteria 4422
577 Ga0207664_10050294 3300025929 Bacteria 3286
578 Ga0207664_10071211 3300025929 Bacteria 2800
579 Ga0207664_10082598 3300025929 Bacteria 2617
580 Ga0207664_10119911 3300025929 Bacteria 2200
581 Ga0207664_10182087 3300025929 Bacteria 1804
582 Ga0207664_10291688 3300025929 Bacteria 1433
583 Ga0207664_10336177 3300025929 Bacteria 1335
584 Ga0207664_10448958 3300025929 Bacteria 1151
585 Ga0207644_10017014 3300025931 Bacteria 4901
586 Ga0207644_10266562 3300025931 Bacteria 1371
587 Ga0207644_10424390 3300025931 Bacteria 1090
588 Ga0207690_10078476 3300025932 Bacteria 2298
589 Ga0207690_10173382 3300025932 Bacteria 1618
590 Ga0207706_10005885 3300025933 Bacteria 11405
591 Ga0207706_10006389 3300025933 Bacteria 10948
592 Ga0207706_10108055 3300025933 Bacteria 2448
593 Ga0207686_10002303 3300025934 Bacteria 10457
594 Ga0207686_10138040 3300025934 Bacteria 1681
595 Ga0207686_10195008 3300025934 Bacteria 1446
596 Ga0207709_10003326 3300025935 Bacteria 9629
597 Ga0207709_10009751 3300025935 Bacteria 5292
598 Ga0207709_10016414 3300025935 Bacteria 4116
599 Ga0207709_10245210 3300025935 Bacteria 1305
600 Ga0207709_10512530 3300025935 Bacteria 938
601 Ga0207709_10901191 3300025935 Bacteria 719
602 Ga0207670_10045513 3300025936 Bacteria 2909
603 Ga0207670_10056448 3300025936 Bacteria 2658
604 Ga0207670_10190275 3300025936 Bacteria 1552
605 Ga0207669_10000555 3300025937 Bacteria 16299
606 Ga0207669_10063457 3300025937 Bacteria 2281
607 Ga0207669_10308428 3300025937 Bacteria 1206
608 Ga0207669_10958100 3300025937 Bacteria 717
609 Ga0207704_10000737 3300025938 Bacteria 14400
610 Ga0207704_10058453 3300025938 Bacteria 2375
611 Ga0207704_10465432 3300025938 Bacteria 1012
612 Ga0207665_10000529 3300025939 Bacteria 25748
613 Ga0207665_10000930 3300025939 Bacteria 19800
614 Ga0207665_10001551 3300025939 Bacteria 15467
615 Ga0207665_10003241 3300025939 Bacteria 10901
616 Ga0207665_10004601 3300025939 Bacteria 9162
617 Ga0207665_10005705 3300025939 Bacteria 8292
618 Ga0207665_10046315 3300025939 Bacteria 2914
619 Ga0207665_10141761 3300025939 Bacteria 1714
620 Ga0207691_10008539 3300025940 Bacteria 9837
621 Ga0207691_10064955 3300025940 Bacteria 3305
622 Ga0207711_10002425 3300025941 Bacteria 16651
623 Ga0207711_10077394 3300025941 Bacteria 2899
624 Ga0207711_10081377 3300025941 Bacteria 2830
625 Ga0207711_10270623 3300025941 Bacteria 1563
626 Ga0207689_10007790 3300025942 Bacteria 9371
627 Ga0207689_10154616 3300025942 Bacteria 1891
628 Ga0207661_10127590 3300025944 Bacteria 2174
629 Ga0207661_10162758 3300025944 Bacteria 1937
630 Ga0207661_10220749 3300025944 Bacteria 1675
631 Ga0207661_10244915 3300025944 Bacteria 1592
632 Ga0207667_10029835 3300025949 Bacteria 5908
633 Ga0207667_10089971 3300025949 Bacteria 3172
634 Ga0207667_10147319 3300025949 Bacteria 2423
635 Ga0207667_10293831 3300025949 Bacteria 1660
636 Ga0207667_10434588 3300025949 Bacteria 1335
637 Ga0207667_10435772 3300025949 Bacteria 1333
638 Ga0207651_10200467 3300025960 Bacteria 1599
639 Ga0207651_10215959 3300025960 Bacteria 1547
640 Ga0207712_10028067 3300025961 Bacteria 3763
641 Ga0207712_10038794 3300025961 Bacteria 3259
642 Ga0207712_10254572 3300025961 Bacteria 1421
643 Ga0207712_11040665 3300025961 Bacteria 727
644 Ga0207668_10024787 3300025972 Bacteria 3875
645 Ga0207668_10052638 3300025972 Bacteria 2817
646 Ga0207668_10087897 3300025972 Bacteria 2274
647 Ga0207668_10158510 3300025972 Bacteria 1761
648 Ga0207668_10169771 3300025972 Bacteria 1710
649 Ga0207640_10145941 3300025981 Bacteria 1731
650 Ga0207640_10814820 3300025981 Bacteria 810
651 Ga0207640_10933651 3300025981 Bacteria 760
652 Ga0207658_10006218 3300025986 Bacteria 8159
653 Ga0207658_10043625 3300025986 Bacteria 3261
654 Ga0207658_10178090 3300025986 Bacteria 1757
655 Ga0207658_10275754 3300025986 Bacteria 1439
656 Ga0207658_10279254 3300025986 Bacteria 1431
657 Ga0207677_10003124 3300026023 Bacteria 8738
658 Ga0207677_10037278 3300026023 Bacteria 3176
659 Ga0207677_10116750 3300026023 Bacteria 1999
660 Ga0207703_10000001 3300026035 Bacteria 822925
661 Ga0207703_10000015 3300026035 Bacteria 287079
662 Ga0207703_10019663 3300026035 Bacteria 5278
663 Ga0207703_10031130 3300026035 Bacteria 4217
664 Ga0207703_10204287 3300026035 Bacteria 1757
665 Ga0207703_10982235 3300026035 Bacteria 810
666 Ga0207639_10025120 3300026041 Bacteria 4319
667 Ga0207639_10131264 3300026041 Bacteria 2074
668 Ga0207639_10607331 3300026041 Bacteria 1009
669 Ga0207678_10108058 3300026067 Bacteria 2373
670 Ga0207678_10301586 3300026067 Bacteria 1377
671 Ga0207708_10010974 3300026075 Bacteria 6739
672 Ga0207708_10029336 3300026075 Bacteria 4169
673 Ga0207708_10057584 3300026075 Bacteria 2965
674 Ga0207708_10220862 3300026075 Bacteria 1518
675 Ga0207708_10406299 3300026075 Bacteria 1127
676 Ga0207702_10101090 3300026078 Bacteria 2545
677 Ga0207702_10106237 3300026078 Bacteria 2487
678 Ga0207702_10133545 3300026078 Bacteria 2236
679 Ga0207641_10002330 3300026088 Bacteria 17625
680 Ga0207641_10006616 3300026088 Bacteria 9732
681 Ga0207648_10002544 3300026089 Bacteria 19560
682 Ga0207648_10016154 3300026089 Bacteria 6834
683 Ga0207648_10076716 3300026089 Bacteria 2913
684 Ga0207676_10084407 3300026095 Bacteria 2589
685 Ga0207676_10091967 3300026095 Bacteria 2493
686 Ga0207676_10182439 3300026095 Bacteria 1839
687 Ga0207674_10006942 3300026116 Bacteria 13262
688 Ga0207674_10016729 3300026116 Bacteria 8015
689 Ga0207674_10187859 3300026116 Bacteria 2016
690 Ga0207675_100016823 3300026118 Bacteria 6832
691 Ga0207675_100018795 3300026118 Bacteria 6449
692 Ga0207675_100220175 3300026118 Bacteria 1829
693 Ga0207675_100365635 3300026118 Bacteria 1416
694 Ga0207675_100598947 3300026118 Bacteria 1105
695 Ga0207683_10001724 3300026121 Bacteria 19499
696 Ga0207683_10144296 3300026121 Bacteria 2146
697 Ga0207683_10185874 3300026121 Bacteria 1885
698 Ga0207683_10384640 3300026121 Bacteria 1290
699 Ga0207683_10454514 3300026121 Bacteria 1181
700 Ga0207683_10692187 3300026121 Bacteria 945
701 Ga0209813_10015195 3300027866 Bacteria 2082
702 Ga0209813_10041816 3300027866 Bacteria 1399
703 Ga0209813_10057657 3300027866 Bacteria 1232
704 Ga0209813_10072912 3300027866 Bacteria 1120
705 Ga0207428_10352299 3300027907 Bacteria 1083
706 Ga0207428_10493548 3300027907 Bacteria 890
707 Ga0268266_10001060 3300028379 Bacteria 34481
708 Ga0268266_10017791 3300028379 Bacteria 6057
709 Ga0268266_10038022 3300028379 Bacteria 4098
710 Ga0268266_10204089 3300028379 Bacteria 1810
711 Ga0268266_10265504 3300028379 Bacteria 1592
712 Ga0268266_10273971 3300028379 Bacteria 1567
713 Ga0268266_10347593 3300028379 Bacteria 1393
714 Ga0268265_10134910 3300028380 Bacteria 2057
715 Ga0268265_10508595 3300028380 Bacteria 1136
716 Ga0268264_10000206 3300028381 Bacteria 120365
717 Ga0268264_10005532 3300028381 Bacteria 10711
718 Ga0268264_10013674 3300028381 Bacteria 6681
719 Ga0268264_10142932 3300028381 Bacteria 2136
720 Ga0268264_10272461 3300028381 Bacteria 1582
721 Ga0268264_10356346 3300028381 Bacteria 1394
722 Ga0268264_10358183 3300028381 Bacteria 1391
723 Ga0268264_10549079 3300028381 Bacteria 1133
724 Ga0265334_10005155 3300028573 Bacteria 5726
725 Ga0307517_10003614 3300028786 Bacteria 24021
726 Ga0307515_10004012 3300028794 Bacteria 30728
727 Ga0307515_10046879 3300028794 Bacteria 6592
728 Ga0307515_10112167 3300028794 Bacteria 3173
729 Ga0307515_10136837 3300028794 Bacteria 2657
730 Ga0265338_10205173 3300028800 Bacteria 1484
731 Ga0268256_1007098 3300030500 Bacteria 4053
732 Ga0307511_10025825 3300030521 Bacteria 5400
733 Ga0307511_10110642 3300030521 Bacteria 1750
734 Ga0307512_10002762 3300030522 Bacteria 21451
735 Ga0307512_10027864 3300030522 Bacteria 4963
736 Ga0307512_10060614 3300030522 Bacteria 2923
737 Ga0307512_10131466 3300030522 Bacteria 1568
738 Ga0265325_10049569 3300031241 Bacteria 2166
739 Ga0265340_10009973 3300031247 Bacteria 5089
740 Ga0265316_10091535 3300031344 Bacteria 2320
741 Ga0307513_10006763 3300031456 Bacteria 14959
742 Ga0307513_10013386 3300031456 Bacteria 10069
743 Ga0307513_10026458 3300031456 Bacteria 6687
744 Ga0307513_10063901 3300031456 Bacteria 3882
745 Ga0307513_10152367 3300031456 Bacteria 2218
746 Ga0307513_10199371 3300031456 Bacteria 1844
747 Ga0265313_10084080 3300031595 Bacteria 1440
748 Ga0307508_10013541 3300031616 Bacteria 7454
749 Ga0307508_10047272 3300031616 Bacteria 3839
750 Ga0307508_10199315 3300031616 Bacteria 1602
751 Ga0307514_10009038 3300031649 Bacteria 8415
752 Ga0307514_10069439 3300031649 Bacteria 2651
753 Ga0307514_10072409 3300031649 Bacteria 2581
754 Ga0265314_10085745 3300031711 Bacteria 2064
755 Ga0316576_10001449 3300031727 Bacteria 12722
756 Ga0316576_10026664 3300031727 Bacteria 4057
757 Ga0316576_10039017 3300031727 Bacteria 3408
758 Ga0316576_10293638 3300031727 Bacteria 1215
759 Ga0316578_10000584 3300031728 Bacteria 12667
760 Ga0316578_10018725 3300031728 Bacteria 3801
761 Ga0316578_10204630 3300031728 Bacteria 1188
762 Ga0307516_10011933 3300031730 Bacteria 9398
763 Ga0307516_10085486 3300031730 Bacteria 2992
764 Ga0307516_10088450 3300031730 Bacteria 2930
765 Ga0316577_10121549 3300031733 Bacteria 1467
766 Ga0307413_10139313 3300031824 Bacteria 1674
767 Ga0307413_10169459 3300031824 Bacteria 1544
768 Ga0307413_10196070 3300031824 Bacteria 1454
769 Ga0307518_10000165 3300031838 Bacteria 49424
770 Ga0307518_10314003 3300031838 Bacteria 942
771 Ga0307410_10107433 3300031852 Bacteria 2013
772 Ga0307410_10320740 3300031852 Bacteria 1229
773 Ga0307410_10402037 3300031852 Bacteria 1107
774 Ga0307407_10003930 3300031903 Bacteria 6205
775 Ga0307409_100000412 3300031995 Bacteria 18123
776 Ga0307409_100066133 3300031995 Bacteria 2849
777 Ga0307409_100119547 3300031995 Bacteria 2228
778 Ga0307409_100124651 3300031995 Bacteria 2189
779 Ga0307409_100202710 3300031995 Bacteria 1776
780 Ga0307409_100392001 3300031995 Bacteria 1324
781 Ga0307409_101001446 3300031995 Bacteria 854
782 Ga0307416_100008730 3300032002 Bacteria 6566
783 Ga0307416_100076948 3300032002 Bacteria 2800
784 Ga0307416_100153781 3300032002 Bacteria 2114
785 Ga0307416_100272692 3300032002 Bacteria 1662
786 Ga0307411_10207211 3300032005 Bacteria 1511
787 Ga0307411_10428605 3300032005 Bacteria 1101
788 Ga0307415_100000018 3300032126 Bacteria 70851
789 Ga0307415_100004426 3300032126 Bacteria 7285
790 Ga0307415_100174505 3300032126 Bacteria 1680
791 Ga0307415_100588891 3300032126 Bacteria 988
792 Ga0316583_10031824 3300032133 Bacteria 1877
793 Ga0316585_10002358 3300032137 Bacteria 5088
794 Ga0316580_10001663 3300032139 Bacteria 5907
795 Ga0307507_10045345 3300033179 Bacteria 4327
796 Ga0307507_10046672 3300033179 Bacteria 4242
797 Ga0307507_10254740 3300033179 Bacteria 1129
798 Ga0307507_10269844 3300033179 Bacteria 1076
799 Ga0307510_10012527 3300033180 Bacteria 10058
800 Ga0307510_10137760 3300033180 Bacteria 2093
801 Ga0373926_0031227 3300035083 Bacteria 1878
802 Ga0373926_0052409 3300035083 Bacteria 1474
803 Ga0373928_0044372 3300035084 Bacteria 1032
804 Ga0373934_0021182 3300035086 Bacteria 2503
805 Ga0373944_0001987 3300035089 Bacteria 5180
806 Ga0373949_0105116 3300035090 Bacteria 778
807 Ga0373951_0016217 3300035091 Bacteria 1680
808 Ga0373932_0026415 3300035112 Bacteria 1579
809 Ga0373936_0003301 3300035113 Bacteria 6049
810 Ga0373939_0066692 3300035114 Bacteria 1161
811 Ga0373939_0091429 3300035114 Bacteria 1029
812 Ga0373941_0101622 3300035115 Bacteria 1002
813 Ga0373945_0005501 3300035116 Bacteria 4056
814 Ga0373953_0045985 3300035117 Bacteria 1751
815 Ga0373954_0044568 3300035118 Bacteria 2071
816 Ga0373954_0053260 3300035118 Bacteria 1902
817 Ga0373954_0074933 3300035118 Bacteria 1611
818 Ga0373954_0248846 3300035118 Bacteria 875
819 Ga0373956_0033068 3300035119 Bacteria 2272
820 Ga0373956_0096423 3300035119 Bacteria 1368
821 Ga0373960_0044911 3300035121 Bacteria 1292
822 Ga0373943_0007579 3300035170 Bacteria 4875
823 Ga0373943_0138676 3300035170 Bacteria 1308
824 Ga0373955_0007576 3300035172 Bacteria 4997
825 Ga0373955_0032416 3300035172 Bacteria 2742
826 Ga0373955_0066305 3300035172 Bacteria 2006
827 Ga0373961_0052563 3300035241 Bacteria 1213
828 Ga0373962_0031228 3300035242 Bacteria 1461
829 Ga0316574_0001518 3300035398 Bacteria 11049
830 Ga0316574_0003568 3300035398 Bacteria 8042
831 Ga0316574_0022859 3300035398 Bacteria 3728
832 Ga0316574_0413957 3300035398 Bacteria 848
833 Ga0373924_0054401 3300035410 Bacteria 1664
834 Ga0373924_0060038 3300035410 Bacteria 1589
835 Ga0373924_0092426 3300035410 Bacteria 1295
836 Ga0373931_0000027 3300035691 Bacteria 123672
837 Ga0373931_0068203 3300035691 Bacteria 1935
838 Ga0373931_0086914 3300035691 Bacteria 1736
839 Ga0373931_0159679 3300035691 Bacteria 1320
840 Ga0373931_0208909 3300035691 Bacteria 1170
841 Ga0373935_0002764 3300035692 Bacteria 10090
842 Ga0373935_0156164 3300035692 Bacteria 1552
843 Ga0373927_0007570 3300035695 Bacteria 7349
844 Ga0373927_0192171 3300035695 Bacteria 1339
845 Ga0373933_0015399 3300035724 Bacteria 4261
846 Ga0373933_0037969 3300035724 Bacteria 2828
847 Ga0373933_0106036 3300035724 Bacteria 1748
848 Ga0373947_0005651 3300035725 Bacteria 7299
849 Ga0373947_0671683 3300035725 Bacteria 707
850 Ga0373937_0070849 3300036401 Bacteria 3215
851 Ga0373937_0110491 3300036401 Bacteria 2556
852 Ga0373937_0181998 3300036401 Bacteria 1974
853 Ga0373937_0183390 3300036401 Bacteria 1966
854 Ga0373937_0325428 3300036401 Bacteria 1454
855 Ga0316582_0004409 3300036647 Bacteria 7111
856 Ga0373925_0003210 3300037068 Bacteria 12782
857 Ga0373925_0017995 3300037068 Bacteria 5131
858 Ga0373925_0101394 3300037068 Bacteria 2213
859 Ga0373925_0210899 3300037068 Bacteria 1547
860 Ga0395899_0377489 3300037312 Bacteria 943
861 Ga0395898_0024415 3300037466 Bacteria 6097
862 Ga0395898_0035080 3300037466 Bacteria 4992
863 Ga0395898_0294817 3300037466 Bacteria 1547
864 Ga0395898_0869723 3300037466 Bacteria 840
865 Ga0395905_0101042 3300037471 Bacteria 2708
866 Ga0436364_0034013 3300037853 Bacteria 5098
867 Ga0436364_0156042 3300037853 Bacteria 23649
868 Ga0436364_0667270 3300037853 Bacteria 158868
869 Ga0436364_0933349 3300037853 Bacteria 3399
870 Ga0436364_1066174 3300037853 Bacteria 1553
871 Ga0436364_1316088 3300037853 Bacteria 12184
872 Ga0436364_1367194 3300037853 Bacteria 2951
873 Ga0436364_1369092 3300037853 Bacteria 3643
874 Ga0395901_0023720 3300038443 Bacteria 6291
875 Ga0395901_0046735 3300038443 Bacteria 4497
876 Ga0395901_0067099 3300038443 Bacteria 3736
877 Ga0395901_0097761 3300038443 Bacteria 3078
878 Ga0395901_0150430 3300038443 Bacteria 2446
879 Ga0395901_0178181 3300038443 Bacteria 2229
880 Ga0395901_0187582 3300038443 Bacteria 2169
881 Ga0400483_143208 3300039062 Bacteria 16664
882 Ga0436365_0101945 3300039437 Bacteria 10158
883 Ga0436365_0242388 3300039437 Bacteria 9630
884 Ga0436365_0377960 3300039437 Bacteria 1109
885 Ga0436365_1353757 3300039437 Bacteria 20905
886 Ga0436365_1397287 3300039437 Bacteria 8052
887 Ga0436365_1477890 3300039437 Bacteria 1235
888 Ga0436365_1573340 3300039437 Bacteria 1577
889 Ga0436365_1662005 3300039437 Bacteria 8466
890 Ga0436363_0466668 3300039450 Bacteria 736
891 Ga0436363_0651887 3300039450 Bacteria 1190
892 Ga0436363_1248969 3300039450 Bacteria 3546
893 Ga0436363_1266751 3300039450 Bacteria 1056
894 Ga0436363_1577689 3300039450 Bacteria 992
895 Ga0436362_0233102 3300039453 Bacteria 74564
896 Ga0436362_1241870 3300039453 Bacteria 1091
897 Ga0439439_0004871 3300041406 Bacteria 3041
898 Ga0439461_0044691 3300041410 Bacteria 967
899 Ga0439466_0010022 3300041411 Bacteria 3526
900 Ga0451791_1578104 3300041451 Bacteria 1055
901 Ga0451793_0507191 3300041452 Bacteria 3535
902 Ga0451797_1409501 3300041453 Bacteria 1356
903 Ga0451795_0914352 3300041456 Bacteria 1026
904 Ga0451802_0862397 3300041460 Bacteria 2427
905 Ga0451833_0575330 3300041491 Bacteria 4293
906 Ga0451837_0006231 3300041494 Bacteria 3826
907 Ga0451837_0276975 3300041494 Bacteria 1749
908 Ga0451837_0921921 3300041494 Bacteria 3498
909 Ga0451839_0178565 3300041496 Bacteria 3568
910 Ga0451845_0414028 3300041501 Bacteria 1102
911 Ga0451843_0437279 3300041509 Bacteria 1166
912 Ga0451853_0663764 3300041512 Bacteria 1470
913 Ga0451853_2380410 3300041512 Bacteria 2477
914 Ga0439433_0000632 3300041999 Bacteria 6730
915 Ga0439442_053094 3300042002 Bacteria 856
916 Ga0439448_0062723 3300042005 Bacteria 1230
917 Ga0439448_0105448 3300042005 Bacteria 960
918 Ga0439449_0001150 3300042007 Bacteria 10383
919 Ga0439449_0001756 3300042007 Bacteria 8520
920 Ga0439454_006489 3300042011 Bacteria 1441
921 Ga0439457_000481 3300042014 Bacteria 11518
922 Ga0439457_003831 3300042014 Bacteria 4032
923 Ga0439462_0018847 3300042015 Bacteria 1794
924 Ga0439462_0030110 3300042015 Bacteria 1435
925 Ga0450894_000022 3300042131 Bacteria 21795
926 Ga0450898_015765 3300042134 Bacteria 1283
927 Ga0450899_000954 3300042135 Bacteria 3282
928 Ga0450903_000614 3300042138 Bacteria 7198
929 Ga0450903_015493 3300042138 Bacteria 1201
930 Ga0439458_0001557 3300042157 Bacteria 5734
931 Ga0450918_016416 3300042531 Bacteria 1287
932 Ga0466969_0001309 3300044656 Bacteria 13412
933 Ga0466969_0005724 3300044656 Bacteria 6607
934 Ga0466969_0013899 3300044656 Bacteria 4237
935 Ga0466969_0014585 3300044656 Bacteria 4131
936 Ga0466969_0016641 3300044656 Bacteria 3846
937 Ga0466969_0019700 3300044656 Bacteria 3503
938 Ga0466969_0025219 3300044656 Bacteria 3058
939 Ga0466969_0035491 3300044656 Bacteria 2522
940 Ga0466969_0040741 3300044656 Bacteria 2326
941 Ga0466969_0045691 3300044656 Bacteria 2173
942 Ga0466972_0004075 3300044658 Bacteria 7297
943 Ga0466972_0010241 3300044658 Bacteria 4708
944 Ga0466972_0017541 3300044658 Bacteria 3583
945 Ga0466972_0046591 3300044658 Bacteria 2099
946 Ga0466972_0074249 3300044658 Bacteria 1620
947 Ga0466965_0000907 3300044683 Bacteria 11336
948 Ga0466965_0002332 3300044683 Bacteria 8023
949 Ga0466965_0012024 3300044683 Bacteria 4063
950 Ga0466965_0013526 3300044683 Bacteria 3852
951 Ga0466965_0022002 3300044683 Bacteria 3073
952 Ga0466965_0082244 3300044683 Bacteria 1629
953 Ga0466965_0093809 3300044683 Bacteria 1529
954 Ga0466965_0122081 3300044683 Bacteria 1346
955 Ga0466965_0214613 3300044683 Bacteria 1024
956 Ga0466966_0002220 3300044684 Bacteria 12625
957 Ga0466966_0002876 3300044684 Bacteria 11337
958 Ga0466966_0003594 3300044684 Bacteria 10234
959 Ga0466966_0018617 3300044684 Bacteria 4576
960 Ga0466966_0021345 3300044684 Bacteria 4252
961 Ga0466966_0038389 3300044684 Bacteria 3086
962 Ga0466966_0058149 3300044684 Bacteria 2444
963 Ga0466966_0089176 3300044684 Bacteria 1916
964 Ga0466966_0092557 3300044684 Bacteria 1875
965 Ga0466966_0413259 3300044684 Bacteria 811
966 Ga0466961_0000308 3300044693 Bacteria 32406
967 Ga0466961_0002104 3300044693 Bacteria 12391
968 Ga0466961_0007726 3300044693 Bacteria 6846
969 Ga0466961_0010722 3300044693 Bacteria 5854
970 Ga0466961_0011811 3300044693 Bacteria 5582
971 Ga0466961_0014875 3300044693 Bacteria 5000
972 Ga0466961_0031962 3300044693 Bacteria 3382
973 Ga0466961_0033202 3300044693 Bacteria 3316
974 Ga0466961_0067418 3300044693 Bacteria 2273
975 Ga0466961_0094065 3300044693 Bacteria 1891
976 Ga0466961_0106941 3300044693 Bacteria 1761
977 Ga0466961_0111071 3300044693 Bacteria 1725
978 Ga0466961_0145425 3300044693 Bacteria 1482
979 Ga0466961_0237103 3300044693 Bacteria 1122
980 Ga0466961_0385820 3300044693 Bacteria 851
981 Ga0466963_0005739 3300044694 Bacteria 7298
982 Ga0466963_0013044 3300044694 Bacteria 5095
983 Ga0466963_0027245 3300044694 Bacteria 3658
984 Ga0466963_0067167 3300044694 Bacteria 2406
985 Ga0466963_0074366 3300044694 Bacteria 2291
986 Ga0466963_0143422 3300044694 Bacteria 1656
987 Ga0466963_0244463 3300044694 Bacteria 1259
988 Ga0466963_0269627 3300044694 Bacteria 1196
989 Ga0466963_0287091 3300044694 Bacteria 1157
990 Ga0466963_0336911 3300044694 Bacteria 1062
991 Ga0466963_0484594 3300044694 Bacteria 873
992 Ga0466964_0029133 3300044706 Bacteria 2178
993 Ga0466964_0062040 3300044706 Bacteria 1558
994 Ga0466964_0171455 3300044706 Bacteria 1022
995 Ga0466964_0249522 3300044706 Bacteria 874
996 Ga0466971_0000332 3300044719 Bacteria 18072
997 Ga0466971_0000463 3300044719 Bacteria 15866
998 Ga0466971_0004447 3300044719 Bacteria 6052
999 Ga0466971_0021847 3300044719 Bacteria 2848
1000 Ga0466971_0037160 3300044719 Bacteria 2183
1001 Ga0466971_0048653 3300044719 Bacteria 1906
1002 Ga0466971_0057877 3300044719 Bacteria 1749
1003 Ga0466971_0093045 3300044719 Bacteria 1381
1004 Ga0466971_0351560 3300044719 Bacteria 713
1005 Ga0466971_0390932 3300044719 Bacteria 677
1006 Ga0466968_0000563 3300044735 Bacteria 12614
1007 Ga0466968_0003829 3300044735 Bacteria 5583
1008 Ga0466968_0014055 3300044735 Bacteria 3158
1009 Ga0466968_0034064 3300044735 Bacteria 2124
1010 Ga0466968_0126530 3300044735 Bacteria 1160
1011 Ga0466970_0002049 3300044765 Bacteria 9758
1012 Ga0466970_0002446 3300044765 Bacteria 8972
1013 Ga0466970_0003236 3300044765 Bacteria 7917
1014 Ga0466970_0004998 3300044765 Bacteria 6550
1015 Ga0466970_0007188 3300044765 Bacteria 5575
1016 Ga0466970_0014443 3300044765 Bacteria 4055
1017 Ga0466970_0016815 3300044765 Bacteria 3776
1018 Ga0466970_0017349 3300044765 Bacteria 3720
1019 Ga0466970_0021525 3300044765 Bacteria 3358
1020 Ga0466970_0048239 3300044765 Bacteria 2270
1021 Ga0466970_0061509 3300044765 Bacteria 2012
1022 Ga0466970_0064279 3300044765 Bacteria 1967
1023 Ga0466970_0070920 3300044765 Bacteria 1874
1024 Ga0466970_0113781 3300044765 Bacteria 1479
1025 Ga0466970_0119435 3300044765 Bacteria 1443
1026 Ga0466970_0125553 3300044765 Bacteria 1407
1027 Ga0466970_0344221 3300044765 Bacteria 845
1028 Ga0466957_0003358 3300044842 Bacteria 8779
1029 Ga0466957_0005992 3300044842 Bacteria 6855
1030 Ga0466957_0006604 3300044842 Bacteria 6560
1031 Ga0466957_0027521 3300044842 Bacteria 3379
1032 Ga0466957_0030878 3300044842 Bacteria 3200
1033 Ga0466957_0053495 3300044842 Bacteria 2461
1034 Ga0466957_0066334 3300044842 Bacteria 2225
1035 Ga0466957_0108470 3300044842 Bacteria 1758
1036 Ga0466957_0281758 3300044842 Bacteria 1113
1037 Ga0466957_0285122 3300044842 Bacteria 1106
1038 Ga0466957_0574421 3300044842 Bacteria 787
1039 Ga0466957_0639954 3300044842 Bacteria 747
1040 Ga0466960_0000958 3300044901 Bacteria 10250
1041 Ga0466960_0001422 3300044901 Bacteria 8713
1042 Ga0466960_0021659 3300044901 Bacteria 2865
1043 Ga0466960_0195287 3300044901 Bacteria 1103
1044 Ga0466959_0000668 3300045049 Bacteria 20018
1045 Ga0466959_0002190 3300045049 Bacteria 12428
1046 Ga0466959_0003841 3300045049 Bacteria 9963
1047 Ga0466959_0004252 3300045049 Bacteria 9550
1048 Ga0466959_0005979 3300045049 Bacteria 8396
1049 Ga0466959_0015896 3300045049 Bacteria 5491
1050 Ga0466959_0017455 3300045049 Bacteria 5261
1051 Ga0466959_0026229 3300045049 Bacteria 4319
1052 Ga0466959_0030336 3300045049 Bacteria 4003
1053 Ga0466959_0046010 3300045049 Bacteria 3212
1054 Ga0466959_0170975 3300045049 Bacteria 1524
1055 Ga0466959_0201915 3300045049 Bacteria 1384
1056 Ga0466959_0209067 3300045049 Bacteria 1356
1057 Ga0466959_0319937 3300045049 Bacteria 1061
1058 Ga0451576_0392237 3300045051 Bacteria 1455
1059 Ga0466958_0000773 3300045836 Bacteria 14072
1060 Ga0466958_0006755 3300045836 Bacteria 6266
1061 Ga0466958_0046047 3300045836 Bacteria 2632
1062 Ga0466958_0063203 3300045836 Bacteria 2257
1063 Ga0466958_0079576 3300045836 Bacteria 2015
1064 Ga0466958_0103073 3300045836 Bacteria 1776
1065 Ga0466958_0141197 3300045836 Bacteria 1516
1066 Ga0466958_0143514 3300045836 Bacteria 1504
1067 Ga0466958_0156284 3300045836 Bacteria 1439
1068 Ga0466967_0005566 3300045976 Bacteria 8753
1069 Ga0466967_0020618 3300045976 Bacteria 5333
1070 Ga0466967_0031648 3300045976 Bacteria 4456
1071 Ga0466967_0035405 3300045976 Bacteria 4250
1072 Ga0466967_0038433 3300045976 Bacteria 4105
1073 Ga0466967_0040073 3300045976 Bacteria 4031
1074 Ga0466967_0065908 3300045976 Bacteria 3225
1075 Ga0466967_0074385 3300045976 Bacteria 3051
1076 Ga0466967_0116736 3300045976 Bacteria 2459
1077 Ga0466967_0174886 3300045976 Bacteria 2022
1078 Ga0466967_0220934 3300045976 Bacteria 1800
1079 Ga0466967_0231570 3300045976 Bacteria 1759
1080 Ga0466967_0255234 3300045976 Bacteria 1676
1081 Ga0466967_0340156 3300045976 Bacteria 1451
1082 Ga0466967_0397160 3300045976 Bacteria 1341
1083 Ga0466967_0549081 3300045976 Bacteria 1137
1084 Ga0466967_0702352 3300045976 Bacteria 1002
1085 Ga0466967_0741231 3300045976 Bacteria 974
1086 Ga0466967_0743845 3300045976 Bacteria 972
1087 Ga0466967_0791518 3300045976 Bacteria 941
1088 Ga0466967_1004222 3300045976 Bacteria 831
1089 Ga0495617_024406 3300046452 Bacteria 2040
1090 Ga0495592_0027906 3300046454 Bacteria 4276
1091 Ga0495592_0060598 3300046454 Bacteria 2783
1092 Ga0495592_0079675 3300046454 Bacteria 2370
1093 Ga0495592_0155165 3300046454 Bacteria 1580
1094 Ga0495592_0207185 3300046454 Bacteria 1319
1095 Ga0495603_0000638 3300046455 Bacteria 19717
1096 Ga0495603_0001879 3300046455 Bacteria 12388
1097 Ga0495603_0005158 3300046455 Bacteria 7803
1098 Ga0495603_0023079 3300046455 Bacteria 3766
1099 Ga0495603_0163152 3300046455 Bacteria 1292
1100 Ga0495603_0381922 3300046455 Bacteria 808
1101 Ga0495629_0001217 3300046459 Bacteria 20212
1102 Ga0495629_0003212 3300046459 Bacteria 12366
1103 Ga0495629_0007463 3300046459 Bacteria 8056
1104 Ga0495629_0019525 3300046459 Bacteria 4840
1105 Ga0495629_0183247 3300046459 Bacteria 1451
1106 Ga0495629_0240524 3300046459 Bacteria 1246
1107 Ga0495638_0020561 3300046460 Bacteria 4360
1108 Ga0495638_0049586 3300046460 Bacteria 2625
1109 Ga0495641_0069531 3300046461 Bacteria 1582
1110 Ga0495641_0178823 3300046461 Bacteria 950
1111 Ga0495641_0276201 3300046461 Bacteria 756
1112 Ga0495651_0000752 3300046462 Bacteria 25055
1113 Ga0495651_0000989 3300046462 Bacteria 22069
1114 Ga0495651_0001909 3300046462 Bacteria 16139
1115 Ga0495651_0003631 3300046462 Bacteria 11819
1116 Ga0495651_0023113 3300046462 Bacteria 4835
1117 Ga0495651_0028565 3300046462 Bacteria 4345
1118 Ga0495651_0031625 3300046462 Bacteria 4127
1119 Ga0495651_0048896 3300046462 Bacteria 3265
1120 Ga0495651_0068119 3300046462 Bacteria 2713
1121 Ga0495651_0088537 3300046462 Bacteria 2326
1122 Ga0495651_0187091 3300046462 Bacteria 1460
1123 Ga0495651_0524202 3300046462 Bacteria 756
1124 Ga0495653_0016688 3300046463 Bacteria 5976
1125 Ga0495653_0019495 3300046463 Bacteria 5500
1126 Ga0495653_0101896 3300046463 Bacteria 2079
1127 Ga0495653_0121947 3300046463 Bacteria 1856
1128 Ga0495653_0361806 3300046463 Bacteria 931
1129 Ga0495580_0347415 3300046472 Bacteria 1005
1130 Ga0495582_0461577 3300046473 Bacteria 733
1131 Ga0495605_0016690 3300046474 Bacteria 3970
1132 Ga0495662_0000804 3300046476 Bacteria 15227
1133 Ga0495662_0004568 3300046476 Bacteria 6940
1134 Ga0495662_0031337 3300046476 Bacteria 2568
1135 Ga0495662_0139395 3300046476 Bacteria 1193
1136 Ga0495664_0001534 3300046477 Bacteria 12218
1137 Ga0495664_0003208 3300046477 Bacteria 8873
1138 Ga0495664_0006890 3300046477 Bacteria 6290
1139 Ga0495664_0334726 3300046477 Bacteria 912
1140 Ga0495664_0367946 3300046477 Bacteria 865
1141 Ga0495584_0024076 3300046491 Bacteria 3087
1142 Ga0495585_0010037 3300046492 Bacteria 5656
1143 Ga0495585_0057137 3300046492 Bacteria 2154
1144 Ga0495594_0001615 3300046499 Bacteria 11732
1145 Ga0495594_0053899 3300046499 Bacteria 2216
1146 Ga0495594_0074018 3300046499 Bacteria 1897
1147 Ga0495607_0035092 3300046501 Bacteria 3037
1148 Ga0495606_0001540 3300046507 Bacteria 30412
1149 Ga0495606_0021860 3300046507 Bacteria 4678
1150 Ga0495606_0053323 3300046507 Bacteria 2624
1151 Ga0495608_0000475 3300046511 Bacteria 27866
1152 Ga0495608_0175532 3300046511 Bacteria 1357
1153 Ga0495610_0050106 3300046512 Bacteria 2040
1154 Ga0495616_0003394 3300046513 Bacteria 10209
1155 Ga0495618_0012534 3300046514 Bacteria 5150
1156 Ga0495618_0014319 3300046514 Bacteria 4831
1157 Ga0495618_0036844 3300046514 Bacteria 3070
1158 Ga0495618_0044728 3300046514 Bacteria 2792
1159 Ga0495618_0061316 3300046514 Bacteria 2385
1160 Ga0495618_0068656 3300046514 Bacteria 2254
1161 Ga0495618_0071381 3300046514 Bacteria 2209
1162 Ga0495618_0080996 3300046514 Bacteria 2072
1163 Ga0495620_0011476 3300046515 Bacteria 4621
1164 Ga0495628_0000710 3300046516 Bacteria 30813
1165 Ga0495628_0001200 3300046516 Bacteria 23680
1166 Ga0495628_0029750 3300046516 Bacteria 4427
1167 Ga0495628_0065623 3300046516 Bacteria 2838
1168 Ga0495628_0098786 3300046516 Bacteria 2255
1169 Ga0495628_0149542 3300046516 Bacteria 1779
1170 Ga0495628_0281957 3300046516 Bacteria 1234
1171 Ga0495630_0005265 3300046517 Bacteria 9127
1172 Ga0495630_0024420 3300046517 Bacteria 4469
1173 Ga0495630_0113180 3300046517 Bacteria 2055
1174 Ga0495631_0046728 3300046518 Bacteria 1902
1175 Ga0495631_0058036 3300046518 Bacteria 1683
1176 Ga0495637_0034789 3300046520 Bacteria 2204
1177 Ga0495643_0002300 3300046522 Bacteria 15428
1178 Ga0495648_0016851 3300046524 Bacteria 5251
1179 Ga0495666_0000918 3300046526 Bacteria 13848
1180 Ga0495666_0084971 3300046526 Bacteria 1495
1181 Ga0495666_0132054 3300046526 Bacteria 1167
1182 Ga0495652_0000586 3300046529 Bacteria 42555
1183 Ga0495652_0002867 3300046529 Bacteria 17391
1184 Ga0495652_0020630 3300046529 Bacteria 5857
1185 Ga0495652_0025780 3300046529 Bacteria 5197
1186 Ga0495652_0030823 3300046529 Bacteria 4699
1187 Ga0495652_0065800 3300046529 Bacteria 3044
1188 Ga0495652_0126905 3300046529 Bacteria 2025
