F496033

General Info

Members Datasets Scaffolds Average Seq Length
1908 666 3814 226

Family's Representative Sequence

Representative Sequence 3300046516|Ga0495628_0161075|Ga0495628_0161075_332_967
Length 211
Sequence VLVVEDEDSFSDAISYLLRKEGFEVAVCSTGPDALETFDRTGADLVLLDLMLPGLPGSEVCKSLREKSNVPVIMLTAKDSEIDKVFSSRELVARMRAVLRRRGEPEDTPESALESGPVRMDVDRHVVTVRGGNVQLPLKEFELLQVLLRNADRVLTRMQLIDRVWGADYVGDTKTLDVHIKRLRAKIELDPARPQHIVTVRGLGYKFESAA

Samples

Sample ID Description Type Environment
1 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
2 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
3 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
4 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
7 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
8 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
31 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
32 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
33 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
34 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
35 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
36 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
37 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
38 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
39 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
40 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
41 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
42 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
43 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
44 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
45 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
46 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
47 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
48 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
49 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
50 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
51 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
52 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
53 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
54 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
55 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
56 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
57 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
58 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
59 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
60 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
61 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
62 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
63 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
64 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
65 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
66 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
67 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
68 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
69 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
70 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
71 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
72 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
73 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
74 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
75 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
76 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
77 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
78 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
79 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
80 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
81 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
82 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
83 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
84 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
85 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
86 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
87 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
88 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
89 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
90 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
91 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
92 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
93 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
94 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
95 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
96 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
97 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
98 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
99 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
100 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
101 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
102 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
103 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
104 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
105 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
106 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
107 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
108 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
109 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
110 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
111 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
112 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
113 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
114 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
115 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
116 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
117 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
118 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
119 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
120 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
121 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
122 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
123 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
124 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
125 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
126 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
127 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
128 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
129 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
130 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
131 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
132 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
133 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
134 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
135 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
136 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
137 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
138 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
139 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
140 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
141 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
205 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
207 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
208 3300028023 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 Metagenome Rhizosphere
209 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
213 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
214 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
215 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
216 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
217 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
218 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
219 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
220 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
221 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
222 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
223 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
224 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
225 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
226 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
227 3300030863 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
228 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
229 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
230 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
231 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
232 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
233 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
234 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
235 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
236 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
237 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
238 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
239 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
240 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
241 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
242 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
243 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
244 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
245 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
246 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
247 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
248 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
249 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
250 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
251 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
252 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
253 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
254 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
255 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
256 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
257 3300033545 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 Metagenome Unclassified
258 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
259 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
260 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
261 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
262 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
263 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
264 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
265 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
266 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
267 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
268 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
269 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
270 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
271 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
272 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
273 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
274 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
275 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
276 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
277 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
278 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
279 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
280 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
281 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
282 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
283 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
284 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
285 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
286 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
287 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
288 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
289 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
290 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
291 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
292 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
293 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
294 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
295 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
296 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
297 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
298 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
299 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
300 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
301 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
302 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
303 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
304 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
305 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
306 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
307 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
308 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
309 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
310 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
311 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
312 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
313 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
314 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
315 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
316 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
317 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
318 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
319 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
320 3300042132 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 Metagenome Rhizosphere
321 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
322 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
323 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
324 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
325 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
326 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
327 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
328 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
329 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
330 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
331 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
332 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
333 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
334 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
335 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
336 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
337 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
338 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
339 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
340 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
341 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
342 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
343 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
344 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
345 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
346 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
347 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
348 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
349 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
350 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
351 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
352 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
353 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
354 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
355 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
356 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
357 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
358 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
359 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
360 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
361 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
362 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
363 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
364 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
365 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
366 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
367 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
368 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
369 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
370 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
371 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
372 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
373 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
374 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
375 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
376 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
377 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
378 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
379 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
380 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
381 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
382 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
383 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
384 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
385 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
386 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
387 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
388 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
389 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
390 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
391 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
392 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
393 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
394 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
395 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
396 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
397 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
398 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
399 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
400 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
401 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
402 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
403 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
404 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
405 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
406 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
407 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
408 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
409 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
410 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
411 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
412 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
413 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
414 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
415 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
416 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
417 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
418 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
419 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
420 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
421 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
422 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
423 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
424 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
425 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
426 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
427 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
428 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
429 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
430 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
431 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