1189 Ga0495652_0182376 3300046529 Bacteria 1609
1190 Ga0495652_0215278 3300046529 Bacteria 1447
1191 Ga0495654_0033076 3300046530 Bacteria 2618
1192 Ga0495665_0005008 3300046531 Bacteria 7143
1193 Ga0495665_0025875 3300046531 Bacteria 3151
1194 Ga0495640_0004918 3300046533 Bacteria 10617
1195 Ga0495640_0005552 3300046533 Bacteria 10028
1196 Ga0495640_0022509 3300046533 Bacteria 4603
1197 Ga0495640_0023678 3300046533 Bacteria 4468
1198 Ga0495586_0324083 3300046535 Bacteria 884
1199 Ga0495587_0001229 3300046536 Bacteria 16979
1200 Ga0495587_0009514 3300046536 Bacteria 6224
1201 Ga0495587_0026899 3300046536 Bacteria 3503
1202 Ga0495587_0043219 3300046536 Bacteria 2684
1203 Ga0495587_0065835 3300046536 Bacteria 2115
1204 Ga0495587_0105022 3300046536 Bacteria 1625
1205 Ga0495609_0012628 3300046538 Bacteria 4005
1206 Ga0495597_0014194 3300046542 Bacteria 3796
1207 Ga0495645_0005253 3300046543 Bacteria 8866
1208 Ga0495645_0005686 3300046543 Bacteria 8585
1209 Ga0495645_0014240 3300046543 Bacteria 5640
1210 Ga0495645_0055025 3300046543 Bacteria 2890
1211 Ga0495645_0081590 3300046543 Bacteria 2320
1212 Ga0495645_0195683 3300046543 Bacteria 1375
1213 Ga0495622_0029426 3300046557 Bacteria 2566
1214 Ga0495633_0008493 3300046558 Bacteria 5776
1215 Ga0495667_0010394 3300046559 Bacteria 6298
1216 Ga0495667_0022780 3300046559 Bacteria 4219
1217 Ga0495667_0051914 3300046559 Bacteria 2703
1218 Ga0495667_0312544 3300046559 Bacteria 995
1219 Ga0495667_0535197 3300046559 Bacteria 732
1220 Ga0495668_0000324 3300046616 Bacteria 65441
1221 Ga0495668_0042882 3300046616 Bacteria 2518
1222 Ga0495668_0111365 3300046616 Bacteria 1497
1223 Ga0495634_0001818 3300046642 Bacteria 18414
1224 Ga0495634_0021529 3300046642 Bacteria 4555
1225 Ga0495634_0044706 3300046642 Bacteria 2996
1226 Ga0495634_0080878 3300046642 Bacteria 2125
1227 Ga0495634_0088769 3300046642 Bacteria 2010
1228 Ga0495611_0013050 3300046648 Bacteria 3533
1229 Ga0495611_0053131 3300046648 Bacteria 1828
1230 Ga0495611_0102466 3300046648 Bacteria 1330
1231 Ga0495625_0000142 3300046660 Bacteria 110278
1232 Ga0495625_0021558 3300046660 Bacteria 4958
1233 Ga0495625_0035084 3300046660 Bacteria 3698
1234 Ga0495635_0000586 3300046663 Bacteria 23438
1235 Ga0495635_0003044 3300046663 Bacteria 11523
1236 Ga0495635_0009603 3300046663 Bacteria 6763
1237 Ga0495635_0009731 3300046663 Bacteria 6719
1238 Ga0495635_0035623 3300046663 Bacteria 3450
1239 Ga0495635_0104778 3300046663 Bacteria 1933
1240 Ga0495635_0221596 3300046663 Bacteria 1279
1241 Ga0495661_0017649 3300046665 Bacteria 4709
1242 Ga0495588_0013636 3300046674 Bacteria 3873
1243 Ga0495588_0031500 3300046674 Bacteria 2669
1244 Ga0495657_0000796 3300046675 Bacteria 28012
1245 Ga0495657_0020698 3300046675 Bacteria 4729
1246 Ga0495657_0021781 3300046675 Bacteria 4597
1247 Ga0495657_0021852 3300046675 Bacteria 4590
1248 Ga0495657_0023246 3300046675 Bacteria 4430
1249 Ga0495657_0029980 3300046675 Bacteria 3812
1250 Ga0495657_0140669 3300046675 Bacteria 1504
1251 Ga0495599_0005960 3300046678 Bacteria 7328
1252 Ga0495599_0008626 3300046678 Bacteria 6203
1253 Ga0495599_0044576 3300046678 Bacteria 2782
1254 Ga0495599_0077251 3300046678 Bacteria 2078
1255 Ga0495623_0029613 3300046679 Bacteria 3523
1256 Ga0495623_0034064 3300046679 Bacteria 3267
1257 Ga0495623_0051388 3300046679 Bacteria 2608
1258 Ga0495623_0189732 3300046679 Bacteria 1188
1259 Ga0495623_0219327 3300046679 Bacteria 1084
1260 Ga0495623_0228247 3300046679 Bacteria 1057
1261 Ga0495623_0270050 3300046679 Bacteria 950
1262 Ga0495646_0036830 3300046680 Bacteria 3028
1263 Ga0495658_0057579 3300046683 Bacteria 2220
1264 Ga0495658_0246094 3300046683 Bacteria 1124
1265 Ga0495613_0002324 3300046689 Bacteria 14400
1266 Ga0495613_0013394 3300046689 Bacteria 6092
1267 Ga0495613_0032346 3300046689 Bacteria 3885
1268 Ga0495613_0220454 3300046689 Bacteria 1332
1269 Ga0495613_0284100 3300046689 Bacteria 1148
1270 Ga0495613_0437322 3300046689 Bacteria 888
1271 Ga0495613_0459133 3300046689 Bacteria 862
1272 Ga0495613_0563143 3300046689 Bacteria 761
1273 Ga0495624_0004583 3300046690 Bacteria 10091
1274 Ga0495624_0174366 3300046690 Bacteria 1311
1275 Ga0495624_0433900 3300046690 Bacteria 787
1276 Ga0495670_0039497 3300046691 Bacteria 2354
1277 Ga0495670_0199162 3300046691 Bacteria 1060
1278 Ga0495649_0050901 3300046694 Bacteria 2246
1279 Ga0495649_0090197 3300046694 Bacteria 1634
1280 Ga0495589_0006450 3300046794 Bacteria 6186
1281 Ga0495589_0048666 3300046794 Bacteria 2098
1282 Ga0495600_0001390 3300046809 Bacteria 13370
1283 Ga0495600_0003691 3300046809 Bacteria 9041
1284 Ga0495600_0006527 3300046809 Bacteria 7099
1285 Ga0495600_0050254 3300046809 Bacteria 2720
1286 Ga0495600_0052676 3300046809 Bacteria 2657
1287 Ga0495600_0068545 3300046809 Bacteria 2318
1288 Ga0495600_0143526 3300046809 Bacteria 1548
1289 Ga0495600_0317482 3300046809 Bacteria 980
1290 Ga0495660_0074787 3300046810 Bacteria 1788
1291 Ga0495581_0004218 3300047315 Bacteria 8283
1292 Ga0495581_0043172 3300047315 Bacteria 2608
1293 Ga0495581_0082513 3300047315 Bacteria 1861
1294 Ga0495581_0095064 3300047315 Bacteria 1730
1295 Ga0495604_0000228 3300047317 Bacteria 50550
1296 Ga0495604_0000695 3300047317 Bacteria 28567
1297 Ga0495604_0004263 3300047317 Bacteria 11322
1298 Ga0495604_0027568 3300047317 Bacteria 4516
1299 Ga0495604_0031309 3300047317 Bacteria 4220
1300 Ga0495604_0079704 3300047317 Bacteria 2455
1301 Ga0495604_0139619 3300047317 Bacteria 1732
1302 Ga0495604_0169087 3300047317 Bacteria 1539
1303 Ga0495636_0002781 3300047318 Bacteria 6752
1304 Ga0495636_0007046 3300047318 Bacteria 4422
1305 Ga0495636_0022839 3300047318 Bacteria 2531
1306 Ga0495636_0255419 3300047318 Bacteria 811
1307 Ga0495674_0003948 3300047319 Bacteria 14392
1308 Ga0495674_0032463 3300047319 Bacteria 4734
1309 Ga0495674_0033850 3300047319 Bacteria 4624
1310 Ga0495674_0484515 3300047319 Bacteria 991
1311 Ga0495672_0002122 3300047320 Bacteria 18588
1312 Ga0495672_0026116 3300047320 Bacteria 3730
1313 Ga0495672_0028599 3300047320 Bacteria 3523
1314 Ga0495676_0000613 3300047321 Bacteria 29512
1315 Ga0495676_0002514 3300047321 Bacteria 16325
1316 Ga0495676_0005115 3300047321 Bacteria 12022
1317 Ga0495676_0009942 3300047321 Bacteria 8642
1318 Ga0495676_0019817 3300047321 Bacteria 5911
1319 Ga0495676_0025430 3300047321 Bacteria 5111
1320 Ga0495676_0094001 3300047321 Bacteria 2234
1321 Ga0495680_0016459 3300047322 Bacteria 6350
1322 Ga0495680_0026448 3300047322 Bacteria 4782
1323 Ga0495680_0042132 3300047322 Bacteria 3625
1324 Ga0495680_0096193 3300047322 Bacteria 2212
1325 Ga0495683_0083660 3300047323 Bacteria 1553
1326 Ga0495683_0261685 3300047323 Bacteria 755
1327 Ga0495687_003278 3300047443 Bacteria 11919
1328 Ga0495687_005559 3300047443 Bacteria 7993
1329 Ga0495687_025871 3300047443 Bacteria 2767
1330 Ga0495675_0045615 3300047444 Bacteria 2791
1331 Ga0495675_0068124 3300047444 Bacteria 2248
1332 Ga0495675_0242492 3300047444 Bacteria 1084
1333 Ga0495675_0261027 3300047444 Bacteria 1038
1334 Ga0495675_0274608 3300047444 Bacteria 1006
1335 Ga0495677_0080392 3300047445 Bacteria 1221
1336 Ga0495685_007505 3300047447 Bacteria 3602
1337 Ga0495685_010371 3300047447 Bacteria 3123
1338 Ga0495685_012966 3300047447 Bacteria 2826
1339 Ga0495685_028167 3300047447 Bacteria 1932
1340 Ga0495685_035141 3300047447 Bacteria 1722
1341 Ga0495685_133250 3300047447 Bacteria 812
1342 Ga0495681_0003919 3300047470 Bacteria 10262
1343 Ga0495684_0002870 3300047471 Bacteria 13570
1344 Ga0495684_0007089 3300047471 Bacteria 8699
1345 Ga0495684_0017005 3300047471 Bacteria 5604
1346 Ga0495684_0022111 3300047471 Bacteria 4896
1347 Ga0495684_0104437 3300047471 Bacteria 2141
1348 Ga0495686_0012981 3300047472 Bacteria 5804
1349 Ga0495686_0017187 3300047472 Bacteria 4881
1350 Ga0495593_0001318 3300047673 Bacteria 14549
1351 Ga0495593_0021544 3300047673 Bacteria 3598
1352 Ga0495593_0047284 3300047673 Bacteria 2289
1353 Ga0495593_0050323 3300047673 Bacteria 2208
1354 Ga0495593_0357732 3300047673 Bacteria 729
1355 Ga0495602_0028882 3300048088 Bacteria 5299
1356 Ga0495602_0048486 3300048088 Bacteria 3816
1357 Ga0495602_0070158 3300048088 Bacteria 3000
1358 Ga0495602_0096039 3300048088 Bacteria 2445
1359 Ga0495602_0117207 3300048088 Bacteria 2150
1360 Ga0495614_0000529 3300048089 Bacteria 15758
1361 Ga0495614_0049900 3300048089 Bacteria 1793
1362 Ga0495626_0000029 3300048091 Bacteria 202868
1363 Ga0495626_0063393 3300048091 Bacteria 1677
1364 Ga0496100_0000902 3300048903 Bacteria 14146
1365 Ga0496100_0161100 3300048903 Bacteria 1608
1366 Ga0496100_0751438 3300048903 Bacteria 763
1367 Ga0496101_0000024 3300048904 Bacteria 205570
1368 Ga0496101_0010909 3300048904 Bacteria 6013
1369 Ga0496101_0065081 3300048904 Bacteria 2657
1370 Ga0496101_0427325 3300048904 Bacteria 1044
1371 Ga0496101_0591272 3300048904 Bacteria 877
1372 Ga0496102_0000001 3300048905 Bacteria 873433
1373 Ga0496102_0003623 3300048905 Bacteria 13072
1374 Ga0496102_0029704 3300048905 Bacteria 4891
1375 Ga0496102_0070980 3300048905 Bacteria 3198
1376 Ga0496102_0174730 3300048905 Bacteria 2022
1377 Ga0496102_0226923 3300048905 Bacteria 1761
1378 Ga0496102_0293760 3300048905 Bacteria 1532
1379 Ga0496102_0459550 3300048905 Bacteria 1194
1380 Ga0496102_0565618 3300048905 Bacteria 1060
1381 Ga0496102_0649959 3300048905 Bacteria 978
1382 Ga0496102_0683337 3300048905 Bacteria 949
1383 Ga0496102_0856110 3300048905 Bacteria 831
1384 Ga0496102_0946529 3300048905 Bacteria 782
1385 Ga0496103_0000003 3300048906 Bacteria 603967
1386 Ga0496103_0006225 3300048906 Bacteria 7131
1387 Ga0496103_0111087 3300048906 Bacteria 1741
1388 Ga0496103_0209106 3300048906 Bacteria 1255
1389 Ga0496104_0001336 3300048907 Bacteria 21331
1390 Ga0496104_0036240 3300048907 Bacteria 4611
1391 Ga0496104_0061551 3300048907 Bacteria 3559
1392 Ga0496104_0092737 3300048907 Bacteria 2888
1393 Ga0496104_0133150 3300048907 Bacteria 2388
1394 Ga0496104_0186372 3300048907 Bacteria 1986
1395 Ga0496104_0215560 3300048907 Bacteria 1831
1396 Ga0496104_0366900 3300048907 Bacteria 1352
1397 Ga0496104_0389046 3300048907 Bacteria 1307
1398 Ga0496104_0573644 3300048907 Bacteria 1039
1399 Ga0496105_0028361 3300048908 Bacteria 4577
1400 Ga0496105_0030436 3300048908 Bacteria 4423
1401 Ga0496105_0153000 3300048908 Bacteria 1895
1402 Ga0496105_0331423 3300048908 Bacteria 1218
1403 Ga0496105_0638364 3300048908 Bacteria 823
1404 Ga0496106_0013278 3300048909 Bacteria 6080
1405 Ga0496106_0027215 3300048909 Bacteria 4258
1406 Ga0496106_0060923 3300048909 Bacteria 2862
1407 Ga0496106_0076508 3300048909 Bacteria 2565
1408 Ga0496106_0142411 3300048909 Bacteria 1886
1409 Ga0496106_0225478 3300048909 Bacteria 1495
1410 Ga0496106_0241191 3300048909 Bacteria 1444
1411 Ga0496106_0848364 3300048909 Bacteria 723
1412 Ga0496107_0005738 3300048910 Bacteria 8496
1413 Ga0496107_0021880 3300048910 Bacteria 4517
1414 Ga0496107_0083603 3300048910 Bacteria 2328
1415 Ga0496107_0365021 3300048910 Bacteria 1074
1416 Ga0496108_0001871 3300048911 Bacteria 16849
1417 Ga0496108_0084909 3300048911 Bacteria 2687
1418 Ga0496108_0183127 3300048911 Bacteria 1814
1419 Ga0496108_0214627 3300048911 Bacteria 1671
1420 Ga0496108_0219585 3300048911 Bacteria 1651
1421 Ga0496108_0241297 3300048911 Bacteria 1572
1422 Ga0496108_0261671 3300048911 Bacteria 1505
1423 Ga0496108_0361090 3300048911 Bacteria 1268
1424 Ga0496109_0047020 3300048912 Bacteria 3921
1425 Ga0496109_0160469 3300048912 Bacteria 2106
1426 Ga0496109_0179586 3300048912 Bacteria 1987
1427 Ga0496109_0336019 3300048912 Bacteria 1426
1428 Ga0496109_0390369 3300048912 Bacteria 1315
1429 Ga0496109_0557682 3300048912 Bacteria 1081
1430 Ga0496110_0004560 3300048913 Bacteria 10759
1431 Ga0496110_0010542 3300048913 Bacteria 7523
1432 Ga0496110_0028288 3300048913 Bacteria 4813
1433 Ga0496110_0053232 3300048913 Bacteria 3557
1434 Ga0496110_0110093 3300048913 Bacteria 2474
1435 Ga0496110_0118475 3300048913 Bacteria 2384
1436 Ga0496110_0195278 3300048913 Bacteria 1838
1437 Ga0496110_0320917 3300048913 Bacteria 1411
1438 Ga0496111_0022705 3300048914 Bacteria 4395
1439 Ga0496111_0096721 3300048914 Bacteria 2167
1440 Ga0496111_0176082 3300048914 Bacteria 1590
1441 Ga0496111_0186492 3300048914 Bacteria 1542
1442 Ga0496111_0232079 3300048914 Bacteria 1370
1443 Ga0496111_0240230 3300048914 Bacteria 1345
1444 Ga0496111_0360440 3300048914 Bacteria 1076
1445 Ga0496111_0608867 3300048914 Bacteria 799
1446 Ga0496112_0001680 3300048915 Bacteria 17227
1447 Ga0496112_0005593 3300048915 Bacteria 10896
1448 Ga0496112_0015710 3300048915 Bacteria 7071
1449 Ga0496112_0026027 3300048915 Bacteria 5624
1450 Ga0496112_0050251 3300048915 Bacteria 4088
1451 Ga0496112_0106638 3300048915 Bacteria 2772
1452 Ga0496112_0135361 3300048915 Bacteria 2434
1453 Ga0496112_0159736 3300048915 Bacteria 2220
1454 Ga0496112_0233423 3300048915 Bacteria 1794
1455 Ga0496112_0302920 3300048915 Bacteria 1544
1456 Ga0496112_0605934 3300048915 Bacteria 1027
1457 Ga0496112_0852405 3300048915 Bacteria 834
1458 Ga0496113_0011976 3300048916 Bacteria 5814
1459 Ga0496113_0049854 3300048916 Bacteria 3119
1460 Ga0496113_0091633 3300048916 Bacteria 2343
1461 Ga0496113_0189149 3300048916 Bacteria 1634
1462 Ga0496113_0203102 3300048916 Bacteria 1575
1463 Ga0496113_0312666 3300048916 Bacteria 1259
1464 Ga0496113_0330620 3300048916 Bacteria 1222
1465 Ga0496113_0344330 3300048916 Bacteria 1195
1466 Ga0496113_0411139 3300048916 Bacteria 1087
1467 Ga0496113_0430715 3300048916 Bacteria 1060
1468 Ga0496113_0493695 3300048916 Bacteria 983
1469 Ga0496114_0001736 3300048917 Bacteria 16536
1470 Ga0496114_0016099 3300048917 Bacteria 6018
1471 Ga0496114_0061530 3300048917 Bacteria 3140
1472 Ga0496114_0081713 3300048917 Bacteria 2730
1473 Ga0496114_0203074 3300048917 Bacteria 1736
1474 Ga0496114_0205891 3300048917 Bacteria 1724
1475 Ga0496114_0272448 3300048917 Bacteria 1492
1476 Ga0496114_0343733 3300048917 Bacteria 1319
1477 Ga0496114_0612843 3300048917 Bacteria 959
1478 Ga0496115_0016304 3300048918 Bacteria 5654
1479 Ga0496115_0023003 3300048918 Bacteria 4834
1480 Ga0496115_0023033 3300048918 Bacteria 4830
1481 Ga0496116_0000013 3300048919 Bacteria 603993
1482 Ga0496117_0000013 3300048920 Bacteria 603995
1483 Ga0496118_0000011 3300048921 Bacteria 603995
1484 Ga0496119_0000865 3300048922 Bacteria 39925
1485 Ga0496119_0032148 3300048922 Bacteria 3502
1486 Ga0496120_0000365 3300048923 Bacteria 73526
1487 Ga0496120_0015937 3300048923 Bacteria 4934
1488 Ga0496120_0038985 3300048923 Bacteria 2807
1489 Ga0496121_0000764 3300048924 Bacteria 59030
1490 Ga0496121_0022379 3300048924 Bacteria 6137
1491 Ga0496122_0046538 3300048925 Bacteria 3358
1492 Ga0496123_0010044 3300048926 Bacteria 8428
1493 Ga0496125_0311066 3300048928 Bacteria 960
1494 Ga0496126_0000351 3300048929 Bacteria 96459
1495 Ga0496126_0001675 3300048929 Bacteria 33240
1496 Ga0496126_0166346 3300048929 Bacteria 1882
1497 Ga0496126_0183020 3300048929 Bacteria 1779
1498 Ga0496126_0375370 3300048929 Bacteria 1159
1499 Ga0495678_056769 3300049459 Bacteria 1486
1500 Ga0501031_0018222 3300049568 Bacteria 4570
1501 Ga0501031_0157940 3300049568 Bacteria 1482
1502 Ga0501031_0309050 3300049568 Bacteria 1024
1503 Ga0501031_0334468 3300049568 Bacteria 980
1504 Ga0501031_0433081 3300049568 Bacteria 850
1505 Ga0501032_0001990 3300049569 Bacteria 16091
1506 Ga0501032_0003034 3300049569 Bacteria 13016
1507 Ga0501032_0010685 3300049569 Bacteria 6607
1508 Ga0501032_0042190 3300049569 Bacteria 3095
1509 Ga0501033_0009919 3300049570 Bacteria 7312
1510 Ga0501033_0030574 3300049570 Bacteria 4046
1511 Ga0501033_0033714 3300049570 Bacteria 3844
1512 Ga0501033_0092653 3300049570 Bacteria 2209
1513 Ga0501033_0156958 3300049570 Bacteria 1639
1514 Ga0501033_0174966 3300049570 Bacteria 1540
1515 Ga0501033_0309834 3300049570 Bacteria 1110
1516 Ga0501033_0335534 3300049570 Bacteria 1060
1517 Ga0501034_0003557 3300049571 Bacteria 17711
1518 Ga0501034_0005363 3300049571 Bacteria 14038
1519 Ga0501034_0005698 3300049571 Bacteria 13538
1520 Ga0501034_0005796 3300049571 Bacteria 13435
1521 Ga0501034_0018502 3300049571 Bacteria 7143
1522 Ga0501034_0045874 3300049571 Bacteria 4415
1523 Ga0501034_0078401 3300049571 Bacteria 3308
1524 Ga0501034_0089866 3300049571 Bacteria 3069
1525 Ga0501034_0097780 3300049571 Bacteria 2931
1526 Ga0501034_0151625 3300049571 Bacteria 2293
1527 Ga0501034_0219929 3300049571 Bacteria 1852
1528 Ga0501034_0267219 3300049571 Bacteria 1652
1529 Ga0501034_0722742 3300049571 Bacteria 893
1530 Ga0501036_0000553 3300049572 Bacteria 26858
1531 Ga0501036_0002888 3300049572 Bacteria 13624
1532 Ga0501036_0010697 3300049572 Bacteria 7584
1533 Ga0501036_0010804 3300049572 Bacteria 7544
1534 Ga0501036_0018835 3300049572 Bacteria 5790
1535 Ga0501036_0023104 3300049572 Bacteria 5234
1536 Ga0501036_0032873 3300049572 Bacteria 4386
1537 Ga0501036_0033695 3300049572 Bacteria 4331
1538 Ga0501036_0041752 3300049572 Bacteria 3881
1539 Ga0501036_0051941 3300049572 Bacteria 3471
1540 Ga0501036_0068045 3300049572 Bacteria 3013
1541 Ga0501036_0072883 3300049572 Bacteria 2903
1542 Ga0501036_0111450 3300049572 Bacteria 2312
1543 Ga0501036_0497795 3300049572 Bacteria 1014
1544 Ga0501037_0000436 3300049573 Bacteria 34343
1545 Ga0501037_0002550 3300049573 Bacteria 13171
1546 Ga0501037_0155175 3300049573 Bacteria 1634
1547 Ga0501037_0390170 3300049573 Bacteria 956
1548 Ga0501038_0002207 3300049574 Bacteria 18105
1549 Ga0501038_0005677 3300049574 Bacteria 11575
1550 Ga0501038_0014677 3300049574 Bacteria 7139
1551 Ga0501038_0027162 3300049574 Bacteria 5094
1552 Ga0501038_0051824 3300049574 Bacteria 3539
1553 Ga0501038_0061328 3300049574 Bacteria 3216
1554 Ga0501038_0070032 3300049574 Bacteria 2978
1555 Ga0501038_0095812 3300049574 Bacteria 2478
1556 Ga0501038_0144333 3300049574 Bacteria 1945
1557 Ga0501038_0233907 3300049574 Bacteria 1461
1558 Ga0501039_0000264 3300049575 Bacteria 38208
1559 Ga0501039_0001904 3300049575 Bacteria 15436
1560 Ga0501039_0002645 3300049575 Bacteria 13380
1561 Ga0501039_0032315 3300049575 Bacteria 4034
1562 Ga0501039_0132540 3300049575 Bacteria 1956
1563 Ga0501039_0394597 3300049575 Bacteria 1087
1564 Ga0501039_0422561 3300049575 Bacteria 1047
1565 Ga0501040_0025874 3300049576 Bacteria 3947
1566 Ga0501040_0053917 3300049576 Bacteria 2756
1567 Ga0501040_0066406 3300049576 Bacteria 2486
1568 Ga0501041_0000849 3300049577 Bacteria 16447
1569 Ga0501041_0008634 3300049577 Bacteria 6002
1570 Ga0501041_0044979 3300049577 Bacteria 2683
1571 Ga0501041_0102202 3300049577 Bacteria 1775
1572 Ga0501041_0268600 3300049577 Bacteria 1073
1573 Ga0501042_0001880 3300049578 Bacteria 12601
1574 Ga0501042_0015330 3300049578 Bacteria 5247
1575 Ga0501042_0028160 3300049578 Bacteria 3955
1576 Ga0501042_0070238 3300049578 Bacteria 2505
1577 Ga0501042_0115999 3300049578 Bacteria 1928
1578 Ga0501042_0129475 3300049578 Bacteria 1818
1579 Ga0501042_0342697 3300049578 Bacteria 1080
1580 Ga0501042_0556022 3300049578 Bacteria 834
1581 Ga0501043_0005890 3300049579 Bacteria 9861
1582 Ga0501043_0007809 3300049579 Bacteria 8457
1583 Ga0501043_0012256 3300049579 Bacteria 6702
1584 Ga0501043_0020943 3300049579 Bacteria 5127
1585 Ga0501043_0033681 3300049579 Bacteria 4031
1586 Ga0501043_0034126 3300049579 Bacteria 4003
1587 Ga0501043_0119835 3300049579 Bacteria 2063
1588 Ga0501043_0145680 3300049579 Bacteria 1855
1589 Ga0501043_0146961 3300049579 Bacteria 1845
1590 Ga0501043_0169728 3300049579 Bacteria 1702
1591 Ga0501046_0001119 3300049580 Bacteria 26186
1592 Ga0501046_0005490 3300049580 Bacteria 11326
1593 Ga0501046_0010017 3300049580 Bacteria 8164
1594 Ga0501046_0017503 3300049580 Bacteria 5978
1595 Ga0501046_0048146 3300049580 Bacteria 3377
1596 Ga0501047_0000029 3300049581 Bacteria 218396
1597 Ga0501047_0003260 3300049581 Bacteria 15389
1598 Ga0501047_0013772 3300049581 Bacteria 7681
1599 Ga0501047_0017015 3300049581 Bacteria 6951
1600 Ga0501047_0023366 3300049581 Bacteria 5936
1601 Ga0501047_0048348 3300049581 Bacteria 4108
1602 Ga0501047_0051699 3300049581 Bacteria 3971
1603 Ga0501047_0209074 3300049581 Bacteria 1810
1604 Ga0501047_0577209 3300049581 Bacteria 947
1605 Ga0501047_0889353 3300049581 Bacteria 704
1606 Ga0501048_0002755 3300049582 Bacteria 13406
1607 Ga0501048_0004538 3300049582 Bacteria 10568
1608 Ga0501048_0025711 3300049582 Bacteria 4288
1609 Ga0501048_0028654 3300049582 Bacteria 4042
1610 Ga0501067_0007326 3300049583 Bacteria 6128
1611 Ga0501068_0010484 3300049584 Bacteria 5209
1612 Ga0501068_0044576 3300049584 Bacteria 2671
1613 Ga0501068_0062071 3300049584 Bacteria 2271
1614 Ga0501068_0108969 3300049584 Bacteria 1721
1615 Ga0501068_0516303 3300049584 Bacteria 775
1616 Ga0501069_0000019 3300049585 Bacteria 129219
1617 Ga0501069_0024870 3300049585 Bacteria 3269
1618 Ga0501069_0038843 3300049585 Bacteria 2628
1619 Ga0501069_0091319 3300049585 Bacteria 1722
1620 Ga0501069_0111469 3300049585 Bacteria 1558
1621 Ga0501069_0125820 3300049585 Bacteria 1466
1622 Ga0501070_0000010 3300049586 Bacteria 192096
1623 Ga0501070_0000903 3300049586 Bacteria 27034
1624 Ga0501070_0001404 3300049586 Bacteria 21565
1625 Ga0501070_0004930 3300049586 Bacteria 11391
1626 Ga0501070_0040910 3300049586 Bacteria 3862
1627 Ga0501070_0079765 3300049586 Bacteria 2709
1628 Ga0501070_0157916 3300049586 Bacteria 1870
1629 Ga0501070_0163866 3300049586 Bacteria 1832
1630 Ga0501070_0389334 3300049586 Bacteria 1128
1631 Ga0501071_0001385 3300049587 Bacteria 13892
1632 Ga0501071_0005799 3300049587 Bacteria 7975
1633 Ga0501071_0008353 3300049587 Bacteria 6840
1634 Ga0501071_0090725 3300049587 Bacteria 2244
1635 Ga0501071_0305176 3300049587 Bacteria 1207
1636 Ga0501071_0310115 3300049587 Bacteria 1197
1637 Ga0501072_0001543 3300049588 Bacteria 17218
1638 Ga0501072_0017666 3300049588 Bacteria 5485
1639 Ga0501072_0191498 3300049588 Bacteria 1631
1640 Ga0501072_0247054 3300049588 Bacteria 1421
1641 Ga0501072_0445067 3300049588 Bacteria 1026
1642 Ga0501073_0022052 3300049589 Bacteria 4589
1643 Ga0501073_0127874 3300049589 Bacteria 1761
1644 Ga0501073_0371622 3300049589 Bacteria 987
1645 Ga0501074_0007022 3300049590 Bacteria 8130
1646 Ga0501074_0033492 3300049590 Bacteria 3723
1647 Ga0501074_0105620 3300049590 Bacteria 2016
1648 Ga0501074_0111740 3300049590 Bacteria 1955
1649 Ga0501075_0010149 3300049591 Bacteria 6609
1650 Ga0501075_0239047 3300049591 Bacteria 1385
1651 Ga0501075_0412306 3300049591 Bacteria 1030
1652 Ga0501076_0016555 3300049592 Bacteria 5589
1653 Ga0501076_0017575 3300049592 Bacteria 5437
1654 Ga0501076_0064922 3300049592 Bacteria 2910
1655 Ga0501076_0552935 3300049592 Bacteria 949
1656 Ga0501077_0010776 3300049593 Bacteria 5693
1657 Ga0501077_0081465 3300049593 Bacteria 2050
1658 Ga0501079_0005970 3300049741 Bacteria 9116
1659 Ga0501079_0031010 3300049741 Bacteria 4108
1660 Ga0501079_0032385 3300049741 Bacteria 4018
1661 Ga0501079_0067500 3300049741 Bacteria 2760
1662 Ga0501080_0001524 3300049742 Bacteria 19570
1663 Ga0501080_0026238 3300049742 Bacteria 5414
1664 Ga0501080_0029985 3300049742 Bacteria 5064
1665 Ga0501080_0036881 3300049742 Bacteria 4564
1666 Ga0501080_0107698 3300049742 Bacteria 2583
1667 Ga0501080_0387294 3300049742 Bacteria 1259
1668 Ga0501080_0589538 3300049742 Bacteria 987
1669 Ga0501081_0003705 3300049743 Bacteria 9785
1670 Ga0501081_0082309 3300049743 Bacteria 2255
1671 Ga0501083_0014418 3300049744 Bacteria 5526
1672 Ga0501083_0015133 3300049744 Bacteria 5401
1673 Ga0501083_0287590 3300049744 Bacteria 1069
1674 Ga0501035_0002105 3300049822 Bacteria 19784
1675 Ga0501035_0002519 3300049822 Bacteria 17915
1676 Ga0501035_0004257 3300049822 Bacteria 13582
1677 Ga0501035_0095144 3300049822 Bacteria 2619
1678 Ga0501035_0122194 3300049822 Bacteria 2275
1679 Ga0501035_0137866 3300049822 Bacteria 2123
1680 Ga0501044_0001501 3300049823 Bacteria 27346
1681 Ga0501044_0007347 3300049823 Bacteria 12111
1682 Ga0501044_0009230 3300049823 Bacteria 10770
1683 Ga0501044_0021769 3300049823 Bacteria 6836
1684 Ga0501044_0023137 3300049823 Bacteria 6613
1685 Ga0501044_0038017 3300049823 Bacteria 5027
1686 Ga0501044_0038724 3300049823 Bacteria 4978
1687 Ga0501044_0039115 3300049823 Bacteria 4950
1688 Ga0501044_0114577 3300049823 Bacteria 2701
1689 Ga0501044_0138166 3300049823 Bacteria 2426
1690 Ga0501044_0208952 3300049823 Bacteria 1907
1691 Ga0501045_0004137 3300049824 Bacteria 10021
1692 Ga0501045_0005095 3300049824 Bacteria 9094
1693 Ga0501045_0015881 3300049824 Bacteria 5340
1694 Ga0501045_0081372 3300049824 Bacteria 2388
1695 Ga0501045_0121774 3300049824 Bacteria 1937
1696 Ga0501045_0247603 3300049824 Bacteria 1327
1697 Ga0501045_0256404 3300049824 Bacteria 1302
1698 Ga0501045_0569205 3300049824 Bacteria 840
1699 nmdc:mga03683_93304_c1 3300050489 Bacteria 1315
1700 nmdc:mga03n38_107452_c1 3300050490 Bacteria 1354
1701 nmdc:mga03n38_3454_c2 3300050490 Bacteria 3198
1702 nmdc:mga03n38_58067_c1 3300050490 Bacteria 1752
1703 nmdc:mga03n38_61037_c1 3300050490 Bacteria 1716
1704 nmdc:mga03n38_90340_c1 3300050490 Bacteria 1457
1705 nmdc:mga03n38_90563_c1 3300050490 Bacteria 1455
1706 nmdc:mga00v17_131406_c1 3300050491 Bacteria 1600
1707 nmdc:mga00v17_141806_c1 3300050491 Bacteria 1541
1708 nmdc:mga00v17_147893_c1 3300050491 Bacteria 1508
1709 nmdc:mga00v17_1665_c1 3300050491 Bacteria 11569
1710 nmdc:mga00v17_179016_c1 3300050491 Bacteria 1368
1711 nmdc:mga00v17_18945_c1 3300050491 Bacteria 3919
1712 nmdc:mga00v17_206603_c1 3300050491 Bacteria 1270
1713 nmdc:mga00v17_252790_c1 3300050491 Bacteria 1143
1714 nmdc:mga00v17_322382_c1 3300050491 Bacteria 1004
1715 nmdc:mga0yw44_121865_c1 3300050492 Bacteria 1680
1716 nmdc:mga0yw44_153832_c1 3300050492 Bacteria 1502
1717 nmdc:mga0yw44_225353_c1 3300050492 Bacteria 1243
1718 nmdc:mga0yw44_24340_c1 3300050492 Bacteria 3425
1719 nmdc:mga0yw44_27966_c1 3300050492 Bacteria 3238
1720 nmdc:mga0yw44_37563_c1 3300050492 Bacteria 2860
1721 nmdc:mga0yw44_516811_c1 3300050492 Bacteria 810
1722 nmdc:mga0yw44_54043_c1 3300050492 Bacteria 2440
1723 nmdc:mga0yw44_74474_c1 3300050492 Bacteria 2115
1724 nmdc:mga0yw44_8278_c1 3300050492 Bacteria 5168
1725 nmdc:mga0k408_84184_c1 3300050493 Bacteria 1865
1726 nmdc:mga06z11_12332_c1 3300050494 Bacteria 3716
1727 nmdc:mga06z11_352192_c1 3300050494 Bacteria 882
1728 nmdc:mga06z11_406522_c1 3300050494 Bacteria 820
1729 nmdc:mga06z11_8290_c1 3300050494 Bacteria 4325
1730 nmdc:mga04h51_28168_c1 3300050495 Bacteria 1751
1731 nmdc:mga04h51_3073_c1 3300050495 Bacteria 4024
1732 nmdc:mga04h51_46527_c1 3300050495 Bacteria 1438
1733 nmdc:mga07m45_189943_c1 3300050496 Bacteria 1194
1734 nmdc:mga07m45_284769_c1 3300050496 Bacteria 961
1735 nmdc:mga07m45_33227_c1 3300050496 Bacteria 2864
1736 nmdc:mga07m45_44461_c1 3300050496 Bacteria 2493
1737 nmdc:mga07m45_81485_c1 3300050496 Bacteria 1848
1738 nmdc:mga07m45_91380_c1 3300050496 Bacteria 1744
1739 nmdc:mga05p37_290624_c1 3300050507 Bacteria 1946
1740 nmdc:mga0qj67_26634_c1 3300050509 Bacteria 4476
1741 nmdc:mga0qj67_64628_c1 3300050509 Bacteria 2911
1742 nmdc:mga06r32_123517_c1 3300050510 Bacteria 2555
1743 nmdc:mga08y16_350646_c1 3300050511 Bacteria 1516
1744 nmdc:mga08y16_733144_c1 3300050511 Bacteria 985
1745 nmdc:mga0n895_138604_c1 3300050512 Bacteria 2460
1746 nmdc:mga0n895_654696_c1 3300050512 Bacteria 1049
1747 nmdc:mga08x19_180405_c1 3300050514 Bacteria 1441
1748 nmdc:mga0sz30_1204_c1 3300050516 Bacteria 9274
1749 nmdc:mga0sz30_29592_c1 3300050516 Bacteria 2259
1750 nmdc:mga0sz30_57426_c1 3300050516 Bacteria 1659
1751 nmdc:mga0sz30_72062_c1 3300050516 Bacteria 1488
1752 Ga0495601_0012919 3300053077 Bacteria 5014
1753 Ga0495601_0117520 3300053077 Bacteria 1725
1754 Ga0495601_0275330 3300053077 Bacteria 1097
1755 Ga0495601_0278869 3300053077 Bacteria 1090
1756 Ga0495612_0003333 3300053078 Bacteria 6657
1757 Ga0495612_0076443 3300053078 Bacteria 1402
1758 Ga0495655_0062592 3300053083 Bacteria 1019
1759 Ga0495595_0017286 3300053084 Bacteria 3102
1760 Ga0495619_0084320 3300053085 Bacteria 2144
1761 Ga0495619_0114510 3300053085 Bacteria 1845
1762 Ga0495619_0577882 3300053085 Bacteria 770
1763 Ga0500643_016877 3300053087 Bacteria 2461
1764 Ga0500640_006196 3300053095 Bacteria 4541
1765 Ga0500641_0000536 3300053096 Bacteria 13678
1766 Ga0500641_0236367 3300053096 Bacteria 770
1767 Ga0500554_002010 3300053102 Bacteria 3945
1768 Ga0500560_122894 3300053107 Bacteria 870
1769 Ga0500642_0140937 3300053130 Bacteria 1131
1770 Ga0500559_0005196 3300053136 Bacteria 6009
1771 Ga0500577_0076596 3300053142 Bacteria 1324
1772 Ga0500624_001462 3300053157 Bacteria 3777
1773 Ga0501084_0000503 3300054114 Bacteria 29987
1774 Ga0501084_0004817 3300054114 Bacteria 11027
1775 Ga0501084_0020844 3300054114 Bacteria 5466
1776 Ga0501084_0030727 3300054114 Bacteria 4491
1777 Ga0501084_0041192 3300054114 Bacteria 3863
1778 Ga0501082_0014461 3300060353 Bacteria 6793
1779 Ga0501082_0019004 3300060353 Bacteria 5920
1780 Ga0501082_0072597 3300060353 Bacteria 2964
1781 Ga0466962_0000572 3300061719 Bacteria 16176
1782 Ga0466962_0000635 3300061719 Bacteria 15613
1783 Ga0466962_0011536 3300061719 Bacteria 4256
1784 Ga0466962_0017021 3300061719 Bacteria 3501
1785 Ga0466962_0070526 3300061719 Bacteria 1669
1786 Ga0466962_0076961 3300061719 Bacteria 1594
1787 Ga0466962_0186336 3300061719 Bacteria 1012
1788 Ga0530510_0011581 3300061734 Bacteria 6190
1789 Ga0530510_0026557 3300061734 Bacteria 4145
1790 Ga0530510_0093094 3300061734 Bacteria 2200
1791 Ga0530510_0187467 3300061734 Bacteria 1535