432 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
433 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
434 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
435 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
436 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
437 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
438 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
439 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
440 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
441 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
442 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
443 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
444 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
445 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
446 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
447 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
448 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
449 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
450 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
451 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
452 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
453 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
454 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
455 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
456 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
457 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
458 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
459 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
460 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
461 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
462 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
463 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
464 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
465 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
466 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
467 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
468 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
469 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
470 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
471 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
472 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
473 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
474 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
475 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
476 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
477 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
478 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
479 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
480 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
481 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
482 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
483 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
484 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
485 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
486 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
487 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
488 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
489 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
490 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
491 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
492 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
493 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
494 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
495 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
496 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
497 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
498 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
499 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
500 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
501 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
502 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
503 3300053106 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 endosphere Metagenome Endosphere
504 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
505 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
506 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
507 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
508 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
509 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
510 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
511 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
512 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
513 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
514 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
515 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
516 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
517 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
518 2506783011 Frankia datiscae Dg1 Isolate Nodule
519 2527291627 Frankia casuarinae Thr Isolate Nodule
520 2527291629 Frankia sp. BMG5.23 Isolate Nodule
521 2546825537 Frankia sp. CcI6 Isolate Rhizoplane
522 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
523 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
524 2576861822 Frankia sp. CeD Isolate Nodule
525 2579778521 Frankia torreyi CpI1-S Isolate Unclassified
526 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
527 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
528 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
529 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
530 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
531 2619618881 Frankia sp. ACN1ag Isolate Unclassified
532 2619619003 Frankia sp. CpI1-P Isolate Nodule
533 2622736605 Geodermatophilus ruber DSM 45317 Isolate Rhizosphere
534 2626541554 Frankia sp. AvcI.1 Isolate Nodule
535 2643221548 Streptomyces sp. Root55 Isolate Unclassified
536 2643221549 Agromyces sp. Root1464 Isolate Unclassified
537 2643221567 Phycicoccus sp. Root563 Isolate Unclassified
538 2643221578 Streptomyces sp. Root63 Isolate Unclassified
539 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
540 2643221619 Agromyces sp. Root81 Isolate Unclassified
541 2643221624 Phycicoccus sp. Root101 Isolate Unclassified
542 2643221632 Leifsonia sp. Root112D2 Isolate Unclassified
543 2643221647 Streptomyces sp. Root369 Isolate Unclassified
544 2643221670 Streptomyces sp. Root431 Isolate Unclassified
545 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
546 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
547 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
548 2643221679 Angustibacter sp. Root456 Isolate Unclassified
549 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
550 2643221711 Terrabacter sp. Root85 Isolate Unclassified
551 2643221714 Streptomyces sp. Root264 Isolate Unclassified
552 2684623036 Frankia sp. CgIM4 Isolate Nodule
553 2731639228 Motilibacter peucedani DSM 45328 Isolate Rhizosphere
554 2767802112 Streptomyces avicenniae NRRL B-24776 Isolate Rhizosphere
555 2773857924 Frankia sp. CgIS1 Isolate Nodule
556 2773857933 Frankia sp. BMG5.30 Isolate Nodule
557 2784132109 Dermacoccus sp. DS28 SAI-028 Isolate Unclassified
558 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
559 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
560 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
561 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
562 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
563 2799112218 Motilibacter rhizosphaerae DSM 45622 Isolate Rhizosphere
564 2802429296 Streptomyces sampsonii KJ40 Isolate Rhizosphere
565 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
566 2808606365 Phycicoccus sp. SLBN-51 Isolate Unclassified
567 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
568 2808606448 Streptomyces sp. 193411 Isolate Unclassified
569 2808606700 Arthrobacter agilis UMCV2 Isolate Rhizosphere
570 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
571 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
572 2811994882 Terrabacter sp. SLBN-196 Isolate Unclassified
573 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
574 2816332305 Kocuria rhizophila FDAARGOS_302 Isolate Rhizosphere
575 2818991318 Humibacillus xanthopallidus SLBN-155 Isolate Unclassified
576 2818991458 Terrabacter sp. 3211 Isolate Rhizosphere
577 2818991462 Terrabacter sp. 3264 Isolate Rhizosphere
578 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
579 2818991469 Terrabacter lapilli 3265 Isolate Rhizosphere
580 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
581 2856741275 Microbispora triticiradicis NEAU-HRDPA2-9 Isolate Unclassified
582 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
583 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
584 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
585 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
586 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
587 2862574272 Streptomyces sp. AcE210 Isolate Nodule
588 2862705112 Streptomyces triticirhizae NEAU-YY642 Isolate Rhizosphere
589 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
590 2867346516 Streptomyces radicis AZ1-7 Isolate Unclassified
591 2867369537 Streptomyces sp. Z26 Isolate Unclassified
592 2867428634 Streptomyces sp. RP5T Isolate Unclassified
593 2867475112 Streptomyces sp. TM32 Isolate Unclassified
594 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
595 2873314349 Sphaerisporangium siamense DSM 45784 Isolate Rhizosphere
596 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
597 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
598 2891395885 Microbispora catharanthi CR1-09 Isolate Unclassified
599 2891554331 Microbispora sp. CL1-1 Isolate Unclassified
600 2891562705 Microbispora tritici MT50 Isolate Unclassified
601 2893684298 Kocuria palustris DSM 11925 Isolate Rhizosphere
602 2905926851 Arthrobacter sedimenti MIC A30 Isolate Rhizosphere
603 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
604 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
605 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
606 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
607 2919446982 Phycicoccus sp. 3266 Isolate Rhizosphere
608 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
609 2935390628 Streptomyces sp. PvR034 Isolate Rhizosphere
610 2946003308 Arthrobacter agilis W3I6 Isolate Rhizosphere
611 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
612 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
613 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
614 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
615 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
616 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
617 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
618 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
619 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
620 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
621 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
622 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
623 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
624 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
625 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
626 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
627 2964326757 Planctomonas psychrotolerans J5903 Isolate Rhizosphere
628 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
629 2966924647 Frigoribacterium sp. 2355 Isolate Rhizosphere
630 2990044586 Streptomyces sedi JCM 16909 Isolate Unclassified
631 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
632 2990088156 Streptomyces albidus CAP 215 Isolate Unclassified
633 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
634 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
635 3002998708 Actinomadura barringtoniae GKU 128 Isolate Unclassified
636 3006321560 Actinacidiphila epipremni PRB2-1 Isolate Unclassified
637 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
638 3006425503 Streptomyces zingiberis PLAI1-29 Isolate Unclassified
639 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
640 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
641 637000116 Frankia casuarinae CcI3 Isolate Nodule
642 8008485437 Streptomyces mimosae 3MP-10 Isolate Unclassified
643 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
644 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
645 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
646 8025478263 Streptomyces telluris AA8 Isolate Rhizosphere
647 8025524527 Streptomyces sp. 3MP-14 Isolate Unclassified
648 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
649 8033684223 Streptomyces phytophilus PIP175 Isolate Unclassified
650 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
651 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
652 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
653 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
654 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
655 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
656 8053945823 Actinomadura terrae OS3-83 Isolate Rhizosphere
657 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere
658 8054913762 Frankia gtarii Agncl-10 Isolate Nodule
659 8054920844 Frankia tisae Agncl-8 Isolate Nodule
660 8055066027 Sphaerisporangium corydalis NEAU-YHS15 Isolate Unclassified
661 8055157932 Frankia umida Ag45/Mut15 Isolate Nodule
662 8055172936 Sphaerisporangium perillae NEAU-ZS1 Isolate Unclassified
663 8056060235 Nocardiopsis endophytica RSe5-2 Isolate Unclassified
664 8056447290 Streptomyces huiliensis SCA2-4 Isolate Rhizosphere
665 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere
666 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 91.25
Metatranscriptomes 0.94
Isolates 7.81

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.57
Nodule 0.89
Rhizoplane 7.02
Rhizosphere 83.28
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495628_0161075 3300046516 Bacteria 1705
2 JGI24735J21928_10011146 3300002067 Bacteria 2855
3 JGI24738J21930_10011186 3300002075 Bacteria 1978
4 JGI25153J46596_10032512 3300003215 Bacteria 1739
5 rootH1_10002967 3300003323 Bacteria 2103
6 JGI25160J50197_1016566 3300003354 Bacteria 2371
7 Ga0006562J51391_1011721 3300003578 Bacteria 3437
8 Ga0006562J51391_1011722 3300003578 Bacteria 3240
9 Ga0006562J51391_1056397 3300003578 Bacteria 2982
10 Ga0006562J51391_1071703 3300003578 Bacteria 1630
11 Ga0006562J51391_1071704 3300003578 Bacteria 2500
12 Ga0065714_10006949 3300005288 Bacteria 4902
13 Ga0070658_10001387 3300005327 Bacteria 20694
14 Ga0070658_10184078 3300005327 Bacteria 1758
15 Ga0070658_10250538 3300005327 Bacteria 1502
16 Ga0070676_10072473 3300005328 Bacteria 2071
17 Ga0070683_100166867 3300005329 Bacteria 2089
18 Ga0070683_100348384 3300005329 Bacteria 1410
19 Ga0068869_100036149 3300005334 Bacteria 3506
20 Ga0068869_100364963 3300005334 Bacteria 1180
21 Ga0070666_10007558 3300005335 Bacteria 6702
22 Ga0070666_10061196 3300005335 Bacteria 2549
23 Ga0070666_10136575 3300005335 Bacteria 1706
24 Ga0070680_100013093 3300005336 Bacteria 6456
25 Ga0070680_100035119 3300005336 Bacteria 4046
26 Ga0070680_100337751 3300005336 Bacteria 1280
27 Ga0070682_100005056 3300005337 Bacteria 7328
28 Ga0068868_100067018 3300005338 Bacteria 2856
29 Ga0070660_100038049 3300005339 Bacteria 3650
30 Ga0070660_100084706 3300005339 Bacteria 2492
31 Ga0070660_100559084 3300005339 Bacteria 955
32 Ga0070689_100028136 3300005340 Bacteria 4246
33 Ga0070691_10014121 3300005341 Bacteria 3661
34 Ga0070691_10017039 3300005341 Bacteria 3343
35 Ga0070661_100228940 3300005344 Bacteria 1428
36 Ga0070661_100560851 3300005344 Bacteria 920
37 Ga0070692_10021193 3300005345 Bacteria 3159
38 Ga0070692_10170923 3300005345 Bacteria 1253
39 Ga0070668_100022918 3300005347 Bacteria 4721
40 Ga0070668_100046575 3300005347 Bacteria 3330
41 Ga0070668_100067218 3300005347 Bacteria 2784
42 Ga0070675_100221788 3300005354 Bacteria 1647
43 Ga0070675_100300602 3300005354 Bacteria 1414
44 Ga0070671_100014896 3300005355 Bacteria 6282
45 Ga0070671_100132739 3300005355 Bacteria 2098
46 Ga0070674_100201836 3300005356 Bacteria 1536
47 Ga0070674_100228758 3300005356 Bacteria 1450
48 Ga0070673_100059069 3300005364 Bacteria 3035
49 Ga0070673_100066970 3300005364 Bacteria 2870
50 Ga0070673_100274444 3300005364 Bacteria 1477
51 Ga0070688_100080165 3300005365 Bacteria 2111
52 Ga0070659_100051008 3300005366 Bacteria 3252
53 Ga0070667_100018998 3300005367 Bacteria 5698
54 Ga0070667_100349927 3300005367 Bacteria 1337
55 Ga0070703_10017010 3300005406 Bacteria 2093
56 Ga0070709_10000220 3300005434 Bacteria 37035
57 Ga0070709_10003796 3300005434 Bacteria 8125
58 Ga0070709_10026469 3300005434 Bacteria 3438
59 Ga0070709_10093584 3300005434 Bacteria 1987
60 Ga0070714_100000010 3300005435 Bacteria 262871
61 Ga0070714_100001618 3300005435 Bacteria 16378
62 Ga0070714_100012670 3300005435 Bacteria 6735
63 Ga0070714_100044829 3300005435 Bacteria 3745
64 Ga0070714_100053229 3300005435 Bacteria 3454
65 Ga0070714_100070235 3300005435 Bacteria 3027
66 Ga0070714_100077141 3300005435 Bacteria 2894
67 Ga0070714_100136718 3300005435 Bacteria 2196
68 Ga0070714_100325816 3300005435 Bacteria 1437
69 Ga0070714_100489764 3300005435 Bacteria 1171
70 Ga0070714_100805068 3300005435 Bacteria 910
71 Ga0070713_100002276 3300005436 Bacteria 12477
72 Ga0070713_100033632 3300005436 Bacteria 4109
73 Ga0070713_100040074 3300005436 Bacteria 3806
74 Ga0070713_100059945 3300005436 Bacteria 3180
75 Ga0070713_100124310 3300005436 Bacteria 2267
76 Ga0070713_100154448 3300005436 Bacteria 2044
77 Ga0070713_100234602 3300005436 Bacteria 1669
78 Ga0070713_100263889 3300005436 Bacteria 1575
79 Ga0070710_10000122 3300005437 Bacteria 36506
80 Ga0070710_10002549 3300005437 Bacteria 8642
81 Ga0070710_10005500 3300005437 Bacteria 6022
82 Ga0070710_10024969 3300005437 Bacteria 3159
83 Ga0070710_10041832 3300005437 Bacteria 2531
84 Ga0070710_10071555 3300005437 Bacteria 2000
85 Ga0070710_10117994 3300005437 Bacteria 1602
86 Ga0070711_100000421 3300005439 Bacteria 21991
87 Ga0070711_100023470 3300005439 Bacteria 4012
88 Ga0070711_100052212 3300005439 Bacteria 2812
89 Ga0070711_100426264 3300005439 Bacteria 1082
90 Ga0070711_100484054 3300005439 Bacteria 1018
91 Ga0070711_100682168 3300005439 Bacteria 864
92 Ga0070705_100003344 3300005440 Bacteria 7872
93 Ga0070700_100000064 3300005441 Bacteria 78318
94 Ga0070694_100173076 3300005444 Bacteria 1592
95 Ga0070708_100026861 3300005445 Bacteria 4932
96 Ga0070708_100043452 3300005445 Bacteria 3949
97 Ga0070708_100104614 3300005445 Bacteria 2596
98 Ga0070708_100132463 3300005445 Bacteria 2308
99 Ga0070708_100364242 3300005445 Bacteria 1362
100 Ga0070708_100366596 3300005445 Bacteria 1358
101 Ga0070708_101081058 3300005445 Bacteria 751
102 Ga0070663_100063514 3300005455 Bacteria 2666
103 Ga0070663_100155171 3300005455 Bacteria 1758
104 Ga0070678_100010423 3300005456 Bacteria 5677
105 Ga0070678_100030918 3300005456 Bacteria 3687
106 Ga0070678_100139558 3300005456 Bacteria 1937
107 Ga0070681_10014130 3300005458 Bacteria 7946
108 Ga0070681_10318200 3300005458 Bacteria 1465
109 Ga0070681_10396346 3300005458 Bacteria 1291
110 Ga0068867_100151666 3300005459 Bacteria 1821
111 Ga0068867_100702227 3300005459 Bacteria 893
112 Ga0070685_10173891 3300005466 Bacteria 1382
113 Ga0070685_10215640 3300005466 Bacteria 1255
114 Ga0070706_100004020 3300005467 Bacteria 14287
115 Ga0070706_100005122 3300005467 Bacteria 12505
116 Ga0070706_100005997 3300005467 Bacteria 11485
117 Ga0070706_100008150 3300005467 Bacteria 9773
118 Ga0070706_100009991 3300005467 Bacteria 8813
119 Ga0070706_100021245 3300005467 Bacteria 5979
120 Ga0070706_100026563 3300005467 Bacteria 5326
121 Ga0070706_100064829 3300005467 Bacteria 3377
122 Ga0070706_100106943 3300005467 Bacteria 2602
123 Ga0070706_100125381 3300005467 Bacteria 2394
124 Ga0070706_100276953 3300005467 Bacteria 1566
125 Ga0070707_100000293 3300005468 Bacteria 49051
126 Ga0070707_100003142 3300005468 Bacteria 15629
127 Ga0070707_100005742 3300005468 Bacteria 11572
128 Ga0070707_100015007 3300005468 Bacteria 7270
129 Ga0070707_100021756 3300005468 Bacteria 6061
130 Ga0070707_100029552 3300005468 Bacteria 5217
131 Ga0070707_100058063 3300005468 Bacteria 3712
132 Ga0070707_100090007 3300005468 Bacteria 2970
133 Ga0070698_100000106 3300005471 Bacteria 69519
134 Ga0070698_100000546 3300005471 Bacteria 40175
135 Ga0070698_100004555 3300005471 Bacteria 15224
136 Ga0070698_100007047 3300005471 Bacteria 12176
137 Ga0070698_100014280 3300005471 Bacteria 8396
138 Ga0070698_100018347 3300005471 Bacteria 7367
139 Ga0070698_100019863 3300005471 Bacteria 7048
140 Ga0070698_100046444 3300005471 Bacteria 4440
141 Ga0070698_100070830 3300005471 Bacteria 3498
142 Ga0070698_100079441 3300005471 Bacteria 3277
143 Ga0070698_100206013 3300005471 Bacteria 1902
144 Ga0070699_100000577 3300005518 Bacteria 34742
145 Ga0070699_100459552 3300005518 Bacteria 1154
146 Ga0070679_100084639 3300005530 Bacteria 3159
147 Ga0070679_100093574 3300005530 Bacteria 2993
148 Ga0070684_100013575 3300005535 Bacteria 6572
149 Ga0070684_100604614 3300005535 Bacteria 1020
150 Ga0070684_100621911 3300005535 Bacteria 1005
151 Ga0070697_100029422 3300005536 Bacteria 4404
152 Ga0070697_100069331 3300005536 Bacteria 2888
153 Ga0070697_100357258 3300005536 Bacteria 1263
154 Ga0068853_100073071 3300005539 Bacteria 2989
155 Ga0068853_100275373 3300005539 Bacteria 1550
156 Ga0070672_100075534 3300005543 Bacteria 2690
157 Ga0070672_100143140 3300005543 Bacteria 1974
158 Ga0070686_100026601 3300005544 Bacteria 3493
159 Ga0070686_100035430 3300005544 Bacteria 3082
160 Ga0070695_100059329 3300005545 Bacteria 2477
161 Ga0070695_100341141 3300005545 Bacteria 1119
162 Ga0070696_100097078 3300005546 Bacteria 2106
163 Ga0070696_100187297 3300005546 Bacteria 1538
164 Ga0070693_100035744 3300005547 Bacteria 2758
165 Ga0070665_100000401 3300005548 Bacteria 63343
166 Ga0070665_100032363 3300005548 Bacteria 5263
167 Ga0070665_100087185 3300005548 Bacteria 3126
168 Ga0070665_100141565 3300005548 Bacteria 2408
169 Ga0068855_100050361 3300005563 Bacteria 4908
170 Ga0068855_100077738 3300005563 Bacteria 3851
171 Ga0070664_100078425 3300005564 Bacteria 2841
172 Ga0070664_100422789 3300005564 Bacteria 1221
173 Ga0068857_100138478 3300005577 Bacteria 2199
174 Ga0068857_100153423 3300005577 Bacteria 2088
175 Ga0068857_100319118 3300005577 Bacteria 1434
176 Ga0068854_100020711 3300005578 Bacteria 4456
177 Ga0068854_100270222 3300005578 Bacteria 1365
178 Ga0068854_100560443 3300005578 Bacteria 970
179 Ga0068856_100015966 3300005614 Bacteria 7260
180 Ga0068856_100025089 3300005614 Bacteria 5809
181 Ga0068856_100035500 3300005614 Bacteria 4887
182 Ga0068856_100042199 3300005614 Bacteria 4487
183 Ga0068856_100268510 3300005614 Bacteria 1722
184 Ga0068856_100749395 3300005614 Bacteria 997
185 Ga0070702_100014799 3300005615 Bacteria 3967
186 Ga0070702_100022796 3300005615 Bacteria 3317
187 Ga0070702_100291093 3300005615 Bacteria 1125
188 Ga0068852_100022811 3300005616 Bacteria 5026
189 Ga0068852_100050239 3300005616 Bacteria 3572
190 Ga0068852_100148003 3300005616 Bacteria 2180
191 Ga0068852_100203210 3300005616 Bacteria 1876
192 Ga0068852_100212067 3300005616 Bacteria 1838
193 Ga0068852_100395840 3300005616 Bacteria 1358
194 Ga0068859_100099277 3300005617 Bacteria 2967
195 Ga0068859_100145116 3300005617 Bacteria 2448
196 Ga0068859_100575966 3300005617 Bacteria 1219
197 Ga0068864_100006862 3300005618 Bacteria 9328
198 Ga0068864_100064036 3300005618 Bacteria 3187
199 Ga0068864_100193491 3300005618 Bacteria 1865
200 Ga0068861_100337992 3300005719 Bacteria 1317
201 Ga0068870_10118853 3300005840 Bacteria 1520
202 Ga0068870_10266306 3300005840 Bacteria 1069
203 Ga0068863_100001365 3300005841 Bacteria 24282
204 Ga0068863_100043562 3300005841 Bacteria 4260
205 Ga0068863_100055890 3300005841 Bacteria 3737
206 Ga0068863_100080467 3300005841 Bacteria 3086
207 Ga0068863_100306575 3300005841 Bacteria 1541
208 Ga0068858_100000732 3300005842 Bacteria 34375
209 Ga0068858_100027030 3300005842 Bacteria 5329
210 Ga0068858_100059448 3300005842 Bacteria 3532
211 Ga0068858_100382570 3300005842 Bacteria 1350
212 Ga0068860_100000114 3300005843 Bacteria 128789
213 Ga0068860_100038551 3300005843 Bacteria 4572
214 Ga0068860_100054813 3300005843 Bacteria 3789
215 Ga0068860_100254576 3300005843 Bacteria 1710
216 Ga0068862_100077659 3300005844 Bacteria 2875
217 Ga0068862_100220064 3300005844 Bacteria 1718
218 Ga0081455_10000575 3300005937 Bacteria 47885
219 Ga0081455_10020190 3300005937 Bacteria 6283
220 Ga0081455_10167176 3300005937 Bacteria 1679
221 Ga0081455_10540228 3300005937 Bacteria 773
222 Ga0081540_1000171 3300005983 Bacteria 67920
223 Ga0081540_1001613 3300005983 Bacteria 19226
224 Ga0081540_1038105 3300005983 Bacteria 2538
225 Ga0081540_1042201 3300005983 Bacteria 2355
226 Ga0081539_10001059 3300005985 Bacteria 50280
227 Ga0070717_10022210 3300006028 Bacteria 5012
228 Ga0070717_10028429 3300006028 Bacteria 4476
229 Ga0070717_10045339 3300006028 Bacteria 3594
230 Ga0070717_10067916 3300006028 Bacteria 2967
231 Ga0070717_10115085 3300006028 Bacteria 2298
232 Ga0070717_10115967 3300006028 Bacteria 2289
233 Ga0070717_10355399 3300006028 Bacteria 1310
234 Ga0075365_10281722 3300006038 Bacteria 1170
235 Ga0075365_10498273 3300006038 Bacteria 861
236 Ga0075368_10265944 3300006042 Bacteria 735
237 Ga0075363_100007574 3300006048 Bacteria 5003
238 Ga0070715_10001293 3300006163 Bacteria 7179
239 Ga0070715_10130593 3300006163 Bacteria 1208
240 Ga0070715_10254649 3300006163 Bacteria 919
241 Ga0070716_100003270 3300006173 Bacteria 7612
242 Ga0070716_100027653 3300006173 Bacteria 3049
243 Ga0070712_100005041 3300006175 Bacteria 8181
244 Ga0070712_100005233 3300006175 Bacteria 8028
245 Ga0070712_100021380 3300006175 Bacteria 4250
246 Ga0070712_100088909 3300006175 Bacteria 2258
247 Ga0070712_100110354 3300006175 Bacteria 2051
248 Ga0070712_100571470 3300006175 Bacteria 954
249 Ga0070712_100717585 3300006175 Bacteria 853
250 Ga0097621_100024496 3300006237 Bacteria 4714
251 Ga0097621_100117863 3300006237 Bacteria 2250
252 Ga0075370_10103451 3300006353 Bacteria 1650
253 Ga0068871_100036095 3300006358 Bacteria 3933
254 Ga0068871_100704884 3300006358 Bacteria 925
255 Ga0075428_100042278 3300006844 Bacteria 5011
256 Ga0075428_100366688 3300006844 Bacteria 1545
257 Ga0075431_100146985 3300006847 Bacteria 2429
258 Ga0075433_10010525 3300006852 Bacteria 7430
259 Ga0075433_10052150 3300006852 Bacteria 3564
260 Ga0075433_10198443 3300006852 Bacteria 1784
261 Ga0075434_100019525 3300006871 Bacteria 6560
262 Ga0075434_100023481 3300006871 Bacteria 6011
263 Ga0075434_100061569 3300006871 Bacteria 3734
264 Ga0075434_100394683 3300006871 Bacteria 1404
265 Ga0068865_100468726 3300006881 Bacteria 1044
266 Ga0075436_100011256 3300006914 Bacteria 6136
267 Ga0075436_100095199 3300006914 Bacteria 2071
268 Ga0075436_100204030 3300006914 Bacteria 1401
269 Ga0075436_100215724 3300006914 Bacteria 1361
270 Ga0097620_100099277 3300006931 Bacteria 2967
271 Ga0097620_100145123 3300006931 Bacteria 2448
272 Ga0097620_100575958 3300006931 Bacteria 1219
273 Ga0075435_100061791 3300007076 Bacteria 3039
274 Ga0075435_100310246 3300007076 Bacteria 1350
275 Ga0105251_10008325 3300009011 Bacteria 6260
276 Ga0105251_10009100 3300009011 Bacteria 5910
277 Ga0105251_10030150 3300009011 Bacteria 2726
278 Ga0105244_10201807 3300009036 Bacteria 937
279 Ga0105250_10016018 3300009092 Bacteria 3060
280 Ga0105240_10058787 3300009093 Bacteria 4799
281 Ga0105240_10085449 3300009093 Bacteria 3865
282 Ga0105240_10088061 3300009093 Bacteria 3800
283 Ga0111539_10015815 3300009094 Bacteria 9372
284 Ga0111539_10143921 3300009094 Bacteria 2791
285 Ga0105245_10008898 3300009098 Bacteria 8764
286 Ga0105245_10090979 3300009098 Bacteria 2807
287 Ga0105245_10104042 3300009098 Bacteria 2631
288 Ga0105245_10360280 3300009098 Bacteria 1443
289 Ga0105245_10373998 3300009098 Bacteria 1417
290 Ga0105247_10000038 3300009101 Bacteria 164083
291 Ga0105247_10003476 3300009101 Bacteria 10268
292 Ga0105247_10030438 3300009101 Bacteria 3272
293 Ga0105247_10186374 3300009101 Bacteria 1387
294 Ga0114129_10011093 3300009147 Bacteria 12838
295 Ga0114129_10093489 3300009147 Bacteria 4165
296 Ga0105243_10007184 3300009148 Bacteria 8559
297 Ga0105243_10013663 3300009148 Bacteria 6143
298 Ga0105243_10021441 3300009148 Bacteria 4905
299 Ga0105243_10037350 3300009148 Bacteria 3774
300 Ga0105243_10126903 3300009148 Bacteria 2160
301 Ga0105243_10470862 3300009148 Bacteria 1183
302 Ga0105241_10021949 3300009174 Bacteria 4726
303 Ga0105241_10026480 3300009174 Bacteria 4315
304 Ga0105241_10026744 3300009174 Bacteria 4294
305 Ga0105242_10040426 3300009176 Bacteria 3758
306 Ga0105242_10055746 3300009176 Bacteria 3233
307 Ga0105242_10172795 3300009176 Bacteria 1900
308 Ga0105248_10004635 3300009177 Bacteria 15206
309 Ga0105248_10150351 3300009177 Bacteria 2627
310 Ga0105248_10299483 3300009177 Bacteria 1811
311 Ga0105248_10785059 3300009177 Bacteria 1075
312 Ga0105237_10095315 3300009545 Bacteria 2965
313 Ga0105237_10201033 3300009545 Bacteria 1993
314 Ga0105237_10797605 3300009545 Bacteria 951
315 Ga0105238_10009629 3300009551 Bacteria 9667
316 Ga0105238_10089976 3300009551 Bacteria 3057
317 Ga0105238_10107688 3300009551 Bacteria 2768
318 Ga0105238_10603642 3300009551 Bacteria 1106
319 Ga0105249_10011339 3300009553 Bacteria 7826
320 Ga0105249_10059762 3300009553 Bacteria 3496
321 Ga0105249_10109889 3300009553 Bacteria 2604
322 Ga0105249_10460205 3300009553 Bacteria 1312
323 Ga0105249_10523618 3300009553 Bacteria 1233
324 Ga0105249_10523642 3300009553 Bacteria 1233
325 Ga0105239_10031946 3300010375 Bacteria 5784
326 Ga0105239_10088101 3300010375 Bacteria 3422
327 Ga0105239_10191487 3300010375 Bacteria 2289
328 Ga0105239_10537759 3300010375 Bacteria 1330
329 Ga0105239_10624742 3300010375 Bacteria 1229
330 Ga0105239_10770420 3300010375 Bacteria 1102
331 Ga0105246_10029622 3300011119 Bacteria 3606
332 Ga0105246_10034148 3300011119 Bacteria 3386
333 Ga0105246_10046747 3300011119 Bacteria 2953
334 Ga0105246_10066977 3300011119 Bacteria 2515
335 Ga0157345_1003149 3300012498 Bacteria 1193
336 Ga0157373_10137647 3300013100 Bacteria 1717
337 Ga0157371_10317202 3300013102 Bacteria 1130
338 Ga0157370_10070210 3300013104 Bacteria 3307
339 Ga0157370_10130425 3300013104 Bacteria 2345
340 Ga0157370_10337002 3300013104 Bacteria 1390
341 Ga0157370_10608524 3300013104 Bacteria 1000
342 Ga0157369_10007003 3300013105 Bacteria 13010
343 Ga0157369_10007588 3300013105 Bacteria 12482
344 Ga0157369_10071651 3300013105 Bacteria 3720
345 Ga0157369_10135443 3300013105 Bacteria 2608
346 Ga0157369_10483585 3300013105 Bacteria 1281
347 Ga0157374_10022784 3300013296 Bacteria 5592
348 Ga0157374_10229451 3300013296 Bacteria 1823
349 Ga0157374_10266988 3300013296 Bacteria 1687
350 Ga0157374_10801467 3300013296 Bacteria 958
351 Ga0157378_10284544 3300013297 Bacteria 1595
352 Ga0163162_10127024 3300013306 Bacteria 2657
353 Ga0163162_10217095 3300013306 Bacteria 2043
354 Ga0163162_10255261 3300013306 Bacteria 1885
355 Ga0163162_10400351 3300013306 Bacteria 1505
356 Ga0163162_10793150 3300013306 Bacteria 1065
357 Ga0157372_10000658 3300013307 Bacteria 37942
358 Ga0157372_10084295 3300013307 Bacteria 3602
359 Ga0157372_10158826 3300013307 Bacteria 2612
360 Ga0157375_10026112 3300013308 Bacteria 5438
361 Ga0157375_10306208 3300013308 Bacteria 1753
362 Ga0157375_10381066 3300013308 Bacteria 1577
363 Ga0157375_10421579 3300013308 Bacteria 1501
364 Ga0157375_10544018 3300013308 Bacteria 1323
365 Ga0157375_11064287 3300013308 Bacteria 946
366 Ga0163163_10021634 3300014325 Bacteria 6073
367 Ga0163163_10022975 3300014325 Bacteria 5913
368 Ga0163163_10058181 3300014325 Bacteria 3822
369 Ga0163163_10061951 3300014325 Bacteria 3706
370 Ga0157380_10019875 3300014326 Bacteria 5012
371 Ga0157380_10051491 3300014326 Bacteria 3256
372 Ga0157380_10091361 3300014326 Bacteria 2513
373 Ga0182008_10001457 3300014497 Bacteria 15816
374 Ga0157377_10061621 3300014745 Bacteria 2144
375 Ga0157377_10094225 3300014745 Bacteria 1773
376 Ga0157379_10085479 3300014968 Bacteria 2827
377 Ga0157379_10115944 3300014968 Bacteria 2408
378 Ga0157379_10140904 3300014968 Bacteria 2174
379 Ga0157376_10253081 3300014969 Bacteria 1646
380 Ga0157376_10306358 3300014969 Bacteria 1505
381 Ga0182007_10011898 3300015262 Bacteria 3367
382 Ga0183367_1005 3300015688 Bacteria 652063
383 Ga0163161_10102864 3300017792 Bacteria 2128
384 Ga0163161_10192161 3300017792 Bacteria 1570
385 Ga0163161_10334050 3300017792 Bacteria 1201
386 Ga0197907_11486011 3300020069 Bacteria 1055
387 Ga0206356_10464819 3300020070 Bacteria 1199
388 Ga0206355_1573660 3300020076 Bacteria 2383
389 Ga0206354_10632267 3300020081 Bacteria 1102
390 Ga0206353_10972019 3300020082 Bacteria 1345
391 Ga0206353_11335110 3300020082 Bacteria 784
392 Ga0213874_10059141 3300021377 Bacteria 1196
393 Ga0213875_10000537 3300021388 Bacteria 31171
394 Ga0213875_10001614 3300021388 Bacteria 14256
395 Ga0213875_10016464 3300021388 Bacteria 3583
396 Ga0213875_10024228 3300021388 Bacteria 2895
397 Ga0213875_10299394 3300021388 Bacteria 761
398 Ga0224712_10004812 3300022467 Bacteria 3687
399 Ga0224712_10012350 3300022467 Bacteria 2684
400 Ga0224712_10016046 3300022467 Bacteria 2451
401 Ga0224712_10050508 3300022467 Bacteria 1616
402 Ga0224712_10122252 3300022467 Bacteria 1128
403 Ga0224712_10138911 3300022467 Bacteria 1068
404 Ga0209758_1005482 3300025297 Bacteria 9735
405 Ga0207426_1004843 3300025302 Bacteria 6378
406 Ga0207426_1008083 3300025302 Bacteria 4310
407 Ga0207426_1010813 3300025302 Bacteria 3520
408 Ga0207426_1048669 3300025302 Bacteria 1272
409 Ga0207696_1048405 3300025711 Bacteria 1222
410 Ga0207713_1005803 3300025735 Bacteria 7640
411 Ga0207653_10009551 3300025885 Bacteria 3024
412 Ga0207692_10002006 3300025898 Bacteria 7775
413 Ga0207692_10012366 3300025898 Bacteria 3664
414 Ga0207692_10015787 3300025898 Bacteria 3330
415 Ga0207692_10026337 3300025898 Bacteria 2727
416 Ga0207692_10056251 3300025898 Bacteria 2017
417 Ga0207692_10118251 3300025898 Bacteria 1480
418 Ga0207710_10000054 3300025900 Bacteria 180103
419 Ga0207710_10000199 3300025900 Bacteria 56491
420 Ga0207710_10009019 3300025900 Bacteria 4198
421 Ga0207688_10013036 3300025901 Bacteria 4521
422 Ga0207688_10022652 3300025901 Bacteria 3438
423 Ga0207680_10024029 3300025903 Bacteria 3338
424 Ga0207680_10121741 3300025903 Bacteria 1707
425 Ga0207647_10013191 3300025904 Bacteria 5738
426 Ga0207647_10027943 3300025904 Bacteria 3673
427 Ga0207647_10052960 3300025904 Bacteria 2503
428 Ga0207685_10008336 3300025905 Bacteria 2947
429 Ga0207685_10021703 3300025905 Bacteria 2157
430 Ga0207699_10000684 3300025906 Bacteria 16276
431 Ga0207699_10002656 3300025906 Bacteria 8440
432 Ga0207699_10005707 3300025906 Bacteria 5983
433 Ga0207699_10014662 3300025906 Bacteria 4048
434 Ga0207699_10014727 3300025906 Bacteria 4041
435 Ga0207699_10037612 3300025906 Bacteria 2768
436 Ga0207699_10337033 3300025906 Bacteria 1062
437 Ga0207645_10051702 3300025907 Bacteria 2625
438 Ga0207643_10022418 3300025908 Bacteria 3477
439 Ga0207643_10166592 3300025908 Bacteria 1328
440 Ga0207705_10000573 3300025909 Bacteria 30814
441 Ga0207684_10000571 3300025910 Bacteria 44831
442 Ga0207684_10001806 3300025910 Bacteria 22396
443 Ga0207684_10014224 3300025910 Bacteria 6868
444 Ga0207684_10019030 3300025910 Bacteria 5874
445 Ga0207684_10025959 3300025910 Bacteria 4994
446 Ga0207684_10061832 3300025910 Bacteria 3179
447 Ga0207684_10066992 3300025910 Bacteria 3050
448 Ga0207684_10073685 3300025910 Bacteria 2900
449 Ga0207684_10144332 3300025910 Bacteria 2047
450 Ga0207684_10236281 3300025910 Bacteria 1577
451 Ga0207684_10282490 3300025910 Bacteria 1431
452 Ga0207654_10024354 3300025911 Bacteria 3253
453 Ga0207654_10036321 3300025911 Bacteria 2752
454 Ga0207654_10534008 3300025911 Bacteria 832
455 Ga0207707_10003446 3300025912 Bacteria 14027
456 Ga0207707_10258377 3300025912 Bacteria 1512
457 Ga0207695_10008627 3300025913 Bacteria 12733
458 Ga0207695_10195826 3300025913 Bacteria 1937
459 Ga0207695_10236258 3300025913 Bacteria 1730
460 Ga0207695_10380506 3300025913 Bacteria 1297
461 Ga0207671_10000188 3300025914 Bacteria 95365
462 Ga0207671_10047172 3300025914 Bacteria 3189
463 Ga0207671_10074718 3300025914 Bacteria 2533
464 Ga0207693_10003796 3300025915 Bacteria 12867
465 Ga0207693_10006369 3300025915 Bacteria 9780
466 Ga0207693_10007211 3300025915 Bacteria 9152
467 Ga0207693_10010872 3300025915 Bacteria 7385
468 Ga0207693_10018090 3300025915 Bacteria 5615
469 Ga0207693_10055665 3300025915 Bacteria 3103
470 Ga0207693_10240941 3300025915 Bacteria 1420
471 Ga0207693_10599488 3300025915 Bacteria 858
472 Ga0207663_10001400 3300025916 Bacteria 11181
473 Ga0207663_10003417 3300025916 Bacteria 7767
474 Ga0207663_10016411 3300025916 Bacteria 4106
475 Ga0207663_10022703 3300025916 Bacteria 3591
476 Ga0207663_10034580 3300025916 Bacteria 3024
477 Ga0207663_10056942 3300025916 Bacteria 2461
478 Ga0207663_10129919 3300025916 Bacteria 1739
479 Ga0207663_10494520 3300025916 Bacteria 949
480 Ga0207660_10237112 3300025917 Bacteria 1436
481 Ga0207660_10304771 3300025917 Bacteria 1269
482 Ga0207660_10380767 3300025917 Bacteria 1134
483 Ga0207662_10008460 3300025918 Bacteria 5634
484 Ga0207662_10083704 3300025918 Bacteria 1950
485 Ga0207657_10004980 3300025919 Bacteria 13974
486 Ga0207657_10028697 3300025919 Bacteria 5072
487 Ga0207657_10037201 3300025919 Bacteria 4349
488 Ga0207652_10031799 3300025921 Bacteria 4433
489 Ga0207652_10078417 3300025921 Bacteria 2884
490 Ga0207652_10236479 3300025921 Bacteria 1647
491 Ga0207646_10000050 3300025922 Bacteria 171554
492 Ga0207646_10001770 3300025922 Bacteria 26156
493 Ga0207646_10002450 3300025922 Bacteria 21909
494 Ga0207646_10009108 3300025922 Bacteria 9854
495 Ga0207646_10011667 3300025922 Bacteria 8497
496 Ga0207646_10123924 3300025922 Bacteria 2323
497 Ga0207694_10004684 3300025924 Bacteria 10647
498 Ga0207694_10127303 3300025924 Bacteria 2039
499 Ga0207694_10369184 3300025924 Bacteria 1190
500 Ga0207650_10356812 3300025925 Bacteria 1204
501 Ga0207659_10279814 3300025926 Bacteria 1364
502 Ga0207687_10017480 3300025927 Bacteria 4723
503 Ga0207687_10076551 3300025927 Bacteria 2404
504 Ga0207687_10106279 3300025927 Bacteria 2075
505 Ga0207687_10118225 3300025927 Bacteria 1978
506 Ga0207687_10264640 3300025927 Bacteria 1372
507 Ga0207687_10346363 3300025927 Bacteria 1209
508 Ga0207700_10001148 3300025928 Bacteria 15212
509 Ga0207700_10011993 3300025928 Bacteria 5562
510 Ga0207700_10041144 3300025928 Bacteria 3379
511 Ga0207700_10046488 3300025928 Bacteria 3210
512 Ga0207700_10060814 3300025928 Bacteria 2862
513 Ga0207700_10077499 3300025928 Bacteria 2582
514 Ga0207700_10078444 3300025928 Bacteria 2569
515 Ga0207700_10089443 3300025928 Bacteria 2427
516 Ga0207700_10188450 3300025928 Bacteria 1732
517 Ga0207700_10529867 3300025928 Bacteria 1044
518 Ga0207664_10000009 3300025929 Bacteria 299246
519 Ga0207664_10000298 3300025929 Bacteria 37109
520 Ga0207664_10003123 3300025929 Bacteria 11003
521 Ga0207664_10004567 3300025929 Bacteria 9378
522 Ga0207664_10006510 3300025929 Bacteria 8038
523 Ga0207664_10012203 3300025929 Bacteria 6141
524 Ga0207664_10016910 3300025929 Bacteria 5334
525 Ga0207664_10028591 3300025929 Bacteria 4238
526 Ga0207664_10033127 3300025929 Bacteria 3967
527 Ga0207664_10067915 3300025929 Bacteria 2862
528 Ga0207664_10193522 3300025929 Bacteria 1752
529 Ga0207664_10194744 3300025929 Bacteria 1747
530 Ga0207664_10265488 3300025929 Bacteria 1502
531 Ga0207664_10672954 3300025929 Bacteria 930
532 Ga0207644_10376549 3300025931 Bacteria 1157
533 Ga0207690_10715941 3300025932 Bacteria 824
534 Ga0207706_10020091 3300025933 Bacteria 6002
535 Ga0207686_10118300 3300025934 Bacteria 1799
536 Ga0207709_10047213 3300025935 Bacteria 2616
537 Ga0207709_10066719 3300025935 Bacteria 2268
538 Ga0207670_10010705 3300025936 Bacteria 5294
539 Ga0207670_10459137 3300025936 Bacteria 1028
540 Ga0207669_10178475 3300025937 Bacteria 1520
541 Ga0207669_10191156 3300025937 Bacteria 1477
542 Ga0207704_10219204 3300025938 Bacteria 1406
543 Ga0207665_10001293 3300025939 Bacteria 16911
544 Ga0207665_10006161 3300025939 Bacteria 7965
545 Ga0207665_10007145 3300025939 Bacteria 7391
546 Ga0207665_10009393 3300025939 Bacteria 6417
547 Ga0207665_10009599 3300025939 Bacteria 6355
548 Ga0207665_10022631 3300025939 Bacteria 4136