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049572 Ga0501036_0018835 Ga0501036_0018835_14_619 193
2 3300049574 Ga0501038_0233907 Ga0501038_0233907_11_616 193
3 3300028381 Ga0268264_10549079 Ga0268264_105490791 194
4 iso_pu_bacteria 2643221617 2644099044 195
5 iso_pu_bacteria 2643221620 2644114925 195
6 3300041491 Ga0451833_0575330 Ga0451833_0575330_2900_3508 197
7 3300041494 Ga0451837_0006231 Ga0451837_0006231_228_836 197
8 3300041496 Ga0451839_0178565 Ga0451839_0178565_121_729 197
9 3300013105 Ga0157369_10970809 Ga0157369_109708091 198
10 3300014497 Ga0182008_10017597 Ga0182008_100175972 198
11 3300048909 Ga0496106_0142411 Ga0496106_0142411_882_1493 198
12 3300049572 Ga0501036_0497795 Ga0501036_0497795_369_989 198
13 3300049742 Ga0501080_0387294 Ga0501080_0387294_625_1245 198
14 3300050490 nmdc:mga03n38_90340_c1 nmdc:mga03n38_90340_c1_715_1335 198
15 3300050492 nmdc:mga0yw44_37563_c1 nmdc:mga0yw44_37563_c1_1303_1923 198
16 3300050492 nmdc:mga0yw44_54043_c1 nmdc:mga0yw44_54043_c1_1125_1745 198
17 3300050494 nmdc:mga06z11_352192_c1 nmdc:mga06z11_352192_c1_235_855 198
18 3300050495 nmdc:mga04h51_3073_c1 nmdc:mga04h51_3073_c1_1637_2257 198
19 3300037466 Ga0395898_0869723 Ga0395898_0869723_170_805 199
20 3300044683 Ga0466965_0012024 Ga0466965_0012024_77_712 199
21 3300005327 Ga0070658_10522255 Ga0070658_105222551 205
22 3300005614 Ga0068856_100029385 Ga0068856_1000293855 205
23 3300005983 Ga0081540_1013422 Ga0081540_10134224 205
24 3300037853 Ga0436364_1367194 Ga0436364_1367194_317_1027 206
25 3300031727 Ga0316576_10001449 Ga0316576_100014498 207
26 3300031728 Ga0316578_10018725 Ga0316578_100187252 207
27 iso_pu_bacteria 2643221576 2643889133 207
28 iso_pu_bacteria 2643221590 2643958188 207
29 3300005471 Ga0070698_100001131 Ga0070698_10000113132 209
30 3300025932 Ga0207690_10078476 Ga0207690_100784762 209
31 3300048913 Ga0496110_0320917 Ga0496110_0320917_338_985 209
32 3300049584 Ga0501068_0516303 Ga0501068_0516303_111_758 209
33 3300025939 Ga0207665_10000930 Ga0207665_1000093020 210
34 3300028573 Ga0265334_10005155 Ga0265334_100051553 210
35 3300044719 Ga0466971_0390932 Ga0466971_0390932_20_664 210
36 3300006881 Ga0068865_100893790 Ga0068865_1008937901 211
37 3300013105 Ga0157369_10750792 Ga0157369_107507922 211
38 3300025929 Ga0207664_10119911 Ga0207664_101199113 211
39 3300049571 Ga0501034_0089866 Ga0501034_0089866_1430_2074 211
40 3300049581 Ga0501047_0023366 Ga0501047_0023366_4128_4772 211
41 3300049590 Ga0501074_0007022 Ga0501074_0007022_279_923 211
42 iso_pu_bacteria 2738543011 2739237466 211
43 3300009147 Ga0114129_10664836 Ga0114129_106648363 212
44 3300009177 Ga0105248_10000152 Ga0105248_1000015231 212
45 3300014325 Ga0163163_10031953 Ga0163163_100319536 212
46 3300014968 Ga0157379_10000139 Ga0157379_1000013924 212
47 iso_pu_bacteria 2738541305 2738867913 212
48 3300005548 Ga0070665_100378423 Ga0070665_1003784232 213
49 3300006186 Ga0075369_10001333 Ga0075369_100013337 213
50 3300038443 Ga0395901_0187582 Ga0395901_0187582_32_685 213
51 3300039437 Ga0436365_0101945 Ga0436365_0101945_1455_2114 213
52 3300048911 Ga0496108_0214627 Ga0496108_0214627_191_862 213
53 3300049568 Ga0501031_0018222 Ga0501031_0018222_144_797 213
54 3300049572 Ga0501036_0041752 Ga0501036_0041752_1675_2328 213
55 3300049574 Ga0501038_0027162 Ga0501038_0027162_2973_3626 213
56 3300049575 Ga0501039_0132540 Ga0501039_0132540_963_1616 213
57 3300049577 Ga0501041_0044979 Ga0501041_0044979_1386_2039 213
58 3300049578 Ga0501042_0129475 Ga0501042_0129475_993_1646 213
59 3300049579 Ga0501043_0034126 Ga0501043_0034126_1779_2432 213
60 3300049580 Ga0501046_0048146 Ga0501046_0048146_2561_3214 213
61 3300049584 Ga0501068_0044576 Ga0501068_0044576_1553_2206 213
62 3300049587 Ga0501071_0090725 Ga0501071_0090725_962_1615 213
63 3300049588 Ga0501072_0191498 Ga0501072_0191498_240_893 213
64 3300049590 Ga0501074_0105620 Ga0501074_0105620_518_1171 213
65 3300049741 Ga0501079_0031010 Ga0501079_0031010_3100_3753 213
66 3300049822 Ga0501035_0137866 Ga0501035_0137866_776_1429 213
67 3300049824 Ga0501045_0004137 Ga0501045_0004137_6648_7301 213
68 3300050511 nmdc:mga08y16_733144_c1 nmdc:mga08y16_733144_c1_202_969 213
69 3300050516 nmdc:mga0sz30_1204_c1 nmdc:mga0sz30_1204_c1_4007_4774 213
70 3300054114 Ga0501084_0030727 Ga0501084_0030727_189_842 213
71 3300060353 Ga0501082_0072597 Ga0501082_0072597_95_748 213
72 3300061734 Ga0530510_0093094 Ga0530510_0093094_1026_1679 213
73 iso_pu_bacteria 2868088558 2868093692 213
74 3300005329 Ga0070683_100575967 Ga0070683_1005759672 214
75 3300005345 Ga0070692_10098436 Ga0070692_100984362 214
76 3300005356 Ga0070674_100258471 Ga0070674_1002584712 214
77 3300005456 Ga0070678_100214016 Ga0070678_1002140162 214
78 3300005843 Ga0068860_100189175 Ga0068860_1001891752 214
79 3300009148 Ga0105243_10112015 Ga0105243_101120152 214
80 3300013308 Ga0157375_10112130 Ga0157375_101121302 214
81 3300017792 Ga0163161_10048885 Ga0163161_100488852 214
82 3300025937 Ga0207669_10308428 Ga0207669_103084282 214
83 3300025961 Ga0207712_11040665 Ga0207712_110406651 214
84 3300025972 Ga0207668_10158510 Ga0207668_101585102 214
85 3300026075 Ga0207708_10220862 Ga0207708_102208622 214
86 3300031247 Ga0265340_10009973 Ga0265340_100099734 214
87 3300031344 Ga0265316_10091535 Ga0265316_100915353 214
88 3300031711 Ga0265314_10085745 Ga0265314_100857451 214
89 3300044901 Ga0466960_0001422 Ga0466960_0001422_1514_2158 214
90 3300046536 Ga0495587_0105022 Ga0495587_0105022_702_1355 214
91 iso_pu_bacteria 2565956761 2566995383 214
92 iso_pu_bacteria 2791355406 2793985229 214
93 iso_pu_bacteria 2802429296 2804847904 214
94 iso_pu_bacteria 2808606982 2811844411 214
95 iso_pu_bacteria 2818991472 2819740633 214
96 iso_pu_bacteria 2862290372 2862293495 214
97 iso_pu_bacteria 2867475112 2867476801 214
98 iso_pu_bacteria 2887478801 2887483002 214
99 iso_pu_bacteria 2889300758 2889302608 214
100 iso_pu_bacteria 2904535858 2904541858 214
101 iso_pu_bacteria 2922554459 2922559080 214
102 iso_pu_bacteria 2939743619 2939748489 214
103 iso_pu_bacteria 2995463766 2995467125 214
104 iso_pu_bacteria 2997451912 2997452866 214
105 iso_pu_bacteria 2997600082 2997606047 214
106 iso_pu_bacteria 8025413630 8025419412 214
107 iso_pu_bacteria 8047893842 8047896102 214
108 iso_pu_bacteria 8048127548 8048132263 214
109 iso_pu_bacteria 8048356638 8048362833 214
110 iso_pu_bacteria 8048369669 8048373127 214
111 iso_pu_bacteria 8048379754 8048382060 214
112 iso_pu_bacteria 8054160619 8054163304 214
113 iso_pu_bacteria 8056447290 8056453800 214
114 3300005841 Ga0068863_100189796 Ga0068863_1001897962 215
115 3300009094 Ga0111539_10681346 Ga0111539_106813462 215
116 3300014325 Ga0163163_10297703 Ga0163163_102977033 215
117 3300021358 Ga0213873_10000035 Ga0213873_1000003532 215
118 3300025935 Ga0207709_10003326 Ga0207709_100033269 215
119 3300025938 Ga0207704_10465432 Ga0207704_104654321 215
120 3300027907 Ga0207428_10352299 Ga0207428_103522992 215
121 3300031727 Ga0316576_10293638 Ga0316576_102936382 215
122 3300031728 Ga0316578_10000584 Ga0316578_1000058411 215
123 3300031733 Ga0316577_10121549 Ga0316577_101215491 215
124 3300032133 Ga0316583_10031824 Ga0316583_100318243 215
125 3300032137 Ga0316585_10002358 Ga0316585_100023583 215
126 3300032139 Ga0316580_10001663 Ga0316580_100016633 215
127 3300035398 Ga0316574_0001518 Ga0316574_0001518_7792_8481 215
128 3300036647 Ga0316582_0004409 Ga0316582_0004409_3315_4004 215
129 3300044683 Ga0466965_0013526 Ga0466965_0013526_801_1463 215
130 3300044684 Ga0466966_0018617 Ga0466966_0018617_136_786 215
131 3300044693 Ga0466961_0094065 Ga0466961_0094065_244_906 215
132 3300044694 Ga0466963_0005739 Ga0466963_0005739_121_771 215
133 3300044706 Ga0466964_0171455 Ga0466964_0171455_347_1009 215
134 3300044719 Ga0466971_0004447 Ga0466971_0004447_4219_4869 215
135 3300044719 Ga0466971_0057877 Ga0466971_0057877_157_819 215
136 3300044735 Ga0466968_0000563 Ga0466968_0000563_3427_4077 215
137 3300044765 Ga0466970_0007188 Ga0466970_0007188_2195_2845 215
138 3300044765 Ga0466970_0048239 Ga0466970_0048239_996_1658 215
139 3300044842 Ga0466957_0027521 Ga0466957_0027521_103_753 215
140 3300045049 Ga0466959_0004252 Ga0466959_0004252_4270_4920 215
141 3300045836 Ga0466958_0006755 Ga0466958_0006755_94_744 215
142 3300045836 Ga0466958_0143514 Ga0466958_0143514_829_1491 215
143 3300045976 Ga0466967_0220934 Ga0466967_0220934_719_1381 215
144 3300046663 Ga0495635_0104778 Ga0495635_0104778_1047_1718 215
145 3300048905 Ga0496102_0856110 Ga0496102_0856110_148_801 215
146 3300048908 Ga0496105_0331423 Ga0496105_0331423_213_866 215
147 3300048914 Ga0496111_0360440 Ga0496111_0360440_37_699 215
148 3300048917 Ga0496114_0061530 Ga0496114_0061530_1455_2108 215
149 3300048917 Ga0496114_0203074 Ga0496114_0203074_626_1288 215
150 3300050511 nmdc:mga08y16_350646_c1 nmdc:mga08y16_350646_c1_324_986 215
151 3300061719 Ga0466962_0017021 Ga0466962_0017021_669_1319 215
152 iso_pu_bacteria 2527291629 2528214862 215
153 iso_pu_bacteria 2546825537 2546949581 215
154 iso_pu_bacteria 2579778521 2579856223 215
155 iso_pu_bacteria 2582580736 2583150595 215
156 iso_pu_bacteria 2619618881 2619858999 215
157 iso_pu_bacteria 2619619003 2620349317 215
158 iso_pu_bacteria 2626541554 2626639205 215
159 iso_pu_bacteria 2675903060 2676494820 215
160 iso_pu_bacteria 2684623036 2686542379 215
161 iso_pu_bacteria 2751185734 2753072622 215
162 iso_pu_bacteria 2773857762 2774396856 215
163 iso_pu_bacteria 2773857924 2774865539 215
164 iso_pu_bacteria 2791354901 2791910802 215
165 iso_pu_bacteria 2795385470 2795783784 215
166 iso_pu_bacteria 2816332119 2816427283 215
167 iso_pu_bacteria 2863067949 2863070870 215
168 iso_pu_bacteria 2866612099 2866615793 215
169 iso_pu_bacteria 2870721527 2870726922 215
170 iso_pu_bacteria 2870782633 2870783854 215
171 iso_pu_bacteria 2891968417 2891969560 215
172 iso_pu_bacteria 2895427314 2895438695 215
173 iso_pu_bacteria 2899359706 2899363466 215
174 iso_pu_bacteria 2899370129 2899373585 215
175 iso_pu_bacteria 2915358134 2915359820 215
176 iso_pu_bacteria 2915768154 2915774696 215
177 iso_pu_bacteria 2917736166 2917742064 215
178 iso_pu_bacteria 2984576629 2984576820 215
179 iso_pu_bacteria 2990256926 2990258568 215
180 iso_pu_bacteria 3006321560 3006322588 215
181 iso_pu_bacteria 3006425503 3006429894 215
182 iso_pu_bacteria 637000116 637881021 215
183 iso_pu_bacteria 8003314358 8003317419 215
184 iso_pu_bacteria 8054913762 8054913877 215
185 iso_pu_bacteria 8054920844 8054926735 215
186 iso_pu_bacteria 8055157932 8055162631 215
187 iso_pu_bacteria 8057568493 8057569187 215
188 3300003203 JGI25406J46586_10001005 JGI25406J46586_1000100512 216
189 3300005338 Ga0068868_100182456 Ga0068868_1001824562 216
190 3300005347 Ga0070668_100017367 Ga0070668_1000173676 216
191 3300005365 Ga0070688_100110943 Ga0070688_1001109432 216
192 3300005535 Ga0070684_100419718 Ga0070684_1004197182 216
193 3300005937 Ga0081455_10000070 Ga0081455_100000702 216
194 3300005985 Ga0081539_10000128 Ga0081539_10000128171 216
195 3300006038 Ga0075365_10024218 Ga0075365_100242184 216
196 3300009148 Ga0105243_10736677 Ga0105243_107366772 216
197 3300009148 Ga0105243_10759292 Ga0105243_107592922 216
198 3300009551 Ga0105238_10071115 Ga0105238_100711152 216
199 3300009553 Ga0105249_11299314 Ga0105249_112993141 216
200 3300025935 Ga0207709_10901191 Ga0207709_109011911 216
201 3300025937 Ga0207669_10958100 Ga0207669_109581001 216
202 3300025941 Ga0207711_10002425 Ga0207711_100024256 216
203 3300025972 Ga0207668_10087897 Ga0207668_100878974 216
204 3300026035 Ga0207703_10000001 Ga0207703_10000001392 216
205 3300028794 Ga0307515_10046879 Ga0307515_100468793 216
206 3300028794 Ga0307515_10136837 Ga0307515_101368372 216
207 3300030522 Ga0307512_10131466 Ga0307512_101314663 216
208 3300031456 Ga0307513_10152367 Ga0307513_101523672 216
209 3300031456 Ga0307513_10199371 Ga0307513_101993712 216
210 3300031824 Ga0307413_10169459 Ga0307413_101694593 216
211 3300031995 Ga0307409_100202710 Ga0307409_1002027102 216
212 3300032002 Ga0307416_100008730 Ga0307416_1000087306 216
213 3300033179 Ga0307507_10254740 Ga0307507_102547401 216
214 3300033180 Ga0307510_10137760 Ga0307510_101377602 216
215 3300035691 Ga0373931_0000027 Ga0373931_0000027_94093_94743 216
216 3300044693 Ga0466961_0014875 Ga0466961_0014875_2120_2770 216
217 3300044693 Ga0466961_0111071 Ga0466961_0111071_587_1237 216
218 3300044694 Ga0466963_0074366 Ga0466963_0074366_876_1526 216
219 3300045976 Ga0466967_0397160 Ga0466967_0397160_487_1164 216
220 3300049572 Ga0501036_0072883 Ga0501036_0072883_1733_2410 216
221 3300049576 Ga0501040_0066406 Ga0501040_0066406_425_1102 216
222 3300049577 Ga0501041_0102202 Ga0501041_0102202_91_768 216
223 3300049578 Ga0501042_0070238 Ga0501042_0070238_1705_2382 216
224 3300049588 Ga0501072_0247054 Ga0501072_0247054_689_1366 216
225 3300049590 Ga0501074_0111740 Ga0501074_0111740_948_1625 216
226 3300049591 Ga0501075_0412306 Ga0501075_0412306_195_872 216
227 3300049592 Ga0501076_0064922 Ga0501076_0064922_237_914 216
228 3300049743 Ga0501081_0082309 Ga0501081_0082309_1591_2241 216
229 3300049824 Ga0501045_0081372 Ga0501045_0081372_445_1122 216
230 3300050490 nmdc:mga03n38_61037_c1 nmdc:mga03n38_61037_c1_957_1625 216
231 3300050491 nmdc:mga00v17_131406_c1 nmdc:mga00v17_131406_c1_113_781 216
232 3300050492 nmdc:mga0yw44_27966_c1 nmdc:mga0yw44_27966_c1_1468_2142 216
233 3300050496 nmdc:mga07m45_91380_c1 nmdc:mga07m45_91380_c1_474_1139 216
234 3300053102 Ga0500554_002010 Ga0500554_002010_2471_3139 216
235 3300053142 Ga0500577_0076596 Ga0500577_0076596_654_1304 216
236 iso_pu_bacteria 2554235005 2554256225 216
237 iso_pu_bacteria 2582581312 2585296614 216
238 iso_pu_bacteria 2582581313 2585309057 216
239 iso_pu_bacteria 2582581314 2585319247 216
240 iso_pu_bacteria 2616644814 2616697299 216
241 iso_pu_bacteria 2616644941 2616903243 216
242 iso_pu_bacteria 2643221578 2643902258 216
243 iso_pu_bacteria 2643221587 2643943915 216
244 iso_pu_bacteria 2643221615 2644090627 216
245 iso_pu_bacteria 2643221641 2644230695 216
246 iso_pu_bacteria 2643221647 2644265807 216
247 iso_pu_bacteria 2643221657 2644320431 216
248 iso_pu_bacteria 2643221670 2644386899 216
249 iso_pu_bacteria 2643221677 2644434652 216
250 iso_pu_bacteria 2643221678 2644440052 216
251 iso_pu_bacteria 2643221682 2644461546 216
252 iso_pu_bacteria 2643221714 2644632623 216
253 iso_pu_bacteria 2739367898 2740167672 216
254 iso_pu_bacteria 2784132148 2784590415 216
255 iso_pu_bacteria 2784746763 2785341200 216
256 iso_pu_bacteria 2784746768 2785371503 216
257 iso_pu_bacteria 2786546132 2786672661 216
258 iso_pu_bacteria 2808606359 2808844030 216
259 iso_pu_bacteria 2808606375 2808913626 216
260 iso_pu_bacteria 2808606448 2809234088 216
261 iso_pu_bacteria 2811994874 2812332235 216
262 iso_pu_bacteria 2811994879 2812355941 216
263 iso_pu_bacteria 2818991463 2819694627 216
264 iso_pu_bacteria 2852635781 2852641023 216
265 iso_pu_bacteria 2855386786 2855390641 216
266 iso_pu_bacteria 2862178590 2862186414 216
267 iso_pu_bacteria 2862281513 2862284745 216
268 iso_pu_bacteria 2862382967 2862390429 216
269 iso_pu_bacteria 2862507626 2862512676 216
270 iso_pu_bacteria 2862574272 2862577506 216
271 iso_pu_bacteria 2863404153 2863408618 216
272 iso_pu_bacteria 2867369537 2867373872 216
273 iso_pu_bacteria 2867428634 2867436323 216
274 iso_pu_bacteria 2873151551 2873154052 216
275 iso_pu_bacteria 2875391855 2875396695 216
276 iso_pu_bacteria 2877676314 2877679103 216
277 iso_pu_bacteria 2912715099 2912717615 216
278 iso_pu_bacteria 2912723979 2912730155 216
279 iso_pu_bacteria 2912757875 2912762754 216
280 iso_pu_bacteria 2918501144 2918506508 216
281 iso_pu_bacteria 2919468124 2919471735 216
282 iso_pu_bacteria 2935390628 2935395077 216
283 iso_pu_bacteria 2946045630 2946047857 216
284 iso_pu_bacteria 2946064051 2946069846 216
285 iso_pu_bacteria 2946072368 2946077763 216
286 iso_pu_bacteria 2947224130 2947226953 216
287 iso_pu_bacteria 2954002825 2954005470 216
288 iso_pu_bacteria 2954380949 2954384007 216
289 iso_pu_bacteria 2954673503 2954678954 216
290 iso_pu_bacteria 2954682443 2954685198 216
291 iso_pu_bacteria 2954691527 2954694806 216
292 iso_pu_bacteria 2954701450 2954710008 216
293 iso_pu_bacteria 2954711539 2954714315 216
294 iso_pu_bacteria 2954721474 2954724264 216
295 iso_pu_bacteria 2954731030 2954737576 216
296 iso_pu_bacteria 2954740390 2954743161 216
297 iso_pu_bacteria 2954749733 2954756409 216
298 iso_pu_bacteria 2954759201 2954762119 216
299 iso_pu_bacteria 2966598605 2966600861 216
300 iso_pu_bacteria 2990059506 2990062945 216
301 iso_pu_bacteria 2990088156 2990089791 216
302 iso_pu_bacteria 3006393351 3006396761 216
303 iso_pu_bacteria 3006486233 3006490327 216
304 iso_pu_bacteria 3006493962 3006500123 216
305 iso_pu_bacteria 8008558824 8008562789 216
306 iso_pu_bacteria 8008574985 8008577165 216
307 iso_pu_bacteria 8023623736 8023627195 216
308 iso_pu_bacteria 8025530807 8025531304 216
309 iso_pu_bacteria 8048406513 8048411660 216
310 iso_pu_bacteria 8056667051 8056669776 216
311 iso_pu_bacteria 8056829672 8056832203 216
312 3300005327 Ga0070658_10129507 Ga0070658_101295072 217
313 3300005327 Ga0070658_10348255 Ga0070658_103482551 217
314 3300005339 Ga0070660_100324261 Ga0070660_1003242612 217
315 3300005530 Ga0070679_100034271 Ga0070679_1000342712 217
316 3300005548 Ga0070665_100000952 Ga0070665_10000095220 217
317 3300005563 Ga0068855_100030073 Ga0068855_1000300733 217
318 3300005563 Ga0068855_100227597 Ga0068855_1002275972 217
319 3300005563 Ga0068855_100741932 Ga0068855_1007419321 217
320 3300005578 Ga0068854_100538218 Ga0068854_1005382182 217
321 3300005841 Ga0068863_100002439 Ga0068863_10000243911 217
322 3300005843 Ga0068860_100000134 Ga0068860_10000013473 217
323 3300009093 Ga0105240_10028626 Ga0105240_100286264 217
324 3300009093 Ga0105240_10266883 Ga0105240_102668832 217
325 3300009177 Ga0105248_10637548 Ga0105248_106375482 217
326 3300010375 Ga0105239_10161014 Ga0105239_101610142 217
327 3300013105 Ga0157369_10025697 Ga0157369_100256973 217
328 3300013307 Ga0157372_10000057 Ga0157372_1000005738 217
329 3300014325 Ga0163163_10673735 Ga0163163_106737352 217
330 3300014968 Ga0157379_10047722 Ga0157379_100477222 217
331 3300025903 Ga0207680_10002130 Ga0207680_100021308 217
332 3300025909 Ga0207705_10230015 Ga0207705_102300152 217
333 3300025913 Ga0207695_10019678 Ga0207695_100196786 217
334 3300025921 Ga0207652_10438825 Ga0207652_104388252 217
335 3300025949 Ga0207667_10147319 Ga0207667_101473192 217
336 3300025949 Ga0207667_10434588 Ga0207667_104345882 217
337 3300025986 Ga0207658_10006218 Ga0207658_100062182 217
338 3300026088 Ga0207641_10006616 Ga0207641_100066168 217
339 3300028379 Ga0268266_10001060 Ga0268266_1000106016 217
340 3300028381 Ga0268264_10000206 Ga0268264_1000020647 217
341 3300028800 Ga0265338_10205173 Ga0265338_102051732 217
342 3300031241 Ga0265325_10049569 Ga0265325_100495692 217
343 3300031595 Ga0265313_10084080 Ga0265313_100840802 217
344 3300031824 Ga0307413_10196070 Ga0307413_101960702 217
345 3300031852 Ga0307410_10320740 Ga0307410_103207402 217
346 3300031995 Ga0307409_100119547 Ga0307409_1001195472 217
347 3300031995 Ga0307409_100392001 Ga0307409_1003920012 217
348 3300032126 Ga0307415_100174505 Ga0307415_1001745052 217
349 3300037466 Ga0395898_0024415 Ga0395898_0024415_4928_5581 217
350 3300037466 Ga0395898_0035080 Ga0395898_0035080_3439_4107 217
351 3300037853 Ga0436364_0034013 Ga0436364_0034013_4425_5078 217
352 3300038443 Ga0395901_0067099 Ga0395901_0067099_775_1443 217
353 3300038443 Ga0395901_0178181 Ga0395901_0178181_209_862 217
354 3300039437 Ga0436365_1353757 Ga0436365_1353757_15879_16532 217
355 3300042531 Ga0450918_016416 Ga0450918_016416_326_988 217
356 3300044658 Ga0466972_0017541 Ga0466972_0017541_1887_2558 217
357 3300044693 Ga0466961_0385820 Ga0466961_0385820_10_699 217
358 3300044842 Ga0466957_0639954 Ga0466957_0639954_49_708 217
359 3300045049 Ga0466959_0319937 Ga0466959_0319937_333_1022 217
360 3300045976 Ga0466967_0743845 Ga0466967_0743845_198_875 217
361 3300046689 Ga0495613_0437322 Ga0495613_0437322_79_738 217
362 3300048917 Ga0496114_0272448 Ga0496114_0272448_795_1448 217
363 3300048918 Ga0496115_0023003 Ga0496115_0023003_3646_4320 217
364 3300049568 Ga0501031_0309050 Ga0501031_0309050_71_724 217
365 3300049585 Ga0501069_0125820 Ga0501069_0125820_471_1130 217
366 3300049586 Ga0501070_0157916 Ga0501070_0157916_153_830 217
367 3300049586 Ga0501070_0389334 Ga0501070_0389334_422_1099 217
368 3300049588 Ga0501072_0445067 Ga0501072_0445067_234_911 217
369 3300049824 Ga0501045_0247603 Ga0501045_0247603_519_1172 217
370 3300049824 Ga0501045_0569205 Ga0501045_0569205_125_802 217
371 3300050490 nmdc:mga03n38_3454_c2 nmdc:mga03n38_3454_c2_507_1184 217
372 3300050491 nmdc:mga00v17_179016_c1 nmdc:mga00v17_179016_c1_49_726 217
373 3300050491 nmdc:mga00v17_252790_c1 nmdc:mga00v17_252790_c1_65_742 217
374 3300050491 nmdc:mga00v17_322382_c1 nmdc:mga00v17_322382_c1_67_744 217
375 3300050492 nmdc:mga0yw44_121865_c1 nmdc:mga0yw44_121865_c1_125_802 217
376 3300050492 nmdc:mga0yw44_153832_c1 nmdc:mga0yw44_153832_c1_763_1440 217
377 3300050492 nmdc:mga0yw44_225353_c1 nmdc:mga0yw44_225353_c1_250_927 217
378 3300050496 nmdc:mga07m45_33227_c1 nmdc:mga07m45_33227_c1_828_1505 217
379 iso_pu_bacteria 2856741275 2856743424 217
380 iso_pu_bacteria 2862705112 2862710929 217
381 iso_pu_bacteria 2891395885 2891404529 217
382 iso_pu_bacteria 2891554331 2891561806 217
383 iso_pu_bacteria 2891562705 2891565732 217
384 iso_pu_bacteria 2990044586 2990046178 217
385 iso_pu_bacteria 8008485437 8008491536 217
386 iso_pu_bacteria 8025524527 8025524592 217
387 3300003320 rootH2_10046720 rootH2_100467202 218
388 3300005330 Ga0070690_100040683 Ga0070690_1000406832 218
389 3300005334 Ga0068869_100330475 Ga0068869_1003304752 218
390 3300005343 Ga0070687_100447300 Ga0070687_1004473001 218
391 3300005365 Ga0070688_100509515 Ga0070688_1005095151 218
392 3300005366 Ga0070659_100061405 Ga0070659_1000614053 218
393 3300005434 Ga0070709_10002886 Ga0070709_100028865 218
394 3300005434 Ga0070709_10028129 Ga0070709_100281292 218
395 3300005435 Ga0070714_100036126 Ga0070714_1000361264 218
396 3300005435 Ga0070714_100721699 Ga0070714_1007216992 218
397 3300005436 Ga0070713_100078525 Ga0070713_1000785253 218
398 3300005436 Ga0070713_100505353 Ga0070713_1005053531 218
399 3300005437 Ga0070710_10002567 Ga0070710_100025677 218
400 3300005437 Ga0070710_10068259 Ga0070710_100682592 218
401 3300005439 Ga0070711_100168711 Ga0070711_1001687111 218
402 3300005441 Ga0070700_100040434 Ga0070700_1000404343 218
403 3300005445 Ga0070708_100387523 Ga0070708_1003875231 218
404 3300005455 Ga0070663_100309770 Ga0070663_1003097701 218
405 3300005457 Ga0070662_100350449 Ga0070662_1003504492 218
406 3300005467 Ga0070706_100486973 Ga0070706_1004869732 218
407 3300005467 Ga0070706_100555550 Ga0070706_1005555501 218
408 3300005468 Ga0070707_100204945 Ga0070707_1002049452 218
409 3300005471 Ga0070698_100382253 Ga0070698_1003822532 218
410 3300005518 Ga0070699_100007971 Ga0070699_1000079715 218
411 3300005518 Ga0070699_100336278 Ga0070699_1003362782 218
412 3300005535 Ga0070684_100092266 Ga0070684_1000922663 218
413 3300005543 Ga0070672_100252091 Ga0070672_1002520911 218
414 3300005545 Ga0070695_100227182 Ga0070695_1002271822 218
415 3300005546 Ga0070696_100331083 Ga0070696_1003310832 218
416 3300005548 Ga0070665_100461286 Ga0070665_1004612862 218
417 3300005564 Ga0070664_100548792 Ga0070664_1005487922 218
418 3300005615 Ga0070702_100036590 Ga0070702_1000365903 218
419 3300005617 Ga0068859_100074156 Ga0068859_1000741563 218
420 3300005618 Ga0068864_100126877 Ga0068864_1001268774 218
421 3300005719 Ga0068861_100167201 Ga0068861_1001672012 218
422 3300005840 Ga0068870_10003234 Ga0068870_100032345 218
423 3300005842 Ga0068858_100232607 Ga0068858_1002326072 218
424 3300005937 Ga0081455_10000782 Ga0081455_100007824 218
425 3300005983 Ga0081540_1000250 Ga0081540_100025022 218
426 3300005985 Ga0081539_10007650 Ga0081539_100076503 218
427 3300006028 Ga0070717_10048061 Ga0070717_100480612 218
428 3300006048 Ga0075363_100042509 Ga0075363_1000425092 218