549 Ga0207665_10027491 3300025939 Bacteria 3758
550 Ga0207665_10422739 3300025939 Bacteria 1018
551 Ga0207691_10018488 3300025940 Bacteria 6606
552 Ga0207691_10220118 3300025940 Bacteria 1646
553 Ga0207711_10038262 3300025941 Bacteria 4078
554 Ga0207711_10069180 3300025941 Bacteria 3059
555 Ga0207711_10143807 3300025941 Bacteria 2147
556 Ga0207711_10474577 3300025941 Bacteria 1165
557 Ga0207689_10011071 3300025942 Bacteria 7751
558 Ga0207689_10116096 3300025942 Bacteria 2200
559 Ga0207689_10886559 3300025942 Bacteria 753
560 Ga0207661_10044710 3300025944 Bacteria 3502
561 Ga0207661_10295793 3300025944 Bacteria 1450
562 Ga0207661_10761574 3300025944 Bacteria 891
563 Ga0207679_10088282 3300025945 Bacteria 2390
564 Ga0207667_10034292 3300025949 Bacteria 5451
565 Ga0207667_10067860 3300025949 Bacteria 3715
566 Ga0207667_10114334 3300025949 Bacteria 2782
567 Ga0207667_10338389 3300025949 Bacteria 1536
568 Ga0207667_10664637 3300025949 Bacteria 1046
569 Ga0207667_10692040 3300025949 Bacteria 1022
570 Ga0207667_10740105 3300025949 Bacteria 983
571 Ga0207651_10126687 3300025960 Bacteria 1947
572 Ga0207651_10298946 3300025960 Bacteria 1338
573 Ga0207712_10056414 3300025961 Bacteria 2767
574 Ga0207712_10164450 3300025961 Bacteria 1728
575 Ga0207668_10024607 3300025972 Bacteria 3889
576 Ga0207668_10130099 3300025972 Bacteria 1921
577 Ga0207668_10328361 3300025972 Bacteria 1272
578 Ga0207640_10031406 3300025981 Bacteria 3281
579 Ga0207640_10560147 3300025981 Bacteria 962
580 Ga0207658_10042016 3300025986 Bacteria 3314
581 Ga0207677_10038407 3300026023 Bacteria 3139
582 Ga0207677_10405190 3300026023 Bacteria 1157
583 Ga0207677_10900324 3300026023 Bacteria 797
584 Ga0207703_10000047 3300026035 Bacteria 151177
585 Ga0207703_10033367 3300026035 Bacteria 4080
586 Ga0207639_10019625 3300026041 Bacteria 4824
587 Ga0207639_10055105 3300026041 Bacteria 3042
588 Ga0207639_10087274 3300026041 Bacteria 2486
589 Ga0207678_10006256 3300026067 Bacteria 10574
590 Ga0207678_10007661 3300026067 Bacteria 9536
591 Ga0207678_10016809 3300026067 Bacteria 6426
592 Ga0207678_10032239 3300026067 Bacteria 4567
593 Ga0207678_10327538 3300026067 Bacteria 1318
594 Ga0207708_10000076 3300026075 Bacteria 78340
595 Ga0207708_10453641 3300026075 Bacteria 1068
596 Ga0207702_10018387 3300026078 Bacteria 5783
597 Ga0207702_10211140 3300026078 Bacteria 1805
598 Ga0207702_10230973 3300026078 Bacteria 1729
599 Ga0207702_10357366 3300026078 Bacteria 1399
600 Ga0207702_10655929 3300026078 Bacteria 1032
601 Ga0207702_10659437 3300026078 Bacteria 1029
602 Ga0207702_10866727 3300026078 Bacteria 894
603 Ga0207641_10043271 3300026088 Bacteria 3781
604 Ga0207641_10315816 3300026088 Bacteria 1480
605 Ga0207676_10071926 3300026095 Bacteria 2778
606 Ga0207676_10112106 3300026095 Bacteria 2284
607 Ga0207674_10105018 3300026116 Bacteria 2803
608 Ga0207674_10161644 3300026116 Bacteria 2194
609 Ga0207674_10190137 3300026116 Bacteria 2003
610 Ga0207674_10470158 3300026116 Bacteria 1215
611 Ga0207674_10672536 3300026116 Bacteria 1000
612 Ga0207675_100036213 3300026118 Bacteria 4603
613 Ga0207675_100083772 3300026118 Bacteria 2991
614 Ga0207683_10008027 3300026121 Bacteria 9026
615 Ga0207683_10010511 3300026121 Bacteria 7896
616 Ga0207683_10019796 3300026121 Bacteria 5748
617 Ga0207683_10118006 3300026121 Bacteria 2380
618 Ga0207683_10591025 3300026121 Bacteria 1027
619 Ga0207683_10785520 3300026121 Bacteria 884
620 Ga0207698_10014788 3300026142 Bacteria 5201
621 Ga0207698_10070428 3300026142 Bacteria 2771
622 Ga0207698_10215039 3300026142 Bacteria 1732
623 Ga0207698_10299760 3300026142 Bacteria 1496
624 Ga0207698_10464844 3300026142 Bacteria 1224
625 Ga0209371_1036492 3300027312 Bacteria 1027
626 Ga0209179_1013955 3300027512 Bacteria 1468
627 Ga0209282_1104653 3300027666 Bacteria 1450
628 Ga0207428_10109901 3300027907 Bacteria 2123
629 Ga0265357_1000648 3300028023 Bacteria 2169
630 Ga0268266_10003295 3300028379 Bacteria 16228
631 Ga0268266_10113916 3300028379 Bacteria 2399
632 Ga0268266_10318640 3300028379 Bacteria 1455
633 Ga0268266_10543717 3300028379 Bacteria 1112
634 Ga0268265_10482871 3300028380 Bacteria 1164
635 Ga0268264_10000147 3300028381 Bacteria 164790
636 Ga0268264_10024763 3300028381 Bacteria 4902
637 Ga0268264_10472530 3300028381 Bacteria 1218
638 Ga0265337_1010294 3300028556 Bacteria 3282
639 Ga0265326_10016736 3300028558 Bacteria 2117
640 Ga0265319_1002778 3300028563 Bacteria 9388
641 Ga0265334_10001473 3300028573 Bacteria 11343
642 Ga0265334_10010969 3300028573 Bacteria 3823
643 Ga0265318_10013803 3300028577 Bacteria 3403
644 Ga0265323_10007434 3300028653 Bacteria 4552
645 Ga0265322_10128498 3300028654 Bacteria 722
646 Ga0265336_10009823 3300028666 Bacteria 3297
647 Ga0307517_10010734 3300028786 Bacteria 12774
648 Ga0307517_10016489 3300028786 Bacteria 9705
649 Ga0307515_10003702 3300028794 Bacteria 32085
650 Ga0307515_10043028 3300028794 Bacteria 7038
651 Ga0307515_10078912 3300028794 Bacteria 4321
652 Ga0307515_10113925 3300028794 Bacteria 3130
653 Ga0307515_10346082 3300028794 Bacteria 1136
654 Ga0307515_10355630 3300028794 Bacteria 1108
655 Ga0307515_10421519 3300028794 Bacteria 955
656 Ga0265338_10000125 3300028800 Bacteria 141151
657 Ga0265338_10001588 3300028800 Bacteria 36478
658 Ga0265338_10003580 3300028800 Bacteria 21688
659 Ga0265338_10012554 3300028800 Bacteria 9650
660 Ga0265324_10005383 3300029957 Bacteria 5539
661 Ga0268256_1030226 3300030500 Bacteria 1315
662 Ga0307511_10001286 3300030521 Bacteria 26612
663 Ga0307511_10056779 3300030521 Bacteria 3055
664 Ga0307512_10001726 3300030522 Bacteria 29809
665 Ga0307512_10006664 3300030522 Bacteria 11634
666 Ga0265766_1003975 3300030863 Bacteria 886
667 Ga0265332_10059749 3300031238 Bacteria 1631
668 Ga0265320_10007329 3300031240 Bacteria 6851
669 Ga0265325_10018697 3300031241 Bacteria 3842
670 Ga0265340_10000127 3300031247 Bacteria 37974
671 Ga0265340_10047965 3300031247 Bacteria 2077
672 Ga0265339_10036771 3300031249 Bacteria 2738
673 Ga0265316_10374245 3300031344 Bacteria 1028
674 Ga0307513_10003878 3300031456 Bacteria 20119
675 Ga0307513_10069197 3300031456 Bacteria 3694
676 Ga0307509_10079436 3300031507 Bacteria 3396
677 Ga0307509_10114455 3300031507 Bacteria 2692
678 Ga0307508_10008805 3300031616 Bacteria 9311
679 Ga0307508_10063253 3300031616 Bacteria 3265
680 Ga0307508_10075915 3300031616 Bacteria 2938
681 Ga0307514_10011203 3300031649 Bacteria 7460
682 Ga0307514_10074227 3300031649 Bacteria 2539
683 Ga0307514_10153866 3300031649 Bacteria 1537
684 Ga0307514_10236484 3300031649 Bacteria 1100
685 Ga0316579_10000077 3300031691 Bacteria 24927
686 Ga0316579_10007071 3300031691 Bacteria 4617
687 Ga0316579_10032470 3300031691 Bacteria 2394
688 Ga0265314_10010681 3300031711 Bacteria 7641
689 Ga0265342_10013026 3300031712 Bacteria 5603
690 Ga0316576_10038983 3300031727 Bacteria 3409
691 Ga0316576_10168165 3300031727 Bacteria 1654
692 Ga0316576_10258203 3300031727 Bacteria 1307
693 Ga0316578_10037179 3300031728 Bacteria 2804
694 Ga0307516_10053784 3300031730 Bacteria 3936
695 Ga0307516_10085042 3300031730 Bacteria 3001
696 Ga0307516_10212121 3300031730 Bacteria 1650
697 Ga0316577_10051727 3300031733 Bacteria 2292
698 Ga0307410_10062443 3300031852 Bacteria 2553
699 Ga0307410_10401842 3300031852 Bacteria 1107
700 Ga0307406_10051528 3300031901 Bacteria 2614
701 Ga0307407_10100086 3300031903 Bacteria 1797
702 Ga0307407_10261421 3300031903 Bacteria 1191
703 Ga0307412_10311139 3300031911 Bacteria 1249
704 Ga0307409_100007448 3300031995 Bacteria 6547
705 Ga0307409_100102486 3300031995 Bacteria 2378
706 Ga0307409_100257551 3300031995 Bacteria 1599
707 Ga0307409_100418407 3300031995 Bacteria 1285
708 Ga0307409_100423753 3300031995 Bacteria 1277
709 Ga0307409_100502748 3300031995 Bacteria 1181
710 Ga0307409_100720625 3300031995 Bacteria 999
711 Ga0307409_100778800 3300031995 Bacteria 962
712 Ga0307409_101051235 3300031995 Bacteria 834
713 Ga0307416_100010494 3300032002 Bacteria 6121
714 Ga0307416_100748499 3300032002 Bacteria 1070
715 Ga0307411_10179029 3300032005 Bacteria 1607
716 Ga0307415_100017174 3300032126 Bacteria 4332
717 Ga0307415_100670522 3300032126 Bacteria 932
718 Ga0316583_10037382 3300032133 Bacteria 1721
719 Ga0316580_10083713 3300032139 Bacteria 975
720 Ga0307507_10000009 3300033179 Bacteria 265992
721 Ga0307507_10065207 3300033179 Bacteria 3351
722 Ga0307507_10152268 3300033179 Bacteria 1736
723 Ga0307507_10198775 3300033179 Bacteria 1392
724 Ga0307510_10046657 3300033180 Bacteria 4654
725 Ga0316214_1000866 3300033545 Bacteria 3319
726 Ga0316214_1001110 3300033545 Bacteria 3027
727 Ga0316214_1029015 3300033545 Bacteria 784
728 Ga0373930_0013153 3300034816 Bacteria 1521
729 Ga0373959_0009081 3300034820 Bacteria 1706
730 Ga0373938_0001761 3300034957 Bacteria 3454
731 Ga0373926_0000156 3300035083 Bacteria 15071
732 Ga0373926_0000832 3300035083 Bacteria 8754
733 Ga0373926_0035486 3300035083 Bacteria 1769
734 Ga0373926_0048779 3300035083 Bacteria 1523
735 Ga0373934_0000058 3300035086 Bacteria 37451
736 Ga0373934_0004599 3300035086 Bacteria 5101
737 Ga0373934_0025399 3300035086 Bacteria 2294
738 Ga0373934_0035510 3300035086 Bacteria 1961
739 Ga0373934_0039886 3300035086 Bacteria 1851
740 Ga0373940_0005394 3300035088 Bacteria 2768
741 Ga0373944_0000925 3300035089 Bacteria 7261
742 Ga0373944_0003386 3300035089 Bacteria 4112
743 Ga0373949_0036185 3300035090 Bacteria 1196
744 Ga0373951_0005589 3300035091 Bacteria 2914
745 Ga0373952_0005808 3300035092 Bacteria 2267
746 Ga0373923_0003028 3300035111 Bacteria 5313
747 Ga0373923_0015058 3300035111 Bacteria 2914
748 Ga0373923_0033594 3300035111 Bacteria 2077
749 Ga0373923_0044608 3300035111 Bacteria 1838
750 Ga0373923_0156828 3300035111 Bacteria 1036
751 Ga0373932_0026901 3300035112 Bacteria 1569
752 Ga0373936_0005337 3300035113 Bacteria 4837
753 Ga0373936_0017711 3300035113 Bacteria 2745
754 Ga0373939_0015568 3300035114 Bacteria 1992
755 Ga0373941_0066178 3300035115 Bacteria 1188
756 Ga0373945_0000023 3300035116 Bacteria 31398
757 Ga0373945_0047461 3300035116 Bacteria 1570
758 Ga0373953_0000217 3300035117 Bacteria 15671
759 Ga0373953_0003800 3300035117 Bacteria 4753
760 Ga0373953_0008649 3300035117 Bacteria 3467
761 Ga0373953_0022344 3300035117 Bacteria 2384
762 Ga0373954_0004267 3300035118 Bacteria 6144
763 Ga0373954_0008892 3300035118 Bacteria 4419
764 Ga0373954_0009716 3300035118 Bacteria 4236
765 Ga0373954_0013477 3300035118 Bacteria 3643
766 Ga0373954_0055904 3300035118 Bacteria 1857
767 Ga0373954_0212017 3300035118 Bacteria 952
768 Ga0373954_0325356 3300035118 Bacteria 759
769 Ga0373956_0002963 3300035119 Bacteria 6871
770 Ga0373956_0025873 3300035119 Bacteria 2538
771 Ga0373956_0067870 3300035119 Bacteria 1624
772 Ga0373956_0070348 3300035119 Bacteria 1596
773 Ga0373956_0080149 3300035119 Bacteria 1497
774 Ga0373956_0086580 3300035119 Bacteria 1442
775 Ga0373956_0155156 3300035119 Bacteria 1078
776 Ga0373957_0001086 3300035120 Bacteria 7184
777 Ga0373957_0004423 3300035120 Bacteria 4277
778 Ga0373957_0009415 3300035120 Bacteria 3196
779 Ga0373957_0018314 3300035120 Bacteria 2451
780 Ga0373957_0062251 3300035120 Bacteria 1447
781 Ga0373957_0084453 3300035120 Bacteria 1256
782 Ga0373957_0102878 3300035120 Bacteria 1145
783 Ga0373960_0006179 3300035121 Bacteria 2801
784 Ga0373960_0056719 3300035121 Bacteria 1177
785 Ga0373943_0013589 3300035170 Bacteria 3678
786 Ga0373943_0017395 3300035170 Bacteria 3289
787 Ga0373943_0073664 3300035170 Bacteria 1735
788 Ga0373943_0095458 3300035170 Bacteria 1546
789 Ga0373943_0163722 3300035170 Bacteria 1213
790 Ga0373946_0000155 3300035171 Bacteria 20705
791 Ga0373946_0026077 3300035171 Bacteria 2302
792 Ga0373946_0169938 3300035171 Bacteria 1028
793 Ga0373955_0000156 3300035172 Bacteria 27424
794 Ga0373955_0001996 3300035172 Bacteria 8807
795 Ga0373955_0036158 3300035172 Bacteria 2619
796 Ga0373955_0107816 3300035172 Bacteria 1607
797 Ga0373955_0242601 3300035172 Bacteria 1079
798 Ga0373955_0267249 3300035172 Bacteria 1027
799 Ga0373955_0291805 3300035172 Bacteria 982
800 Ga0373942_0007720 3300035207 Bacteria 2502
801 Ga0373942_0012258 3300035207 Bacteria 2045
802 Ga0373942_0143813 3300035207 Bacteria 761
803 Ga0373962_0010234 3300035242 Bacteria 2334
804 Ga0316574_0001785 3300035398 Bacteria 10457
805 Ga0316574_0053143 3300035398 Bacteria 2528
806 Ga0316574_0378355 3300035398 Bacteria 893
807 Ga0373924_0001561 3300035410 Bacteria 7480
808 Ga0373924_0004802 3300035410 Bacteria 4748
809 Ga0373924_0021005 3300035410 Bacteria 2543
810 Ga0373924_0173181 3300035410 Bacteria 949
811 Ga0373931_0042796 3300035691 Bacteria 2382
812 Ga0373931_0086392 3300035691 Bacteria 1740
813 Ga0373931_0262341 3300035691 Bacteria 1054
814 Ga0373935_0002708 3300035692 Bacteria 10195
815 Ga0373935_0005390 3300035692 Bacteria 7535
816 Ga0373935_0034511 3300035692 Bacteria 3153
817 Ga0373935_0138420 3300035692 Bacteria 1642
818 Ga0373927_0019143 3300035695 Bacteria 4489
819 Ga0373927_0137679 3300035695 Bacteria 1596
820 Ga0373927_0159577 3300035695 Bacteria 1477
821 Ga0373927_0477572 3300035695 Bacteria 824
822 Ga0373933_0000009 3300035724 Bacteria 112662
823 Ga0373933_0004934 3300035724 Bacteria 7277
824 Ga0373933_0029843 3300035724 Bacteria 3155
825 Ga0373933_0069097 3300035724 Bacteria 2146
826 Ga0373933_0103878 3300035724 Bacteria 1766
827 Ga0373933_0130932 3300035724 Bacteria 1577
828 Ga0373947_0000075 3300035725 Bacteria 50183
829 Ga0373947_0137705 3300035725 Bacteria 1563
830 Ga0373937_0000012 3300036401 Bacteria 159418
831 Ga0373937_0035586 3300036401 Bacteria 4533
832 Ga0373937_0046636 3300036401 Bacteria 3963
833 Ga0373937_0085585 3300036401 Bacteria 2917
834 Ga0373937_0092882 3300036401 Bacteria 2797
835 Ga0373937_0133778 3300036401 Bacteria 2317
836 Ga0373937_0214266 3300036401 Bacteria 1812
837 Ga0373937_0355260 3300036401 Bacteria 1388
838 Ga0316582_0013111 3300036647 Bacteria 4655
839 Ga0316582_0029915 3300036647 Bacteria 3312
840 Ga0316582_0220683 3300036647 Bacteria 1296
841 Ga0316584_0060140 3300036712 Bacteria 2845
842 Ga0373925_0000262 3300037068 Bacteria 54852
843 Ga0373925_0001964 3300037068 Bacteria 17017
844 Ga0373925_0011639 3300037068 Bacteria 6362
845 Ga0373925_0015148 3300037068 Bacteria 5574
846 Ga0373925_0146501 3300037068 Bacteria 1851
847 Ga0373925_0202415 3300037068 Bacteria 1579
848 Ga0373925_0254379 3300037068 Bacteria 1409
849 Ga0373925_0254485 3300037068 Bacteria 1409
850 Ga0395899_0007409 3300037312 Bacteria 8479
851 Ga0395899_0065818 3300037312 Bacteria 2663
852 Ga0395900_0030148 3300037418 Bacteria 5568
853 Ga0395900_0110138 3300037418 Bacteria 2829
854 Ga0395900_0248527 3300037418 Bacteria 1781
855 Ga0395898_0005654 3300037466 Bacteria 13479
856 Ga0395898_0005710 3300037466 Bacteria 13410
857 Ga0395898_0048693 3300037466 Bacteria 4155
858 Ga0395898_0066020 3300037466 Bacteria 3507
859 Ga0395898_0117049 3300037466 Bacteria 2553
860 Ga0395898_0123137 3300037466 Bacteria 2485
861 Ga0395898_0139143 3300037466 Bacteria 2324
862 Ga0395898_0182253 3300037466 Bacteria 2007
863 Ga0395898_0431093 3300037466 Bacteria 1256
864 Ga0436364_0109924 3300037853 Bacteria 16000
865 Ga0436364_0138124 3300037853 Bacteria 7843
866 Ga0436364_0392443 3300037853 Bacteria 1867
867 Ga0436364_0647259 3300037853 Bacteria 794
868 Ga0436364_0858481 3300037853 Bacteria 17713
869 Ga0436364_0891745 3300037853 Bacteria 1734
870 Ga0436364_0932176 3300037853 Bacteria 1054
871 Ga0436364_1059010 3300037853 Bacteria 60327
872 Ga0395901_0020046 3300038443 Bacteria 6842
873 Ga0395901_0029954 3300038443 Bacteria 5606
874 Ga0395901_0043581 3300038443 Bacteria 4653
875 Ga0395901_0203596 3300038443 Bacteria 2074
876 Ga0395901_0362343 3300038443 Bacteria 1495
877 Ga0395901_0373590 3300038443 Bacteria 1468
878 Ga0395901_0488586 3300038443 Bacteria 1255
879 Ga0395901_0516645 3300038443 Bacteria 1214
880 Ga0395901_0594418 3300038443 Bacteria 1116
881 Ga0395901_0749100 3300038443 Bacteria 970
882 Ga0395901_1081816 3300038443 Bacteria 773
883 Ga0436365_0144311 3300039437 Bacteria 2167
884 Ga0436365_0789144 3300039437 Bacteria 4499
885 Ga0436365_1434079 3300039437 Bacteria 3109
886 Ga0436360_0666661 3300039438 Bacteria 1110
887 Ga0436363_0382238 3300039450 Bacteria 980
888 Ga0436363_0859415 3300039450 Bacteria 1353
889 Ga0436363_0995323 3300039450 Bacteria 822
890 Ga0436362_0025783 3300039453 Bacteria 1834
891 Ga0436362_0488032 3300039453 Bacteria 1153
892 Ga0436362_0638503 3300039453 Bacteria 900
893 Ga0436362_0944772 3300039453 Bacteria 1445
894 Ga0439436_0000221 3300041404 Bacteria 13685
895 Ga0439436_0000369 3300041404 Bacteria 11193
896 Ga0439436_0008523 3300041404 Bacteria 3154
897 Ga0439439_0004672 3300041406 Bacteria 3094
898 Ga0439439_0071063 3300041406 Bacteria 932
899 Ga0439439_0076794 3300041406 Bacteria 899
900 Ga0439466_0037874 3300041411 Bacteria 1622
901 Ga0451789_0394708 3300041443 Bacteria 864
902 Ga0451793_1930165 3300041452 Bacteria 1084
903 Ga0451833_1303516 3300041491 Bacteria 1405
904 Ga0451837_0319373 3300041494 Bacteria 3822
905 Ga0439433_0001075 3300041999 Bacteria 5544
906 Ga0439433_0007557 3300041999 Bacteria 2348
907 Ga0439448_0049198 3300042005 Bacteria 1378
908 Ga0439448_0085699 3300042005 Bacteria 1061
909 Ga0439449_0001351 3300042007 Bacteria 9619
910 Ga0439449_0047792 3300042007 Bacteria 1584
911 Ga0439449_0139201 3300042007 Bacteria 903
912 Ga0439457_000912 3300042014 Bacteria 8905
913 Ga0439457_003251 3300042014 Bacteria 4457
914 Ga0439462_0003322 3300042015 Bacteria 3850
915 Ga0450888_023225 3300042126 Bacteria 800
916 Ga0450890_004402 3300042127 Bacteria 1841
917 Ga0450897_002158 3300042128 Bacteria 1441
918 Ga0450894_000165 3300042131 Bacteria 11729
919 Ga0450895_001091 3300042132 Bacteria 1809
920 Ga0450896_000843 3300042133 Bacteria 3488
921 Ga0450898_026543 3300042134 Bacteria 1044
922 Ga0450900_017926 3300042136 Bacteria 968
923 Ga0450902_004816 3300042137 Bacteria 2018
924 Ga0450903_003902 3300042138 Bacteria 2562
925 Ga0450906_002967 3300042145 Bacteria 3681
926 Ga0439458_0005305 3300042157 Bacteria 2899
927 Ga0450908_000484 3300042184 Bacteria 7648
928 Ga0439460_0064916 3300042461 Bacteria 1121
929 Ga0466969_0011075 3300044656 Bacteria 4776
930 Ga0466969_0014683 3300044656 Bacteria 4117
931 Ga0466969_0029467 3300044656 Bacteria 2802
932 Ga0466969_0140123 3300044656 Bacteria 1118
933 Ga0466972_0003842 3300044658 Bacteria 7474
934 Ga0466972_0003903 3300044658 Bacteria 7432
935 Ga0466972_0010829 3300044658 Bacteria 4578
936 Ga0466972_0143263 3300044658 Bacteria 1124
937 Ga0466965_0000304 3300044683 Bacteria 16357
938 Ga0466965_0028551 3300044683 Bacteria 2711
939 Ga0466965_0042100 3300044683 Bacteria 2251
940 Ga0466965_0104011 3300044683 Bacteria 1454
941 Ga0466965_0171166 3300044683 Bacteria 1143
942 Ga0466965_0198379 3300044683 Bacteria 1064
943 Ga0466966_0008603 3300044684 Bacteria 6757
944 Ga0466966_0043489 3300044684 Bacteria 2879
945 Ga0466966_0045850 3300044684 Bacteria 2793
946 Ga0466966_0050263 3300044684 Bacteria 2653
947 Ga0466966_0063589 3300044684 Bacteria 2325
948 Ga0466966_0457228 3300044684 Bacteria 767
949 Ga0466961_0006417 3300044693 Bacteria 7468
950 Ga0466961_0009741 3300044693 Bacteria 6114
951 Ga0466961_0094517 3300044693 Bacteria 1886
952 Ga0466961_0219468 3300044693 Bacteria 1172
953 Ga0466961_0219638 3300044693 Bacteria 1172
954 Ga0466961_0281864 3300044693 Bacteria 1017
955 Ga0466963_0001543 3300044694 Bacteria 12482
956 Ga0466963_0001954 3300044694 Bacteria 11303
957 Ga0466963_0004547 3300044694 Bacteria 8078
958 Ga0466963_0032003 3300044694 Bacteria 3403
959 Ga0466963_0038082 3300044694 Bacteria 3144
960 Ga0466963_0054026 3300044694 Bacteria 2669
961 Ga0466963_0074239 3300044694 Bacteria 2293
962 Ga0466963_0083702 3300044694 Bacteria 2164
963 Ga0466963_0096421 3300044694 Bacteria 2020
964 Ga0466963_0318529 3300044694 Bacteria 1094
965 Ga0466964_0009875 3300044706 Bacteria 3597
966 Ga0466971_0006461 3300044719 Bacteria 5092
967 Ga0466971_0011590 3300044719 Bacteria 3861
968 Ga0466971_0028559 3300044719 Bacteria 2495
969 Ga0466971_0034980 3300044719 Bacteria 2252
970 Ga0466971_0041072 3300044719 Bacteria 2077
971 Ga0466971_0041165 3300044719 Bacteria 2075
972 Ga0466971_0280450 3300044719 Bacteria 797
973 Ga0466970_0000179 3300044765 Bacteria 30305
974 Ga0466970_0006119 3300044765 Bacteria 5995
975 Ga0466970_0096053 3300044765 Bacteria 1611
976 Ga0466970_0119935 3300044765 Bacteria 1440
977 Ga0466970_0272429 3300044765 Bacteria 951
978 Ga0466957_0001101 3300044842 Bacteria 13974
979 Ga0466957_0046598 3300044842 Bacteria 2632
980 Ga0466957_0047119 3300044842 Bacteria 2618
981 Ga0466957_0236810 3300044842 Bacteria 1210
982 Ga0466957_0269937 3300044842 Bacteria 1136
983 Ga0466957_0355331 3300044842 Bacteria 995
984 Ga0466960_0002996 3300044901 Bacteria 6441
985 Ga0466960_0043520 3300044901 Bacteria 2136
986 Ga0466960_0184606 3300044901 Bacteria 1132
987 Ga0466960_0310670 3300044901 Bacteria 890
988 Ga0466959_0002789 3300045049 Bacteria 11249
989 Ga0466959_0064052 3300045049 Bacteria 2669
990 Ga0466959_0080783 3300045049 Bacteria 2343
991 Ga0466959_0353256 3300045049 Bacteria 1002
992 Ga0466958_0010946 3300045836 Bacteria 5096
993 Ga0466958_0014015 3300045836 Bacteria 4573
994 Ga0466958_0019871 3300045836 Bacteria 3913
995 Ga0466958_0032131 3300045836 Bacteria 3121
996 Ga0466958_0241273 3300045836 Bacteria 1155
997 Ga0466958_0248102 3300045836 Bacteria 1138
998 Ga0466958_0315677 3300045836 Bacteria 1004
999 Ga0466967_0011410 3300045976 Bacteria 6728
1000 Ga0466967_0028007 3300045976 Bacteria 4696
1001 Ga0466967_0031778 3300045976 Bacteria 4450
1002 Ga0466967_0065600 3300045976 Bacteria 3232
1003 Ga0466967_0128608 3300045976 Bacteria 2349
1004 Ga0466967_0155973 3300045976 Bacteria 2138
1005 Ga0466967_0211964 3300045976 Bacteria 1837
1006 Ga0466967_0415282 3300045976 Bacteria 1311
1007 Ga0466967_0519108 3300045976 Bacteria 1170
1008 Ga0466967_0678940 3300045976 Bacteria 1019
1009 Ga0466967_0776438 3300045976 Bacteria 951
1010 Ga0466967_1004868 3300045976 Bacteria 830
1011 Ga0466967_1075215 3300045976 Bacteria 801
1012 Ga0466967_1298927 3300045976 Bacteria 725
1013 Ga0495617_002534 3300046452 Bacteria 7221
1014 Ga0495617_157897 3300046452 Bacteria 720
1015 Ga0495627_013158 3300046453 Bacteria 2916
1016 Ga0495627_042990 3300046453 Bacteria 1383
1017 Ga0495592_0000049 3300046454 Bacteria 113704
1018 Ga0495592_0014903 3300046454 Bacteria 5899
1019 Ga0495592_0040961 3300046454 Bacteria 3473
1020 Ga0495592_0046032 3300046454 Bacteria 3253
1021 Ga0495592_0070946 3300046454 Bacteria 2536
1022 Ga0495592_0074524 3300046454 Bacteria 2465
1023 Ga0495592_0099155 3300046454 Bacteria 2078
1024 Ga0495603_0001554 3300046455 Bacteria 13423
1025 Ga0495603_0001594 3300046455 Bacteria 13301
1026 Ga0495603_0013288 3300046455 Bacteria 4977
1027 Ga0495603_0016215 3300046455 Bacteria 4507
1028 Ga0495603_0031472 3300046455 Bacteria 3194
1029 Ga0495603_0046082 3300046455 Bacteria 2599
1030 Ga0495603_0082929 3300046455 Bacteria 1877
1031 Ga0495603_0146545 3300046455 Bacteria 1372
1032 Ga0495603_0364295 3300046455 Bacteria 829
1033 Ga0495590_0022011 3300046457 Bacteria 2256
1034 Ga0495590_0044639 3300046457 Bacteria 1545
1035 Ga0495590_0093346 3300046457 Bacteria 1066
1036 Ga0495629_0002112 3300046459 Bacteria 15396
1037 Ga0495629_0010288 3300046459 Bacteria 6813
1038 Ga0495629_0048873 3300046459 Bacteria 2965
1039 Ga0495629_0050531 3300046459 Bacteria 2911
1040 Ga0495629_0056568 3300046459 Bacteria 2742
1041 Ga0495629_0093561 3300046459 Bacteria 2097
1042 Ga0495629_0109496 3300046459 Bacteria 1926
1043 Ga0495629_0186003 3300046459 Bacteria 1439
1044 Ga0495629_0188609 3300046459 Bacteria 1427
1045 Ga0495629_0366042 3300046459 Bacteria 982
1046 Ga0495638_0051975 3300046460 Bacteria 2554
1047 Ga0495638_0077718 3300046460 Bacteria 2020
1048 Ga0495638_0152161 3300046460 Bacteria 1341
1049 Ga0495638_0163491 3300046460 Bacteria 1282
1050 Ga0495641_0006736 3300046461 Bacteria 7379
1051 Ga0495641_0016436 3300046461 Bacteria 3899
1052 Ga0495641_0025068 3300046461 Bacteria 2930
1053 Ga0495641_0065678 3300046461 Bacteria 1633
1054 Ga0495641_0122110 3300046461 Bacteria 1162
1055 Ga0495641_0174597 3300046461 Bacteria 961
1056 Ga0495651_0000007 3300046462 Bacteria 158577
1057 Ga0495651_0001322 3300046462 Bacteria 19203
1058 Ga0495651_0001709 3300046462 Bacteria 16956
1059 Ga0495651_0011440 3300046462 Bacteria 6817
1060 Ga0495651_0013776 3300046462 Bacteria 6252
1061 Ga0495651_0032077 3300046462 Bacteria 4098
1062 Ga0495651_0047460 3300046462 Bacteria 3320
1063 Ga0495651_0196207 3300046462 Bacteria 1416
1064 Ga0495651_0276742 3300046462 Bacteria 1135
1065 Ga0495653_0002706 3300046463 Bacteria 14128
1066 Ga0495653_0009356 3300046463 Bacteria 8017
1067 Ga0495653_0011729 3300046463 Bacteria 7155
1068 Ga0495653_0069063 3300046463 Bacteria 2648
1069 Ga0495653_0069203 3300046463 Bacteria 2645
1070 Ga0495653_0072394 3300046463 Bacteria 2573
1071 Ga0495653_0076433 3300046463 Bacteria 2489
1072 Ga0495653_0105415 3300046463 Bacteria 2035
1073 Ga0495653_0187823 3300046463 Bacteria 1412
1074 Ga0495580_0088787 3300046472 Bacteria 2152
1075 Ga0495580_0116065 3300046472 Bacteria 1859
1076 Ga0495580_0203805 3300046472 Bacteria 1362
1077 Ga0495582_0008843 3300046473 Bacteria 5555
1078 Ga0495582_0018157 3300046473 Bacteria 3849
1079 Ga0495582_0019820 3300046473 Bacteria 3677
1080 Ga0495582_0034601 3300046473 Bacteria 2777
1081 Ga0495582_0097616 3300046473 Bacteria 1643
1082 Ga0495582_0173155 3300046473 Bacteria 1229
1083 Ga0495605_0019223 3300046474 Bacteria 3654
1084 Ga0495605_0081391 3300046474 Bacteria 1514
1085 Ga0495605_0145250 3300046474 Bacteria 1061
1086 Ga0495639_0008986 3300046475 Bacteria 4283
1087 Ga0495639_0010613 3300046475 Bacteria 3967
1088 Ga0495639_0022556 3300046475 Bacteria 2762
1089 Ga0495639_0077375 3300046475 Bacteria 1544
1090 Ga0495639_0142709 3300046475 Bacteria 1152
1091 Ga0495662_0000163 3300046476 Bacteria 26131
1092 Ga0495662_0010357 3300046476 Bacteria 4568
1093 Ga0495662_0015181 3300046476 Bacteria 3741
1094 Ga0495662_0051644 3300046476 Bacteria 1985
1095 Ga0495662_0065279 3300046476 Bacteria 1759
1096 Ga0495662_0103865 3300046476 Bacteria 1390
1097 Ga0495664_0001047 3300046477 Bacteria 14288
1098 Ga0495664_0005749 3300046477 Bacteria 6829
1099 Ga0495664_0012698 3300046477 Bacteria 4770
1100 Ga0495664_0032570 3300046477 Bacteria 3059
1101 Ga0495664_0049010 3300046477 Bacteria 2507
1102 Ga0495664_0049582 3300046477 Bacteria 2492
1103 Ga0495664_0051332 3300046477 Bacteria 2448
1104 Ga0495664_0077271 3300046477 Bacteria 1993
1105 Ga0495664_0198339 3300046477 Bacteria 1216
1106 Ga0495664_0299212 3300046477 Bacteria 971
1107 Ga0495585_0003798 3300046492 Bacteria 10058
1108 Ga0495585_0031254 3300046492 Bacteria 3023
1109 Ga0495594_0016102 3300046499 Bacteria 3934
1110 Ga0495594_0020549 3300046499 Bacteria 3517
1111 Ga0495594_0057855 3300046499 Bacteria 2141
1112 Ga0495594_0113890 3300046499 Bacteria 1526
1113 Ga0495594_0128827 3300046499 Bacteria 1432
1114 Ga0495594_0326107 3300046499 Bacteria 874
1115 Ga0495596_0050341 3300046500 Bacteria 1632
1116 Ga0495607_0254833 3300046501 Bacteria 843
1117 Ga0495606_0013625 3300046507 Bacteria 6410
1118 Ga0495608_0000015 3300046511 Bacteria 200266
1119 Ga0495608_0017575 3300046511 Bacteria 4946
1120 Ga0495608_0021907 3300046511 Bacteria 4382
1121 Ga0495608_0024177 3300046511 Bacteria 4156
1122 Ga0495608_0155193 3300046511 Bacteria 1457
1123 Ga0495608_0159614 3300046511 Bacteria 1434
1124 Ga0495608_0202332 3300046511 Bacteria 1251
1125 Ga0495608_0366617 3300046511 Bacteria 885
1126 Ga0495610_0004959 3300046512 Bacteria 9640
1127 Ga0495616_0008463 3300046513 Bacteria 6094
1128 Ga0495618_0006907 3300046514 Bacteria 6881
1129 Ga0495618_0024295 3300046514 Bacteria 3753
1130 Ga0495618_0089136 3300046514 Bacteria 1972
1131 Ga0495618_0092236 3300046514 Bacteria 1936
1132 Ga0495618_0101126 3300046514 Bacteria 1845
1133 Ga0495618_0154577 3300046514 Bacteria 1464
1134 Ga0495618_0167406 3300046514 Bacteria 1399
1135 Ga0495618_0179717 3300046514 Bacteria 1345
1136 Ga0495620_0047482 3300046515 Bacteria 1847
1137 Ga0495620_0224594 3300046515 Bacteria 718
1138 Ga0495628_0001681 3300046516 Bacteria 20199
1139 Ga0495628_0002433 3300046516 Bacteria 16783
1140 Ga0495628_0025594 3300046516 Bacteria 4820
1141 Ga0495628_0074087 3300046516 Bacteria 2653
1142 Ga0495628_0095221 3300046516 Bacteria 2300
1143 Ga0495628_0116863 3300046516 Bacteria 2048
1144 Ga0495628_0184372 3300046516 Bacteria 1577
1145 Ga0495628_0219730 3300046516 Bacteria 1427
1146 Ga0495630_0003597 3300046517 Bacteria 10796
1147 Ga0495630_0030861 3300046517 Bacteria 3989
1148 Ga0495630_0131528 3300046517 Bacteria 1900
1149 Ga0495630_0303413 3300046517 Bacteria 1220
1150 Ga0495630_0333377 3300046517 Bacteria 1160
1151 Ga0495631_0005911 3300046518 Bacteria 6370
1152 Ga0495637_0058397 3300046520 Bacteria 1590
1153 Ga0495643_0012121 3300046522 Bacteria 5211
1154 Ga0495648_0151473 3300046524 Bacteria 1209
1155 Ga0495666_0026609 3300046526 Bacteria 2850
1156 Ga0495666_0093232 3300046526 Bacteria 1420
1157 Ga0495666_0123361 3300046526 Bacteria 1212
1158 Ga0495666_0179321 3300046526 Bacteria 978
1159 Ga0495642_0287921 3300046528 Bacteria 719
1160 Ga0495652_0001157 3300046529 Bacteria 29740
1161 Ga0495652_0001969 3300046529 Bacteria 21864
1162 Ga0495652_0046161 3300046529 Bacteria 3741
1163 Ga0495652_0049508 3300046529 Bacteria 3597
1164 Ga0495652_0061099 3300046529 Bacteria 3182
1165 Ga0495652_0064207 3300046529 Bacteria 3088
1166 Ga0495652_0073989 3300046529 Bacteria 2834
1167 Ga0495652_0284389 3300046529 Bacteria 1209
1168 Ga0495652_0389385 3300046529 Bacteria 989
1169 Ga0495654_0052892 3300046530 Bacteria 1975
1170 Ga0495665_0004214 3300046531 Bacteria 7765
1171 Ga0495665_0004805 3300046531 Bacteria 7292
1172 Ga0495665_0034731 3300046531 Bacteria 2696
1173 Ga0495665_0046298 3300046531 Bacteria 2310
1174 Ga0495665_0166448 3300046531 Bacteria 1148
1175 Ga0495640_0005364 3300046533 Bacteria 10196
1176 Ga0495640_0008144 3300046533 Bacteria 8232
1177 Ga0495640_0056612 3300046533 Bacteria 2678
1178 Ga0495640_0074622 3300046533 Bacteria 2267
1179 Ga0495640_0088651 3300046533 Bacteria 2044
1180 Ga0495640_0099308 3300046533 Bacteria 1912
1181 Ga0495640_0104125 3300046533 Bacteria 1860
1182 Ga0495640_0165867 3300046533 Bacteria 1413
1183 Ga0495640_0176501 3300046533 Bacteria 1363
1184 Ga0495640_0268862 3300046533 Bacteria 1063
1185 Ga0495586_0030108 3300046535 Bacteria 2905
1186 Ga0495586_0071294 3300046535 Bacteria 1898
1187 Ga0495587_0000032 3300046536 Bacteria 124143
1188 Ga0495587_0004304 3300046536 Bacteria 9399
1189 Ga0495587_0030319 3300046536 Bacteria 3280
1190 Ga0495587_0036355 3300046536 Bacteria 2962
1191 Ga0495587_0046097 3300046536 Bacteria 2588
1192 Ga0495587_0157803 3300046536 Bacteria 1292
1193 Ga0495587_0167586 3300046536 Bacteria 1248
1194 Ga0495609_0008249 3300046538 Bacteria 5114
1195 Ga0495597_0073531 3300046542 Bacteria 1469
1196 Ga0495645_0013643 3300046543 Bacteria 5755
1197 Ga0495645_0016859 3300046543 Bacteria 5228
1198 Ga0495645_0061156 3300046543 Bacteria 2729
1199 Ga0495645_0062886 3300046543 Bacteria 2688
1200 Ga0495645_0068949 3300046543 Bacteria 2552
1201 Ga0495645_0096810 3300046543 Bacteria 2102
1202 Ga0495645_0099814 3300046543 Bacteria 2065
1203 Ga0495645_0162284 3300046543 Bacteria 1544
1204 Ga0495645_0242182 3300046543 Bacteria 1203
1205 Ga0495645_0267136 3300046543 Bacteria 1130
1206 Ga0495622_0005947 3300046557 Bacteria 5669
1207 Ga0495622_0021107 3300046557 Bacteria 3034
1208 Ga0495633_0288298 3300046558 Bacteria 746
1209 Ga0495667_0008628 3300046559 Bacteria 6920
1210 Ga0495667_0014297 3300046559 Bacteria 5361
1211 Ga0495667_0127095 3300046559 Bacteria 1644
1212 Ga0495667_0144359 3300046559 Bacteria 1533
1213 Ga0495667_0162988 3300046559 Bacteria 1434
1214 Ga0495667_0194755 3300046559 Bacteria 1298
1215 Ga0495634_0006405 3300046642 Bacteria 8947
1216 Ga0495634_0006867 3300046642 Bacteria 8606
1217 Ga0495634_0016697 3300046642 Bacteria 5245
1218 Ga0495634_0024117 3300046642 Bacteria 4271
1219 Ga0495634_0029978 3300046642 Bacteria 3761
1220 Ga0495634_0030299 3300046642 Bacteria 3738
1221 Ga0495634_0233947 3300046642 Bacteria 1129
1222 Ga0495611_0069557 3300046648 Bacteria 1608
1223 Ga0495611_0090842 3300046648 Bacteria 1411
1224 Ga0495625_0001776 3300046660 Bacteria 24861
1225 Ga0495625_0038628 3300046660 Bacteria 3493
1226 Ga0495625_0070707 3300046660 Bacteria 2450
1227 Ga0495625_0150283 3300046660 Bacteria 1566
1228 Ga0495635_0002928 3300046663 Bacteria 11723
1229 Ga0495635_0006534 3300046663 Bacteria 8136
1230 Ga0495635_0014928 3300046663 Bacteria 5434
1231 Ga0495635_0016716 3300046663 Bacteria 5125
1232 Ga0495635_0030421 3300046663 Bacteria 3752
1233 Ga0495635_0041587 3300046663 Bacteria 3174
1234 Ga0495635_0231708 3300046663 Bacteria 1248
1235 Ga0495659_0115846 3300046664 Bacteria 1051
1236 Ga0495661_0021386 3300046665 Bacteria 4218
1237 Ga0495588_0005660 3300046674 Bacteria 5572
1238 Ga0495588_0030229 3300046674 Bacteria 2722
1239 Ga0495588_0053948 3300046674 Bacteria 2073
1240 Ga0495657_0000106 3300046675 Bacteria 74585
1241 Ga0495657_0002543 3300046675 Bacteria 15305
1242 Ga0495657_0005981 3300046675 Bacteria 9551
1243 Ga0495657_0012582 3300046675 Bacteria 6279
1244 Ga0495657_0016670 3300046675 Bacteria 5347
1245 Ga0495657_0020771 3300046675 Bacteria 4720
1246 Ga0495657_0036983 3300046675 Bacteria 3368
1247 Ga0495657_0060941 3300046675 Bacteria 2497
1248 Ga0495657_0111171 3300046675 Bacteria 1735
1249 Ga0495657_0265243 3300046675 Bacteria 1031
1250 Ga0495657_0409050 3300046675 Bacteria 797
1251 Ga0495599_0000414 3300046678 Bacteria 24387
1252 Ga0495599_0006481 3300046678 Bacteria 7065
1253 Ga0495599_0016216 3300046678 Bacteria 4624
1254 Ga0495599_0032519 3300046678 Bacteria 3274
1255 Ga0495599_0054425 3300046678 Bacteria 2506
1256 Ga0495599_0089821 3300046678 Bacteria 1917
1257 Ga0495623_0009879 3300046679 Bacteria 6182
1258 Ga0495623_0019308 3300046679 Bacteria 4406
1259 Ga0495623_0025742 3300046679 Bacteria 3789
1260 Ga0495623_0050810 3300046679 Bacteria 2625
1261 Ga0495623_0107046 3300046679 Bacteria 1698
1262 Ga0495623_0252520 3300046679 Bacteria 991
1263 Ga0495623_0332636 3300046679 Bacteria 831
1264 Ga0495646_0002859 3300046680 Bacteria 10688
1265 Ga0495646_0018949 3300046680 Bacteria 4357
1266 Ga0495646_0020936 3300046680 Bacteria 4135
1267 Ga0495646_0036623 3300046680 Bacteria 3038
1268 Ga0495646_0038583 3300046680 Bacteria 2948
1269 Ga0495646_0080871 3300046680 Bacteria 1894
1270 Ga0495646_0122320 3300046680 Bacteria 1471
1271 Ga0495647_0084457 3300046681 Bacteria 1292
1272 Ga0495658_0047240 3300046683 Bacteria 2423
1273 Ga0495658_0048373 3300046683 Bacteria 2398
1274 Ga0495658_0065618 3300046683 Bacteria 2094
1275 Ga0495658_0105565 3300046683 Bacteria 1687
1276 Ga0495658_0456303 3300046683 Bacteria 816
1277 Ga0495613_0002345 3300046689 Bacteria 14347
1278 Ga0495613_0024867 3300046689 Bacteria 4462
1279 Ga0495613_0048617 3300046689 Bacteria 3132
1280 Ga0495613_0052053 3300046689 Bacteria 3016
1281 Ga0495613_0094091 3300046689 Bacteria 2168
1282 Ga0495613_0159831 3300046689 Bacteria 1603
1283 Ga0495613_0250314 3300046689 Bacteria 1236
1284 Ga0495613_0524589 3300046689 Bacteria 795
1285 Ga0495613_0601785 3300046689 Bacteria 731
1286 Ga0495624_0001191 3300046690 Bacteria 20556
1287 Ga0495624_0002632 3300046690 Bacteria 13550
1288 Ga0495624_0042798 3300046690 Bacteria 2893
1289 Ga0495624_0057229 3300046690 Bacteria 2451
1290 Ga0495624_0082408 3300046690 Bacteria 1991
1291 Ga0495624_0129313 3300046690 Bacteria 1549
1292 Ga0495624_0275902 3300046690 Bacteria 1015
1293 Ga0495624_0284273 3300046690 Bacteria 998
1294 Ga0495624_0359452 3300046690 Bacteria 875
1295 Ga0495670_0034029 3300046691 Bacteria 2536
1296 Ga0495670_0073647 3300046691 Bacteria 1731
1297 Ga0495671_0104479 3300046692 Bacteria 1383
1298 Ga0495649_0058252 3300046694 Bacteria 2082
1299 Ga0495649_0070923 3300046694 Bacteria 1867
1300 Ga0495589_0004731 3300046794 Bacteria 7225
1301 Ga0495589_0043120 3300046794 Bacteria 2246
1302 Ga0495589_0045168 3300046794 Bacteria 2189
1303 Ga0495589_0168512 3300046794 Bacteria 1041
1304 Ga0495600_0001446 3300046809 Bacteria 13159
1305 Ga0495600_0004594 3300046809 Bacteria 8270
1306 Ga0495600_0012322 3300046809 Bacteria 5344
1307 Ga0495600_0016101 3300046809 Bacteria 4739
1308 Ga0495600_0020341 3300046809 Bacteria 4246
1309 Ga0495600_0022349 3300046809 Bacteria 4059
1310 Ga0495600_0096553 3300046809 Bacteria 1926
1311 Ga0495600_0112553 3300046809 Bacteria 1772
1312 Ga0495600_0309098 3300046809 Bacteria 996
1313 Ga0495660_0012621 3300046810 Bacteria 4903
1314 Ga0495660_0255896 3300046810 Bacteria 810
1315 Ga0495581_0030122 3300047315 Bacteria 3145
1316 Ga0495581_0037431 3300047315 Bacteria 2808
1317 Ga0495581_0040774 3300047315 Bacteria 2685
1318 Ga0495581_0053224 3300047315 Bacteria 2338
1319 Ga0495581_0064372 3300047315 Bacteria 2118
1320 Ga0495604_0000062 3300047317 Bacteria 93264
1321 Ga0495604_0000878 3300047317 Bacteria 25046
1322 Ga0495604_0016358 3300047317 Bacteria 5929
1323 Ga0495604_0031341 3300047317 Bacteria 4216
1324 Ga0495604_0053909 3300047317 Bacteria 3105
1325 Ga0495604_0063208 3300047317 Bacteria 2824
1326 Ga0495604_0074780 3300047317 Bacteria 2552
1327 Ga0495604_0097092 3300047317 Bacteria 2173
1328 Ga0495604_0136584 3300047317 Bacteria 1756
1329 Ga0495604_0199151 3300047317 Bacteria 1390
1330 Ga0495604_0199416 3300047317 Bacteria 1389
1331 Ga0495604_0262792 3300047317 Bacteria 1172
1332 Ga0495636_0023512 3300047318 Bacteria 2495
1333 Ga0495636_0127015 3300047318 Bacteria 1132
1334 Ga0495674_0000654 3300047319 Bacteria 32473
1335 Ga0495674_0014303 3300047319 Bacteria 7431
1336 Ga0495674_0028679 3300047319 Bacteria 5070
1337 Ga0495674_0042670 3300047319 Bacteria 4044
1338 Ga0495674_0103586 3300047319 Bacteria 2419
1339 Ga0495674_0120346 3300047319 Bacteria 2218
1340 Ga0495674_0169028 3300047319 Bacteria 1825
1341 Ga0495672_0051574 3300047320 Bacteria 2422
1342 Ga0495676_0000150 3300047321 Bacteria 53407
1343 Ga0495676_0001728 3300047321 Bacteria 19083
1344 Ga0495676_0005833 3300047321 Bacteria 11302
1345 Ga0495676_0007138 3300047321 Bacteria 10251
1346 Ga0495676_0023708 3300047321 Bacteria 5321
1347 Ga0495676_0036064 3300047321 Bacteria 4132
1348 Ga0495676_0066375 3300047321 Bacteria 2796
1349 Ga0495676_0096520 3300047321 Bacteria 2197
1350 Ga0495676_0103858 3300047321 Bacteria 2097
1351 Ga0495676_0198921 3300047321 Bacteria 1393
1352 Ga0495680_0001896 3300047322 Bacteria 21959
1353 Ga0495680_0016084 3300047322 Bacteria 6432
1354 Ga0495680_0018955 3300047322 Bacteria 5827
1355 Ga0495680_0020371 3300047322 Bacteria 5581
1356 Ga0495680_0022021 3300047322 Bacteria 5322
1357 Ga0495680_0047137 3300047322 Bacteria 3392
1358 Ga0495680_0050025 3300047322 Bacteria 3269
1359 Ga0495680_0057203 3300047322 Bacteria 3016
1360 Ga0495680_0060126 3300047322 Bacteria 2931
1361 Ga0495680_0089175 3300047322 Bacteria 2315
1362 Ga0495680_0102082 3300047322 Bacteria 2136
1363 Ga0495680_0144920 3300047322 Bacteria 1735
1364 Ga0495687_002534 3300047443 Bacteria 14481
1365 Ga0495675_0014468 3300047444 Bacteria 4986
1366 Ga0495675_0017619 3300047444 Bacteria 4528
1367 Ga0495675_0023625 3300047444 Bacteria 3918
1368 Ga0495675_0102866 3300047444 Bacteria 1786
1369 Ga0495675_0161720 3300047444 Bacteria 1378
1370 Ga0495677_0057656 3300047445 Bacteria 1436
1371 Ga0495685_001035 3300047447 Bacteria 8466
1372 Ga0495685_018250 3300047447 Bacteria 2406
1373 Ga0495685_136430 3300047447 Bacteria 800
1374 Ga0495685_166961 3300047447 Bacteria 711
1375 Ga0495681_0001177 3300047470 Bacteria 19878
1376 Ga0495681_0011246 3300047470 Bacteria 5348
1377 Ga0495681_0102854 3300047470 Bacteria 1246
1378 Ga0495684_0004087 3300047471 Bacteria 11395
1379 Ga0495684_0007997 3300047471 Bacteria 8174
1380 Ga0495684_0016230 3300047471 Bacteria 5734
1381 Ga0495684_0041054 3300047471 Bacteria 3546
1382 Ga0495684_0050658 3300047471 Bacteria 3170
1383 Ga0495684_0076311 3300047471 Bacteria 2545
1384 Ga0495684_0116805 3300047471 Bacteria 2011
1385 Ga0495684_0392390 3300047471 Bacteria 976
1386 Ga0495686_0044711 3300047472 Bacteria 2803
1387 Ga0495686_0374598 3300047472 Bacteria 769
1388 Ga0495593_0008567 3300047673 Bacteria 5948
1389 Ga0495593_0023902 3300047673 Bacteria 3391
1390 Ga0495593_0059745 3300047673 Bacteria 1997
1391 Ga0495593_0071813 3300047673 Bacteria 1797
1392 Ga0495593_0115501 3300047673 Bacteria 1368
1393 Ga0495602_0002545 3300048088 Bacteria 18578
1394 Ga0495602_0028807 3300048088 Bacteria 5305
1395 Ga0495602_0063161 3300048088 Bacteria 3210
1396 Ga0495602_0094928 3300048088 Bacteria 2463
1397 Ga0495602_0135146 3300048088 Bacteria 1960
1398 Ga0495602_0148791 3300048088 Bacteria 1843