429 3300006051 Ga0075364_10043165 Ga0075364_100431652 218
430 3300006051 Ga0075364_10064987 Ga0075364_100649872 218
431 3300006173 Ga0070716_100003420 Ga0070716_1000034204 218
432 3300006173 Ga0070716_100038292 Ga0070716_1000382922 218
433 3300006175 Ga0070712_100009935 Ga0070712_1000099354 218
434 3300006175 Ga0070712_100143627 Ga0070712_1001436272 218
435 3300006353 Ga0075370_10080071 Ga0075370_100800712 218
436 3300006353 Ga0075370_10336319 Ga0075370_103363191 218
437 3300006852 Ga0075433_10046325 Ga0075433_100463253 218
438 3300006871 Ga0075434_100049869 Ga0075434_1000498694 218
439 3300006871 Ga0075434_100277486 Ga0075434_1002774863 218
440 3300006914 Ga0075436_100085266 Ga0075436_1000852662 218
441 3300006914 Ga0075436_100169258 Ga0075436_1001692583 218
442 3300006931 Ga0097620_100074155 Ga0097620_1000741553 218
443 3300007076 Ga0075435_100075904 Ga0075435_1000759044 218
444 3300007076 Ga0075435_100282303 Ga0075435_1002823033 218
445 3300007076 Ga0075435_100385127 Ga0075435_1003851272 218
446 3300009093 Ga0105240_10536743 Ga0105240_105367433 218
447 3300009101 Ga0105247_10175098 Ga0105247_101750982 218
448 3300009148 Ga0105243_10019834 Ga0105243_100198344 218
449 3300009176 Ga0105242_10067924 Ga0105242_100679243 218
450 3300009176 Ga0105242_10105388 Ga0105242_101053883 218
451 3300009545 Ga0105237_10636820 Ga0105237_106368202 218
452 3300009553 Ga0105249_10134670 Ga0105249_101346704 218
453 3300010159 Ga0099796_10042679 Ga0099796_100426792 218
454 3300010375 Ga0105239_11101258 Ga0105239_111012581 218
455 3300011119 Ga0105246_10009301 Ga0105246_100093017 218
456 3300012505 Ga0157339_1002414 Ga0157339_10024143 218
457 3300013100 Ga0157373_10240362 Ga0157373_102403622 218
458 3300013105 Ga0157369_10000755 Ga0157369_1000075518 218
459 3300013306 Ga0163162_10425805 Ga0163162_104258052 218
460 3300014325 Ga0163163_10018689 Ga0163163_100186897 218
461 3300014325 Ga0163163_10049428 Ga0163163_100494284 218
462 3300014325 Ga0163163_10385466 Ga0163163_103854663 218
463 3300014326 Ga0157380_10084699 Ga0157380_100846993 218
464 3300020070 Ga0206356_11114730 Ga0206356_111147302 218
465 3300020081 Ga0206354_11578533 Ga0206354_115785335 218
466 3300021377 Ga0213874_10071077 Ga0213874_100710772 218
467 3300021388 Ga0213875_10004169 Ga0213875_100041695 218
468 3300025302 Ga0207426_1001450 Ga0207426_10014509 218
469 3300025302 Ga0207426_1025097 Ga0207426_10250973 218
470 3300025898 Ga0207692_10002504 Ga0207692_100025042 218
471 3300025899 Ga0207642_10003716 Ga0207642_100037163 218
472 3300025901 Ga0207688_10014701 Ga0207688_100147013 218
473 3300025906 Ga0207699_10012852 Ga0207699_100128524 218
474 3300025906 Ga0207699_10052615 Ga0207699_100526152 218
475 3300025908 Ga0207643_10009748 Ga0207643_100097484 218
476 3300025910 Ga0207684_10024036 Ga0207684_100240367 218
477 3300025912 Ga0207707_10340839 Ga0207707_103408393 218
478 3300025913 Ga0207695_10202854 Ga0207695_102028544 218
479 3300025915 Ga0207693_10016027 Ga0207693_100160274 218
480 3300025916 Ga0207663_10142302 Ga0207663_101423023 218
481 3300025917 Ga0207660_10425723 Ga0207660_104257232 218
482 3300025918 Ga0207662_10005906 Ga0207662_100059065 218
483 3300025919 Ga0207657_10011451 Ga0207657_100114518 218
484 3300025922 Ga0207646_10119621 Ga0207646_101196214 218
485 3300025922 Ga0207646_10155512 Ga0207646_101555123 218
486 3300025927 Ga0207687_10461736 Ga0207687_104617362 218
487 3300025928 Ga0207700_10004439 Ga0207700_100044392 218
488 3300025928 Ga0207700_10199728 Ga0207700_101997282 218
489 3300025928 Ga0207700_10444566 Ga0207700_104445661 218
490 3300025929 Ga0207664_10001700 Ga0207664_100017002 218
491 3300025929 Ga0207664_10050294 Ga0207664_100502944 218
492 3300025929 Ga0207664_10071211 Ga0207664_100712112 218
493 3300025929 Ga0207664_10336177 Ga0207664_103361771 218
494 3300025933 Ga0207706_10108055 Ga0207706_101080552 218
495 3300025936 Ga0207670_10190275 Ga0207670_101902752 218
496 3300025937 Ga0207669_10063457 Ga0207669_100634572 218
497 3300025939 Ga0207665_10000529 Ga0207665_1000052919 218
498 3300025939 Ga0207665_10046315 Ga0207665_100463154 218
499 3300025940 Ga0207691_10008539 Ga0207691_100085394 218
500 3300025942 Ga0207689_10007790 Ga0207689_100077903 218
501 3300025944 Ga0207661_10244915 Ga0207661_102449151 218
502 3300025961 Ga0207712_10254572 Ga0207712_102545722 218
503 3300025972 Ga0207668_10169771 Ga0207668_101697713 218
504 3300025981 Ga0207640_10145941 Ga0207640_101459413 218
505 3300026035 Ga0207703_10204287 Ga0207703_102042873 218
506 3300026067 Ga0207678_10108058 Ga0207678_101080584 218
507 3300026075 Ga0207708_10029336 Ga0207708_100293363 218
508 3300026078 Ga0207702_10101090 Ga0207702_101010904 218
509 3300026089 Ga0207648_10076716 Ga0207648_100767163 218
510 3300026095 Ga0207676_10091967 Ga0207676_100919673 218
511 3300026116 Ga0207674_10016729 Ga0207674_100167293 218
512 3300027866 Ga0209813_10041816 Ga0209813_100418162 218
513 3300030521 Ga0307511_10110642 Ga0307511_101106423 218
514 3300031616 Ga0307508_10199315 Ga0307508_101993152 218
515 3300031730 Ga0307516_10085486 Ga0307516_100854861 218
516 3300031824 Ga0307413_10139313 Ga0307413_101393132 218
517 3300031903 Ga0307407_10003930 Ga0307407_100039304 218
518 3300031995 Ga0307409_100000412 Ga0307409_1000004126 218
519 3300032002 Ga0307416_100076948 Ga0307416_1000769483 218
520 3300032002 Ga0307416_100153781 Ga0307416_1001537813 218
521 3300032126 Ga0307415_100000018 Ga0307415_10000001819 218
522 3300032126 Ga0307415_100004426 Ga0307415_1000044262 218
523 3300035083 Ga0373926_0031227 Ga0373926_0031227_41_697 218
524 3300035084 Ga0373928_0044372 Ga0373928_0044372_166_822 218
525 3300035086 Ga0373934_0021182 Ga0373934_0021182_333_989 218
526 3300035089 Ga0373944_0001987 Ga0373944_0001987_740_1396 218
527 3300035090 Ga0373949_0105116 Ga0373949_0105116_14_670 218
528 3300035091 Ga0373951_0016217 Ga0373951_0016217_527_1183 218
529 3300035112 Ga0373932_0026415 Ga0373932_0026415_101_757 218
530 3300035113 Ga0373936_0003301 Ga0373936_0003301_2078_2734 218
531 3300035114 Ga0373939_0091429 Ga0373939_0091429_247_903 218
532 3300035115 Ga0373941_0101622 Ga0373941_0101622_101_757 218
533 3300035116 Ga0373945_0005501 Ga0373945_0005501_1412_2068 218
534 3300035117 Ga0373953_0045985 Ga0373953_0045985_524_1180 218
535 3300035119 Ga0373956_0096423 Ga0373956_0096423_397_1053 218
536 3300035170 Ga0373943_0007579 Ga0373943_0007579_1986_2642 218
537 3300035172 Ga0373955_0066305 Ga0373955_0066305_372_1028 218
538 3300035242 Ga0373962_0031228 Ga0373962_0031228_233_889 218
539 3300035410 Ga0373924_0054401 Ga0373924_0054401_677_1333 218
540 3300035410 Ga0373924_0092426 Ga0373924_0092426_535_1191 218
541 3300035691 Ga0373931_0159679 Ga0373931_0159679_512_1168 218
542 3300035692 Ga0373935_0002764 Ga0373935_0002764_3561_4217 218
543 3300035692 Ga0373935_0156164 Ga0373935_0156164_634_1290 218
544 3300035695 Ga0373927_0007570 Ga0373927_0007570_1837_2493 218
545 3300035724 Ga0373933_0037969 Ga0373933_0037969_1919_2575 218
546 3300035725 Ga0373947_0005651 Ga0373947_0005651_2583_3239 218
547 3300036401 Ga0373937_0110491 Ga0373937_0110491_689_1345 218
548 3300036401 Ga0373937_0183390 Ga0373937_0183390_256_915 218
549 3300037068 Ga0373925_0017995 Ga0373925_0017995_2970_3626 218
550 3300037853 Ga0436364_0156042 Ga0436364_0156042_16099_16839 218
551 3300037853 Ga0436364_1066174 Ga0436364_1066174_722_1378 218
552 3300037853 Ga0436364_1316088 Ga0436364_1316088_8572_9228 218
553 3300037853 Ga0436364_1369092 Ga0436364_1369092_894_1550 218
554 3300038443 Ga0395901_0097761 Ga0395901_0097761_735_1391 218
555 3300039437 Ga0436365_0377960 Ga0436365_0377960_152_811 218
556 3300039437 Ga0436365_1477890 Ga0436365_1477890_90_746 218
557 3300039450 Ga0436363_0651887 Ga0436363_0651887_148_804 218
558 3300039450 Ga0436363_1266751 Ga0436363_1266751_133_789 218
559 3300039450 Ga0436363_1577689 Ga0436363_1577689_160_816 218
560 3300039453 Ga0436362_0233102 Ga0436362_0233102_45708_46367 218
561 3300039453 Ga0436362_1241870 Ga0436362_1241870_383_1039 218
562 3300042007 Ga0439449_0001756 Ga0439449_0001756_750_1427 218
563 3300044656 Ga0466969_0035491 Ga0466969_0035491_1753_2412 218
564 3300044656 Ga0466969_0040741 Ga0466969_0040741_883_1542 218
565 3300044684 Ga0466966_0003594 Ga0466966_0003594_8706_9365 218
566 3300044694 Ga0466963_0244463 Ga0466963_0244463_172_828 218
567 3300044706 Ga0466964_0249522 Ga0466964_0249522_181_837 218
568 3300044765 Ga0466970_0070920 Ga0466970_0070920_715_1374 218
569 3300044765 Ga0466970_0344221 Ga0466970_0344221_129_788 218
570 3300045049 Ga0466959_0209067 Ga0466959_0209067_672_1331 218
571 3300045976 Ga0466967_0031648 Ga0466967_0031648_2556_3212 218
572 3300045976 Ga0466967_0174886 Ga0466967_0174886_551_1207 218
573 3300045976 Ga0466967_1004222 Ga0466967_1004222_128_787 218
574 3300046454 Ga0495592_0079675 Ga0495592_0079675_523_1182 218
575 3300046459 Ga0495629_0183247 Ga0495629_0183247_211_870 218
576 3300046462 Ga0495651_0028565 Ga0495651_0028565_384_1043 218
577 3300046462 Ga0495651_0048896 Ga0495651_0048896_1632_2288 218
578 3300046462 Ga0495651_0068119 Ga0495651_0068119_1499_2155 218
579 3300046463 Ga0495653_0016688 Ga0495653_0016688_3497_4156 218
580 3300046463 Ga0495653_0121947 Ga0495653_0121947_58_714 218
581 3300046476 Ga0495662_0004568 Ga0495662_0004568_4066_4725 218
582 3300046476 Ga0495662_0031337 Ga0495662_0031337_826_1482 218
583 3300046477 Ga0495664_0003208 Ga0495664_0003208_3107_3766 218
584 3300046477 Ga0495664_0006890 Ga0495664_0006890_960_1616 218
585 3300046499 Ga0495594_0053899 Ga0495594_0053899_941_1600 218
586 3300046507 Ga0495606_0001540 Ga0495606_0001540_14271_14930 218
587 3300046511 Ga0495608_0000475 Ga0495608_0000475_22463_23122 218
588 3300046511 Ga0495608_0175532 Ga0495608_0175532_573_1229 218
589 3300046514 Ga0495618_0061316 Ga0495618_0061316_205_861 218
590 3300046514 Ga0495618_0068656 Ga0495618_0068656_37_693 218
591 3300046514 Ga0495618_0080996 Ga0495618_0080996_562_1218 218
592 3300046516 Ga0495628_0000710 Ga0495628_0000710_15086_15745 218
593 3300046516 Ga0495628_0149542 Ga0495628_0149542_785_1441 218
594 3300046516 Ga0495628_0281957 Ga0495628_0281957_370_1026 218
595 3300046517 Ga0495630_0024420 Ga0495630_0024420_1232_1888 218
596 3300046517 Ga0495630_0113180 Ga0495630_0113180_42_701 218
597 3300046526 Ga0495666_0000918 Ga0495666_0000918_10794_11453 218
598 3300046526 Ga0495666_0084971 Ga0495666_0084971_139_795 218
599 3300046529 Ga0495652_0030823 Ga0495652_0030823_1698_2357 218
600 3300046529 Ga0495652_0065800 Ga0495652_0065800_1203_1859 218
601 3300046531 Ga0495665_0005008 Ga0495665_0005008_541_1200 218
602 3300046531 Ga0495665_0025875 Ga0495665_0025875_408_1064 218
603 3300046533 Ga0495640_0022509 Ga0495640_0022509_2718_3377 218
604 3300046535 Ga0495586_0324083 Ga0495586_0324083_121_780 218
605 3300046536 Ga0495587_0026899 Ga0495587_0026899_303_962 218
606 3300046536 Ga0495587_0043219 Ga0495587_0043219_336_992 218
607 3300046543 Ga0495645_0005686 Ga0495645_0005686_4870_5529 218
608 3300046559 Ga0495667_0010394 Ga0495667_0010394_4279_4935 218
609 3300046559 Ga0495667_0022780 Ga0495667_0022780_1581_2237 218
610 3300046559 Ga0495667_0051914 Ga0495667_0051914_384_1043 218
611 3300046559 Ga0495667_0535197 Ga0495667_0535197_15_671 218
612 3300046616 Ga0495668_0000324 Ga0495668_0000324_50547_51206 218
613 3300046642 Ga0495634_0080878 Ga0495634_0080878_1425_2084 218
614 3300046660 Ga0495625_0000142 Ga0495625_0000142_41515_42174 218
615 3300046663 Ga0495635_0009603 Ga0495635_0009603_6078_6737 218
616 3300046663 Ga0495635_0009731 Ga0495635_0009731_4895_5551 218
617 3300046663 Ga0495635_0035623 Ga0495635_0035623_393_1049 218
618 3300046675 Ga0495657_0020698 Ga0495657_0020698_384_1043 218
619 3300046675 Ga0495657_0021781 Ga0495657_0021781_1877_2533 218
620 3300046678 Ga0495599_0005960 Ga0495599_0005960_740_1399 218
621 3300046678 Ga0495599_0077251 Ga0495599_0077251_573_1229 218
622 3300046679 Ga0495623_0219327 Ga0495623_0219327_384_1043 218
623 3300046680 Ga0495646_0036830 Ga0495646_0036830_2343_3002 218
624 3300046689 Ga0495613_0013394 Ga0495613_0013394_1394_2053 218
625 3300046689 Ga0495613_0459133 Ga0495613_0459133_196_852 218
626 3300046690 Ga0495624_0004583 Ga0495624_0004583_2792_3448 218
627 3300046809 Ga0495600_0050254 Ga0495600_0050254_1533_2192 218
628 3300046809 Ga0495600_0143526 Ga0495600_0143526_670_1326 218
629 3300047315 Ga0495581_0043172 Ga0495581_0043172_563_1219 218
630 3300047315 Ga0495581_0082513 Ga0495581_0082513_961_1620 218
631 3300047317 Ga0495604_0000228 Ga0495604_0000228_23916_24575 218
632 3300047319 Ga0495674_0003948 Ga0495674_0003948_4676_5332 218
633 3300047319 Ga0495674_0033850 Ga0495674_0033850_563_1222 218
634 3300047321 Ga0495676_0002514 Ga0495676_0002514_5325_5981 218
635 3300047322 Ga0495680_0026448 Ga0495680_0026448_3845_4501 218
636 3300047323 Ga0495683_0261685 Ga0495683_0261685_59_718 218
637 3300047444 Ga0495675_0242492 Ga0495675_0242492_384_1043 218
638 3300047471 Ga0495684_0002870 Ga0495684_0002870_2139_2795 218
639 3300047471 Ga0495684_0022111 Ga0495684_0022111_2566_3225 218
640 3300047673 Ga0495593_0021544 Ga0495593_0021544_2510_3169 218
641 3300047673 Ga0495593_0047284 Ga0495593_0047284_503_1159 218
642 3300048088 Ga0495602_0070158 Ga0495602_0070158_2172_2831 218
643 3300048088 Ga0495602_0096039 Ga0495602_0096039_1576_2232 218
644 3300048091 Ga0495626_0000029 Ga0495626_0000029_90757_91416 218
645 3300048904 Ga0496101_0591272 Ga0496101_0591272_102_758 218
646 3300048905 Ga0496102_0683337 Ga0496102_0683337_102_758 218
647 3300048906 Ga0496103_0111087 Ga0496103_0111087_176_832 218
648 3300048907 Ga0496104_0036240 Ga0496104_0036240_544_1200 218
649 3300048907 Ga0496104_0092737 Ga0496104_0092737_54_728 218
650 3300048907 Ga0496104_0389046 Ga0496104_0389046_76_732 218
651 3300048908 Ga0496105_0153000 Ga0496105_0153000_274_930 218
652 3300048910 Ga0496107_0021880 Ga0496107_0021880_949_1605 218
653 3300048911 Ga0496108_0084909 Ga0496108_0084909_1109_1774 218
654 3300048913 Ga0496110_0010542 Ga0496110_0010542_3408_4064 218
655 3300048914 Ga0496111_0186492 Ga0496111_0186492_208_864 218
656 3300048915 Ga0496112_0015710 Ga0496112_0015710_3634_4293 218
657 3300048915 Ga0496112_0050251 Ga0496112_0050251_3255_3914 218
658 3300048915 Ga0496112_0302920 Ga0496112_0302920_257_913 218
659 3300048915 Ga0496112_0852405 Ga0496112_0852405_102_758 218
660 3300048916 Ga0496113_0203102 Ga0496113_0203102_773_1429 218
661 3300048916 Ga0496113_0330620 Ga0496113_0330620_408_1067 218
662 3300048916 Ga0496113_0411139 Ga0496113_0411139_32_688 218
663 3300048917 Ga0496114_0205891 Ga0496114_0205891_675_1331 218
664 3300048918 Ga0496115_0016304 Ga0496115_0016304_3284_3940 218
665 3300048929 Ga0496126_0166346 Ga0496126_0166346_180_836 218
666 3300048929 Ga0496126_0375370 Ga0496126_0375370_257_913 218
667 3300049568 Ga0501031_0334468 Ga0501031_0334468_118_780 218
668 3300049570 Ga0501033_0335534 Ga0501033_0335534_25_684 218
669 3300049571 Ga0501034_0097780 Ga0501034_0097780_1903_2565 218
670 3300049571 Ga0501034_0267219 Ga0501034_0267219_357_1016 218
671 3300049572 Ga0501036_0023104 Ga0501036_0023104_1212_1874 218
672 3300049572 Ga0501036_0068045 Ga0501036_0068045_60_719 218
673 3300049573 Ga0501037_0390170 Ga0501037_0390170_75_737 218
674 3300049574 Ga0501038_0014677 Ga0501038_0014677_2404_3066 218
675 3300049574 Ga0501038_0070032 Ga0501038_0070032_1415_2074 218
676 3300049575 Ga0501039_0422561 Ga0501039_0422561_19_681 218
677 3300049579 Ga0501043_0020943 Ga0501043_0020943_1232_1894 218
678 3300049579 Ga0501043_0169728 Ga0501043_0169728_378_1037 218
679 3300049580 Ga0501046_0017503 Ga0501046_0017503_2360_3019 218
680 3300049581 Ga0501047_0013772 Ga0501047_0013772_4581_5243 218
681 3300049581 Ga0501047_0209074 Ga0501047_0209074_785_1444 218
682 3300049581 Ga0501047_0889353 Ga0501047_0889353_29_688 218
683 3300049586 Ga0501070_0079765 Ga0501070_0079765_1850_2509 218
684 3300049822 Ga0501035_0122194 Ga0501035_0122194_1378_2040 218
685 3300049823 Ga0501044_0038017 Ga0501044_0038017_2920_3582 218
686 3300049823 Ga0501044_0138166 Ga0501044_0138166_1391_2050 218
687 3300049824 Ga0501045_0256404 Ga0501045_0256404_35_697 218
688 3300050490 nmdc:mga03n38_107452_c1 nmdc:mga03n38_107452_c1_279_962 218
689 3300050512 nmdc:mga0n895_138604_c1 nmdc:mga0n895_138604_c1_725_1381 218
690 3300050512 nmdc:mga0n895_654696_c1 nmdc:mga0n895_654696_c1_63_719 218
691 3300050514 nmdc:mga08x19_180405_c1 nmdc:mga08x19_180405_c1_504_1160 218
692 3300053077 Ga0495601_0117520 Ga0495601_0117520_372_1031 218
693 iso_pu_bacteria 2767802112 2768642995 218
694 iso_pu_bacteria 2867346516 2867349164 218
695 iso_pu_bacteria 8033684223 8033686499 218
696 iso_pu_bacteria 8053945823 8053949416 218
697 3300005329 Ga0070683_100088071 Ga0070683_1000880712 219
698 3300005329 Ga0070683_100233237 Ga0070683_1002332372 219
699 3300005334 Ga0068869_100217591 Ga0068869_1002175913 219
700 3300005335 Ga0070666_10126500 Ga0070666_101265001 219
701 3300005336 Ga0070680_100039721 Ga0070680_1000397212 219
702 3300005337 Ga0070682_100212268 Ga0070682_1002122682 219
703 3300005338 Ga0068868_100316050 Ga0068868_1003160502 219
704 3300005347 Ga0070668_100028430 Ga0070668_1000284302 219
705 3300005355 Ga0070671_100130223 Ga0070671_1001302232 219
706 3300005355 Ga0070671_100139122 Ga0070671_1001391222 219
707 3300005365 Ga0070688_100415575 Ga0070688_1004155752 219
708 3300005366 Ga0070659_100125348 Ga0070659_1001253482 219
709 3300005367 Ga0070667_100008049 Ga0070667_1000080498 219
710 3300005434 Ga0070709_10053484 Ga0070709_100534843 219
711 3300005435 Ga0070714_100000106 Ga0070714_1000001061 219
712 3300005435 Ga0070714_100016786 Ga0070714_1000167863 219
713 3300005435 Ga0070714_100039063 Ga0070714_1000390632 219
714 3300005435 Ga0070714_100078646 Ga0070714_1000786464 219
715 3300005435 Ga0070714_100139965 Ga0070714_1001399652 219
716 3300005435 Ga0070714_100209099 Ga0070714_1002090992 219
717 3300005436 Ga0070713_100000462 Ga0070713_1000004623 219
718 3300005436 Ga0070713_100019461 Ga0070713_1000194613 219
719 3300005436 Ga0070713_100812901 Ga0070713_1008129011 219
720 3300005437 Ga0070710_10000075 Ga0070710_1000007532 219
721 3300005437 Ga0070710_10069508 Ga0070710_100695082 219
722 3300005439 Ga0070711_100000491 Ga0070711_10000049120 219
723 3300005439 Ga0070711_100130493 Ga0070711_1001304933 219
724 3300005459 Ga0068867_100138119 Ga0068867_1001381193 219
725 3300005467 Ga0070706_100002590 Ga0070706_1000025908 219
726 3300005467 Ga0070706_100005146 Ga0070706_1000051465 219
727 3300005467 Ga0070706_100056749 Ga0070706_1000567493 219
728 3300005467 Ga0070706_100227252 Ga0070706_1002272522 219
729 3300005467 Ga0070706_100255250 Ga0070706_1002552501 219
730 3300005468 Ga0070707_100006772 Ga0070707_1000067725 219
731 3300005468 Ga0070707_100048333 Ga0070707_1000483335 219
732 3300005468 Ga0070707_100087775 Ga0070707_1000877752 219
733 3300005468 Ga0070707_100155691 Ga0070707_1001556912 219
734 3300005468 Ga0070707_100329862 Ga0070707_1003298621 219
735 3300005471 Ga0070698_100005631 Ga0070698_1000056312 219
736 3300005471 Ga0070698_100025292 Ga0070698_1000252927 219
737 3300005471 Ga0070698_100031377 Ga0070698_1000313774 219
738 3300005471 Ga0070698_100224422 Ga0070698_1002244222 219
739 3300005471 Ga0070698_100549937 Ga0070698_1005499372 219
740 3300005536 Ga0070697_100027312 Ga0070697_1000273123 219
741 3300005536 Ga0070697_100093276 Ga0070697_1000932762 219
742 3300005544 Ga0070686_100668053 Ga0070686_1006680531 219
743 3300005545 Ga0070695_100440489 Ga0070695_1004404891 219
744 3300005548 Ga0070665_100179347 Ga0070665_1001793472 219
745 3300005548 Ga0070665_100251600 Ga0070665_1002516002 219
746 3300005548 Ga0070665_100467993 Ga0070665_1004679932 219
747 3300005549 Ga0070704_100114820 Ga0070704_1001148202 219
748 3300005614 Ga0068856_100073865 Ga0068856_1000738654 219
749 3300005614 Ga0068856_100312675 Ga0068856_1003126752 219
750 3300005616 Ga0068852_100088806 Ga0068852_1000888062 219
751 3300005618 Ga0068864_100074462 Ga0068864_1000744623 219
752 3300005718 Ga0068866_10070058 Ga0068866_100700582 219
753 3300005840 Ga0068870_10135820 Ga0068870_101358202 219
754 3300005841 Ga0068863_100107283 Ga0068863_1001072832 219
755 3300005842 Ga0068858_100000032 Ga0068858_10000003278 219
756 3300005842 Ga0068858_100393566 Ga0068858_1003935662 219
757 3300005843 Ga0068860_100036494 Ga0068860_1000364943 219
758 3300005843 Ga0068860_100088242 Ga0068860_1000882422 219
759 3300005844 Ga0068862_100540085 Ga0068862_1005400852 219
760 3300005937 Ga0081455_10005937 Ga0081455_1000593710 219
761 3300005981 Ga0081538_10000001 Ga0081538_10000001231 219
762 3300005981 Ga0081538_10001676 Ga0081538_1000167615 219
763 3300006028 Ga0070717_10000595 Ga0070717_100005953 219
764 3300006028 Ga0070717_10001224 Ga0070717_100012245 219
765 3300006028 Ga0070717_10254202 Ga0070717_102542022 219
766 3300006038 Ga0075365_10046145 Ga0075365_100461454 219
767 3300006042 Ga0075368_10012732 Ga0075368_100127322 219
768 3300006048 Ga0075363_100024321 Ga0075363_1000243214 219
769 3300006048 Ga0075363_100058264 Ga0075363_1000582642 219
770 3300006048 Ga0075363_100075240 Ga0075363_1000752401 219
771 3300006051 Ga0075364_10027184 Ga0075364_100271842 219
772 3300006173 Ga0070716_100002234 Ga0070716_1000022343 219
773 3300006173 Ga0070716_100011459 Ga0070716_1000114592 219
774 3300006173 Ga0070716_100074098 Ga0070716_1000740982 219
775 3300006175 Ga0070712_100000461 Ga0070712_10000046120 219
776 3300006178 Ga0075367_10187614 Ga0075367_101876142 219
777 3300006178 Ga0075367_10298907 Ga0075367_102989071 219
778 3300006195 Ga0075366_10097429 Ga0075366_100974292 219
779 3300006353 Ga0075370_10102539 Ga0075370_101025393 219
780 3300006846 Ga0075430_100480730 Ga0075430_1004807301 219
781 3300006914 Ga0075436_100206175 Ga0075436_1002061752 219
782 3300009094 Ga0111539_11303293 Ga0111539_113032932 219
783 3300009098 Ga0105245_10369567 Ga0105245_103695672 219
784 3300009098 Ga0105245_10670643 Ga0105245_106706431 219
785 3300009101 Ga0105247_10008465 Ga0105247_100084656 219
786 3300009148 Ga0105243_10414652 Ga0105243_104146522 219
787 3300009176 Ga0105242_10002671 Ga0105242_1000267114 219
788 3300009176 Ga0105242_10678424 Ga0105242_106784242 219
789 3300009177 Ga0105248_10000603 Ga0105248_1000060323 219
790 3300009551 Ga0105238_10299146 Ga0105238_102991462 219
791 3300009553 Ga0105249_11687553 Ga0105249_116875531 219
792 3300010375 Ga0105239_10217555 Ga0105239_102175552 219
793 3300013105 Ga0157369_10288824 Ga0157369_102888242 219
794 3300013105 Ga0157369_10291991 Ga0157369_102919912 219
795 3300013296 Ga0157374_10922230 Ga0157374_109222302 219
796 3300013297 Ga0157378_10187282 Ga0157378_101872822 219
797 3300013306 Ga0163162_10029622 Ga0163162_100296225 219
798 3300013307 Ga0157372_10167253 Ga0157372_101672532 219
799 3300013307 Ga0157372_10636783 Ga0157372_106367832 219
800 3300013308 Ga0157375_10138638 Ga0157375_101386382 219
801 3300013308 Ga0157375_10956041 Ga0157375_109560412 219
802 3300014325 Ga0163163_10018827 Ga0163163_100188273 219
803 3300014968 Ga0157379_10222864 Ga0157379_102228643 219
804 3300014968 Ga0157379_10225656 Ga0157379_102256562 219
805 3300020082 Ga0206353_12041050 Ga0206353_120410502 219
806 3300021388 Ga0213875_10001597 Ga0213875_1000159713 219
807 3300025898 Ga0207692_10000219 Ga0207692_1000021913 219
808 3300025898 Ga0207692_10027269 Ga0207692_100272694 219
809 3300025899 Ga0207642_10031115 Ga0207642_100311152 219
810 3300025900 Ga0207710_10000082 Ga0207710_1000008232 219
811 3300025900 Ga0207710_10000120 Ga0207710_1000012038 219
812 3300025901 Ga0207688_10012855 Ga0207688_100128553 219
813 3300025906 Ga0207699_10000107 Ga0207699_1000010732 219
814 3300025906 Ga0207699_10048359 Ga0207699_100483592 219
815 3300025908 Ga0207643_10053346 Ga0207643_100533462 219
816 3300025909 Ga0207705_10393656 Ga0207705_103936561 219
817 3300025910 Ga0207684_10008443 Ga0207684_100084437 219
818 3300025910 Ga0207684_10022385 Ga0207684_100223854 219
819 3300025910 Ga0207684_10027532 Ga0207684_100275323 219
820 3300025910 Ga0207684_10033233 Ga0207684_100332332 219
821 3300025911 Ga0207654_10256258 Ga0207654_102562582 219