1399 Ga0495602_0194062 3300048088 Bacteria 1554
1400 Ga0495602_0215765 3300048088 Bacteria 1452
1401 Ga0495602_0363396 3300048088 Bacteria 1041
1402 Ga0495602_0449376 3300048088 Bacteria 910
1403 Ga0495614_0000611 3300048089 Bacteria 14956
1404 Ga0495614_0037662 3300048089 Bacteria 2075
1405 Ga0495614_0044088 3300048089 Bacteria 1913
1406 Ga0495614_0184814 3300048089 Bacteria 939
1407 Ga0495615_0113718 3300048090 Bacteria 777
1408 Ga0495626_0006328 3300048091 Bacteria 6752
1409 Ga0496100_0027737 3300048903 Bacteria 3485
1410 Ga0496100_0036636 3300048903 Bacteria 3096
1411 Ga0496100_0078631 3300048903 Bacteria 2220
1412 Ga0496100_0140651 3300048903 Bacteria 1710
1413 Ga0496100_0150672 3300048903 Bacteria 1658
1414 Ga0496100_0189882 3300048903 Bacteria 1491
1415 Ga0496100_0229831 3300048903 Bacteria 1364
1416 Ga0496101_0014873 3300048904 Bacteria 5237
1417 Ga0496101_0028793 3300048904 Bacteria 3881
1418 Ga0496101_0039436 3300048904 Bacteria 3359
1419 Ga0496101_0057875 3300048904 Bacteria 2805
1420 Ga0496101_0321634 3300048904 Bacteria 1214
1421 Ga0496101_0344703 3300048904 Bacteria 1170
1422 Ga0496101_0457770 3300048904 Bacteria 1007
1423 Ga0496102_0006769 3300048905 Bacteria 9780
1424 Ga0496102_0014285 3300048905 Bacteria 6901
1425 Ga0496102_0027853 3300048905 Bacteria 5047
1426 Ga0496102_0084947 3300048905 Bacteria 2922
1427 Ga0496102_0093131 3300048905 Bacteria 2791
1428 Ga0496102_0209726 3300048905 Bacteria 1837
1429 Ga0496102_0509021 3300048905 Bacteria 1126
1430 Ga0496102_0533770 3300048905 Bacteria 1096
1431 Ga0496102_0653434 3300048905 Bacteria 975
1432 Ga0496103_0020725 3300048906 Bacteria 3952
1433 Ga0496103_0039720 3300048906 Bacteria 2891
1434 Ga0496103_0044364 3300048906 Bacteria 2740
1435 Ga0496103_0641226 3300048906 Bacteria 675
1436 Ga0496104_0006175 3300048907 Bacteria 10521
1437 Ga0496104_0008256 3300048907 Bacteria 9245
1438 Ga0496104_0016097 3300048907 Bacteria 6787
1439 Ga0496104_0072280 3300048907 Bacteria 3280
1440 Ga0496104_0145656 3300048907 Bacteria 2274
1441 Ga0496104_0162629 3300048907 Bacteria 2141
1442 Ga0496104_0322655 3300048907 Bacteria 1457
1443 Ga0496104_0334357 3300048907 Bacteria 1427
1444 Ga0496104_0500953 3300048907 Bacteria 1126
1445 Ga0496104_0570064 3300048907 Bacteria 1042
1446 Ga0496104_0947992 3300048907 Bacteria 765
1447 Ga0496105_0000770 3300048908 Bacteria 21786
1448 Ga0496105_0001849 3300048908 Bacteria 15180
1449 Ga0496105_0018813 3300048908 Bacteria 5562
1450 Ga0496105_0032974 3300048908 Bacteria 4251
1451 Ga0496105_0059034 3300048908 Bacteria 3165
1452 Ga0496105_0066420 3300048908 Bacteria 2977
1453 Ga0496105_0192886 3300048908 Bacteria 1665
1454 Ga0496105_0387757 3300048908 Bacteria 1111
1455 Ga0496106_0105759 3300048909 Bacteria 2187
1456 Ga0496106_0260206 3300048909 Bacteria 1388
1457 Ga0496106_0267558 3300048909 Bacteria 1368
1458 Ga0496106_0351626 3300048909 Bacteria 1184
1459 Ga0496106_0552765 3300048909 Bacteria 924
1460 Ga0496107_0013004 3300048910 Bacteria 5815
1461 Ga0496107_0025724 3300048910 Bacteria 4168
1462 Ga0496107_0027912 3300048910 Bacteria 4009
1463 Ga0496107_0151938 3300048910 Bacteria 1713
1464 Ga0496107_0163235 3300048910 Bacteria 1652
1465 Ga0496107_0197521 3300048910 Bacteria 1495
1466 Ga0496107_0314608 3300048910 Bacteria 1165
1467 Ga0496107_0360825 3300048910 Bacteria 1081
1468 Ga0496107_0687800 3300048910 Bacteria 753
1469 Ga0496108_0001256 3300048911 Bacteria 19832
1470 Ga0496108_0056003 3300048911 Bacteria 3312
1471 Ga0496108_0076757 3300048911 Bacteria 2824
1472 Ga0496108_0077787 3300048911 Bacteria 2806
1473 Ga0496108_0156347 3300048911 Bacteria 1969
1474 Ga0496108_0170435 3300048911 Bacteria 1883
1475 Ga0496108_0242654 3300048911 Bacteria 1567
1476 Ga0496108_0274873 3300048911 Bacteria 1467
1477 Ga0496108_0347647 3300048911 Bacteria 1294
1478 Ga0496108_0373293 3300048911 Bacteria 1245
1479 Ga0496108_0778364 3300048911 Bacteria 826
1480 Ga0496109_0022092 3300048912 Bacteria 5631
1481 Ga0496109_0028644 3300048912 Bacteria 4984
1482 Ga0496109_0028918 3300048912 Bacteria 4962
1483 Ga0496109_0074823 3300048912 Bacteria 3114
1484 Ga0496109_0105066 3300048912 Bacteria 2622
1485 Ga0496109_0117542 3300048912 Bacteria 2475
1486 Ga0496109_0131240 3300048912 Bacteria 2338
1487 Ga0496109_0154342 3300048912 Bacteria 2150
1488 Ga0496109_0236245 3300048912 Bacteria 1720
1489 Ga0496109_0251297 3300048912 Bacteria 1665
1490 Ga0496109_0474045 3300048912 Bacteria 1182
1491 Ga0496110_0022947 3300048913 Bacteria 5303
1492 Ga0496110_0046500 3300048913 Bacteria 3797
1493 Ga0496110_0049751 3300048913 Bacteria 3678
1494 Ga0496110_0064333 3300048913 Bacteria 3241
1495 Ga0496110_0126849 3300048913 Bacteria 2303
1496 Ga0496110_0171323 3300048913 Bacteria 1969
1497 Ga0496110_0193491 3300048913 Bacteria 1847
1498 Ga0496110_0223498 3300048913 Bacteria 1712
1499 Ga0496110_0402112 3300048913 Bacteria 1248
1500 Ga0496110_0571790 3300048913 Bacteria 1026
1501 Ga0496110_0874104 3300048913 Bacteria 804
1502 Ga0496111_0001697 3300048914 Bacteria 12845
1503 Ga0496111_0017359 3300048914 Bacteria 4976
1504 Ga0496111_0019743 3300048914 Bacteria 4686
1505 Ga0496111_0020319 3300048914 Bacteria 4622
1506 Ga0496111_0035970 3300048914 Bacteria 3540
1507 Ga0496111_0044283 3300048914 Bacteria 3199
1508 Ga0496111_0347448 3300048914 Bacteria 1098
1509 Ga0496111_0490330 3300048914 Bacteria 905
1510 Ga0496112_0000586 3300048915 Bacteria 24986
1511 Ga0496112_0028415 3300048915 Bacteria 5398
1512 Ga0496112_0048959 3300048915 Bacteria 4141
1513 Ga0496112_0088303 3300048915 Bacteria 3068
1514 Ga0496112_0193140 3300048915 Bacteria 1997
1515 Ga0496112_0674093 3300048915 Bacteria 963
1516 Ga0496112_0905039 3300048915 Bacteria 804
1517 Ga0496113_0015052 3300048916 Bacteria 5299
1518 Ga0496113_0041324 3300048916 Bacteria 3402
1519 Ga0496113_0059184 3300048916 Bacteria 2885
1520 Ga0496113_0105996 3300048916 Bacteria 2183
1521 Ga0496113_0119118 3300048916 Bacteria 2062
1522 Ga0496113_0119629 3300048916 Bacteria 2058
1523 Ga0496114_0004150 3300048917 Bacteria 11208
1524 Ga0496114_0009285 3300048917 Bacteria 7804
1525 Ga0496114_0028823 3300048917 Bacteria 4559
1526 Ga0496114_0031007 3300048917 Bacteria 4398
1527 Ga0496114_0067269 3300048917 Bacteria 3005
1528 Ga0496114_0102807 3300048917 Bacteria 2441
1529 Ga0496114_0134724 3300048917 Bacteria 2135
1530 Ga0496114_0157514 3300048917 Bacteria 1972
1531 Ga0496114_0278431 3300048917 Bacteria 1474
1532 Ga0496114_0852798 3300048917 Bacteria 791
1533 Ga0496114_0908831 3300048917 Bacteria 762
1534 Ga0496115_0021963 3300048918 Bacteria 4935
1535 Ga0496115_0028311 3300048918 Bacteria 4390
1536 Ga0496115_0047442 3300048918 Bacteria 3435
1537 Ga0496115_0207876 3300048918 Bacteria 1617
1538 Ga0496115_0707159 3300048918 Bacteria 792
1539 Ga0496119_0000200 3300048922 Bacteria 84506
1540 Ga0496119_0000475 3300048922 Bacteria 54868
1541 Ga0496119_0026206 3300048922 Bacteria 4047
1542 Ga0496119_0054433 3300048922 Bacteria 2436
1543 Ga0496120_0000353 3300048923 Bacteria 75672
1544 Ga0496120_0002957 3300048923 Bacteria 16188
1545 Ga0496121_0014747 3300048924 Bacteria 8256
1546 Ga0496125_0293085 3300048928 Bacteria 1001
1547 Ga0496126_0004952 3300048929 Bacteria 15533
1548 Ga0496126_0026965 3300048929 Bacteria 5499
1549 Ga0496126_0043878 3300048929 Bacteria 4121
1550 Ga0496126_0184836 3300048929 Bacteria 1768
1551 Ga0496126_0438497 3300048929 Bacteria 1053
1552 Ga0495678_027678 3300049459 Bacteria 2402
1553 Ga0495682_0041301 3300049460 Bacteria 1691
1554 Ga0501031_0013166 3300049568 Bacteria 5398
1555 Ga0501031_0014095 3300049568 Bacteria 5201
1556 Ga0501031_0096162 3300049568 Bacteria 1933
1557 Ga0501031_0310468 3300049568 Bacteria 1022
1558 Ga0501031_0547186 3300049568 Bacteria 746
1559 Ga0501031_0577604 3300049568 Bacteria 723
1560 Ga0501032_0038311 3300049569 Bacteria 3265
1561 Ga0501032_0076296 3300049569 Bacteria 2232
1562 Ga0501032_0388240 3300049569 Bacteria 897
1563 Ga0501033_0006244 3300049570 Bacteria 9338
1564 Ga0501033_0032215 3300049570 Bacteria 3936
1565 Ga0501033_0034045 3300049570 Bacteria 3822
1566 Ga0501033_0111002 3300049570 Bacteria 1995
1567 Ga0501033_0144725 3300049570 Bacteria 1717
1568 Ga0501033_0150444 3300049570 Bacteria 1679
1569 Ga0501034_0007085 3300049571 Bacteria 11960
1570 Ga0501034_0008257 3300049571 Bacteria 11019
1571 Ga0501034_0036552 3300049571 Bacteria 4974
1572 Ga0501034_0062389 3300049571 Bacteria 3742
1573 Ga0501034_0581792 3300049571 Bacteria 1026
1574 Ga0501036_0000154 3300049572 Bacteria 45221
1575 Ga0501036_0007966 3300049572 Bacteria 8671
1576 Ga0501036_0010321 3300049572 Bacteria 7707
1577 Ga0501036_0017214 3300049572 Bacteria 6041
1578 Ga0501036_0046676 3300049572 Bacteria 3667
1579 Ga0501036_0304204 3300049572 Bacteria 1333
1580 Ga0501037_0006107 3300049573 Bacteria 8799
1581 Ga0501037_0016220 3300049573 Bacteria 5482
1582 Ga0501037_0050588 3300049573 Bacteria 3041
1583 Ga0501037_0093624 3300049573 Bacteria 2172
1584 Ga0501037_0629464 3300049573 Bacteria 718
1585 Ga0501038_0008899 3300049574 Bacteria 9212
1586 Ga0501038_0011859 3300049574 Bacteria 7955
1587 Ga0501038_0029152 3300049574 Bacteria 4894
1588 Ga0501038_0065187 3300049574 Bacteria 3104
1589 Ga0501038_0181013 3300049574 Bacteria 1700
1590 Ga0501038_0410994 3300049574 Bacteria 1045
1591 Ga0501039_0015284 3300049575 Bacteria 5875
1592 Ga0501039_0027179 3300049575 Bacteria 4399
1593 Ga0501039_0095901 3300049575 Bacteria 2312
1594 Ga0501039_0143434 3300049575 Bacteria 1876
1595 Ga0501039_0730034 3300049575 Bacteria 774
1596 Ga0501040_0028569 3300049576 Bacteria 3760
1597 Ga0501040_0092810 3300049576 Bacteria 2099
1598 Ga0501040_0267729 3300049576 Bacteria 1220
1599 Ga0501041_0016820 3300049577 Bacteria 4352
1600 Ga0501041_0020014 3300049577 Bacteria 3997
1601 Ga0501042_0003066 3300049578 Bacteria 10404
1602 Ga0501042_0033230 3300049578 Bacteria 3656
1603 Ga0501042_0034260 3300049578 Bacteria 3601
1604 Ga0501042_0084146 3300049578 Bacteria 2280
1605 Ga0501042_0506112 3300049578 Bacteria 877
1606 Ga0501043_0003227 3300049579 Bacteria 13459
1607 Ga0501043_0005709 3300049579 Bacteria 10024
1608 Ga0501043_0010922 3300049579 Bacteria 7112
1609 Ga0501043_0013418 3300049579 Bacteria 6407
1610 Ga0501043_0165569 3300049579 Bacteria 1726
1611 Ga0501043_0233097 3300049579 Bacteria 1421
1612 Ga0501046_0021502 3300049580 Bacteria 5323
1613 Ga0501046_0046370 3300049580 Bacteria 3449
1614 Ga0501046_0047282 3300049580 Bacteria 3411
1615 Ga0501046_0181215 3300049580 Bacteria 1575
1616 Ga0501047_0000033 3300049581 Bacteria 206961
1617 Ga0501047_0000369 3300049581 Bacteria 50837
1618 Ga0501047_0001481 3300049581 Bacteria 22897
1619 Ga0501047_0029209 3300049581 Bacteria 5317
1620 Ga0501047_0058613 3300049581 Bacteria 3719
1621 Ga0501047_0099451 3300049581 Bacteria 2787
1622 Ga0501047_0127143 3300049581 Bacteria 2429
1623 Ga0501047_0183674 3300049581 Bacteria 1957
1624 Ga0501047_0461742 3300049581 Bacteria 1098
1625 Ga0501048_0003583 3300049582 Bacteria 11820
1626 Ga0501048_0006936 3300049582 Bacteria 8607
1627 Ga0501048_0007884 3300049582 Bacteria 8067
1628 Ga0501048_0033083 3300049582 Bacteria 3736
1629 Ga0501048_0287186 3300049582 Bacteria 1170
1630 Ga0501067_0021266 3300049583 Bacteria 3589
1631 Ga0501067_0339433 3300049583 Bacteria 837
1632 Ga0501068_0013033 3300049584 Bacteria 4726
1633 Ga0501068_0066962 3300049584 Bacteria 2188
1634 Ga0501068_0126056 3300049584 Bacteria 1599
1635 Ga0501068_0388112 3300049584 Bacteria 899
1636 Ga0501069_0010447 3300049585 Bacteria 4913
1637 Ga0501069_0066819 3300049585 Bacteria 2011
1638 Ga0501069_0155485 3300049585 Bacteria 1315
1639 Ga0501070_0005487 3300049586 Bacteria 10819
1640 Ga0501070_0008402 3300049586 Bacteria 8720
1641 Ga0501070_0040771 3300049586 Bacteria 3871
1642 Ga0501070_0749249 3300049586 Bacteria 770
1643 Ga0501071_0000622 3300049587 Bacteria 18372
1644 Ga0501071_0015459 3300049587 Bacteria 5238
1645 Ga0501072_0042082 3300049588 Bacteria 3588
1646 Ga0501072_0097045 3300049588 Bacteria 2342
1647 Ga0501073_0061740 3300049589 Bacteria 2614
1648 Ga0501073_0206183 3300049589 Bacteria 1359
1649 Ga0501073_0306197 3300049589 Bacteria 1096
1650 Ga0501074_0003420 3300049590 Bacteria 11243
1651 Ga0501074_0004389 3300049590 Bacteria 10081
1652 Ga0501074_0012014 3300049590 Bacteria 6293
1653 Ga0501074_0062681 3300049590 Bacteria 2678
1654 Ga0501075_0056288 3300049591 Bacteria 2960
1655 Ga0501075_0234055 3300049591 Bacteria 1401
1656 Ga0501076_0002267 3300049592 Bacteria 13155
1657 Ga0501076_0096796 3300049592 Bacteria 2377
1658 Ga0501077_0048562 3300049593 Bacteria 2697
1659 Ga0501077_0067104 3300049593 Bacteria 2275
1660 Ga0501079_0016047 3300049741 Bacteria 5722
1661 Ga0501079_0103124 3300049741 Bacteria 2212
1662 Ga0501080_0032359 3300049742 Bacteria 4877
1663 Ga0501080_0057577 3300049742 Bacteria 3618
1664 Ga0501080_0064310 3300049742 Bacteria 3413
1665 Ga0501081_0036447 3300049743 Bacteria 3354
1666 Ga0501083_0001270 3300049744 Bacteria 17091
1667 Ga0501083_0151204 3300049744 Bacteria 1520
1668 Ga0501270_033114 3300049767 Bacteria 864
1669 Ga0501035_0050911 3300049822 Bacteria 3709
1670 Ga0501035_0151202 3300049822 Bacteria 2014
1671 Ga0501035_0171437 3300049822 Bacteria 1874
1672 Ga0501044_0003451 3300049823 Bacteria 17804
1673 Ga0501044_0014764 3300049823 Bacteria 8420
1674 Ga0501044_0032181 3300049823 Bacteria 5513
1675 Ga0501044_0042581 3300049823 Bacteria 4721
1676 Ga0501044_0043290 3300049823 Bacteria 4678
1677 Ga0501044_0117041 3300049823 Bacteria 2669
1678 Ga0501044_0168139 3300049823 Bacteria 2165
1679 Ga0501044_0292757 3300049823 Bacteria 1559
1680 Ga0501044_0677524 3300049823 Bacteria 918
1681 Ga0501045_0000424 3300049824 Bacteria 25806
1682 Ga0501045_0037402 3300049824 Bacteria 3527
1683 Ga0501045_0057284 3300049824 Bacteria 2852
1684 nmdc:mga03n38_7371_c1 3300050490 Bacteria 3889
1685 nmdc:mga0yw44_510969_c1 3300050492 Bacteria 815
1686 nmdc:mga05p37_145975_c1 3300050507 Bacteria 2897
1687 nmdc:mga05p37_37397_c1 3300050507 Bacteria 5951
1688 nmdc:mga06r32_521174_c1 3300050510 Bacteria 1164
1689 nmdc:mga08y16_127471_c1 3300050511 Bacteria 2647
1690 nmdc:mga08y16_198046_c1 3300050511 Bacteria 2082
1691 nmdc:mga0n895_21840_c1 3300050512 Bacteria 5992
1692 nmdc:mga0n895_23116_c1 3300050512 Bacteria 5839
1693 nmdc:mga0n895_261667_c1 3300050512 Bacteria 1756
1694 nmdc:mga0n895_303043_c1 3300050512 Bacteria 1620
1695 nmdc:mga0rr50_67504_c1 3300050513 Bacteria 2717
1696 nmdc:mga0rr50_93982_c1 3300050513 Bacteria 2341
1697 nmdc:mga08x19_12213_c1 3300050514 Bacteria 5170
1698 nmdc:mga08x19_135827_c1 3300050514 Bacteria 1658
1699 nmdc:mga08x19_19788_c1 3300050514 Bacteria 4137
1700 nmdc:mga08x19_253060_c1 3300050514 Bacteria 1216
1701 nmdc:mga0a205_12233_c1 3300050515 Bacteria 7935
1702 nmdc:mga0a205_152994_c1 3300050515 Bacteria 2205
1703 nmdc:mga0a205_18672_c1 3300050515 Bacteria 6525
1704 Ga0495601_0029968 3300053077 Bacteria 3378
1705 Ga0495601_0035862 3300053077 Bacteria 3097
1706 Ga0495601_0102025 3300053077 Bacteria 1854
1707 Ga0495601_0180603 3300053077 Bacteria 1380
1708 Ga0495601_0195085 3300053077 Bacteria 1323
1709 Ga0495601_0291558 3300053077 Bacteria 1063
1710 Ga0495601_0361339 3300053077 Bacteria 943
1711 Ga0495612_0015838 3300053078 Bacteria 3022
1712 Ga0495612_0023246 3300053078 Bacteria 2486
1713 Ga0495612_0031195 3300053078 Bacteria 2148
1714 Ga0495612_0048953 3300053078 Bacteria 1733
1715 Ga0495612_0116533 3300053078 Bacteria 1147
1716 Ga0495612_0169220 3300053078 Bacteria 956
1717 Ga0495612_0172639 3300053078 Bacteria 947
1718 Ga0495655_0004208 3300053083 Bacteria 2442
1719 Ga0495655_0048185 3300053083 Bacteria 1117
1720 Ga0495595_0004203 3300053084 Bacteria 5792
1721 Ga0495595_0010359 3300053084 Bacteria 3873
1722 Ga0495595_0027343 3300053084 Bacteria 2541
1723 Ga0495619_0005533 3300053085 Bacteria 8016
1724 Ga0495619_0055462 3300053085 Bacteria 2624
1725 Ga0495619_0062929 3300053085 Bacteria 2471
1726 Ga0495619_0095675 3300053085 Bacteria 2015
1727 Ga0495619_0111525 3300053085 Bacteria 1869
1728 Ga0495619_0137360 3300053085 Bacteria 1682
1729 Ga0500578_0102675 3300053086 Bacteria 1808
1730 Ga0500583_0160244 3300053092 Bacteria 1121
1731 Ga0500654_149730 3300053099 Bacteria 824
1732 Ga0500558_069221 3300053106 Bacteria 1459
1733 Ga0500560_002512 3300053107 Bacteria 3521
1734 Ga0500652_032895 3300053131 Bacteria 2046
1735 Ga0500658_0174001 3300053134 Bacteria 978
1736 Ga0500568_0003761 3300053139 Bacteria 8309
1737 Ga0500573_0064343 3300053140 Bacteria 2098
1738 Ga0500600_0067524 3300053149 Bacteria 1971
1739 Ga0500616_0001111 3300053153 Bacteria 27803
1740 Ga0500616_0001619 3300053153 Bacteria 20932
1741 Ga0500616_0102913 3300053153 Bacteria 1392
1742 Ga0500624_003031 3300053157 Bacteria 2220
1743 Ga0500634_0186514 3300053161 Bacteria 927
1744 Ga0500656_018751 3300053732 Bacteria 839
1745 Ga0501084_0032890 3300054114 Bacteria 4339
1746 Ga0501084_0041617 3300054114 Bacteria 3843
1747 Ga0501084_1116875 3300054114 Bacteria 662
1748 Ga0501082_0062906 3300060353 Bacteria 3195
1749 Ga0501082_0077792 3300060353 Bacteria 2860
1750 Ga0466962_0015486 3300061719 Bacteria 3677
1751 Ga0466962_0017787 3300061719 Bacteria 3421
1752 Ga0466962_0036829 3300061719 Bacteria 2342
1753 Ga0466962_0036934 3300061719 Bacteria 2338
1754 Ga0466962_0058723 3300061719 Bacteria 1836
1755 Ga0466962_0063712 3300061719 Bacteria 1760
1756 Ga0466962_0198539 3300061719 Bacteria 980
1757 Ga0530510_0020733 3300061734 Bacteria 4675
1758 Ga0530510_0052918 3300061734 Bacteria 2933
1759 2506868635 2506783011 Bacteria 5323186
1760 2528204225 2527291627 Bacteria 5309833
1761 2528214638 2527291629 Bacteria 5267418
1762 2546947015 2546825537 Bacteria 5389291
1763 2547408247 2547132111 Bacteria 8013147
1764 2554257211 2554235005 Bacteria 6457341
1765 2579747476 2576861822 Bacteria 5004595
1766 2579854487 2579778521 Bacteria 7624758
1767 2585299269 2582581312 Bacteria 7308206
1768 2585308921 2582581313 Bacteria 10042643
1769 2585313613 2582581314 Bacteria 11452267
1770 2616694936 2616644814 Bacteria 11555299
1771 2616904593 2616644941 Bacteria 8510691
1772 2619853873 2619618881 Bacteria 7521104
1773 2620349444 2619619003 Bacteria 7619552
1774 2623497760 2622736605 Bacteria 4992138
1775 2626634784 2626541554 Bacteria 7741902
1776 2643765071 2643221548 Bacteria 8053412
1777 2643768460 2643221549 Bacteria 4042819
1778 2643852315 2643221567 Bacteria 4163945
1779 2643899160 2643221578 Bacteria 9213798
1780 2643942410 2643221587 Bacteria 7586415
1781 2644111838 2643221619 Bacteria 4158469
1782 2644136837 2643221624 Bacteria 4384879
1783 2644182548 2643221632 Bacteria 3406696
1784 2644262424 2643221647 Bacteria 10741251
1785 2644390034 2643221670 Bacteria 6497041
1786 2644403343 2643221673 Bacteria 9196637
1787 2644429491 2643221677 Bacteria 7584031
1788 2644437260 2643221678 Bacteria 9540101
1789 2644446901 2643221679 Bacteria 3839507
1790 2644461090 2643221682 Bacteria 6743283
1791 2644607748 2643221711 Bacteria 4865335
1792 2644628998 2643221714 Bacteria 9015452
1793 2686543471 2684623036 Bacteria 5199090
1794 2731905894 2731639228 Bacteria 4187555
1795 2768643471 2767802112 Bacteria 6465194
1796 2774867137 2773857924 Bacteria 5256821
1797 2774905405 2773857933 Bacteria 5818019
1798 2784473081 2784132109 Bacteria 3141763
1799 2784588713 2784132148 Bacteria 8627943
1800 2785343161 2784746763 Bacteria 9783172
1801 2785369642 2784746768 Bacteria 10036182
1802 2786670728 2786546132 Bacteria 10419719
1803 2793978334 2791355406 Bacteria 11364898
1804 2799185849 2799112218 Bacteria 4315149
1805 2804846760 2802429296 Bacteria 7227771
1806 2808842163 2808606359 Bacteria 9866990
1807 2808871871 2808606365 Bacteria 4301966
1808 2808920696 2808606375 Bacteria 9466072
1809 2809232323 2808606448 Bacteria 8656184
1810 2810363084 2808606700 Bacteria 3482157
1811 2811849168 2808606982 Bacteria 7791042
1812 2812357965 2811994879 Bacteria 9313447
1813 2812373249 2811994882 Bacteria 4688362
1814 2812480415 2811994917 Bacteria 7761064
1815 2817509797 2816332305 Bacteria 2697803
1816 2819426049 2818991318 Bacteria 5266538
1817 2819665107 2818991458 Bacteria 4794049
1818 2819692822 2818991462 Bacteria 4320267
1819 2819695531 2818991463 Bacteria 7948711
1820 2819727221 2818991469 Bacteria 4644110
1821 2852636533 2852635781 Bacteria 8251373
1822 2856742975 2856741275 Bacteria 8096094
1823 2862179355 2862178590 Bacteria 8583590
1824 2862285778 2862281513 Bacteria 9621493
1825 2862297060 2862290372 Bacteria 7471434
1826 2862392144 2862382967 Bacteria 10317375
1827 2862511694 2862507626 Bacteria 9425308
1828 2862579128 2862574272 Bacteria 10567477
1829 2862706478 2862705112 Bacteria 6563286
1830 2863404461 2863404153 Bacteria 9672205
1831 2867348931 2867346516 Bacteria 7608576
1832 2867371996 2867369537 Bacteria 6501581
1833 2867432461 2867428634 Bacteria 9590268
1834 2867478816 2867475112 Bacteria 6909112
1835 2873155610 2873151551 Bacteria 8625867
1836 2873314482 2873314349 Bacteria 8512634
1837 2875395565 2875391855 Bacteria 7600475
1838 2877680984 2877676314 Bacteria 9512378
1839 2891401193 2891395885 Bacteria 9251614
1840 2891560109 2891554331 Bacteria 8812224
1841 2891563541 2891562705 Bacteria 8039471
1842 2893686216 2893684298 Bacteria 2897960
1843 2905930823 2905926851 Bacteria 4423176
1844 2912719829 2912715099 Bacteria 9460473
1845 2912724225 2912723979 Bacteria 8557534
1846 2912760902 2912757875 Bacteria 7940295
1847 2918505451 2918501144 Bacteria 8668083
1848 2919448242 2919446982 Bacteria 3994487
1849 2919469412 2919468124 Bacteria 9133025
1850 2935393297 2935390628 Bacteria 7043367
1851 2946006964 2946003308 Bacteria 3857229
1852 2946049874 2946045630 Bacteria 8527308
1853 2946067878 2946064051 Bacteria 8957905
1854 2946076017 2946072368 Bacteria 8999607
1855 2947229069 2947224130 Bacteria 9938529
1856 2954007256 2954002825 Bacteria 9173742
1857 2954386094 2954380949 Bacteria 10050426
1858 2954677053 2954673503 Bacteria 9685905
1859 2954687103 2954682443 Bacteria 9862841
1860 2954696734 2954691527 Bacteria 10720516
1861 2954705404 2954701450 Bacteria 10834262
1862 2954716115 2954711539 Bacteria 10867210
1863 2954726058 2954721474 Bacteria 10456478
1864 2954735752 2954731030 Bacteria 10243860
1865 2954744984 2954740390 Bacteria 10229294
1866 2954754607 2954749733 Bacteria 10366972
1867 2954763956 2954759201 Bacteria 9358192
1868 2964328590 2964326757 Bacteria 3290868
1869 2966601770 2966598605 Bacteria 7676064
1870 2966927025 2966924647 Bacteria 3268643
1871 2990045326 2990044586 Bacteria 6603797
1872 2990063211 2990059506 Bacteria 9321252
1873 2990088366 2990088156 Bacteria 6657676
1874 2997457727 2997451912 Bacteria 8492419
1875 2997600299 2997600082 Bacteria 9896405
1876 3003004922 3002998708 Bacteria 11715108
1877 3006325195 3006321560 Bacteria 8247479
1878 3006394459 3006393351 Bacteria 6615579
1879 3006428808 3006425503 Bacteria 6491253
1880 3006490861 3006486233 Bacteria 8157040
1881 3006500871 3006493962 Bacteria 8825450
1882 637877802 637000116 Bacteria 5433628
1883 8008490301 8008485437 Bacteria 7198341
1884 8008567119 8008558824 Bacteria 10610750
1885 8008578779 8008574985 Bacteria 7815457
1886 8023627098 8023623736 Bacteria 8593882
1887 8025482475 8025478263 Bacteria 8209203
1888 8025529603 8025524527 Bacteria 7197316
1889 8025537899 8025530807 Bacteria 8495698
1890 8033690855 8033684223 Bacteria 6906479
1891 8047897968 8047893842 Bacteria 11723082
1892 8048133048 8048127548 Bacteria 11053136
1893 8048360926 8048356638 Bacteria 11044339
1894 8048374931 8048369669 Bacteria 11666822
1895 8048383274 8048379754 Bacteria 11877923
1896 8048413926 8048406513 Bacteria 8936924
1897 8053952145 8053945823 Bacteria 8962862
1898 8054161755 8054160619 Bacteria 7783213
1899 8054917380 8054913762 Bacteria 7713009
1900 8054921994 8054920844 Bacteria 7068637
1901 8055072721 8055066027 Bacteria 9479577
1902 8055160494 8055157932 Bacteria 6429399
1903 8055175942 8055172936 Bacteria 9305943
1904 8056062084 8056060235 Bacteria 7259403
1905 8056450884 8056447290 Bacteria 7680491
1906 8056671245 8056667051 Bacteria 6953971
1907 8056833498 8056829672 Bacteria 9045328
1908 Ga0495628_0161075
1909 JGI24735J21928_10011146
1910 JGI24738J21930_10011186
1911 JGI25153J46596_10032512
1912 rootH1_10002967
1913 JGI25160J50197_1016566
1914 Ga0006562J51391_1011721
1915 Ga0006562J51391_1011722
1916 Ga0006562J51391_1056397
1917 Ga0006562J51391_1071703
1918 Ga0006562J51391_1071704
1919 Ga0065714_10006949
1920 Ga0070658_10001387
1921 Ga0070658_10184078
1922 Ga0070658_10250538
1923 Ga0070676_10072473
1924 Ga0070683_100166867
1925 Ga0070683_100348384
1926 Ga0068869_100036149
1927 Ga0068869_100364963
1928 Ga0070666_10007558
1929 Ga0070666_10061196
1930 Ga0070666_10136575
1931 Ga0070680_100013093
1932 Ga0070680_100035119
1933 Ga0070680_100337751
1934 Ga0070682_100005056
1935 Ga0068868_100067018
1936 Ga0070660_100038049
1937 Ga0070660_100084706
1938 Ga0070660_100559084
1939 Ga0070689_100028136
1940 Ga0070691_10014121
1941 Ga0070691_10017039
1942 Ga0070661_100228940
1943 Ga0070661_100560851
1944 Ga0070692_10021193
1945 Ga0070692_10170923
1946 Ga0070668_100022918
1947 Ga0070668_100046575
1948 Ga0070668_100067218
1949 Ga0070675_100221788
1950 Ga0070675_100300602
1951 Ga0070671_100014896
1952 Ga0070671_100132739
1953 Ga0070674_100201836
1954 Ga0070674_100228758
1955 Ga0070673_100059069
1956 Ga0070673_100066970
1957 Ga0070673_100274444
1958 Ga0070688_100080165
1959 Ga0070659_100051008
1960 Ga0070667_100018998
1961 Ga0070667_100349927
1962 Ga0070703_10017010
1963 Ga0070709_10000220
1964 Ga0070709_10003796
1965 Ga0070709_10026469
1966 Ga0070709_10093584
1967 Ga0070714_100000010
1968 Ga0070714_100001618
1969 Ga0070714_100012670
1970 Ga0070714_100044829
1971 Ga0070714_100053229
1972 Ga0070714_100070235
1973 Ga0070714_100077141
1974 Ga0070714_100136718
1975 Ga0070714_100325816
1976 Ga0070714_100489764
1977 Ga0070714_100805068
1978 Ga0070713_100002276
1979 Ga0070713_100033632
1980 Ga0070713_100040074
1981 Ga0070713_100059945
1982 Ga0070713_100124310
1983 Ga0070713_100154448
1984 Ga0070713_100234602
1985 Ga0070713_100263889
1986 Ga0070710_10000122
1987 Ga0070710_10002549
1988 Ga0070710_10005500
1989 Ga0070710_10024969
1990 Ga0070710_10041832
1991 Ga0070710_10071555
1992 Ga0070710_10117994
1993 Ga0070711_100000421
1994 Ga0070711_100023470
1995 Ga0070711_100052212
1996 Ga0070711_100426264
1997 Ga0070711_100484054
1998 Ga0070711_100682168
1999 Ga0070705_100003344
2000 Ga0070700_100000064
2001 Ga0070694_100173076
2002 Ga0070708_100026861
2003 Ga0070708_100043452
2004 Ga0070708_100104614
2005 Ga0070708_100132463
2006 Ga0070708_100364242
2007 Ga0070708_100366596
2008 Ga0070708_101081058
2009 Ga0070663_100063514
2010 Ga0070663_100155171
2011 Ga0070678_100010423
2012 Ga0070678_100030918
2013 Ga0070678_100139558
2014 Ga0070681_10014130
2015 Ga0070681_10318200
2016 Ga0070681_10396346
2017 Ga0068867_100151666
2018 Ga0068867_100702227
2019 Ga0070685_10173891
2020 Ga0070685_10215640
2021 Ga0070706_100004020
2022 Ga0070706_100005122
2023 Ga0070706_100005997
2024 Ga0070706_100008150
2025 Ga0070706_100009991
2026 Ga0070706_100021245
2027 Ga0070706_100026563
2028 Ga0070706_100064829
2029 Ga0070706_100106943
2030 Ga0070706_100125381
2031 Ga0070706_100276953
2032 Ga0070707_100000293
2033 Ga0070707_100003142
2034 Ga0070707_100005742
2035 Ga0070707_100015007
2036 Ga0070707_100021756
2037 Ga0070707_100029552
2038 Ga0070707_100058063
2039 Ga0070707_100090007
2040 Ga0070698_100000106
2041 Ga0070698_100000546
2042 Ga0070698_100004555
2043 Ga0070698_100007047
2044 Ga0070698_100014280
2045 Ga0070698_100018347
2046 Ga0070698_100019863
2047 Ga0070698_100046444
2048 Ga0070698_100070830
2049 Ga0070698_100079441
2050 Ga0070698_100206013
2051 Ga0070699_100000577
2052 Ga0070699_100459552
2053 Ga0070679_100084639
2054 Ga0070679_100093574
2055 Ga0070684_100013575
2056 Ga0070684_100604614
2057 Ga0070684_100621911
2058 Ga0070697_100029422
2059 Ga0070697_100069331
2060 Ga0070697_100357258
2061 Ga0068853_100073071
2062 Ga0068853_100275373
2063 Ga0070672_100075534
2064 Ga0070672_100143140
2065 Ga0070686_100026601
2066 Ga0070686_100035430
2067 Ga0070695_100059329
2068 Ga0070695_100341141
2069 Ga0070696_100097078
2070 Ga0070696_100187297
2071 Ga0070693_100035744
2072 Ga0070665_100000401
2073 Ga0070665_100032363
2074 Ga0070665_100087185
2075 Ga0070665_100141565
2076 Ga0068855_100050361
2077 Ga0068855_100077738
2078 Ga0070664_100078425
2079 Ga0070664_100422789
2080 Ga0068857_100138478
2081 Ga0068857_100153423
2082 Ga0068857_100319118
2083 Ga0068854_100020711
2084 Ga0068854_100270222
2085 Ga0068854_100560443
2086 Ga0068856_100015966
2087 Ga0068856_100025089
2088 Ga0068856_100035500
2089 Ga0068856_100042199
2090 Ga0068856_100268510
2091 Ga0068856_100749395
2092 Ga0070702_100014799
2093 Ga0070702_100022796
2094 Ga0070702_100291093
2095 Ga0068852_100022811
2096 Ga0068852_100050239
2097 Ga0068852_100148003
2098 Ga0068852_100203210
2099 Ga0068852_100212067
2100 Ga0068852_100395840
2101 Ga0068859_100099277
2102 Ga0068859_100145116
2103 Ga0068859_100575966
2104 Ga0068864_100006862
2105 Ga0068864_100064036
2106 Ga0068864_100193491
2107 Ga0068861_100337992
2108 Ga0068870_10118853
2109 Ga0068870_10266306
2110 Ga0068863_100001365
2111 Ga0068863_100043562
2112 Ga0068863_100055890
2113 Ga0068863_100080467
2114 Ga0068863_100306575
2115 Ga0068858_100000732
2116 Ga0068858_100027030
2117 Ga0068858_100059448
2118 Ga0068858_100382570
2119 Ga0068860_100000114
2120 Ga0068860_100038551
2121 Ga0068860_100054813
2122 Ga0068860_100254576
2123 Ga0068862_100077659
2124 Ga0068862_100220064
2125 Ga0081455_10000575
2126 Ga0081455_10020190
2127 Ga0081455_10167176
2128 Ga0081455_10540228
2129 Ga0081540_1000171
2130 Ga0081540_1001613
2131 Ga0081540_1038105
2132 Ga0081540_1042201
2133 Ga0081539_10001059
2134 Ga0070717_10022210
2135 Ga0070717_10028429
2136 Ga0070717_10045339
2137 Ga0070717_10067916
2138 Ga0070717_10115085
2139 Ga0070717_10115967
2140 Ga0070717_10355399
2141 Ga0075365_10281722
2142 Ga0075365_10498273
2143 Ga0075368_10265944
2144 Ga0075363_100007574
2145 Ga0070715_10001293
2146 Ga0070715_10130593
2147 Ga0070715_10254649
2148 Ga0070716_100003270
2149 Ga0070716_100027653
2150 Ga0070712_100005041
2151 Ga0070712_100005233
2152 Ga0070712_100021380
2153 Ga0070712_100088909
2154 Ga0070712_100110354
2155 Ga0070712_100571470
2156 Ga0070712_100717585
2157 Ga0097621_100024496
2158 Ga0097621_100117863
2159 Ga0075370_10103451
2160 Ga0068871_100036095
2161 Ga0068871_100704884
2162 Ga0075428_100042278
2163 Ga0075428_100366688
2164 Ga0075431_100146985
2165 Ga0075433_10010525
2166 Ga0075433_10052150
2167 Ga0075433_10198443
2168 Ga0075434_100019525
2169 Ga0075434_100023481
2170 Ga0075434_100061569
2171 Ga0075434_100394683
2172 Ga0068865_100468726
2173 Ga0075436_100011256
2174 Ga0075436_100095199
2175 Ga0075436_100204030
2176 Ga0075436_100215724
2177 Ga0097620_100099277
2178 Ga0097620_100145123
2179 Ga0097620_100575958
2180 Ga0075435_100061791
2181 Ga0075435_100310246
2182 Ga0105251_10008325
2183 Ga0105251_10009100
2184 Ga0105251_10030150
2185 Ga0105244_10201807
2186 Ga0105250_10016018
2187 Ga0105240_10058787
2188 Ga0105240_10085449
2189 Ga0105240_10088061
2190 Ga0111539_10015815
2191 Ga0111539_10143921
2192 Ga0105245_10008898
2193 Ga0105245_10090979
2194 Ga0105245_10104042
2195 Ga0105245_10360280
2196 Ga0105245_10373998
2197 Ga0105247_10000038
2198 Ga0105247_10003476
2199 Ga0105247_10030438
2200 Ga0105247_10186374
2201 Ga0114129_10011093
2202 Ga0114129_10093489
2203 Ga0105243_10007184
2204 Ga0105243_10013663
2205 Ga0105243_10021441
2206 Ga0105243_10037350
2207 Ga0105243_10126903
2208 Ga0105243_10470862
2209 Ga0105241_10021949
2210 Ga0105241_10026480
2211 Ga0105241_10026744
2212 Ga0105242_10040426
2213 Ga0105242_10055746
2214 Ga0105242_10172795
2215 Ga0105248_10004635
2216 Ga0105248_10150351
2217 Ga0105248_10299483
2218 Ga0105248_10785059
2219 Ga0105237_10095315
2220 Ga0105237_10201033
2221 Ga0105237_10797605
2222 Ga0105238_10009629
2223 Ga0105238_10089976
2224 Ga0105238_10107688
2225 Ga0105238_10603642
2226 Ga0105249_10011339
2227 Ga0105249_10059762
2228 Ga0105249_10109889
2229 Ga0105249_10460205
2230 Ga0105249_10523618
2231 Ga0105249_10523642
2232 Ga0105239_10031946
2233 Ga0105239_10088101
2234 Ga0105239_10191487
2235 Ga0105239_10537759
2236 Ga0105239_10624742
2237 Ga0105239_10770420
2238 Ga0105246_10029622
2239 Ga0105246_10034148
2240 Ga0105246_10046747
2241 Ga0105246_10066977
2242 Ga0157345_1003149
2243 Ga0157373_10137647
2244 Ga0157371_10317202
2245 Ga0157370_10070210
2246 Ga0157370_10130425
2247 Ga0157370_10337002
2248 Ga0157370_10608524
2249 Ga0157369_10007003
2250 Ga0157369_10007588
2251 Ga0157369_10071651
2252 Ga0157369_10135443
2253 Ga0157369_10483585
2254 Ga0157374_10022784
2255 Ga0157374_10229451
2256 Ga0157374_10266988
2257 Ga0157374_10801467
2258 Ga0157378_10284544
2259 Ga0163162_10127024
2260 Ga0163162_10217095
2261 Ga0163162_10255261
2262 Ga0163162_10400351
2263 Ga0163162_10793150
2264 Ga0157372_10000658
2265 Ga0157372_10084295
2266 Ga0157372_10158826
2267 Ga0157375_10026112
2268 Ga0157375_10306208
2269 Ga0157375_10381066
2270 Ga0157375_10421579
2271 Ga0157375_10544018
2272 Ga0157375_11064287
2273 Ga0163163_10021634
2274 Ga0163163_10022975
2275 Ga0163163_10058181
2276 Ga0163163_10061951
2277 Ga0157380_10019875
2278 Ga0157380_10051491
2279 Ga0157380_10091361
2280 Ga0182008_10001457
2281 Ga0157377_10061621
2282 Ga0157377_10094225
2283 Ga0157379_10085479
2284 Ga0157379_10115944
2285 Ga0157379_10140904
2286 Ga0157376_10253081
2287 Ga0157376_10306358
2288 Ga0182007_10011898
2289 Ga0183367_1005
2290 Ga0163161_10102864
2291 Ga0163161_10192161
2292 Ga0163161_10334050
2293 Ga0197907_11486011
2294 Ga0206356_10464819
2295 Ga0206355_1573660
2296 Ga0206354_10632267
2297 Ga0206353_10972019
2298 Ga0206353_11335110
2299 Ga0213874_10059141
2300 Ga0213875_10000537
2301 Ga0213875_10001614
2302 Ga0213875_10016464
2303 Ga0213875_10024228
2304 Ga0213875_10299394
2305 Ga0224712_10004812
2306 Ga0224712_10012350
2307 Ga0224712_10016046
2308 Ga0224712_10050508
2309 Ga0224712_10122252
2310 Ga0224712_10138911
2311 Ga0209758_1005482
2312 Ga0207426_1004843
2313 Ga0207426_1008083
2314 Ga0207426_1010813
2315 Ga0207426_1048669
2316 Ga0207696_1048405
2317 Ga0207713_1005803
2318 Ga0207653_10009551
2319 Ga0207692_10002006
2320 Ga0207692_10012366
2321 Ga0207692_10015787
2322 Ga0207692_10026337
2323 Ga0207692_10056251
2324 Ga0207692_10118251
2325 Ga0207710_10000054
2326 Ga0207710_10000199
2327 Ga0207710_10009019
2328 Ga0207688_10013036
2329 Ga0207688_10022652
2330 Ga0207680_10024029
2331 Ga0207680_10121741
2332 Ga0207647_10013191
2333 Ga0207647_10027943
2334 Ga0207647_10052960
2335 Ga0207685_10008336
2336 Ga0207685_10021703
2337 Ga0207699_10000684
2338 Ga0207699_10002656
2339 Ga0207699_10005707
2340 Ga0207699_10014662
2341 Ga0207699_10014727
2342 Ga0207699_10037612
2343 Ga0207699_10337033
2344 Ga0207645_10051702
2345 Ga0207643_10022418
2346 Ga0207643_10166592
2347 Ga0207705_10000573
2348 Ga0207684_10000571
2349 Ga0207684_10001806
2350 Ga0207684_10014224
2351 Ga0207684_10019030
2352 Ga0207684_10025959
2353 Ga0207684_10061832
2354 Ga0207684_10066992
2355 Ga0207684_10073685
2356 Ga0207684_10144332
2357 Ga0207684_10236281
2358 Ga0207684_10282490
2359 Ga0207654_10024354
2360 Ga0207654_10036321
2361 Ga0207654_10534008
2362 Ga0207707_10003446
2363 Ga0207707_10258377
2364 Ga0207695_10008627
2365 Ga0207695_10195826
2366 Ga0207695_10236258
2367 Ga0207695_10380506
2368 Ga0207671_10000188
2369 Ga0207671_10047172
2370 Ga0207671_10074718
2371 Ga0207693_10003796
2372 Ga0207693_10006369
2373 Ga0207693_10007211
2374 Ga0207693_10010872
2375 Ga0207693_10018090
2376 Ga0207693_10055665
2377 Ga0207693_10240941
2378 Ga0207693_10599488
2379 Ga0207663_10001400
2380 Ga0207663_10003417
2381 Ga0207663_10016411
2382 Ga0207663_10022703
2383 Ga0207663_10034580
2384 Ga0207663_10056942
2385 Ga0207663_10129919
2386 Ga0207663_10494520
2387 Ga0207660_10237112
2388 Ga0207660_10304771
2389 Ga0207660_10380767
2390 Ga0207662_10008460
2391 Ga0207662_10083704
2392 Ga0207657_10004980
2393 Ga0207657_10028697
2394 Ga0207657_10037201
2395 Ga0207652_10031799
2396 Ga0207652_10078417
2397 Ga0207652_10236479
2398 Ga0207646_10000050
2399 Ga0207646_10001770
2400 Ga0207646_10002450
2401 Ga0207646_10009108
2402 Ga0207646_10011667
2403 Ga0207646_10123924
2404 Ga0207694_10004684
2405 Ga0207694_10127303
2406 Ga0207694_10369184
2407 Ga0207650_10356812
2408 Ga0207659_10279814
2409 Ga0207687_10017480
2410 Ga0207687_10076551
2411 Ga0207687_10106279
2412 Ga0207687_10118225
2413 Ga0207687_10264640
2414 Ga0207687_10346363
2415 Ga0207700_10001148
2416 Ga0207700_10011993
2417 Ga0207700_10041144
2418 Ga0207700_10046488
2419 Ga0207700_10060814
2420 Ga0207700_10077499
2421 Ga0207700_10078444
2422 Ga0207700_10089443
2423 Ga0207700_10188450
2424 Ga0207700_10529867
2425 Ga0207664_10000009
2426 Ga0207664_10000298
2427 Ga0207664_10003123
2428 Ga0207664_10004567
2429 Ga0207664_10006510
2430 Ga0207664_10012203
2431 Ga0207664_10016910
2432 Ga0207664_10028591
2433 Ga0207664_10033127
2434 Ga0207664_10067915
2435 Ga0207664_10193522
2436 Ga0207664_10194744
2437 Ga0207664_10265488
2438 Ga0207664_10672954
2439 Ga0207644_10376549
2440 Ga0207690_10715941
2441 Ga0207706_10020091
2442 Ga0207686_10118300
2443 Ga0207709_10047213
2444 Ga0207709_10066719
2445 Ga0207670_10010705
2446 Ga0207670_10459137
2447 Ga0207669_10178475
2448 Ga0207669_10191156
2449 Ga0207704_10219204
2450 Ga0207665_10001293
2451 Ga0207665_10006161
2452 Ga0207665_10007145
2453 Ga0207665_10009393
2454 Ga0207665_10009599
2455 Ga0207665_10022631
2456 Ga0207665_10027491
2457 Ga0207665_10422739
2458 Ga0207691_10018488
2459 Ga0207691_10220118
2460 Ga0207711_10038262
2461 Ga0207711_10069180
2462 Ga0207711_10143807
2463 Ga0207711_10474577
2464 Ga0207689_10011071
2465 Ga0207689_10116096
2466 Ga0207689_10886559
2467 Ga0207661_10044710
2468 Ga0207661_10295793
2469 Ga0207661_10761574
2470 Ga0207679_10088282
2471 Ga0207667_10034292
2472 Ga0207667_10067860
2473 Ga0207667_10114334
2474 Ga0207667_10338389
2475 Ga0207667_10664637
2476 Ga0207667_10692040
2477 Ga0207667_10740105
2478 Ga0207651_10126687
2479 Ga0207651_10298946
2480 Ga0207712_10056414
2481 Ga0207712_10164450
2482 Ga0207668_10024607
2483 Ga0207668_10130099
2484 Ga0207668_10328361
2485 Ga0207640_10031406
2486 Ga0207640_10560147
2487 Ga0207658_10042016
2488 Ga0207677_10038407
2489 Ga0207677_10405190
2490 Ga0207677_10900324
2491 Ga0207703_10000047
2492 Ga0207703_10033367
2493 Ga0207639_10019625
2494 Ga0207639_10055105
2495 Ga0207639_10087274
2496 Ga0207678_10006256
2497 Ga0207678_10007661
2498 Ga0207678_10016809
2499 Ga0207678_10032239
2500 Ga0207678_10327538
2501 Ga0207708_10000076
2502 Ga0207708_10453641
2503 Ga0207702_10018387
2504 Ga0207702_10211140
2505 Ga0207702_10230973
2506 Ga0207702_10357366
2507 Ga0207702_10655929
2508 Ga0207702_10659437
2509 Ga0207702_10866727
2510 Ga0207641_10043271
2511 Ga0207641_10315816
2512 Ga0207676_10071926
2513 Ga0207676_10112106
2514 Ga0207674_10105018
2515 Ga0207674_10161644
2516 Ga0207674_10190137
2517 Ga0207674_10470158
2518 Ga0207674_10672536
2519 Ga0207675_100036213
2520 Ga0207675_100083772
2521 Ga0207683_10008027
2522 Ga0207683_10010511
2523 Ga0207683_10019796
2524 Ga0207683_10118006
2525 Ga0207683_10591025
2526 Ga0207683_10785520
2527 Ga0207698_10014788
2528 Ga0207698_10070428
2529 Ga0207698_10215039
2530 Ga0207698_10299760
2531 Ga0207698_10464844
2532 Ga0209371_1036492
2533 Ga0209179_1013955
2534 Ga0209282_1104653
2535 Ga0207428_10109901
2536 Ga0265357_1000648
2537 Ga0268266_10003295
2538 Ga0268266_10113916
2539 Ga0268266_10318640
2540 Ga0268266_10543717
2541 Ga0268265_10482871
2542 Ga0268264_10000147
2543 Ga0268264_10024763
2544 Ga0268264_10472530
2545 Ga0265337_1010294
2546 Ga0265326_10016736
2547 Ga0265319_1002778
2548 Ga0265334_10001473
2549 Ga0265334_10010969
2550 Ga0265318_10013803
2551 Ga0265323_10007434
2552 Ga0265322_10128498
2553 Ga0265336_10009823
2554 Ga0307517_10010734
2555 Ga0307517_10016489
2556 Ga0307515_10003702
2557 Ga0307515_10043028
2558 Ga0307515_10078912
2559 Ga0307515_10113925
2560 Ga0307515_10346082
2561 Ga0307515_10355630
2562 Ga0307515_10421519
2563 Ga0265338_10000125
2564 Ga0265338_10001588
2565 Ga0265338_10003580
2566 Ga0265338_10012554
2567 Ga0265324_10005383
2568 Ga0268256_1030226
2569 Ga0307511_10001286
2570 Ga0307511_10056779
2571 Ga0307512_10001726
2572 Ga0307512_10006664
2573 Ga0265766_1003975
2574 Ga0265332_10059749
2575 Ga0265320_10007329
2576 Ga0265325_10018697
2577 Ga0265340_10000127
2578 Ga0265340_10047965
2579 Ga0265339_10036771
2580 Ga0265316_10374245
2581 Ga0307513_10003878
2582 Ga0307513_10069197
2583 Ga0307509_10079436
2584 Ga0307509_10114455
2585 Ga0307508_10008805
2586 Ga0307508_10063253
2587 Ga0307508_10075915