822 3300025912 Ga0207707_10375567 Ga0207707_103755672 219
823 3300025915 Ga0207693_10000536 Ga0207693_100005366 219
824 3300025916 Ga0207663_10004399 Ga0207663_100043996 219
825 3300025916 Ga0207663_10134143 Ga0207663_101341433 219
826 3300025917 Ga0207660_10158598 Ga0207660_101585982 219
827 3300025919 Ga0207657_10294189 Ga0207657_102941891 219
828 3300025919 Ga0207657_10468935 Ga0207657_104689352 219
829 3300025921 Ga0207652_10571104 Ga0207652_105711042 219
830 3300025922 Ga0207646_10013367 Ga0207646_100133678 219
831 3300025922 Ga0207646_10060719 Ga0207646_100607192 219
832 3300025922 Ga0207646_10067963 Ga0207646_100679632 219
833 3300025922 Ga0207646_10217921 Ga0207646_102179212 219
834 3300025922 Ga0207646_10365690 Ga0207646_103656901 219
835 3300025928 Ga0207700_10000738 Ga0207700_1000073813 219
836 3300025928 Ga0207700_10103904 Ga0207700_101039042 219
837 3300025928 Ga0207700_10270441 Ga0207700_102704411 219
838 3300025929 Ga0207664_10000047 Ga0207664_1000004790 219
839 3300025929 Ga0207664_10000271 Ga0207664_100002718 219
840 3300025929 Ga0207664_10007656 Ga0207664_100076564 219
841 3300025929 Ga0207664_10020227 Ga0207664_100202272 219
842 3300025929 Ga0207664_10082598 Ga0207664_100825982 219
843 3300025929 Ga0207664_10182087 Ga0207664_101820873 219
844 3300025929 Ga0207664_10291688 Ga0207664_102916882 219
845 3300025931 Ga0207644_10266562 Ga0207644_102665622 219
846 3300025931 Ga0207644_10424390 Ga0207644_104243901 219
847 3300025934 Ga0207686_10138040 Ga0207686_101380401 219
848 3300025935 Ga0207709_10245210 Ga0207709_102452102 219
849 3300025936 Ga0207670_10045513 Ga0207670_100455132 219
850 3300025939 Ga0207665_10003241 Ga0207665_100032412 219
851 3300025939 Ga0207665_10005705 Ga0207665_100057057 219
852 3300025944 Ga0207661_10162758 Ga0207661_101627582 219
853 3300025986 Ga0207658_10178090 Ga0207658_101780902 219
854 3300026023 Ga0207677_10037278 Ga0207677_100372782 219
855 3300026035 Ga0207703_10000015 Ga0207703_1000001575 219
856 3300026035 Ga0207703_10031130 Ga0207703_100311304 219
857 3300026075 Ga0207708_10406299 Ga0207708_104062991 219
858 3300026078 Ga0207702_10133545 Ga0207702_101335452 219
859 3300026089 Ga0207648_10016154 Ga0207648_100161545 219
860 3300026116 Ga0207674_10187859 Ga0207674_101878592 219
861 3300026121 Ga0207683_10144296 Ga0207683_101442963 219
862 3300027866 Ga0209813_10072912 Ga0209813_100729122 219
863 3300028379 Ga0268266_10204089 Ga0268266_102040891 219
864 3300028379 Ga0268266_10265504 Ga0268266_102655042 219
865 3300028380 Ga0268265_10508595 Ga0268265_105085952 219
866 3300028381 Ga0268264_10013674 Ga0268264_100136744 219
867 3300028381 Ga0268264_10142932 Ga0268264_101429322 219
868 3300031456 Ga0307513_10026458 Ga0307513_100264582 219
869 3300031727 Ga0316576_10026664 Ga0316576_100266645 219
870 3300031728 Ga0316578_10204630 Ga0316578_102046302 219
871 3300031838 Ga0307518_10000165 Ga0307518_1000016523 219
872 3300031852 Ga0307410_10402037 Ga0307410_104020372 219
873 3300031995 Ga0307409_100066133 Ga0307409_1000661334 219
874 3300035083 Ga0373926_0052409 Ga0373926_0052409_104_763 219
875 3300035118 Ga0373954_0044568 Ga0373954_0044568_182_841 219
876 3300035118 Ga0373954_0053260 Ga0373954_0053260_921_1580 219
877 3300035118 Ga0373954_0074933 Ga0373954_0074933_737_1396 219
878 3300035118 Ga0373954_0248846 Ga0373954_0248846_90_749 219
879 3300035119 Ga0373956_0033068 Ga0373956_0033068_575_1234 219
880 3300035170 Ga0373943_0138676 Ga0373943_0138676_437_1096 219
881 3300035172 Ga0373955_0007576 Ga0373955_0007576_222_881 219
882 3300035172 Ga0373955_0032416 Ga0373955_0032416_886_1545 219
883 3300035398 Ga0316574_0022859 Ga0316574_0022859_2470_3129 219
884 3300035398 Ga0316574_0413957 Ga0316574_0413957_115_774 219
885 3300035410 Ga0373924_0060038 Ga0373924_0060038_509_1168 219
886 3300035691 Ga0373931_0086914 Ga0373931_0086914_315_989 219
887 3300035691 Ga0373931_0208909 Ga0373931_0208909_243_911 219
888 3300035695 Ga0373927_0192171 Ga0373927_0192171_647_1306 219
889 3300035724 Ga0373933_0015399 Ga0373933_0015399_2793_3452 219
890 3300035724 Ga0373933_0106036 Ga0373933_0106036_400_1059 219
891 3300035725 Ga0373947_0671683 Ga0373947_0671683_16_675 219
892 3300036401 Ga0373937_0070849 Ga0373937_0070849_267_926 219
893 3300036401 Ga0373937_0181998 Ga0373937_0181998_581_1240 219
894 3300036401 Ga0373937_0325428 Ga0373937_0325428_253_912 219
895 3300037068 Ga0373925_0003210 Ga0373925_0003210_4309_4968 219
896 3300037068 Ga0373925_0101394 Ga0373925_0101394_1460_2119 219
897 3300037068 Ga0373925_0210899 Ga0373925_0210899_641_1309 219
898 3300037466 Ga0395898_0294817 Ga0395898_0294817_400_1074 219
899 3300037853 Ga0436364_0667270 Ga0436364_0667270_31322_31981 219
900 3300037853 Ga0436364_0933349 Ga0436364_0933349_916_1584 219
901 3300038443 Ga0395901_0023720 Ga0395901_0023720_5381_6055 219
902 3300039062 Ga0400483_143208 Ga0400483_143208_7019_7678 219
903 3300039437 Ga0436365_1573340 Ga0436365_1573340_51_710 219
904 3300039437 Ga0436365_1662005 Ga0436365_1662005_5438_6097 219
905 3300041512 Ga0451853_2380410 Ga0451853_2380410_353_1012 219
906 3300044656 Ga0466969_0001309 Ga0466969_0001309_12096_12755 219
907 3300044656 Ga0466969_0014585 Ga0466969_0014585_220_888 219
908 3300044656 Ga0466969_0025219 Ga0466969_0025219_496_1155 219
909 3300044658 Ga0466972_0010241 Ga0466972_0010241_1458_2117 219
910 3300044683 Ga0466965_0093809 Ga0466965_0093809_453_1136 219
911 3300044683 Ga0466965_0214613 Ga0466965_0214613_99_761 219
912 3300044684 Ga0466966_0002220 Ga0466966_0002220_6243_6902 219
913 3300044684 Ga0466966_0089176 Ga0466966_0089176_1006_1665 219
914 3300044693 Ga0466961_0002104 Ga0466961_0002104_3659_4318 219
915 3300044693 Ga0466961_0067418 Ga0466961_0067418_964_1647 219
916 3300044693 Ga0466961_0145425 Ga0466961_0145425_616_1275 219
917 3300044719 Ga0466971_0000463 Ga0466971_0000463_796_1455 219
918 3300044735 Ga0466968_0034064 Ga0466968_0034064_810_1469 219
919 3300044765 Ga0466970_0003236 Ga0466970_0003236_1544_2203 219
920 3300044765 Ga0466970_0017349 Ga0466970_0017349_276_935 219
921 3300044765 Ga0466970_0021525 Ga0466970_0021525_1646_2305 219
922 3300044765 Ga0466970_0061509 Ga0466970_0061509_51_710 219
923 3300044765 Ga0466970_0119435 Ga0466970_0119435_381_1064 219
924 3300044842 Ga0466957_0108470 Ga0466957_0108470_978_1661 219
925 3300044842 Ga0466957_0281758 Ga0466957_0281758_256_939 219
926 3300045049 Ga0466959_0002190 Ga0466959_0002190_9696_10355 219
927 3300045049 Ga0466959_0030336 Ga0466959_0030336_1205_1864 219
928 3300045836 Ga0466958_0103073 Ga0466958_0103073_475_1134 219
929 3300045836 Ga0466958_0141197 Ga0466958_0141197_801_1460 219
930 3300045976 Ga0466967_0005566 Ga0466967_0005566_917_1576 219
931 3300045976 Ga0466967_0116736 Ga0466967_0116736_1583_2266 219
932 3300045976 Ga0466967_0231570 Ga0466967_0231570_795_1454 219
933 3300045976 Ga0466967_0340156 Ga0466967_0340156_503_1171 219
934 3300045976 Ga0466967_0549081 Ga0466967_0549081_376_1059 219
935 3300045976 Ga0466967_0741231 Ga0466967_0741231_83_748 219
936 3300046454 Ga0495592_0027906 Ga0495592_0027906_362_1021 219
937 3300046454 Ga0495592_0155165 Ga0495592_0155165_56_715 219
938 3300046454 Ga0495592_0207185 Ga0495592_0207185_553_1212 219
939 3300046455 Ga0495603_0163152 Ga0495603_0163152_141_803 219
940 3300046459 Ga0495629_0240524 Ga0495629_0240524_497_1159 219
941 3300046461 Ga0495641_0069531 Ga0495641_0069531_248_907 219
942 3300046461 Ga0495641_0178823 Ga0495641_0178823_159_833 219
943 3300046461 Ga0495641_0276201 Ga0495641_0276201_18_680 219
944 3300046462 Ga0495651_0001909 Ga0495651_0001909_11470_12129 219
945 3300046462 Ga0495651_0003631 Ga0495651_0003631_5836_6495 219
946 3300046462 Ga0495651_0023113 Ga0495651_0023113_643_1302 219
947 3300046462 Ga0495651_0031625 Ga0495651_0031625_3340_4002 219
948 3300046462 Ga0495651_0088537 Ga0495651_0088537_1468_2127 219
949 3300046463 Ga0495653_0019495 Ga0495653_0019495_1649_2308 219
950 3300046463 Ga0495653_0361806 Ga0495653_0361806_232_891 219
951 3300046472 Ga0495580_0347415 Ga0495580_0347415_235_894 219
952 3300046473 Ga0495582_0461577 Ga0495582_0461577_35_694 219
953 3300046492 Ga0495585_0010037 Ga0495585_0010037_828_1490 219
954 3300046499 Ga0495594_0074018 Ga0495594_0074018_112_774 219
955 3300046514 Ga0495618_0012534 Ga0495618_0012534_383_1042 219
956 3300046514 Ga0495618_0014319 Ga0495618_0014319_870_1532 219
957 3300046514 Ga0495618_0036844 Ga0495618_0036844_598_1257 219
958 3300046516 Ga0495628_0065623 Ga0495628_0065623_129_791 219
959 3300046516 Ga0495628_0098786 Ga0495628_0098786_43_702 219
960 3300046526 Ga0495666_0132054 Ga0495666_0132054_129_791 219
961 3300046529 Ga0495652_0002867 Ga0495652_0002867_4372_5031 219
962 3300046529 Ga0495652_0025780 Ga0495652_0025780_470_1129 219
963 3300046529 Ga0495652_0126905 Ga0495652_0126905_557_1216 219
964 3300046529 Ga0495652_0182376 Ga0495652_0182376_228_890 219
965 3300046533 Ga0495640_0004918 Ga0495640_0004918_9824_10483 219
966 3300046533 Ga0495640_0023678 Ga0495640_0023678_3609_4271 219
967 3300046536 Ga0495587_0009514 Ga0495587_0009514_4765_5424 219
968 3300046536 Ga0495587_0065835 Ga0495587_0065835_794_1453 219
969 3300046543 Ga0495645_0005253 Ga0495645_0005253_8154_8813 219
970 3300046543 Ga0495645_0195683 Ga0495645_0195683_361_1020 219
971 3300046642 Ga0495634_0021529 Ga0495634_0021529_2059_2718 219
972 3300046642 Ga0495634_0044706 Ga0495634_0044706_66_728 219
973 3300046663 Ga0495635_0000586 Ga0495635_0000586_16279_16938 219
974 3300046663 Ga0495635_0221596 Ga0495635_0221596_511_1170 219
975 3300046675 Ga0495657_0021852 Ga0495657_0021852_3394_4053 219
976 3300046675 Ga0495657_0029980 Ga0495657_0029980_1365_2024 219
977 3300046675 Ga0495657_0140669 Ga0495657_0140669_623_1285 219
978 3300046678 Ga0495599_0008626 Ga0495599_0008626_2486_3145 219
979 3300046678 Ga0495599_0044576 Ga0495599_0044576_1284_1943 219
980 3300046679 Ga0495623_0029613 Ga0495623_0029613_783_1442 219
981 3300046679 Ga0495623_0034064 Ga0495623_0034064_782_1441 219
982 3300046679 Ga0495623_0189732 Ga0495623_0189732_110_769 219
983 3300046679 Ga0495623_0228247 Ga0495623_0228247_364_1023 219
984 3300046679 Ga0495623_0270050 Ga0495623_0270050_43_711 219
985 3300046689 Ga0495613_0032346 Ga0495613_0032346_164_826 219
986 3300046689 Ga0495613_0220454 Ga0495613_0220454_633_1295 219
987 3300046690 Ga0495624_0174366 Ga0495624_0174366_132_794 219
988 3300046690 Ga0495624_0433900 Ga0495624_0433900_109_768 219
989 3300046809 Ga0495600_0001390 Ga0495600_0001390_6117_6776 219
990 3300046809 Ga0495600_0068545 Ga0495600_0068545_1522_2184 219
991 3300046809 Ga0495600_0317482 Ga0495600_0317482_132_791 219
992 3300047315 Ga0495581_0095064 Ga0495581_0095064_914_1576 219
993 3300047317 Ga0495604_0004263 Ga0495604_0004263_5038_5700 219
994 3300047317 Ga0495604_0027568 Ga0495604_0027568_2051_2710 219
995 3300047317 Ga0495604_0139619 Ga0495604_0139619_366_1025 219
996 3300047317 Ga0495604_0169087 Ga0495604_0169087_217_876 219
997 3300047319 Ga0495674_0032463 Ga0495674_0032463_188_847 219
998 3300047319 Ga0495674_0484515 Ga0495674_0484515_78_737 219
999 3300047321 Ga0495676_0000613 Ga0495676_0000613_28657_29319 219
1000 3300047322 Ga0495680_0016459 Ga0495680_0016459_4636_5295 219
1001 3300047322 Ga0495680_0042132 Ga0495680_0042132_718_1377 219
1002 3300047444 Ga0495675_0045615 Ga0495675_0045615_20_679 219
1003 3300047444 Ga0495675_0261027 Ga0495675_0261027_68_727 219
1004 3300047444 Ga0495675_0274608 Ga0495675_0274608_290_949 219
1005 3300047447 Ga0495685_133250 Ga0495685_133250_105_767 219
1006 3300047471 Ga0495684_0007089 Ga0495684_0007089_4331_4990 219
1007 3300047471 Ga0495684_0104437 Ga0495684_0104437_874_1533 219
1008 3300048088 Ga0495602_0028882 Ga0495602_0028882_2075_2734 219
1009 3300048088 Ga0495602_0117207 Ga0495602_0117207_530_1189 219
1010 3300048903 Ga0496100_0751438 Ga0496100_0751438_34_708 219
1011 3300048905 Ga0496102_0226923 Ga0496102_0226923_240_899 219
1012 3300048905 Ga0496102_0649959 Ga0496102_0649959_86_751 219
1013 3300048907 Ga0496104_0061551 Ga0496104_0061551_2332_2994 219
1014 3300048907 Ga0496104_0186372 Ga0496104_0186372_552_1226 219
1015 3300048907 Ga0496104_0215560 Ga0496104_0215560_391_1050 219
1016 3300048907 Ga0496104_0573644 Ga0496104_0573644_92_751 219
1017 3300048908 Ga0496105_0030436 Ga0496105_0030436_2978_3640 219
1018 3300048909 Ga0496106_0241191 Ga0496106_0241191_301_960 219
1019 3300048911 Ga0496108_0241297 Ga0496108_0241297_599_1258 219
1020 3300048911 Ga0496108_0361090 Ga0496108_0361090_585_1253 219
1021 3300048912 Ga0496109_0160469 Ga0496109_0160469_230_904 219
1022 3300048912 Ga0496109_0557682 Ga0496109_0557682_49_708 219
1023 3300048913 Ga0496110_0110093 Ga0496110_0110093_527_1186 219
1024 3300048913 Ga0496110_0118475 Ga0496110_0118475_1205_1864 219
1025 3300048914 Ga0496111_0096721 Ga0496111_0096721_976_1635 219
1026 3300048914 Ga0496111_0176082 Ga0496111_0176082_426_1085 219
1027 3300048915 Ga0496112_0159736 Ga0496112_0159736_907_1581 219
1028 3300048915 Ga0496112_0605934 Ga0496112_0605934_349_1008 219
1029 3300048916 Ga0496113_0091633 Ga0496113_0091633_327_1001 219
1030 3300048916 Ga0496113_0493695 Ga0496113_0493695_225_884 219
1031 3300048917 Ga0496114_0081713 Ga0496114_0081713_95_754 219
1032 3300048917 Ga0496114_0612843 Ga0496114_0612843_144_803 219
1033 3300048922 Ga0496119_0000865 Ga0496119_0000865_8182_8844 219
1034 3300048922 Ga0496119_0032148 Ga0496119_0032148_804_1466 219
1035 3300048923 Ga0496120_0000365 Ga0496120_0000365_37581_38243 219
1036 3300048924 Ga0496121_0022379 Ga0496121_0022379_998_1660 219
1037 3300049568 Ga0501031_0433081 Ga0501031_0433081_38_700 219
1038 3300049569 Ga0501032_0001990 Ga0501032_0001990_11868_12530 219
1039 3300049570 Ga0501033_0156958 Ga0501033_0156958_815_1483 219
1040 3300049570 Ga0501033_0174966 Ga0501033_0174966_137_799 219
1041 3300049571 Ga0501034_0005698 Ga0501034_0005698_788_1450 219
1042 3300049571 Ga0501034_0018502 Ga0501034_0018502_4461_5123 219
1043 3300049571 Ga0501034_0045874 Ga0501034_0045874_485_1144 219
1044 3300049571 Ga0501034_0078401 Ga0501034_0078401_1085_1744 219
1045 3300049572 Ga0501036_0002888 Ga0501036_0002888_12865_13527 219
1046 3300049572 Ga0501036_0010697 Ga0501036_0010697_6135_6797 219
1047 3300049572 Ga0501036_0010804 Ga0501036_0010804_1939_2607 219
1048 3300049573 Ga0501037_0002550 Ga0501037_0002550_11868_12530 219
1049 3300049574 Ga0501038_0005677 Ga0501038_0005677_9983_10645 219
1050 3300049574 Ga0501038_0051824 Ga0501038_0051824_1728_2396 219
1051 3300049574 Ga0501038_0061328 Ga0501038_0061328_972_1634 219
1052 3300049575 Ga0501039_0001904 Ga0501039_0001904_5522_6190 219
1053 3300049575 Ga0501039_0032315 Ga0501039_0032315_1271_1933 219
1054 3300049575 Ga0501039_0394597 Ga0501039_0394597_229_903 219
1055 3300049576 Ga0501040_0025874 Ga0501040_0025874_1619_2287 219
1056 3300049576 Ga0501040_0053917 Ga0501040_0053917_567_1226 219
1057 3300049577 Ga0501041_0000849 Ga0501041_0000849_3755_4417 219
1058 3300049577 Ga0501041_0008634 Ga0501041_0008634_4417_5085 219
1059 3300049578 Ga0501042_0001880 Ga0501042_0001880_639_1301 219
1060 3300049578 Ga0501042_0015330 Ga0501042_0015330_1482_2150 219
1061 3300049578 Ga0501042_0342697 Ga0501042_0342697_83_745 219
1062 3300049579 Ga0501043_0005890 Ga0501043_0005890_98_760 219
1063 3300049579 Ga0501043_0033681 Ga0501043_0033681_2829_3491 219
1064 3300049579 Ga0501043_0145680 Ga0501043_0145680_701_1369 219
1065 3300049580 Ga0501046_0005490 Ga0501046_0005490_10111_10773 219
1066 3300049580 Ga0501046_0010017 Ga0501046_0010017_3643_4311 219
1067 3300049581 Ga0501047_0000029 Ga0501047_0000029_217637_218299 219
1068 3300049581 Ga0501047_0051699 Ga0501047_0051699_3101_3763 219
1069 3300049582 Ga0501048_0002755 Ga0501048_0002755_3644_4306 219
1070 3300049582 Ga0501048_0028654 Ga0501048_0028654_3070_3738 219
1071 3300049583 Ga0501067_0007326 Ga0501067_0007326_3779_4441 219
1072 3300049584 Ga0501068_0010484 Ga0501068_0010484_2094_2753 219
1073 3300049584 Ga0501068_0062071 Ga0501068_0062071_1075_1737 219
1074 3300049585 Ga0501069_0000019 Ga0501069_0000019_11073_11732 219
1075 3300049585 Ga0501069_0024870 Ga0501069_0024870_831_1499 219
1076 3300049585 Ga0501069_0038843 Ga0501069_0038843_1412_2074 219
1077 3300049585 Ga0501069_0091319 Ga0501069_0091319_686_1345 219
1078 3300049586 Ga0501070_0000010 Ga0501070_0000010_117469_118128 219
1079 3300049586 Ga0501070_0040910 Ga0501070_0040910_2379_3038 219
1080 3300049586 Ga0501070_0163866 Ga0501070_0163866_189_851 219
1081 3300049587 Ga0501071_0001385 Ga0501071_0001385_1236_1898 219
1082 3300049587 Ga0501071_0005799 Ga0501071_0005799_7064_7723 219
1083 3300049587 Ga0501071_0008353 Ga0501071_0008353_4499_5167 219
1084 3300049587 Ga0501071_0310115 Ga0501071_0310115_53_712 219
1085 3300049588 Ga0501072_0001543 Ga0501072_0001543_4441_5109 219
1086 3300049588 Ga0501072_0017666 Ga0501072_0017666_4082_4744 219
1087 3300049589 Ga0501073_0022052 Ga0501073_0022052_1998_2657 219
1088 3300049589 Ga0501073_0371622 Ga0501073_0371622_78_740 219
1089 3300049590 Ga0501074_0033492 Ga0501074_0033492_1702_2370 219
1090 3300049591 Ga0501075_0010149 Ga0501075_0010149_1870_2538 219
1091 3300049591 Ga0501075_0239047 Ga0501075_0239047_87_749 219
1092 3300049592 Ga0501076_0016555 Ga0501076_0016555_1525_2187 219
1093 3300049592 Ga0501076_0017575 Ga0501076_0017575_4593_5261 219
1094 3300049593 Ga0501077_0010776 Ga0501077_0010776_2632_3300 219
1095 3300049593 Ga0501077_0081465 Ga0501077_0081465_714_1376 219
1096 3300049741 Ga0501079_0005970 Ga0501079_0005970_3974_4642 219
1097 3300049741 Ga0501079_0032385 Ga0501079_0032385_554_1216 219
1098 3300049741 Ga0501079_0067500 Ga0501079_0067500_1715_2374 219
1099 3300049742 Ga0501080_0001524 Ga0501080_0001524_10299_10958 219
1100 3300049742 Ga0501080_0026238 Ga0501080_0026238_560_1228 219
1101 3300049742 Ga0501080_0029985 Ga0501080_0029985_2632_3291 219
1102 3300049742 Ga0501080_0589538 Ga0501080_0589538_248_910 219
1103 3300049743 Ga0501081_0003705 Ga0501081_0003705_4310_4978 219
1104 3300049744 Ga0501083_0014418 Ga0501083_0014418_2997_3656 219
1105 3300049744 Ga0501083_0015133 Ga0501083_0015133_420_1088 219
1106 3300049744 Ga0501083_0287590 Ga0501083_0287590_37_696 219
1107 3300049822 Ga0501035_0002519 Ga0501035_0002519_12315_12977 219
1108 3300049822 Ga0501035_0095144 Ga0501035_0095144_1924_2592 219
1109 3300049823 Ga0501044_0021769 Ga0501044_0021769_3013_3675 219
1110 3300049823 Ga0501044_0023137 Ga0501044_0023137_3644_4306 219
1111 3300049823 Ga0501044_0039115 Ga0501044_0039115_3513_4172 219
1112 3300049823 Ga0501044_0208952 Ga0501044_0208952_1202_1864 219
1113 3300049824 Ga0501045_0005095 Ga0501045_0005095_1769_2437 219
1114 3300049824 Ga0501045_0015881 Ga0501045_0015881_4542_5204 219
1115 3300049824 Ga0501045_0121774 Ga0501045_0121774_1149_1811 219
1116 3300050492 nmdc:mga0yw44_516811_c1 nmdc:mga0yw44_516811_c1_44_703 219
1117 3300050493 nmdc:mga0k408_84184_c1 nmdc:mga0k408_84184_c1_518_1177 219
1118 3300053077 Ga0495601_0012919 Ga0495601_0012919_1322_1981 219
1119 3300053077 Ga0495601_0275330 Ga0495601_0275330_77_736 219
1120 3300053077 Ga0495601_0278869 Ga0495601_0278869_326_985 219
1121 3300053078 Ga0495612_0003333 Ga0495612_0003333_1729_2388 219
1122 3300053078 Ga0495612_0076443 Ga0495612_0076443_166_825 219
1123 3300053084 Ga0495595_0017286 Ga0495595_0017286_1559_2218 219
1124 3300053085 Ga0495619_0084320 Ga0495619_0084320_1225_1884 219
1125 3300053085 Ga0495619_0577882 Ga0495619_0577882_82_741 219
1126 3300053136 Ga0500559_0005196 Ga0500559_0005196_523_1182 219
1127 3300054114 Ga0501084_0000503 Ga0501084_0000503_7076_7735 219
1128 3300054114 Ga0501084_0004817 Ga0501084_0004817_1374_2042 219
1129 3300054114 Ga0501084_0020844 Ga0501084_0020844_375_1037 219
1130 3300054114 Ga0501084_0041192 Ga0501084_0041192_75_734 219
1131 3300060353 Ga0501082_0014461 Ga0501082_0014461_436_1098 219
1132 3300060353 Ga0501082_0019004 Ga0501082_0019004_1405_2073 219
1133 3300061719 Ga0466962_0000572 Ga0466962_0000572_13961_14620 219
1134 3300061734 Ga0530510_0011581 Ga0530510_0011581_3898_4566 219
1135 3300061734 Ga0530510_0026557 Ga0530510_0026557_2932_3591 219
1136 3300061734 Ga0530510_0187467 Ga0530510_0187467_134_796 219
1137 iso_pu_bacteria 2558860280 2559429350 219
1138 iso_pu_bacteria 2585427649 2586058605 219
1139 iso_pu_bacteria 2643221715 2644635999 219
1140 iso_pu_bacteria 2738541274 2738707738 219
1141 iso_pu_bacteria 2738543028 2739334078 219
1142 iso_pu_bacteria 2775506925 2776373798 219
1143 iso_pu_bacteria 2808606439 2809198496 219
1144 iso_pu_bacteria 2808606522 2809592550 219
1145 iso_pu_bacteria 2811994878 2812349719 219
1146 iso_pu_bacteria 2816332139 2816505103 219
1147 iso_pu_bacteria 2842134933 2842140146 219
1148 iso_pu_bacteria 2902792274 2902796500 219
1149 iso_pu_bacteria 2919713450 2919719245 219
1150 iso_pu_bacteria 2929212328 2929216890 219
1151 iso_pu_bacteria 2932398195 2932399392 219
1152 iso_pu_bacteria 8056207758 8056211794 219
1153 3300001989 JGI24739J22299_10038054 JGI24739J22299_100380543 220
1154 3300002077 JGI24744J21845_10000482 JGI24744J21845_100004825 220
1155 3300002459 JGI24751J29686_10001221 JGI24751J29686_100012215 220
1156 3300003578 Ga0006562J51391_1049494 Ga0006562J51391_10494941 220
1157 3300005329 Ga0070683_100021585 Ga0070683_1000215853 220
1158 3300005329 Ga0070683_100246068 Ga0070683_1002460682 220
1159 3300005331 Ga0070670_100187030 Ga0070670_1001870301 220
1160 3300005338 Ga0068868_100185491 Ga0068868_1001854912 220
1161 3300005338 Ga0068868_100548048 Ga0068868_1005480481 220
1162 3300005339 Ga0070660_100064174 Ga0070660_1000641743 220
1163 3300005347 Ga0070668_100047790 Ga0070668_1000477903 220
1164 3300005355 Ga0070671_100027267 Ga0070671_1000272674 220
1165 3300005364 Ga0070673_100026683 Ga0070673_1000266835 220
1166 3300005366 Ga0070659_100009674 Ga0070659_1000096744 220
1167 3300005367 Ga0070667_100287857 Ga0070667_1002878572 220
1168 3300005438 Ga0070701_10029223 Ga0070701_100292233 220
1169 3300005441 Ga0070700_100003448 Ga0070700_1000034485 220
1170 3300005445 Ga0070708_100452070 Ga0070708_1004520701 220
1171 3300005466 Ga0070685_10017354 Ga0070685_100173542 220
1172 3300005466 Ga0070685_10260096 Ga0070685_102600961 220
1173 3300005535 Ga0070684_100000737 Ga0070684_10000073726 220
1174 3300005539 Ga0068853_100047259 Ga0068853_1000472592 220
1175 3300005548 Ga0070665_100092799 Ga0070665_1000927992 220
1176 3300005549 Ga0070704_100404378 Ga0070704_1004043782 220
1177 3300005563 Ga0068855_100263826 Ga0068855_1002638261 220
1178 3300005615 Ga0070702_100002552 Ga0070702_1000025527 220
1179 3300005615 Ga0070702_100003974 Ga0070702_1000039743 220
1180 3300005618 Ga0068864_100079088 Ga0068864_1000790883 220
1181 3300005719 Ga0068861_100084159 Ga0068861_1000841593 220
1182 3300005843 Ga0068860_100096186 Ga0068860_1000961863 220
1183 3300005937 Ga0081455_10074548 Ga0081455_100745481 220
1184 3300006038 Ga0075365_10654456 Ga0075365_106544561 220
1185 3300006042 Ga0075368_10093341 Ga0075368_100933411 220
1186 3300006048 Ga0075363_100013133 Ga0075363_1000131332 220
1187 3300006051 Ga0075364_10566140 Ga0075364_105661401 220
1188 3300006163 Ga0070715_10359202 Ga0070715_103592021 220
1189 3300006178 Ga0075367_10011939 Ga0075367_100119392 220
1190 3300006178 Ga0075367_10523282 Ga0075367_105232821 220
1191 3300006186 Ga0075369_10025295 Ga0075369_100252952 220
1192 3300006881 Ga0068865_100047173 Ga0068865_1000471733 220
1193 3300009011 Ga0105251_10011572 Ga0105251_100115723 220
1194 3300009092 Ga0105250_10194455 Ga0105250_101944551 220
1195 3300009098 Ga0105245_10068501 Ga0105245_100685013 220
1196 3300009098 Ga0105245_10104748 Ga0105245_101047481 220
1197 3300009098 Ga0105245_10120323 Ga0105245_101203233 220
1198 3300009148 Ga0105243_10178280 Ga0105243_101782802 220
1199 3300009148 Ga0105243_11012205 Ga0105243_110122051 220
1200 3300009176 Ga0105242_10061302 Ga0105242_100613022 220
1201 3300009177 Ga0105248_10140365 Ga0105248_101403652 220
1202 3300009177 Ga0105248_10597936 Ga0105248_105979362 220
1203 3300009551 Ga0105238_10500231 Ga0105238_105002312 220
1204 3300009551 Ga0105238_10740519 Ga0105238_107405191 220
1205 3300009553 Ga0105249_10229717 Ga0105249_102297171 220
1206 3300010375 Ga0105239_10004470 Ga0105239_100044703 220
1207 3300013105 Ga0157369_10058042 Ga0157369_100580423 220
1208 3300013105 Ga0157369_10410938 Ga0157369_104109382 220
1209 3300013296 Ga0157374_10162738 Ga0157374_101627382 220
1210 3300013306 Ga0163162_10478723 Ga0163162_104787231 220
1211 3300013306 Ga0163162_10997425 Ga0163162_109974251 220
1212 3300013307 Ga0157372_10122114 Ga0157372_101221143 220
1213 3300013307 Ga0157372_10367583 Ga0157372_103675832 220
1214 3300013308 Ga0157375_10008324 Ga0157375_100083242 220
1215 3300013308 Ga0157375_10100182 Ga0157375_101001824 220
1216 3300014325 Ga0163163_10012638 Ga0163163_100126382 220
1217 3300014325 Ga0163163_10059570 Ga0163163_100595702 220
1218 3300014497 Ga0182008_10003296 Ga0182008_100032968 220
1219 3300014745 Ga0157377_10033626 Ga0157377_100336262 220
1220 3300014968 Ga0157379_10340370 Ga0157379_103403702 220
1221 3300015261 Ga0182006_1049148 Ga0182006_10491482 220
1222 3300015262 Ga0182007_10021380 Ga0182007_100213802 220
1223 3300015265 Ga0182005_1005205 Ga0182005_10052051 220
1224 3300015688 Ga0183367_1002 Ga0183367_100267 220
1225 3300021384 Ga0213876_10004888 Ga0213876_100048884 220
1226 3300025297 Ga0209758_1008145 Ga0209758_10081453 220
1227 3300025302 Ga0207426_1034160 Ga0207426_10341601 220
1228 3300025901 Ga0207688_10004245 Ga0207688_100042452 220
1229 3300025904 Ga0207647_10015250 Ga0207647_100152506 220
1230 3300025919 Ga0207657_10070007 Ga0207657_100700072 220
1231 3300025927 Ga0207687_10073268 Ga0207687_100732682 220
1232 3300025927 Ga0207687_10176178 Ga0207687_101761781 220
1233 3300025934 Ga0207686_10195008 Ga0207686_101950082 220
1234 3300025935 Ga0207709_10512530 Ga0207709_105125302 220
1235 3300025938 Ga0207704_10058453 Ga0207704_100584533 220
1236 3300025941 Ga0207711_10081377 Ga0207711_100813772 220
1237 3300025941 Ga0207711_10270623 Ga0207711_102706232 220
1238 3300025944 Ga0207661_10127590 Ga0207661_101275901 220
1239 3300025981 Ga0207640_10814820 Ga0207640_108148201 220
1240 3300026023 Ga0207677_10116750 Ga0207677_101167503 220
1241 3300026041 Ga0207639_10607331 Ga0207639_106073312 220
1242 3300026095 Ga0207676_10182439 Ga0207676_101824393 220
1243 3300026116 Ga0207674_10006942 Ga0207674_100069424 220
1244 3300026118 Ga0207675_100220175 Ga0207675_1002201752 220
1245 3300026121 Ga0207683_10692187 Ga0207683_106921872 220
1246 3300027866 Ga0209813_10057657 Ga0209813_100576572 220
1247 3300028379 Ga0268266_10347593 Ga0268266_103475932 220
1248 3300028381 Ga0268264_10356346 Ga0268264_103563462 220
1249 3300028786 Ga0307517_10003614 Ga0307517_1000361414 220
1250 3300028794 Ga0307515_10004012 Ga0307515_1000401223 220
1251 3300028794 Ga0307515_10112167 Ga0307515_101121673 220
1252 3300030500 Ga0268256_1007098 Ga0268256_10070981 220
1253 3300030521 Ga0307511_10025825 Ga0307511_100258252 220
1254 3300030522 Ga0307512_10002762 Ga0307512_100027623 220
1255 3300030522 Ga0307512_10027864 Ga0307512_100278643 220
1256 3300030522 Ga0307512_10060614 Ga0307512_100606142 220
1257 3300031456 Ga0307513_10006763 Ga0307513_100067636 220
1258 3300031456 Ga0307513_10013386 Ga0307513_100133868 220
1259 3300031456 Ga0307513_10063901 Ga0307513_100639012 220
1260 3300031616 Ga0307508_10013541 Ga0307508_100135417 220
1261 3300031616 Ga0307508_10047272 Ga0307508_100472725 220
1262 3300031649 Ga0307514_10009038 Ga0307514_100090385 220
1263 3300031649 Ga0307514_10069439 Ga0307514_100694393 220
1264 3300031649 Ga0307514_10072409 Ga0307514_100724093 220
1265 3300031727 Ga0316576_10039017 Ga0316576_100390173 220
1266 3300031730 Ga0307516_10011933 Ga0307516_100119336 220
1267 3300031730 Ga0307516_10088450 Ga0307516_100884502 220
1268 3300031838 Ga0307518_10314003 Ga0307518_103140031 220
1269 3300031852 Ga0307410_10107433 Ga0307410_101074332 220
1270 3300031995 Ga0307409_100124651 Ga0307409_1001246512 220
1271 3300031995 Ga0307409_101001446 Ga0307409_1010014461 220
1272 3300032002 Ga0307416_100272692 Ga0307416_1002726922 220
1273 3300033179 Ga0307507_10045345 Ga0307507_100453453 220
1274 3300033179 Ga0307507_10046672 Ga0307507_100466723 220
1275 3300033180 Ga0307510_10012527 Ga0307510_100125275 220
1276 3300035398 Ga0316574_0003568 Ga0316574_0003568_828_1499 220
1277 3300037471 Ga0395905_0101042 Ga0395905_0101042_1814_2485 220
1278 3300039437 Ga0436365_0242388 Ga0436365_0242388_439_1101 220
1279 3300039437 Ga0436365_1397287 Ga0436365_1397287_275_937 220
1280 3300039450 Ga0436363_0466668 Ga0436363_0466668_35_697 220
1281 3300039450 Ga0436363_1248969 Ga0436363_1248969_2684_3346 220
1282 3300041406 Ga0439439_0004871 Ga0439439_0004871_1048_1719 220
1283 3300041451 Ga0451791_1578104 Ga0451791_1578104_329_1000 220
1284 3300041453 Ga0451797_1409501 Ga0451797_1409501_523_1212 220
1285 3300041460 Ga0451802_0862397 Ga0451802_0862397_1268_1939 220
1286 3300041494 Ga0451837_0921921 Ga0451837_0921921_2165_2836 220
1287 3300041501 Ga0451845_0414028 Ga0451845_0414028_184_855 220
1288 3300041512 Ga0451853_0663764 Ga0451853_0663764_384_1064 220
1289 3300041999 Ga0439433_0000632 Ga0439433_0000632_5835_6506 220
1290 3300042002 Ga0439442_053094 Ga0439442_053094_167_838 220
1291 3300042005 Ga0439448_0062723 Ga0439448_0062723_12_683 220
1292 3300042007 Ga0439449_0001150 Ga0439449_0001150_875_1546 220
1293 3300042011 Ga0439454_006489 Ga0439454_006489_40_711 220
1294 3300042014 Ga0439457_000481 Ga0439457_000481_3720_4400 220
1295 3300042014 Ga0439457_003831 Ga0439457_003831_2343_3014 220
1296 3300042015 Ga0439462_0018847 Ga0439462_0018847_574_1254 220
1297 3300042015 Ga0439462_0030110 Ga0439462_0030110_196_876 220
1298 3300042131 Ga0450894_000022 Ga0450894_000022_13837_14517 220
1299 3300042134 Ga0450898_015765 Ga0450898_015765_492_1172 220
1300 3300042135 Ga0450899_000954 Ga0450899_000954_111_791 220
1301 3300042138 Ga0450903_000614 Ga0450903_000614_3181_3852 220
1302 3300042138 Ga0450903_015493 Ga0450903_015493_40_711 220
1303 3300042157 Ga0439458_0001557 Ga0439458_0001557_4880_5551 220
1304 3300044656 Ga0466969_0005724 Ga0466969_0005724_5334_6005 220
1305 3300044656 Ga0466969_0019700 Ga0466969_0019700_2193_2864 220
1306 3300044656 Ga0466969_0045691 Ga0466969_0045691_47_718 220
1307 3300044658 Ga0466972_0004075 Ga0466972_0004075_3663_4334 220
1308 3300044658 Ga0466972_0046591 Ga0466972_0046591_583_1272 220
1309 3300044658 Ga0466972_0074249 Ga0466972_0074249_365_1036 220
1310 3300044683 Ga0466965_0000907 Ga0466965_0000907_9995_10666 220
1311 3300044683 Ga0466965_0022002 Ga0466965_0022002_1736_2425 220
1312 3300044683 Ga0466965_0122081 Ga0466965_0122081_353_1024 220
1313 3300044684 Ga0466966_0002876 Ga0466966_0002876_9861_10532 220
1314 3300044684 Ga0466966_0021345 Ga0466966_0021345_2633_3304 220
1315 3300044684 Ga0466966_0038389 Ga0466966_0038389_1582_2253 220
1316 3300044684 Ga0466966_0092557 Ga0466966_0092557_564_1241 220
1317 3300044684 Ga0466966_0413259 Ga0466966_0413259_61_756 220
1318 3300044693 Ga0466961_0000308 Ga0466961_0000308_28341_29012 220
1319 3300044693 Ga0466961_0011811 Ga0466961_0011811_142_813 220
1320 3300044693 Ga0466961_0033202 Ga0466961_0033202_2049_2726 220
1321 3300044693 Ga0466961_0237103 Ga0466961_0237103_336_1007 220
1322 3300044694 Ga0466963_0013044 Ga0466963_0013044_3242_3919 220
1323 3300044694 Ga0466963_0143422 Ga0466963_0143422_85_777 220
1324 3300044694 Ga0466963_0269627 Ga0466963_0269627_493_1170 220
1325 3300044694 Ga0466963_0287091 Ga0466963_0287091_56_727 220
1326 3300044694 Ga0466963_0336911 Ga0466963_0336911_170_832 220
1327 3300044694 Ga0466963_0484594 Ga0466963_0484594_158_829 220
1328 3300044706 Ga0466964_0029133 Ga0466964_0029133_1456_2127 220
1329 3300044719 Ga0466971_0000332 Ga0466971_0000332_10580_11251 220
1330 3300044719 Ga0466971_0021847 Ga0466971_0021847_507_1184 220
1331 3300044719 Ga0466971_0048653 Ga0466971_0048653_160_831 220
1332 3300044719 Ga0466971_0093045 Ga0466971_0093045_690_1361 220
1333 3300044719 Ga0466971_0351560 Ga0466971_0351560_10_681 220
1334 3300044735 Ga0466968_0014055 Ga0466968_0014055_319_990 220
1335 3300044765 Ga0466970_0002049 Ga0466970_0002049_6735_7424 220
1336 3300044765 Ga0466970_0004998 Ga0466970_0004998_38_709 220
1337 3300044765 Ga0466970_0014443 Ga0466970_0014443_3283_3954 220
1338 3300044765 Ga0466970_0113781 Ga0466970_0113781_304_996 220
1339 3300044842 Ga0466957_0006604 Ga0466957_0006604_5841_6512 220
1340 3300044842 Ga0466957_0030878 Ga0466957_0030878_977_1666 220
1341 3300044842 Ga0466957_0066334 Ga0466957_0066334_59_754 220
1342 3300044842 Ga0466957_0285122 Ga0466957_0285122_245_922 220
1343 3300044901 Ga0466960_0021659 Ga0466960_0021659_657_1352 220
1344 3300044901 Ga0466960_0195287 Ga0466960_0195287_315_998 220
1345 3300045049 Ga0466959_0000668 Ga0466959_0000668_10603_11274 220
1346 3300045049 Ga0466959_0005979 Ga0466959_0005979_1848_2525 220
1347 3300045049 Ga0466959_0015896 Ga0466959_0015896_4310_4981 220
1348 3300045049 Ga0466959_0046010 Ga0466959_0046010_171_842 220
1349 3300045049 Ga0466959_0170975 Ga0466959_0170975_736_1431 220
1350 3300045051 Ga0451576_0392237 Ga0451576_0392237_320_1009 220
1351 3300045836 Ga0466958_0000773 Ga0466958_0000773_3429_4100 220
1352 3300045836 Ga0466958_0046047 Ga0466958_0046047_1669_2346 220
1353 3300045976 Ga0466967_0035405 Ga0466967_0035405_543_1205 220
1354 3300045976 Ga0466967_0038433 Ga0466967_0038433_3351_4022 220
1355 3300045976 Ga0466967_0040073 Ga0466967_0040073_452_1123 220
1356 3300045976 Ga0466967_0065908 Ga0466967_0065908_1774_2436 220
1357 3300045976 Ga0466967_0074385 Ga0466967_0074385_2156_2818 220
1358 3300045976 Ga0466967_0791518 Ga0466967_0791518_233_904 220
1359 3300046452 Ga0495617_024406 Ga0495617_024406_844_1515 220
1360 3300046454 Ga0495592_0060598 Ga0495592_0060598_335_1096 220
1361 3300046455 Ga0495603_0000638 Ga0495603_0000638_13239_13910 220
1362 3300046455 Ga0495603_0001879 Ga0495603_0001879_7363_8034 220
1363 3300046455 Ga0495603_0005158 Ga0495603_0005158_3327_3998 220
1364 3300046455 Ga0495603_0023079 Ga0495603_0023079_719_1390 220
1365 3300046455 Ga0495603_0381922 Ga0495603_0381922_83_754 220
1366 3300046459 Ga0495629_0001217 Ga0495629_0001217_7386_8057 220
1367 3300046459 Ga0495629_0003212 Ga0495629_0003212_7838_8509 220
1368 3300046459 Ga0495629_0007463 Ga0495629_0007463_5064_5735 220
1369 3300046459 Ga0495629_0019525 Ga0495629_0019525_2207_2878 220
1370 3300046460 Ga0495638_0020561 Ga0495638_0020561_3644_4315 220
1371 3300046460 Ga0495638_0049586 Ga0495638_0049586_1288_1959 220
1372 3300046462 Ga0495651_0000989 Ga0495651_0000989_10437_11108 220
1373 3300046462 Ga0495651_0187091 Ga0495651_0187091_51_722 220
1374 3300046462 Ga0495651_0524202 Ga0495651_0524202_47_739 220
1375 3300046463 Ga0495653_0101896 Ga0495653_0101896_197_868 220
1376 3300046474 Ga0495605_0016690 Ga0495605_0016690_2862_3533 220
1377 3300046476 Ga0495662_0000804 Ga0495662_0000804_3705_4376 220
1378 3300046476 Ga0495662_0139395 Ga0495662_0139395_472_1143 220
1379 3300046477 Ga0495664_0001534 Ga0495664_0001534_10937_11608 220
1380 3300046477 Ga0495664_0334726 Ga0495664_0334726_19_690 220
1381 3300046491 Ga0495584_0024076 Ga0495584_0024076_229_900 220
1382 3300046492 Ga0495585_0057137 Ga0495585_0057137_39_710 220
1383 3300046499 Ga0495594_0001615 Ga0495594_0001615_6887_7558 220
1384 3300046501 Ga0495607_0035092 Ga0495607_0035092_1120_1791 220
1385 3300046507 Ga0495606_0021860 Ga0495606_0021860_733_1404 220
1386 3300046512 Ga0495610_0050106 Ga0495610_0050106_1352_2023 220
1387 3300046513 Ga0495616_0003394 Ga0495616_0003394_6032_6703 220
1388 3300046514 Ga0495618_0044728 Ga0495618_0044728_1475_2146 220
1389 3300046514 Ga0495618_0071381 Ga0495618_0071381_393_1064 220
1390 3300046515 Ga0495620_0011476 Ga0495620_0011476_1049_1720 220
1391 3300046516 Ga0495628_0029750 Ga0495628_0029750_3681_4352 220
1392 3300046517 Ga0495630_0005265 Ga0495630_0005265_1990_2661 220
1393 3300046518 Ga0495631_0046728 Ga0495631_0046728_234_905 220
1394 3300046518 Ga0495631_0058036 Ga0495631_0058036_949_1620 220
1395 3300046520 Ga0495637_0034789 Ga0495637_0034789_21_692 220
1396 3300046522 Ga0495643_0002300 Ga0495643_0002300_2298_2969 220
1397 3300046529 Ga0495652_0020630 Ga0495652_0020630_2163_2834 220
1398 3300046529 Ga0495652_0215278 Ga0495652_0215278_41_712 220
1399 3300046530 Ga0495654_0033076 Ga0495654_0033076_162_833 220
1400 3300046533 Ga0495640_0005552 Ga0495640_0005552_2270_2941 220
1401 3300046536 Ga0495587_0001229 Ga0495587_0001229_4561_5232 220
1402 3300046538 Ga0495609_0012628 Ga0495609_0012628_1671_2342 220
1403 3300046542 Ga0495597_0014194 Ga0495597_0014194_2058_2729 220
1404 3300046543 Ga0495645_0055025 Ga0495645_0055025_2161_2832 220
1405 3300046543 Ga0495645_0081590 Ga0495645_0081590_1596_2267 220
1406 3300046557 Ga0495622_0029426 Ga0495622_0029426_300_971 220
1407 3300046558 Ga0495633_0008493 Ga0495633_0008493_1600_2271 220
1408 3300046559 Ga0495667_0312544 Ga0495667_0312544_114_785 220
1409 3300046616 Ga0495668_0042882 Ga0495668_0042882_654_1325 220
1410 3300046642 Ga0495634_0001818 Ga0495634_0001818_15134_15805 220
1411 3300046642 Ga0495634_0088769 Ga0495634_0088769_493_1164 220
1412 3300046648 Ga0495611_0013050 Ga0495611_0013050_182_853 220
1413 3300046648 Ga0495611_0053131 Ga0495611_0053131_1100_1771 220
1414 3300046648 Ga0495611_0102466 Ga0495611_0102466_168_839 220
1415 3300046660 Ga0495625_0021558 Ga0495625_0021558_2218_2889 220
1416 3300046660 Ga0495625_0035084 Ga0495625_0035084_2314_2985 220
1417 3300046663 Ga0495635_0003044 Ga0495635_0003044_7172_7843 220
1418 3300046665 Ga0495661_0017649 Ga0495661_0017649_3541_4212 220
1419 3300046674 Ga0495588_0013636 Ga0495588_0013636_3020_3691 220
1420 3300046674 Ga0495588_0031500 Ga0495588_0031500_1284_1955 220
1421 3300046675 Ga0495657_0000796 Ga0495657_0000796_9126_9797 220
1422 3300046675 Ga0495657_0023246 Ga0495657_0023246_2617_3288 220
1423 3300046683 Ga0495658_0057579 Ga0495658_0057579_370_1041 220
1424 3300046683 Ga0495658_0246094 Ga0495658_0246094_27_698 220
1425 3300046689 Ga0495613_0002324 Ga0495613_0002324_2243_2914 220
1426 3300046689 Ga0495613_0284100 Ga0495613_0284100_454_1125 220
1427 3300046689 Ga0495613_0563143 Ga0495613_0563143_47_718 220
1428 3300046691 Ga0495670_0039497 Ga0495670_0039497_773_1444 220
1429 3300046691 Ga0495670_0199162 Ga0495670_0199162_281_952 220
1430 3300046694 Ga0495649_0050901 Ga0495649_0050901_1022_1693 220
1431 3300046794 Ga0495589_0006450 Ga0495589_0006450_5347_6018 220
1432 3300046794 Ga0495589_0048666 Ga0495589_0048666_541_1212 220
1433 3300046809 Ga0495600_0003691 Ga0495600_0003691_611_1282 220
1434 3300046809 Ga0495600_0052676 Ga0495600_0052676_1168_1839 220
1435 3300046810 Ga0495660_0074787 Ga0495660_0074787_564_1235 220
1436 3300047315 Ga0495581_0004218 Ga0495581_0004218_1572_2243 220
1437 3300047317 Ga0495604_0000695 Ga0495604_0000695_3970_4641 220
1438 3300047317 Ga0495604_0079704 Ga0495604_0079704_1583_2254 220
1439 3300047318 Ga0495636_0002781 Ga0495636_0002781_3539_4210 220
1440 3300047318 Ga0495636_0007046 Ga0495636_0007046_25_696 220
1441 3300047318 Ga0495636_0022839 Ga0495636_0022839_576_1247 220
1442 3300047318 Ga0495636_0255419 Ga0495636_0255419_106_777 220
1443 3300047320 Ga0495672_0028599 Ga0495672_0028599_2808_3479 220
1444 3300047321 Ga0495676_0005115 Ga0495676_0005115_323_994 220
1445 3300047321 Ga0495676_0009942 Ga0495676_0009942_7550_8221 220
1446 3300047321 Ga0495676_0019817 Ga0495676_0019817_610_1281 220
1447 3300047321 Ga0495676_0025430 Ga0495676_0025430_323_994 220
1448 3300047321 Ga0495676_0094001 Ga0495676_0094001_1320_1991 220
1449 3300047322 Ga0495680_0096193 Ga0495680_0096193_1449_2120 220
1450 3300047323 Ga0495683_0083660 Ga0495683_0083660_715_1386 220
1451 3300047443 Ga0495687_003278 Ga0495687_003278_2861_3532 220
1452 3300047443 Ga0495687_005559 Ga0495687_005559_434_1105 220
1453 3300047443 Ga0495687_025871 Ga0495687_025871_1795_2466 220
1454 3300047444 Ga0495675_0068124 Ga0495675_0068124_537_1208 220
1455 3300047445 Ga0495677_0080392 Ga0495677_0080392_504_1175 220
1456 3300047447 Ga0495685_007505 Ga0495685_007505_2637_3308 220
1457 3300047447 Ga0495685_010371 Ga0495685_010371_112_783 220
1458 3300047447 Ga0495685_012966 Ga0495685_012966_1497_2168 220
1459 3300047447 Ga0495685_028167 Ga0495685_028167_254_925 220
1460 3300047447 Ga0495685_035141 Ga0495685_035141_498_1169 220
1461 3300047470 Ga0495681_0003919 Ga0495681_0003919_9191_9862 220
1462 3300047471 Ga0495684_0017005 Ga0495684_0017005_2506_3177 220
1463 3300047472 Ga0495686_0012981 Ga0495686_0012981_213_884 220
1464 3300047472 Ga0495686_0017187 Ga0495686_0017187_4178_4849 220
1465 3300047673 Ga0495593_0001318 Ga0495593_0001318_1931_2602 220
1466 3300047673 Ga0495593_0050323 Ga0495593_0050323_69_740 220
1467 3300047673 Ga0495593_0357732 Ga0495593_0357732_34_705 220
1468 3300048088 Ga0495602_0048486 Ga0495602_0048486_2151_2822 220
1469 3300048089 Ga0495614_0000529 Ga0495614_0000529_12799_13470 220
1470 3300048089 Ga0495614_0049900 Ga0495614_0049900_565_1236 220
1471 3300048091 Ga0495626_0063393 Ga0495626_0063393_70_741 220
1472 3300048905 Ga0496102_0946529 Ga0496102_0946529_87_758 220
1473 3300048906 Ga0496103_0209106 Ga0496103_0209106_417_1088 220
1474 3300048907 Ga0496104_0133150 Ga0496104_0133150_1692_2363 220
1475 3300048908 Ga0496105_0638364 Ga0496105_0638364_52_723 220
1476 3300048909 Ga0496106_0225478 Ga0496106_0225478_217_906 220
1477 3300048910 Ga0496107_0365021 Ga0496107_0365021_330_1019 220
1478 3300048911 Ga0496108_0183127 Ga0496108_0183127_402_1091 220
1479 3300048911 Ga0496108_0219585 Ga0496108_0219585_641_1312 220
1480 3300048911 Ga0496108_0261671 Ga0496108_0261671_496_1188 220
1481 3300048912 Ga0496109_0047020 Ga0496109_0047020_1077_1769 220
1482 3300048912 Ga0496109_0179586 Ga0496109_0179586_395_1066 220
1483 3300048912 Ga0496109_0336019 Ga0496109_0336019_174_863 220
1484 3300048912 Ga0496109_0390369 Ga0496109_0390369_583_1254 220
1485 3300048913 Ga0496110_0004560 Ga0496110_0004560_5079_5768 220
1486 3300048913 Ga0496110_0053232 Ga0496110_0053232_2298_2969 220
1487 3300048914 Ga0496111_0022705 Ga0496111_0022705_322_1011 220
1488 3300048914 Ga0496111_0232079 Ga0496111_0232079_398_1069 220
1489 3300048915 Ga0496112_0135361 Ga0496112_0135361_1356_2027 220
1490 3300048916 Ga0496113_0344330 Ga0496113_0344330_11_682 220
1491 3300048916 Ga0496113_0430715 Ga0496113_0430715_184_855 220
1492 3300048917 Ga0496114_0016099 Ga0496114_0016099_2399_3070 220
1493 3300048917 Ga0496114_0343733 Ga0496114_0343733_350_1042 220
1494 3300049459 Ga0495678_056769 Ga0495678_056769_72_743 220
1495 3300049568 Ga0501031_0157940 Ga0501031_0157940_604_1275 220
1496 3300049569 Ga0501032_0003034 Ga0501032_0003034_7770_8432 220
1497 3300049569 Ga0501032_0042190 Ga0501032_0042190_216_887 220
1498 3300049570 Ga0501033_0009919 Ga0501033_0009919_2930_3610 220
1499 3300049570 Ga0501033_0030574 Ga0501033_0030574_19_690 220
1500 3300049570 Ga0501033_0033714 Ga0501033_0033714_1709_2371 220
1501 3300049570 Ga0501033_0092653 Ga0501033_0092653_1029_1700 220
1502 3300049571 Ga0501034_0003557 Ga0501034_0003557_4910_5572 220
1503 3300049571 Ga0501034_0005363 Ga0501034_0005363_9774_10454 220
1504 3300049571 Ga0501034_0151625 Ga0501034_0151625_1581_2261 220
1505 3300049572 Ga0501036_0000553 Ga0501036_0000553_17209_17889 220
1506 3300049572 Ga0501036_0032873 Ga0501036_0032873_1464_2135 220
1507 3300049572 Ga0501036_0051941 Ga0501036_0051941_2491_3171 220
1508 3300049572 Ga0501036_0111450 Ga0501036_0111450_780_1442 220
1509 3300049573 Ga0501037_0155175 Ga0501037_0155175_131_802 220
1510 3300049574 Ga0501038_0002207 Ga0501038_0002207_1155_1826 220
1511 3300049574 Ga0501038_0144333 Ga0501038_0144333_437_1108 220
1512 3300049575 Ga0501039_0002645 Ga0501039_0002645_12649_13329 220
1513 3300049577 Ga0501041_0268600 Ga0501041_0268600_296_982 220
1514 3300049578 Ga0501042_0028160 Ga0501042_0028160_43_714 220
1515 3300049578 Ga0501042_0115999 Ga0501042_0115999_938_1624 220
1516 3300049578 Ga0501042_0556022 Ga0501042_0556022_134_814 220
1517 3300049579 Ga0501043_0007809 Ga0501043_0007809_250_912 220
1518 3300049579 Ga0501043_0119835 Ga0501043_0119835_1352_2023 220
1519 3300049579 Ga0501043_0146961 Ga0501043_0146961_79_750 220
1520 3300049580 Ga0501046_0001119 Ga0501046_0001119_4401_5063 220
1521 3300049581 Ga0501047_0003260 Ga0501047_0003260_4586_5248 220
1522 3300049581 Ga0501047_0017015 Ga0501047_0017015_1544_2215 220
1523 3300049581 Ga0501047_0048348 Ga0501047_0048348_89_769 220
1524 3300049581 Ga0501047_0577209 Ga0501047_0577209_36_707 220
1525 3300049582 Ga0501048_0004538 Ga0501048_0004538_4321_4983 220
1526 3300049582 Ga0501048_0025711 Ga0501048_0025711_3399_4070 220
1527 3300049584 Ga0501068_0108969 Ga0501068_0108969_787_1467 220
1528 3300049585 Ga0501069_0111469 Ga0501069_0111469_830_1510 220
1529 3300049586 Ga0501070_0000903 Ga0501070_0000903_12714_13394 220
1530 3300049586 Ga0501070_0001404 Ga0501070_0001404_4585_5247 220
1531 3300049587 Ga0501071_0305176 Ga0501071_0305176_238_915 220
1532 3300049589 Ga0501073_0127874 Ga0501073_0127874_665_1327 220
1533 3300049592 Ga0501076_0552935 Ga0501076_0552935_178_864 220
1534 3300049742 Ga0501080_0107698 Ga0501080_0107698_1160_1831 220
1535 3300049822 Ga0501035_0002105 Ga0501035_0002105_4557_5219 220
1536 3300049822 Ga0501035_0004257 Ga0501035_0004257_4725_5405 220
1537 3300049823 Ga0501044_0001501 Ga0501044_0001501_4585_5247 220
1538 3300049823 Ga0501044_0007347 Ga0501044_0007347_55_726 220
1539 3300049823 Ga0501044_0009230 Ga0501044_0009230_724_1395 220
1540 3300049823 Ga0501044_0114577 Ga0501044_0114577_1137_1808 220
1541 3300050494 nmdc:mga06z11_8290_c1 nmdc:mga06z11_8290_c1_3242_3913 220
1542 3300050495 nmdc:mga04h51_28168_c1 nmdc:mga04h51_28168_c1_286_957 220
1543 3300050496 nmdc:mga07m45_284769_c1 nmdc:mga07m45_284769_c1_196_867 220
1544 3300053085 Ga0495619_0114510 Ga0495619_0114510_820_1491 220
1545 3300053095 Ga0500640_006196 Ga0500640_006196_3592_4263 220
1546 3300053096 Ga0500641_0000536 Ga0500641_0000536_1079_1756 220
1547 3300053096 Ga0500641_0236367 Ga0500641_0236367_67_738 220
1548 3300053107 Ga0500560_122894 Ga0500560_122894_39_710 220
1549 3300053157 Ga0500624_001462 Ga0500624_001462_619_1290 220
1550 3300061719 Ga0466962_0000635 Ga0466962_0000635_5462_6133 220
1551 3300061719 Ga0466962_0011536 Ga0466962_0011536_527_1204 220
1552 3300061719 Ga0466962_0070526 Ga0466962_0070526_968_1639 220
1553 3300061719 Ga0466962_0186336 Ga0466962_0186336_291_980 220
1554 iso_pu_bacteria 2547132111 2547408390 220
1555 iso_pu_bacteria 2643221548 2643764021 220
1556 iso_pu_bacteria 2751185725 2753035375 220
1557 iso_pu_bacteria 2751185792 2753323892 220
1558 iso_pu_bacteria 8054609563 8054613239 220
1559 3300041452 Ga0451793_0507191 Ga0451793_0507191_474_1190 221
1560 3300041456 Ga0451795_0914352 Ga0451795_0914352_117_833 221
1561 3300041494 Ga0451837_0276975 Ga0451837_0276975_313_1029 221
1562 3300041509 Ga0451843_0437279 Ga0451843_0437279_312_1028 221
1563 3300048909 Ga0496106_0848364 Ga0496106_0848364_12_686 221
1564 3300002067 JGI24735J21928_10027825 JGI24735J21928_100278251 222
1565 3300005548 Ga0070665_100014993 Ga0070665_1000149934 222
1566 3300005563 Ga0068855_100013371 Ga0068855_1000133715 222
1567 3300005614 Ga0068856_100108589 Ga0068856_1001085892 222
1568 3300009174 Ga0105241_10004696 Ga0105241_100046968 222
1569 3300009551 Ga0105238_10015709 Ga0105238_100157091 222
1570 3300010375 Ga0105239_10054240 Ga0105239_100542403 222
1571 3300013105 Ga0157369_10608606 Ga0157369_106086062 222
1572 3300025321 Ga0207656_10083705 Ga0207656_100837052 222
1573 3300025904 Ga0207647_10003737 Ga0207647_1000373710 222
1574 3300025911 Ga0207654_10008291 Ga0207654_100082915 222
1575 3300025913 Ga0207695_10010754 Ga0207695_100107549 222
1576 3300025914 Ga0207671_10004875 Ga0207671_100048759 222
1577 3300025924 Ga0207694_10007071 Ga0207694_100070713 222
1578 3300025949 Ga0207667_10029835 Ga0207667_100298355 222
1579 3300026041 Ga0207639_10025120 Ga0207639_100251202 222
1580 3300026078 Ga0207702_10106237 Ga0207702_101062372 222
1581 3300026121 Ga0207683_10384640 Ga0207683_103846402 222
1582 3300028379 Ga0268266_10017791 Ga0268266_100177912 222
1583 3300032005 Ga0307411_10207211 Ga0307411_102072112 222
1584 3300033179 Ga0307507_10269844 Ga0307507_102698442 222
1585 3300044656 Ga0466969_0016641 Ga0466969_0016641_2850_3527 222
1586 3300044693 Ga0466961_0031962 Ga0466961_0031962_2435_3112 222
1587 3300044693 Ga0466961_0106941 Ga0466961_0106941_885_1562 222
1588 3300045049 Ga0466959_0201915 Ga0466959_0201915_121_798 222
1589 3300046462 Ga0495651_0000752 Ga0495651_0000752_5980_6657 222
1590 3300046477 Ga0495664_0367946 Ga0495664_0367946_111_788 222
1591 3300046516 Ga0495628_0001200 Ga0495628_0001200_15061_15738 222
1592 3300046529 Ga0495652_0000586 Ga0495652_0000586_14057_14734 222
1593 3300046543 Ga0495645_0014240 Ga0495645_0014240_3806_4483 222
1594 3300046679 Ga0495623_0051388 Ga0495623_0051388_921_1598 222
1595 3300046809 Ga0495600_0006527 Ga0495600_0006527_1582_2259 222
1596 3300047317 Ga0495604_0031309 Ga0495604_0031309_1686_2363 222
1597 3300000546 LJNas_1002234 LJNas_10022343 223
1598 3300001989 JGI24739J22299_10018981 JGI24739J22299_100189813 223
1599 3300001991 JGI24743J22301_10024147 JGI24743J22301_100241472 223
1600 3300002073 JGI24745J21846_1007568 JGI24745J21846_10075681 223
1601 3300002077 JGI24744J21845_10029918 JGI24744J21845_100299181 223
1602 3300002244 JGI24742J22300_10018246 JGI24742J22300_100182461 223
1603 3300005328 Ga0070676_10041661 Ga0070676_100416613 223
1604 3300005329 Ga0070683_100052263 Ga0070683_1000522633 223
1605 3300005334 Ga0068869_100018867 Ga0068869_1000188675 223
1606 3300005334 Ga0068869_100212345 Ga0068869_1002123451 223
1607 3300005336 Ga0070680_100413841 Ga0070680_1004138412 223
1608 3300005337 Ga0070682_100038312 Ga0070682_1000383122 223
1609 3300005337 Ga0070682_100222035 Ga0070682_1002220351 223
1610 3300005338 Ga0068868_100049822 Ga0068868_1000498223 223
1611 3300005339 Ga0070660_100222588 Ga0070660_1002225882 223
1612 3300005341 Ga0070691_10017872 Ga0070691_100178722 223
1613 3300005343 Ga0070687_100201635 Ga0070687_1002016352 223
1614 3300005347 Ga0070668_100158257 Ga0070668_1001582572 223
1615 3300005355 Ga0070671_100096836 Ga0070671_1000968362 223
1616 3300005355 Ga0070671_100180354 Ga0070671_1001803541 223
1617 3300005356 Ga0070674_100012179 Ga0070674_1000121795 223
1618 3300005364 Ga0070673_100155281 Ga0070673_1001552812 223
1619 3300005365 Ga0070688_100046284 Ga0070688_1000462842 223
1620 3300005365 Ga0070688_100134045 Ga0070688_1001340452 223
1621 3300005367 Ga0070667_100008326 Ga0070667_1000083268 223
1622 3300005367 Ga0070667_100134337 Ga0070667_1001343371 223
1623 3300005367 Ga0070667_100930914 Ga0070667_1009309141 223
1624 3300005434 Ga0070709_10164011 Ga0070709_101640112 223
1625 3300005435 Ga0070714_100041771 Ga0070714_1000417711 223
1626 3300005435 Ga0070714_100120047 Ga0070714_1001200472 223
1627 3300005437 Ga0070710_10032805 Ga0070710_100328052 223
1628 3300005439 Ga0070711_100014320 Ga0070711_1000143202 223
1629 3300005441 Ga0070700_100151491 Ga0070700_1001514912 223
1630 3300005455 Ga0070663_100067966 Ga0070663_1000679662 223
1631 3300005455 Ga0070663_100158763 Ga0070663_1001587632 223
1632 3300005456 Ga0070678_100009238 Ga0070678_1000092385 223
1633 3300005456 Ga0070678_100406661 Ga0070678_1004066612 223
1634 3300005457 Ga0070662_100008744 Ga0070662_1000087442 223
1635 3300005459 Ga0068867_100001230 Ga0068867_1000012304 223
1636 3300005539 Ga0068853_100006449 Ga0068853_1000064494 223
1637 3300005543 Ga0070672_100104658 Ga0070672_1001046582 223
1638 3300005543 Ga0070672_100439267 Ga0070672_1004392671 223
1639 3300005544 Ga0070686_100145225 Ga0070686_1001452252 223
1640 3300005545 Ga0070695_100009168 Ga0070695_1000091683 223
1641 3300005546 Ga0070696_100190938 Ga0070696_1001909382 223
1642 3300005547 Ga0070693_100055738 Ga0070693_1000557382 223
1643 3300005548 Ga0070665_100106886 Ga0070665_1001068862 223
1644 3300005548 Ga0070665_100202051 Ga0070665_1002020512 223
1645 3300005549 Ga0070704_100175610 Ga0070704_1001756102 223
1646 3300005563 Ga0068855_100108712 Ga0068855_1001087122 223
1647 3300005563 Ga0068855_100245461 Ga0068855_1002454612 223
1648 3300005563 Ga0068855_100520288 Ga0068855_1005202882 223
1649 3300005578 Ga0068854_100017680 Ga0068854_1000176805 223
1650 3300005578 Ga0068854_100066956 Ga0068854_1000669562 223
1651 3300005615 Ga0070702_100148510 Ga0070702_1001485102 223
1652 3300005616 Ga0068852_100166246 Ga0068852_1001662462 223
1653 3300005617 Ga0068859_100019447 Ga0068859_1000194475 223
1654 3300005617 Ga0068859_100299831 Ga0068859_1002998312 223
1655 3300005618 Ga0068864_100804846 Ga0068864_1008048462 223
1656 3300005718 Ga0068866_10078301 Ga0068866_100783012 223
1657 3300005718 Ga0068866_10088642 Ga0068866_100886421 223
1658 3300005719 Ga0068861_100022214 Ga0068861_1000222142 223
1659 3300005719 Ga0068861_100189935 Ga0068861_1001899352 223
1660 3300005719 Ga0068861_100288222 Ga0068861_1002882222 223
1661 3300005834 Ga0068851_10165638 Ga0068851_101656382 223
1662 3300005841 Ga0068863_100022717 Ga0068863_1000227177 223
1663 3300005842 Ga0068858_100090693 Ga0068858_1000906931 223
1664 3300005842 Ga0068858_100151031 Ga0068858_1001510312 223
1665 3300005843 Ga0068860_100029872 Ga0068860_1000298723 223
1666 3300005844 Ga0068862_100020623 Ga0068862_1000206235 223
1667 3300005844 Ga0068862_100296054 Ga0068862_1002960542 223
1668 3300005937 Ga0081455_10029466 Ga0081455_100294663 223
1669 3300006028 Ga0070717_10376712 Ga0070717_103767123 223
1670 3300006038 Ga0075365_10019569 Ga0075365_100195692 223
1671 3300006038 Ga0075365_10025950 Ga0075365_100259502 223
1672 3300006038 Ga0075365_10027908 Ga0075365_100279083 223
1673 3300006042 Ga0075368_10027373 Ga0075368_100273732 223
1674 3300006048 Ga0075363_100002601 Ga0075363_1000026017 223
1675 3300006048 Ga0075363_100002888 Ga0075363_10000288810 223
1676 3300006048 Ga0075363_100035938 Ga0075363_1000359382 223
1677 3300006048 Ga0075363_100272464 Ga0075363_1002724642 223
1678 3300006051 Ga0075364_10040348 Ga0075364_100403483 223
1679 3300006051 Ga0075364_10042036 Ga0075364_100420363 223
1680 3300006163 Ga0070715_10055539 Ga0070715_100555392 223
1681 3300006163 Ga0070715_10070388 Ga0070715_100703882 223
1682 3300006173 Ga0070716_100021084 Ga0070716_1000210842 223
1683 3300006173 Ga0070716_100048735 Ga0070716_1000487353 223
1684 3300006175 Ga0070712_100007315 Ga0070712_1000073155 223
1685 3300006175 Ga0070712_100125009 Ga0070712_1001250091 223
1686 3300006177 Ga0075362_10113800 Ga0075362_101138002 223
1687 3300006178 Ga0075367_10028198 Ga0075367_100281982 223
1688 3300006178 Ga0075367_10130382 Ga0075367_101303821 223
1689 3300006186 Ga0075369_10010428 Ga0075369_100104283 223
1690 3300006186 Ga0075369_10074907 Ga0075369_100749071 223
1691 3300006186 Ga0075369_10077748 Ga0075369_100777482 223
1692 3300006186 Ga0075369_10117158 Ga0075369_101171581 223
1693 3300006237 Ga0097621_100133318 Ga0097621_1001333182 223
1694 3300006353 Ga0075370_10003021 Ga0075370_100030215 223
1695 3300006353 Ga0075370_10099536 Ga0075370_100995362 223
1696 3300006353 Ga0075370_10123420 Ga0075370_101234202 223
1697 3300006353 Ga0075370_10142330 Ga0075370_101423301 223
1698 3300006358 Ga0068871_100130721 Ga0068871_1001307212 223
1699 3300006844 Ga0075428_100004401 Ga0075428_10000440120 223
1700 3300006846 Ga0075430_100033633 Ga0075430_1000336334 223
1701 3300006846 Ga0075430_100357475 Ga0075430_1003574751 223
1702 3300006847 Ga0075431_100051511 Ga0075431_1000515114 223
1703 3300006881 Ga0068865_100157416 Ga0068865_1001574162 223
1704 3300006881 Ga0068865_100174082 Ga0068865_1001740822 223
1705 3300006931 Ga0097620_100019448 Ga0097620_1000194485 223
1706 3300006931 Ga0097620_100299819 Ga0097620_1002998192 223
1707 3300009092 Ga0105250_10072137 Ga0105250_100721372 223
1708 3300009098 Ga0105245_10002311 Ga0105245_1000231120 223
1709 3300009098 Ga0105245_10263866 Ga0105245_102638661 223
1710 3300009147 Ga0114129_10323469 Ga0114129_103234693 223
1711 3300009148 Ga0105243_10020757 Ga0105243_100207571 223
1712 3300009148 Ga0105243_10411839 Ga0105243_104118391 223
1713 3300009174 Ga0105241_10332511 Ga0105241_103325111 223
1714 3300009176 Ga0105242_10021206 Ga0105242_100212064 223
1715 3300009177 Ga0105248_10037787 Ga0105248_100377872 223
1716 3300009177 Ga0105248_10159115 Ga0105248_101591152 223
1717 3300009545 Ga0105237_10001807 Ga0105237_1000180719 223
1718 3300009551 Ga0105238_10154229 Ga0105238_101542293 223
1719 3300009551 Ga0105238_10181560 Ga0105238_101815601 223
1720 3300009553 Ga0105249_10002470 Ga0105249_1000247021 223
1721 3300009553 Ga0105249_10056827 Ga0105249_100568273 223
1722 3300009553 Ga0105249_10117111 Ga0105249_101171112 223
1723 3300009553 Ga0105249_10776347 Ga0105249_107763471 223
1724 3300010375 Ga0105239_10003912 Ga0105239_1000391212 223
1725 3300010375 Ga0105239_10064325 Ga0105239_100643253 223
1726 3300010375 Ga0105239_10385628 Ga0105239_103856282 223
1727 3300011119 Ga0105246_10452018 Ga0105246_104520181 223
1728 3300013296 Ga0157374_10027664 Ga0157374_100276644 223
1729 3300013297 Ga0157378_10030818 Ga0157378_100308182 223
1730 3300013297 Ga0157378_10379793 Ga0157378_103797931 223
1731 3300013306 Ga0163162_10032889 Ga0163162_100328896 223
1732 3300013306 Ga0163162_10041572 Ga0163162_100415723 223
1733 3300013306 Ga0163162_10045256 Ga0163162_100452564 223
1734 3300013306 Ga0163162_10388714 Ga0163162_103887142 223
1735 3300013307 Ga0157372_10024009 Ga0157372_100240092 223
1736 3300013307 Ga0157372_10556438 Ga0157372_105564381 223
1737 3300013308 Ga0157375_10002207 Ga0157375_1000220723 223
1738 3300014325 Ga0163163_10007532 Ga0163163_1000753212 223
1739 3300014326 Ga0157380_10005890 Ga0157380_1000589010 223
1740 3300014745 Ga0157377_10013698 Ga0157377_100136983 223
1741 3300014968 Ga0157379_10063345 Ga0157379_100633452 223
1742 3300014968 Ga0157379_11246859 Ga0157379_112468591 223
1743 3300017792 Ga0163161_10008851 Ga0163161_100088513 223
1744 3300017792 Ga0163161_10044177 Ga0163161_100441772 223
1745 3300021384 Ga0213876_10005167 Ga0213876_100051676 223
1746 3300025898 Ga0207692_10005049 Ga0207692_100050496 223
1747 3300025898 Ga0207692_10009781 Ga0207692_100097813 223
1748 3300025899 Ga0207642_10001826 Ga0207642_100018265 223
1749 3300025899 Ga0207642_10065054 Ga0207642_100650541 223
1750 3300025900 Ga0207710_10096215 Ga0207710_100962152 223
1751 3300025901 Ga0207688_10002242 Ga0207688_100022422 223
1752 3300025901 Ga0207688_10009670 Ga0207688_100096705 223
1753 3300025904 Ga0207647_10012119 Ga0207647_100121192 223
1754 3300025905 Ga0207685_10030871 Ga0207685_100308712 223
1755 3300025905 Ga0207685_10061026 Ga0207685_100610262 223
1756 3300025907 Ga0207645_10285012 Ga0207645_102850121 223
1757 3300025911 Ga0207654_10032568 Ga0207654_100325683 223
1758 3300025912 Ga0207707_10251968 Ga0207707_102519683 223
1759 3300025914 Ga0207671_10004750 Ga0207671_100047508 223
1760 3300025915 Ga0207693_10002466 Ga0207693_1000246620 223
1761 3300025916 Ga0207663_10003233 Ga0207663_100032338 223
1762 3300025916 Ga0207663_10110443 Ga0207663_101104432 223
1763 3300025917 Ga0207660_10389315 Ga0207660_103893151 223
1764 3300025918 Ga0207662_10017337 Ga0207662_100173373 223
1765 3300025918 Ga0207662_10337861 Ga0207662_103378612 223
1766 3300025919 Ga0207657_10112084 Ga0207657_101120842 223
1767 3300025927 Ga0207687_10010539 Ga0207687_100105393 223
1768 3300025929 Ga0207664_10025960 Ga0207664_100259604 223
1769 3300025929 Ga0207664_10448958 Ga0207664_104489581 223
1770 3300025931 Ga0207644_10017014 Ga0207644_100170142 223
1771 3300025932 Ga0207690_10173382 Ga0207690_101733822 223
1772 3300025933 Ga0207706_10005885 Ga0207706_1000588510 223
1773 3300025933 Ga0207706_10006389 Ga0207706_100063893 223
1774 3300025934 Ga0207686_10002303 Ga0207686_100023037 223
1775 3300025935 Ga0207709_10009751 Ga0207709_100097515 223
1776 3300025935 Ga0207709_10016414 Ga0207709_100164142 223
1777 3300025936 Ga0207670_10056448 Ga0207670_100564483 223
1778 3300025937 Ga0207669_10000555 Ga0207669_1000055522 223
1779 3300025938 Ga0207704_10000737 Ga0207704_100007372 223
1780 3300025939 Ga0207665_10001551 Ga0207665_100015516 223
1781 3300025939 Ga0207665_10004601 Ga0207665_1000460111 223
1782 3300025939 Ga0207665_10141761 Ga0207665_101417612 223
1783 3300025940 Ga0207691_10064955 Ga0207691_100649553 223
1784 3300025941 Ga0207711_10077394 Ga0207711_100773941 223
1785 3300025942 Ga0207689_10154616 Ga0207689_101546162 223
1786 3300025944 Ga0207661_10220749 Ga0207661_102207492 223
1787 3300025949 Ga0207667_10089971 Ga0207667_100899713 223
1788 3300025949 Ga0207667_10293831 Ga0207667_102938312 223
1789 3300025949 Ga0207667_10435772 Ga0207667_104357722 223
1790 3300025960 Ga0207651_10200467 Ga0207651_102004671 223
1791 3300025960 Ga0207651_10215959 Ga0207651_102159591 223
1792 3300025961 Ga0207712_10028067 Ga0207712_100280672 223
1793 3300025961 Ga0207712_10038794 Ga0207712_100387942 223
1794 3300025972 Ga0207668_10024787 Ga0207668_100247873 223
1795 3300025972 Ga0207668_10052638 Ga0207668_100526383 223
1796 3300025981 Ga0207640_10933651 Ga0207640_109336511 223
1797 3300025986 Ga0207658_10043625 Ga0207658_100436252 223
1798 3300025986 Ga0207658_10275754 Ga0207658_102757541 223
1799 3300025986 Ga0207658_10279254 Ga0207658_102792541 223
1800 3300026023 Ga0207677_10003124 Ga0207677_100031249 223
1801 3300026035 Ga0207703_10019663 Ga0207703_100196633 223
1802 3300026035 Ga0207703_10982235 Ga0207703_109822351 223
1803 3300026041 Ga0207639_10131264 Ga0207639_101312642 223
1804 3300026067 Ga0207678_10301586 Ga0207678_103015861 223
1805 3300026075 Ga0207708_10010974 Ga0207708_100109742 223
1806 3300026075 Ga0207708_10057584 Ga0207708_100575843 223
1807 3300026088 Ga0207641_10002330 Ga0207641_100023304 223
1808 3300026089 Ga0207648_10002544 Ga0207648_100025446 223
1809 3300026095 Ga0207676_10084407 Ga0207676_100844073 223
1810 3300026118 Ga0207675_100016823 Ga0207675_10001682310 223
1811 3300026118 Ga0207675_100018795 Ga0207675_1000187958 223
1812 3300026118 Ga0207675_100365635 Ga0207675_1003656352 223
1813 3300026118 Ga0207675_100598947 Ga0207675_1005989472 223
1814 3300026121 Ga0207683_10001724 Ga0207683_100017246 223
1815 3300026121 Ga0207683_10185874 Ga0207683_101858742 223
1816 3300026121 Ga0207683_10454514 Ga0207683_104545142 223
1817 3300027866 Ga0209813_10015195 Ga0209813_100151952 223
1818 3300027907 Ga0207428_10493548 Ga0207428_104935482 223
1819 3300028379 Ga0268266_10038022 Ga0268266_100380222 223
1820 3300028379 Ga0268266_10273971 Ga0268266_102739712 223
1821 3300028380 Ga0268265_10134910 Ga0268265_101349102 223
1822 3300028381 Ga0268264_10005532 Ga0268264_1000553213 223
1823 3300028381 Ga0268264_10272461 Ga0268264_102724612 223
1824 3300028381 Ga0268264_10358183 Ga0268264_103581831 223
1825 3300032005 Ga0307411_10428605 Ga0307411_104286051 223
1826 3300032126 Ga0307415_100588891 Ga0307415_1005888912 223
1827 3300035114 Ga0373939_0066692 Ga0373939_0066692_56_727 223
1828 3300035121 Ga0373960_0044911 Ga0373960_0044911_223_894 223
1829 3300035241 Ga0373961_0052563 Ga0373961_0052563_355_1026 223
1830 3300035691 Ga0373931_0068203 Ga0373931_0068203_1214_1885 223
1831 3300037312 Ga0395899_0377489 Ga0395899_0377489_126_821 223
1832 3300038443 Ga0395901_0046735 Ga0395901_0046735_3269_3973 223
1833 3300038443 Ga0395901_0150430 Ga0395901_0150430_311_1006 223
1834 3300041410 Ga0439461_0044691 Ga0439461_0044691_93_764 223
1835 3300041411 Ga0439466_0010022 Ga0439466_0010022_1094_1765 223
1836 3300042005 Ga0439448_0105448 Ga0439448_0105448_207_887 223
1837 3300044656 Ga0466969_0013899 Ga0466969_0013899_3507_4178 223
1838 3300044683 Ga0466965_0002332 Ga0466965_0002332_1308_1991 223
1839 3300044683 Ga0466965_0082244 Ga0466965_0082244_614_1285 223
1840 3300044684 Ga0466966_0058149 Ga0466966_0058149_933_1616 223
1841 3300044693 Ga0466961_0007726 Ga0466961_0007726_5531_6211 223
1842 3300044693 Ga0466961_0010722 Ga0466961_0010722_1066_1737 223
1843 3300044694 Ga0466963_0027245 Ga0466963_0027245_1927_2607 223
1844 3300044694 Ga0466963_0067167 Ga0466963_0067167_347_1018 223
1845 3300044706 Ga0466964_0062040 Ga0466964_0062040_271_951 223
1846 3300044719 Ga0466971_0037160 Ga0466971_0037160_1452_2135 223
1847 3300044735 Ga0466968_0003829 Ga0466968_0003829_4831_5517 223
1848 3300044735 Ga0466968_0126530 Ga0466968_0126530_298_969 223
1849 3300044765 Ga0466970_0002446 Ga0466970_0002446_5300_5983 223
1850 3300044765 Ga0466970_0016815 Ga0466970_0016815_2433_3104 223
1851 3300044765 Ga0466970_0064279 Ga0466970_0064279_1120_1806 223
1852 3300044765 Ga0466970_0125553 Ga0466970_0125553_563_1243 223
1853 3300044842 Ga0466957_0003358 Ga0466957_0003358_2422_3108 223
1854 3300044842 Ga0466957_0005992 Ga0466957_0005992_5496_6176 223
1855 3300044842 Ga0466957_0053495 Ga0466957_0053495_343_1026 223
1856 3300044842 Ga0466957_0574421 Ga0466957_0574421_83_775 223
1857 3300044901 Ga0466960_0000958 Ga0466960_0000958_2973_3659 223
1858 3300045049 Ga0466959_0003841 Ga0466959_0003841_7635_8315 223
1859 3300045049 Ga0466959_0017455 Ga0466959_0017455_1256_1942 223
1860 3300045049 Ga0466959_0026229 Ga0466959_0026229_122_805 223
1861 3300045836 Ga0466958_0063203 Ga0466958_0063203_121_801 223
1862 3300045836 Ga0466958_0079576 Ga0466958_0079576_1321_1992 223
1863 3300045836 Ga0466958_0156284 Ga0466958_0156284_477_1163 223
1864 3300045976 Ga0466967_0020618 Ga0466967_0020618_1182_1868 223
1865 3300045976 Ga0466967_0255234 Ga0466967_0255234_567_1238 223
1866 3300045976 Ga0466967_0702352 Ga0466967_0702352_111_782 223
1867 3300046507 Ga0495606_0053323 Ga0495606_0053323_975_1646 223
1868 3300046524 Ga0495648_0016851 Ga0495648_0016851_220_891 223
1869 3300046616 Ga0495668_0111365 Ga0495668_0111365_620_1291 223
1870 3300046694 Ga0495649_0090197 Ga0495649_0090197_150_830 223
1871 3300047320 Ga0495672_0002122 Ga0495672_0002122_13562_14233 223
1872 3300047320 Ga0495672_0026116 Ga0495672_0026116_1721_2395 223
1873 3300048903 Ga0496100_0000902 Ga0496100_0000902_6503_7183 223
1874 3300048903 Ga0496100_0161100 Ga0496100_0161100_477_1148 223
1875 3300048904 Ga0496101_0000024 Ga0496101_0000024_39630_40310 223
1876 3300048904 Ga0496101_0010909 Ga0496101_0010909_1209_1895 223
1877 3300048904 Ga0496101_0065081 Ga0496101_0065081_442_1113 223
1878 3300048904 Ga0496101_0427325 Ga0496101_0427325_38_709 223
1879 3300048905 Ga0496102_0000001 Ga0496102_0000001_832628_833308 223
1880 3300048905 Ga0496102_0003623 Ga0496102_0003623_11614_12285 223
1881 3300048905 Ga0496102_0029704 Ga0496102_0029704_1460_2131 223
1882 3300048905 Ga0496102_0070980 Ga0496102_0070980_1332_2003 223
1883 3300048905 Ga0496102_0174730 Ga0496102_0174730_1339_2010 223
1884 3300048905 Ga0496102_0293760 Ga0496102_0293760_116_787 223
1885 3300048905 Ga0496102_0459550 Ga0496102_0459550_483_1163 223
1886 3300048905 Ga0496102_0565618 Ga0496102_0565618_227_898 223
1887 3300048906 Ga0496103_0000003 Ga0496103_0000003_563690_564370 223
1888 3300048906 Ga0496103_0006225 Ga0496103_0006225_283_954 223
1889 3300048907 Ga0496104_0001336 Ga0496104_0001336_19874_20545 223
1890 3300048907 Ga0496104_0366900 Ga0496104_0366900_123_794 223
1891 3300048908 Ga0496105_0028361 Ga0496105_0028361_1482_2153 223
1892 3300048909 Ga0496106_0013278 Ga0496106_0013278_1449_2120 223
1893 3300048909 Ga0496106_0027215 Ga0496106_0027215_793_1464 223
1894 3300048909 Ga0496106_0060923 Ga0496106_0060923_840_1520 223
1895 3300048909 Ga0496106_0076508 Ga0496106_0076508_1770_2450 223
1896 3300048910 Ga0496107_0005738 Ga0496107_0005738_4970_5641 223
1897 3300048910 Ga0496107_0083603 Ga0496107_0083603_736_1407 223
1898 3300048911 Ga0496108_0001871 Ga0496108_0001871_344_1015 223
1899 3300048913 Ga0496110_0028288 Ga0496110_0028288_1456_2127 223
1900 3300048913 Ga0496110_0195278 Ga0496110_0195278_490_1161 223
1901 3300048914 Ga0496111_0240230 Ga0496111_0240230_314_985 223
1902 3300048914 Ga0496111_0608867 Ga0496111_0608867_52_723 223
1903 3300048915 Ga0496112_0001680 Ga0496112_0001680_4173_4844 223
1904 3300048915 Ga0496112_0005593 Ga0496112_0005593_8361_9032 223
1905 3300048915 Ga0496112_0026027 Ga0496112_0026027_1397_2083 223
1906 3300048915 Ga0496112_0106638 Ga0496112_0106638_1784_2455 223
1907 3300048915 Ga0496112_0233423 Ga0496112_0233423_1107_1778 223
1908 3300048916 Ga0496113_0011976 Ga0496113_0011976_4466_5152 223
1909 3300048916 Ga0496113_0049854 Ga0496113_0049854_1485_2156 223
1910 3300048916 Ga0496113_0189149 Ga0496113_0189149_636_1307 223
1911 3300048916 Ga0496113_0312666 Ga0496113_0312666_339_1010 223
1912 3300048917 Ga0496114_0001736 Ga0496114_0001736_15164_15835 223
1913 3300048918 Ga0496115_0023033 Ga0496115_0023033_613_1284 223
1914 3300048919 Ga0496116_0000013 Ga0496116_0000013_39624_40304 223
1915 3300048920 Ga0496117_0000013 Ga0496117_0000013_563690_564370 223
1916 3300048921 Ga0496118_0000011 Ga0496118_0000011_39626_40306 223
1917 3300048923 Ga0496120_0015937 Ga0496120_0015937_877_1563 223
1918 3300048923 Ga0496120_0038985 Ga0496120_0038985_2116_2796 223
1919 3300048924 Ga0496121_0000764 Ga0496121_0000764_34964_35644 223
1920 3300048925 Ga0496122_0046538 Ga0496122_0046538_2244_2930 223
1921 3300048926 Ga0496123_0010044 Ga0496123_0010044_2205_2891 223
1922 3300048928 Ga0496125_0311066 Ga0496125_0311066_126_812 223
1923 3300048929 Ga0496126_0000351 Ga0496126_0000351_71705_72385 223
1924 3300048929 Ga0496126_0001675 Ga0496126_0001675_24971_25657 223
1925 3300048929 Ga0496126_0183020 Ga0496126_0183020_1013_1687 223
1926 3300049569 Ga0501032_0010685 Ga0501032_0010685_1557_2252 223
1927 3300049570 Ga0501033_0309834 Ga0501033_0309834_26_721 223
1928 3300049571 Ga0501034_0005796 Ga0501034_0005796_10598_11293 223
1929 3300049571 Ga0501034_0219929 Ga0501034_0219929_806_1477 223
1930 3300049571 Ga0501034_0722742 Ga0501034_0722742_162_833 223
1931 3300049572 Ga0501036_0033695 Ga0501036_0033695_2206_2901 223
1932 3300049573 Ga0501037_0000436 Ga0501037_0000436_32220_32915 223
1933 3300049574 Ga0501038_0095812 Ga0501038_0095812_27_722 223
1934 3300049575 Ga0501039_0000264 Ga0501039_0000264_33403_34098 223
1935 3300049579 Ga0501043_0012256 Ga0501043_0012256_1885_2580 223
1936 3300049586 Ga0501070_0004930 Ga0501070_0004930_6809_7504 223
1937 3300049742 Ga0501080_0036881 Ga0501080_0036881_2387_3058 223
1938 3300049823 Ga0501044_0038724 Ga0501044_0038724_1556_2251 223
1939 3300050489 nmdc:mga03683_93304_c1 nmdc:mga03683_93304_c1_18_689 223
1940 3300050490 nmdc:mga03n38_58067_c1 nmdc:mga03n38_58067_c1_309_980 223
1941 3300050490 nmdc:mga03n38_90563_c1 nmdc:mga03n38_90563_c1_317_988 223
1942 3300050491 nmdc:mga00v17_141806_c1 nmdc:mga00v17_141806_c1_537_1208 223
1943 3300050491 nmdc:mga00v17_147893_c1 nmdc:mga00v17_147893_c1_159_833 223
1944 3300050491 nmdc:mga00v17_1665_c1 nmdc:mga00v17_1665_c1_3807_4481 223
1945 3300050491 nmdc:mga00v17_18945_c1 nmdc:mga00v17_18945_c1_2421_3101 223
1946 3300050491 nmdc:mga00v17_206603_c1 nmdc:mga00v17_206603_c1_535_1206 223
1947 3300050492 nmdc:mga0yw44_24340_c1 nmdc:mga0yw44_24340_c1_752_1426 223
1948 3300050492 nmdc:mga0yw44_74474_c1 nmdc:mga0yw44_74474_c1_59_730 223
1949 3300050492 nmdc:mga0yw44_8278_c1 nmdc:mga0yw44_8278_c1_2415_3086 223
1950 3300050494 nmdc:mga06z11_12332_c1 nmdc:mga06z11_12332_c1_2288_2959 223
1951 3300050494 nmdc:mga06z11_406522_c1 nmdc:mga06z11_406522_c1_37_708 223
1952 3300050495 nmdc:mga04h51_46527_c1 nmdc:mga04h51_46527_c1_565_1236 223
1953 3300050496 nmdc:mga07m45_189943_c1 nmdc:mga07m45_189943_c1_389_1060 223
1954 3300050496 nmdc:mga07m45_44461_c1 nmdc:mga07m45_44461_c1_1303_1974 223
1955 3300050496 nmdc:mga07m45_81485_c1 nmdc:mga07m45_81485_c1_919_1590 223
1956 3300050507 nmdc:mga05p37_290624_c1 nmdc:mga05p37_290624_c1_1097_1768 223
1957 3300050509 nmdc:mga0qj67_26634_c1 nmdc:mga0qj67_26634_c1_881_1552 223
1958 3300050509 nmdc:mga0qj67_64628_c1 nmdc:mga0qj67_64628_c1_2051_2722 223
1959 3300050510 nmdc:mga06r32_123517_c1 nmdc:mga06r32_123517_c1_338_1009 223
1960 3300050516 nmdc:mga0sz30_29592_c1 nmdc:mga0sz30_29592_c1_384_1055 223
1961 3300050516 nmdc:mga0sz30_57426_c1 nmdc:mga0sz30_57426_c1_222_893 223
1962 3300050516 nmdc:mga0sz30_72062_c1 nmdc:mga0sz30_72062_c1_229_900 223
1963 3300053083 Ga0495655_0062592 Ga0495655_0062592_125_796 223
1964 3300053087 Ga0500643_016877 Ga0500643_016877_1680_2351 223
1965 3300053130 Ga0500642_0140937 Ga0500642_0140937_271_945 223
1966 3300061719 Ga0466962_0076961 Ga0466962_0076961_406_1089 223

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01939

NucS_C

Endonuclease NucS C-terminal domain

147

267

0.98

PF21003

NucS_N

Endonuclease NucS N-terminal PH-like domain

46

141

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
5umd-assembly1.cif.gz_O structure of the plasmodium falciparum 80s ribosome bound to the antimalarial drug mefloquine 0.8817 181 208
7qep-assembly1.cif.gz_N8 cryo-em structure of the ribosome from encephalitozoon cuniculi 0.8531 181 208
8ir1-assembly1.cif.gz_L human nuclear pre-60s ribosomal particle - state a 0.8293 180 208
5gke-assembly1.cif.gz_B structure of endoms-dsdna1 complex 0.8291 2 208
7tzi-assembly2.cif.gz_B structure of a pseudomurein peptide ligase type e from methanothermobacter thermautotrophicus 0.804 150 208
ID Description Score Start End Superfamily
af_P9WIY5_101_213_3.40.1350.10 Alpha Beta;3-Layer(aba) Sandwich;Trna Endonuclease; Chain: A, domain 1; 0.9879 98 210 3.40.1350.10
af_P9WIY5_101_213_3.40.1350.10 Alpha Beta;3-Layer(aba) Sandwich;Trna Endonuclease; Chain: A, domain 1; 0.9793 98 210 3.40.1350.10
af_P9WIY5_1_96_2.70.180.20 Mainly Beta;Distorted Sandwich;Protein Yojf; Chain: A;; 0.904 2 93 2.70.180.20
af_Q6UUH5_140_226_3.100.10.10 Alpha Beta;Ribosomal Protein L15; Chain: K; domain 2;Ribosomal Protein L15; Chain: K; domain 2; 0.89 181 208 3.100.10.10
2vldB02 Alpha Beta;3-Layer(aba) Sandwich;Trna Endonuclease; Chain: A, domain 1; 0.8722 101 209 3.40.1350.10
ID Description Score Start End GO Terms
AF-X8F319-F1-model_v4 deleted 0.9955 104 205
AF-X8F319-F1-model_v4 deleted 0.9763 104 205
AF-A0A2W6BVV5-F1-model_v4 Endonuclease 0.9584 108 223 GO:0003677
GO:0004519
AF-A0A6J6R3V0-F1-model_v4 Unannotated protein 0.9546 104 223 GO:0003677
GO:0004519
AF-A0A7W0RJ64-F1-model_v4 DUF91 domain-containing protein 0.9523 106 223 GO:0003677
GO:0004519

Feature Viewer

pLDDT pTM Quality
90.26 0.6 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map