2588 Ga0307514_10011203
2589 Ga0307514_10074227
2590 Ga0307514_10153866
2591 Ga0307514_10236484
2592 Ga0316579_10000077
2593 Ga0316579_10007071
2594 Ga0316579_10032470
2595 Ga0265314_10010681
2596 Ga0265342_10013026
2597 Ga0316576_10038983
2598 Ga0316576_10168165
2599 Ga0316576_10258203
2600 Ga0316578_10037179
2601 Ga0307516_10053784
2602 Ga0307516_10085042
2603 Ga0307516_10212121
2604 Ga0316577_10051727
2605 Ga0307410_10062443
2606 Ga0307410_10401842
2607 Ga0307406_10051528
2608 Ga0307407_10100086
2609 Ga0307407_10261421
2610 Ga0307412_10311139
2611 Ga0307409_100007448
2612 Ga0307409_100102486
2613 Ga0307409_100257551
2614 Ga0307409_100418407
2615 Ga0307409_100423753
2616 Ga0307409_100502748
2617 Ga0307409_100720625
2618 Ga0307409_100778800
2619 Ga0307409_101051235
2620 Ga0307416_100010494
2621 Ga0307416_100748499
2622 Ga0307411_10179029
2623 Ga0307415_100017174
2624 Ga0307415_100670522
2625 Ga0316583_10037382
2626 Ga0316580_10083713
2627 Ga0307507_10000009
2628 Ga0307507_10065207
2629 Ga0307507_10152268
2630 Ga0307507_10198775
2631 Ga0307510_10046657
2632 Ga0316214_1000866
2633 Ga0316214_1001110
2634 Ga0316214_1029015
2635 Ga0373930_0013153
2636 Ga0373959_0009081
2637 Ga0373938_0001761
2638 Ga0373926_0000156
2639 Ga0373926_0000832
2640 Ga0373926_0035486
2641 Ga0373926_0048779
2642 Ga0373934_0000058
2643 Ga0373934_0004599
2644 Ga0373934_0025399
2645 Ga0373934_0035510
2646 Ga0373934_0039886
2647 Ga0373940_0005394
2648 Ga0373944_0000925
2649 Ga0373944_0003386
2650 Ga0373949_0036185
2651 Ga0373951_0005589
2652 Ga0373952_0005808
2653 Ga0373923_0003028
2654 Ga0373923_0015058
2655 Ga0373923_0033594
2656 Ga0373923_0044608
2657 Ga0373923_0156828
2658 Ga0373932_0026901
2659 Ga0373936_0005337
2660 Ga0373936_0017711
2661 Ga0373939_0015568
2662 Ga0373941_0066178
2663 Ga0373945_0000023
2664 Ga0373945_0047461
2665 Ga0373953_0000217
2666 Ga0373953_0003800
2667 Ga0373953_0008649
2668 Ga0373953_0022344
2669 Ga0373954_0004267
2670 Ga0373954_0008892
2671 Ga0373954_0009716
2672 Ga0373954_0013477
2673 Ga0373954_0055904
2674 Ga0373954_0212017
2675 Ga0373954_0325356
2676 Ga0373956_0002963
2677 Ga0373956_0025873
2678 Ga0373956_0067870
2679 Ga0373956_0070348
2680 Ga0373956_0080149
2681 Ga0373956_0086580
2682 Ga0373956_0155156
2683 Ga0373957_0001086
2684 Ga0373957_0004423
2685 Ga0373957_0009415
2686 Ga0373957_0018314
2687 Ga0373957_0062251
2688 Ga0373957_0084453
2689 Ga0373957_0102878
2690 Ga0373960_0006179
2691 Ga0373960_0056719
2692 Ga0373943_0013589
2693 Ga0373943_0017395
2694 Ga0373943_0073664
2695 Ga0373943_0095458
2696 Ga0373943_0163722
2697 Ga0373946_0000155
2698 Ga0373946_0026077
2699 Ga0373946_0169938
2700 Ga0373955_0000156
2701 Ga0373955_0001996
2702 Ga0373955_0036158
2703 Ga0373955_0107816
2704 Ga0373955_0242601
2705 Ga0373955_0267249
2706 Ga0373955_0291805
2707 Ga0373942_0007720
2708 Ga0373942_0012258
2709 Ga0373942_0143813
2710 Ga0373962_0010234
2711 Ga0316574_0001785
2712 Ga0316574_0053143
2713 Ga0316574_0378355
2714 Ga0373924_0001561
2715 Ga0373924_0004802
2716 Ga0373924_0021005
2717 Ga0373924_0173181
2718 Ga0373931_0042796
2719 Ga0373931_0086392
2720 Ga0373931_0262341
2721 Ga0373935_0002708
2722 Ga0373935_0005390
2723 Ga0373935_0034511
2724 Ga0373935_0138420
2725 Ga0373927_0019143
2726 Ga0373927_0137679
2727 Ga0373927_0159577
2728 Ga0373927_0477572
2729 Ga0373933_0000009
2730 Ga0373933_0004934
2731 Ga0373933_0029843
2732 Ga0373933_0069097
2733 Ga0373933_0103878
2734 Ga0373933_0130932
2735 Ga0373947_0000075
2736 Ga0373947_0137705
2737 Ga0373937_0000012
2738 Ga0373937_0035586
2739 Ga0373937_0046636
2740 Ga0373937_0085585
2741 Ga0373937_0092882
2742 Ga0373937_0133778
2743 Ga0373937_0214266
2744 Ga0373937_0355260
2745 Ga0316582_0013111
2746 Ga0316582_0029915
2747 Ga0316582_0220683
2748 Ga0316584_0060140
2749 Ga0373925_0000262
2750 Ga0373925_0001964
2751 Ga0373925_0011639
2752 Ga0373925_0015148
2753 Ga0373925_0146501
2754 Ga0373925_0202415
2755 Ga0373925_0254379
2756 Ga0373925_0254485
2757 Ga0395899_0007409
2758 Ga0395899_0065818
2759 Ga0395900_0030148
2760 Ga0395900_0110138
2761 Ga0395900_0248527
2762 Ga0395898_0005654
2763 Ga0395898_0005710
2764 Ga0395898_0048693
2765 Ga0395898_0066020
2766 Ga0395898_0117049
2767 Ga0395898_0123137
2768 Ga0395898_0139143
2769 Ga0395898_0182253
2770 Ga0395898_0431093
2771 Ga0436364_0109924
2772 Ga0436364_0138124
2773 Ga0436364_0392443
2774 Ga0436364_0647259
2775 Ga0436364_0858481
2776 Ga0436364_0891745
2777 Ga0436364_0932176
2778 Ga0436364_1059010
2779 Ga0395901_0020046
2780 Ga0395901_0029954
2781 Ga0395901_0043581
2782 Ga0395901_0203596
2783 Ga0395901_0362343
2784 Ga0395901_0373590
2785 Ga0395901_0488586
2786 Ga0395901_0516645
2787 Ga0395901_0594418
2788 Ga0395901_0749100
2789 Ga0395901_1081816
2790 Ga0436365_0144311
2791 Ga0436365_0789144
2792 Ga0436365_1434079
2793 Ga0436360_0666661
2794 Ga0436363_0382238
2795 Ga0436363_0859415
2796 Ga0436363_0995323
2797 Ga0436362_0025783
2798 Ga0436362_0488032
2799 Ga0436362_0638503
2800 Ga0436362_0944772
2801 Ga0439436_0000221
2802 Ga0439436_0000369
2803 Ga0439436_0008523
2804 Ga0439439_0004672
2805 Ga0439439_0071063
2806 Ga0439439_0076794
2807 Ga0439466_0037874
2808 Ga0451789_0394708
2809 Ga0451793_1930165
2810 Ga0451833_1303516
2811 Ga0451837_0319373
2812 Ga0439433_0001075
2813 Ga0439433_0007557
2814 Ga0439448_0049198
2815 Ga0439448_0085699
2816 Ga0439449_0001351
2817 Ga0439449_0047792
2818 Ga0439449_0139201
2819 Ga0439457_000912
2820 Ga0439457_003251
2821 Ga0439462_0003322
2822 Ga0450888_023225
2823 Ga0450890_004402
2824 Ga0450897_002158
2825 Ga0450894_000165
2826 Ga0450895_001091
2827 Ga0450896_000843
2828 Ga0450898_026543
2829 Ga0450900_017926
2830 Ga0450902_004816
2831 Ga0450903_003902
2832 Ga0450906_002967
2833 Ga0439458_0005305
2834 Ga0450908_000484
2835 Ga0439460_0064916
2836 Ga0466969_0011075
2837 Ga0466969_0014683
2838 Ga0466969_0029467
2839 Ga0466969_0140123
2840 Ga0466972_0003842
2841 Ga0466972_0003903
2842 Ga0466972_0010829
2843 Ga0466972_0143263
2844 Ga0466965_0000304
2845 Ga0466965_0028551
2846 Ga0466965_0042100
2847 Ga0466965_0104011
2848 Ga0466965_0171166
2849 Ga0466965_0198379
2850 Ga0466966_0008603
2851 Ga0466966_0043489
2852 Ga0466966_0045850
2853 Ga0466966_0050263
2854 Ga0466966_0063589
2855 Ga0466966_0457228
2856 Ga0466961_0006417
2857 Ga0466961_0009741
2858 Ga0466961_0094517
2859 Ga0466961_0219468
2860 Ga0466961_0219638
2861 Ga0466961_0281864
2862 Ga0466963_0001543
2863 Ga0466963_0001954
2864 Ga0466963_0004547
2865 Ga0466963_0032003
2866 Ga0466963_0038082
2867 Ga0466963_0054026
2868 Ga0466963_0074239
2869 Ga0466963_0083702
2870 Ga0466963_0096421
2871 Ga0466963_0318529
2872 Ga0466964_0009875
2873 Ga0466971_0006461
2874 Ga0466971_0011590
2875 Ga0466971_0028559
2876 Ga0466971_0034980
2877 Ga0466971_0041072
2878 Ga0466971_0041165
2879 Ga0466971_0280450
2880 Ga0466970_0000179
2881 Ga0466970_0006119
2882 Ga0466970_0096053
2883 Ga0466970_0119935
2884 Ga0466970_0272429
2885 Ga0466957_0001101
2886 Ga0466957_0046598
2887 Ga0466957_0047119
2888 Ga0466957_0236810
2889 Ga0466957_0269937
2890 Ga0466957_0355331
2891 Ga0466960_0002996
2892 Ga0466960_0043520
2893 Ga0466960_0184606
2894 Ga0466960_0310670
2895 Ga0466959_0002789
2896 Ga0466959_0064052
2897 Ga0466959_0080783
2898 Ga0466959_0353256
2899 Ga0466958_0010946
2900 Ga0466958_0014015
2901 Ga0466958_0019871
2902 Ga0466958_0032131
2903 Ga0466958_0241273
2904 Ga0466958_0248102
2905 Ga0466958_0315677
2906 Ga0466967_0011410
2907 Ga0466967_0028007
2908 Ga0466967_0031778
2909 Ga0466967_0065600
2910 Ga0466967_0128608
2911 Ga0466967_0155973
2912 Ga0466967_0211964
2913 Ga0466967_0415282
2914 Ga0466967_0519108
2915 Ga0466967_0678940
2916 Ga0466967_0776438
2917 Ga0466967_1004868
2918 Ga0466967_1075215
2919 Ga0466967_1298927
2920 Ga0495617_002534
2921 Ga0495617_157897
2922 Ga0495627_013158
2923 Ga0495627_042990
2924 Ga0495592_0000049
2925 Ga0495592_0014903
2926 Ga0495592_0040961
2927 Ga0495592_0046032
2928 Ga0495592_0070946
2929 Ga0495592_0074524
2930 Ga0495592_0099155
2931 Ga0495603_0001554
2932 Ga0495603_0001594
2933 Ga0495603_0013288
2934 Ga0495603_0016215
2935 Ga0495603_0031472
2936 Ga0495603_0046082
2937 Ga0495603_0082929
2938 Ga0495603_0146545
2939 Ga0495603_0364295
2940 Ga0495590_0022011
2941 Ga0495590_0044639
2942 Ga0495590_0093346
2943 Ga0495629_0002112
2944 Ga0495629_0010288
2945 Ga0495629_0048873
2946 Ga0495629_0050531
2947 Ga0495629_0056568
2948 Ga0495629_0093561
2949 Ga0495629_0109496
2950 Ga0495629_0186003
2951 Ga0495629_0188609
2952 Ga0495629_0366042
2953 Ga0495638_0051975
2954 Ga0495638_0077718
2955 Ga0495638_0152161
2956 Ga0495638_0163491
2957 Ga0495641_0006736
2958 Ga0495641_0016436
2959 Ga0495641_0025068
2960 Ga0495641_0065678
2961 Ga0495641_0122110
2962 Ga0495641_0174597
2963 Ga0495651_0000007
2964 Ga0495651_0001322
2965 Ga0495651_0001709
2966 Ga0495651_0011440
2967 Ga0495651_0013776
2968 Ga0495651_0032077
2969 Ga0495651_0047460
2970 Ga0495651_0196207
2971 Ga0495651_0276742
2972 Ga0495653_0002706
2973 Ga0495653_0009356
2974 Ga0495653_0011729
2975 Ga0495653_0069063
2976 Ga0495653_0069203
2977 Ga0495653_0072394
2978 Ga0495653_0076433
2979 Ga0495653_0105415
2980 Ga0495653_0187823
2981 Ga0495580_0088787
2982 Ga0495580_0116065
2983 Ga0495580_0203805
2984 Ga0495582_0008843
2985 Ga0495582_0018157
2986 Ga0495582_0019820
2987 Ga0495582_0034601
2988 Ga0495582_0097616
2989 Ga0495582_0173155
2990 Ga0495605_0019223
2991 Ga0495605_0081391
2992 Ga0495605_0145250
2993 Ga0495639_0008986
2994 Ga0495639_0010613
2995 Ga0495639_0022556
2996 Ga0495639_0077375
2997 Ga0495639_0142709
2998 Ga0495662_0000163
2999 Ga0495662_0010357
3000 Ga0495662_0015181
3001 Ga0495662_0051644
3002 Ga0495662_0065279
3003 Ga0495662_0103865
3004 Ga0495664_0001047
3005 Ga0495664_0005749
3006 Ga0495664_0012698
3007 Ga0495664_0032570
3008 Ga0495664_0049010
3009 Ga0495664_0049582
3010 Ga0495664_0051332
3011 Ga0495664_0077271
3012 Ga0495664_0198339
3013 Ga0495664_0299212
3014 Ga0495585_0003798
3015 Ga0495585_0031254
3016 Ga0495594_0016102
3017 Ga0495594_0020549
3018 Ga0495594_0057855
3019 Ga0495594_0113890
3020 Ga0495594_0128827
3021 Ga0495594_0326107
3022 Ga0495596_0050341
3023 Ga0495607_0254833
3024 Ga0495606_0013625
3025 Ga0495608_0000015
3026 Ga0495608_0017575
3027 Ga0495608_0021907
3028 Ga0495608_0024177
3029 Ga0495608_0155193
3030 Ga0495608_0159614
3031 Ga0495608_0202332
3032 Ga0495608_0366617
3033 Ga0495610_0004959
3034 Ga0495616_0008463
3035 Ga0495618_0006907
3036 Ga0495618_0024295
3037 Ga0495618_0089136
3038 Ga0495618_0092236
3039 Ga0495618_0101126
3040 Ga0495618_0154577
3041 Ga0495618_0167406
3042 Ga0495618_0179717
3043 Ga0495620_0047482
3044 Ga0495620_0224594
3045 Ga0495628_0001681
3046 Ga0495628_0002433
3047 Ga0495628_0025594
3048 Ga0495628_0074087
3049 Ga0495628_0095221
3050 Ga0495628_0116863
3051 Ga0495628_0184372
3052 Ga0495628_0219730
3053 Ga0495630_0003597
3054 Ga0495630_0030861
3055 Ga0495630_0131528
3056 Ga0495630_0303413
3057 Ga0495630_0333377
3058 Ga0495631_0005911
3059 Ga0495637_0058397
3060 Ga0495643_0012121
3061 Ga0495648_0151473
3062 Ga0495666_0026609
3063 Ga0495666_0093232
3064 Ga0495666_0123361
3065 Ga0495666_0179321
3066 Ga0495642_0287921
3067 Ga0495652_0001157
3068 Ga0495652_0001969
3069 Ga0495652_0046161
3070 Ga0495652_0049508
3071 Ga0495652_0061099
3072 Ga0495652_0064207
3073 Ga0495652_0073989
3074 Ga0495652_0284389
3075 Ga0495652_0389385
3076 Ga0495654_0052892
3077 Ga0495665_0004214
3078 Ga0495665_0004805
3079 Ga0495665_0034731
3080 Ga0495665_0046298
3081 Ga0495665_0166448
3082 Ga0495640_0005364
3083 Ga0495640_0008144
3084 Ga0495640_0056612
3085 Ga0495640_0074622
3086 Ga0495640_0088651
3087 Ga0495640_0099308
3088 Ga0495640_0104125
3089 Ga0495640_0165867
3090 Ga0495640_0176501
3091 Ga0495640_0268862
3092 Ga0495586_0030108
3093 Ga0495586_0071294
3094 Ga0495587_0000032
3095 Ga0495587_0004304
3096 Ga0495587_0030319
3097 Ga0495587_0036355
3098 Ga0495587_0046097
3099 Ga0495587_0157803
3100 Ga0495587_0167586
3101 Ga0495609_0008249
3102 Ga0495597_0073531
3103 Ga0495645_0013643
3104 Ga0495645_0016859
3105 Ga0495645_0061156
3106 Ga0495645_0062886
3107 Ga0495645_0068949
3108 Ga0495645_0096810
3109 Ga0495645_0099814
3110 Ga0495645_0162284
3111 Ga0495645_0242182
3112 Ga0495645_0267136
3113 Ga0495622_0005947
3114 Ga0495622_0021107
3115 Ga0495633_0288298
3116 Ga0495667_0008628
3117 Ga0495667_0014297
3118 Ga0495667_0127095
3119 Ga0495667_0144359
3120 Ga0495667_0162988
3121 Ga0495667_0194755
3122 Ga0495634_0006405
3123 Ga0495634_0006867
3124 Ga0495634_0016697
3125 Ga0495634_0024117
3126 Ga0495634_0029978
3127 Ga0495634_0030299
3128 Ga0495634_0233947
3129 Ga0495611_0069557
3130 Ga0495611_0090842
3131 Ga0495625_0001776
3132 Ga0495625_0038628
3133 Ga0495625_0070707
3134 Ga0495625_0150283
3135 Ga0495635_0002928
3136 Ga0495635_0006534
3137 Ga0495635_0014928
3138 Ga0495635_0016716
3139 Ga0495635_0030421
3140 Ga0495635_0041587
3141 Ga0495635_0231708
3142 Ga0495659_0115846
3143 Ga0495661_0021386
3144 Ga0495588_0005660
3145 Ga0495588_0030229
3146 Ga0495588_0053948
3147 Ga0495657_0000106
3148 Ga0495657_0002543
3149 Ga0495657_0005981
3150 Ga0495657_0012582
3151 Ga0495657_0016670
3152 Ga0495657_0020771
3153 Ga0495657_0036983
3154 Ga0495657_0060941
3155 Ga0495657_0111171
3156 Ga0495657_0265243
3157 Ga0495657_0409050
3158 Ga0495599_0000414
3159 Ga0495599_0006481
3160 Ga0495599_0016216
3161 Ga0495599_0032519
3162 Ga0495599_0054425
3163 Ga0495599_0089821
3164 Ga0495623_0009879
3165 Ga0495623_0019308
3166 Ga0495623_0025742
3167 Ga0495623_0050810
3168 Ga0495623_0107046
3169 Ga0495623_0252520
3170 Ga0495623_0332636
3171 Ga0495646_0002859
3172 Ga0495646_0018949
3173 Ga0495646_0020936
3174 Ga0495646_0036623
3175 Ga0495646_0038583
3176 Ga0495646_0080871
3177 Ga0495646_0122320
3178 Ga0495647_0084457
3179 Ga0495658_0047240
3180 Ga0495658_0048373
3181 Ga0495658_0065618
3182 Ga0495658_0105565
3183 Ga0495658_0456303
3184 Ga0495613_0002345
3185 Ga0495613_0024867
3186 Ga0495613_0048617
3187 Ga0495613_0052053
3188 Ga0495613_0094091
3189 Ga0495613_0159831
3190 Ga0495613_0250314
3191 Ga0495613_0524589
3192 Ga0495613_0601785
3193 Ga0495624_0001191
3194 Ga0495624_0002632
3195 Ga0495624_0042798
3196 Ga0495624_0057229
3197 Ga0495624_0082408
3198 Ga0495624_0129313
3199 Ga0495624_0275902
3200 Ga0495624_0284273
3201 Ga0495624_0359452
3202 Ga0495670_0034029
3203 Ga0495670_0073647
3204 Ga0495671_0104479
3205 Ga0495649_0058252
3206 Ga0495649_0070923
3207 Ga0495589_0004731
3208 Ga0495589_0043120
3209 Ga0495589_0045168
3210 Ga0495589_0168512
3211 Ga0495600_0001446
3212 Ga0495600_0004594
3213 Ga0495600_0012322
3214 Ga0495600_0016101
3215 Ga0495600_0020341
3216 Ga0495600_0022349
3217 Ga0495600_0096553
3218 Ga0495600_0112553
3219 Ga0495600_0309098
3220 Ga0495660_0012621
3221 Ga0495660_0255896
3222 Ga0495581_0030122
3223 Ga0495581_0037431
3224 Ga0495581_0040774
3225 Ga0495581_0053224
3226 Ga0495581_0064372
3227 Ga0495604_0000062
3228 Ga0495604_0000878
3229 Ga0495604_0016358
3230 Ga0495604_0031341
3231 Ga0495604_0053909
3232 Ga0495604_0063208
3233 Ga0495604_0074780
3234 Ga0495604_0097092
3235 Ga0495604_0136584
3236 Ga0495604_0199151
3237 Ga0495604_0199416
3238 Ga0495604_0262792
3239 Ga0495636_0023512
3240 Ga0495636_0127015
3241 Ga0495674_0000654
3242 Ga0495674_0014303
3243 Ga0495674_0028679
3244 Ga0495674_0042670
3245 Ga0495674_0103586
3246 Ga0495674_0120346
3247 Ga0495674_0169028
3248 Ga0495672_0051574
3249 Ga0495676_0000150
3250 Ga0495676_0001728
3251 Ga0495676_0005833
3252 Ga0495676_0007138
3253 Ga0495676_0023708
3254 Ga0495676_0036064
3255 Ga0495676_0066375
3256 Ga0495676_0096520
3257 Ga0495676_0103858
3258 Ga0495676_0198921
3259 Ga0495680_0001896
3260 Ga0495680_0016084
3261 Ga0495680_0018955
3262 Ga0495680_0020371
3263 Ga0495680_0022021
3264 Ga0495680_0047137
3265 Ga0495680_0050025
3266 Ga0495680_0057203
3267 Ga0495680_0060126
3268 Ga0495680_0089175
3269 Ga0495680_0102082
3270 Ga0495680_0144920
3271 Ga0495687_002534
3272 Ga0495675_0014468
3273 Ga0495675_0017619
3274 Ga0495675_0023625
3275 Ga0495675_0102866
3276 Ga0495675_0161720
3277 Ga0495677_0057656
3278 Ga0495685_001035
3279 Ga0495685_018250
3280 Ga0495685_136430
3281 Ga0495685_166961
3282 Ga0495681_0001177
3283 Ga0495681_0011246
3284 Ga0495681_0102854
3285 Ga0495684_0004087
3286 Ga0495684_0007997
3287 Ga0495684_0016230
3288 Ga0495684_0041054
3289 Ga0495684_0050658
3290 Ga0495684_0076311
3291 Ga0495684_0116805
3292 Ga0495684_0392390
3293 Ga0495686_0044711
3294 Ga0495686_0374598
3295 Ga0495593_0008567
3296 Ga0495593_0023902
3297 Ga0495593_0059745
3298 Ga0495593_0071813
3299 Ga0495593_0115501
3300 Ga0495602_0002545
3301 Ga0495602_0028807
3302 Ga0495602_0063161
3303 Ga0495602_0094928
3304 Ga0495602_0135146
3305 Ga0495602_0148791
3306 Ga0495602_0194062
3307 Ga0495602_0215765
3308 Ga0495602_0363396
3309 Ga0495602_0449376
3310 Ga0495614_0000611
3311 Ga0495614_0037662
3312 Ga0495614_0044088
3313 Ga0495614_0184814
3314 Ga0495615_0113718
3315 Ga0495626_0006328
3316 Ga0496100_0027737
3317 Ga0496100_0036636
3318 Ga0496100_0078631
3319 Ga0496100_0140651
3320 Ga0496100_0150672
3321 Ga0496100_0189882
3322 Ga0496100_0229831
3323 Ga0496101_0014873
3324 Ga0496101_0028793
3325 Ga0496101_0039436
3326 Ga0496101_0057875
3327 Ga0496101_0321634
3328 Ga0496101_0344703
3329 Ga0496101_0457770
3330 Ga0496102_0006769
3331 Ga0496102_0014285
3332 Ga0496102_0027853
3333 Ga0496102_0084947
3334 Ga0496102_0093131
3335 Ga0496102_0209726
3336 Ga0496102_0509021
3337 Ga0496102_0533770
3338 Ga0496102_0653434
3339 Ga0496103_0020725
3340 Ga0496103_0039720
3341 Ga0496103_0044364
3342 Ga0496103_0641226
3343 Ga0496104_0006175
3344 Ga0496104_0008256
3345 Ga0496104_0016097
3346 Ga0496104_0072280
3347 Ga0496104_0145656
3348 Ga0496104_0162629
3349 Ga0496104_0322655
3350 Ga0496104_0334357
3351 Ga0496104_0500953
3352 Ga0496104_0570064
3353 Ga0496104_0947992
3354 Ga0496105_0000770
3355 Ga0496105_0001849
3356 Ga0496105_0018813
3357 Ga0496105_0032974
3358 Ga0496105_0059034
3359 Ga0496105_0066420
3360 Ga0496105_0192886
3361 Ga0496105_0387757
3362 Ga0496106_0105759
3363 Ga0496106_0260206
3364 Ga0496106_0267558
3365 Ga0496106_0351626
3366 Ga0496106_0552765
3367 Ga0496107_0013004
3368 Ga0496107_0025724
3369 Ga0496107_0027912
3370 Ga0496107_0151938
3371 Ga0496107_0163235
3372 Ga0496107_0197521
3373 Ga0496107_0314608
3374 Ga0496107_0360825
3375 Ga0496107_0687800
3376 Ga0496108_0001256
3377 Ga0496108_0056003
3378 Ga0496108_0076757
3379 Ga0496108_0077787
3380 Ga0496108_0156347
3381 Ga0496108_0170435
3382 Ga0496108_0242654
3383 Ga0496108_0274873
3384 Ga0496108_0347647
3385 Ga0496108_0373293
3386 Ga0496108_0778364
3387 Ga0496109_0022092
3388 Ga0496109_0028644
3389 Ga0496109_0028918
3390 Ga0496109_0074823
3391 Ga0496109_0105066
3392 Ga0496109_0117542
3393 Ga0496109_0131240
3394 Ga0496109_0154342
3395 Ga0496109_0236245
3396 Ga0496109_0251297
3397 Ga0496109_0474045
3398 Ga0496110_0022947
3399 Ga0496110_0046500
3400 Ga0496110_0049751
3401 Ga0496110_0064333
3402 Ga0496110_0126849
3403 Ga0496110_0171323
3404 Ga0496110_0193491
3405 Ga0496110_0223498
3406 Ga0496110_0402112
3407 Ga0496110_0571790
3408 Ga0496110_0874104
3409 Ga0496111_0001697
3410 Ga0496111_0017359
3411 Ga0496111_0019743
3412 Ga0496111_0020319
3413 Ga0496111_0035970
3414 Ga0496111_0044283
3415 Ga0496111_0347448
3416 Ga0496111_0490330
3417 Ga0496112_0000586
3418 Ga0496112_0028415
3419 Ga0496112_0048959
3420 Ga0496112_0088303
3421 Ga0496112_0193140
3422 Ga0496112_0674093
3423 Ga0496112_0905039
3424 Ga0496113_0015052
3425 Ga0496113_0041324
3426 Ga0496113_0059184
3427 Ga0496113_0105996
3428 Ga0496113_0119118
3429 Ga0496113_0119629
3430 Ga0496114_0004150
3431 Ga0496114_0009285
3432 Ga0496114_0028823
3433 Ga0496114_0031007
3434 Ga0496114_0067269
3435 Ga0496114_0102807
3436 Ga0496114_0134724
3437 Ga0496114_0157514
3438 Ga0496114_0278431
3439 Ga0496114_0852798
3440 Ga0496114_0908831
3441 Ga0496115_0021963
3442 Ga0496115_0028311
3443 Ga0496115_0047442
3444 Ga0496115_0207876
3445 Ga0496115_0707159
3446 Ga0496119_0000200
3447 Ga0496119_0000475
3448 Ga0496119_0026206
3449 Ga0496119_0054433
3450 Ga0496120_0000353
3451 Ga0496120_0002957
3452 Ga0496121_0014747
3453 Ga0496125_0293085
3454 Ga0496126_0004952
3455 Ga0496126_0026965
3456 Ga0496126_0043878
3457 Ga0496126_0184836
3458 Ga0496126_0438497
3459 Ga0495678_027678
3460 Ga0495682_0041301
3461 Ga0501031_0013166
3462 Ga0501031_0014095
3463 Ga0501031_0096162
3464 Ga0501031_0310468
3465 Ga0501031_0547186
3466 Ga0501031_0577604
3467 Ga0501032_0038311
3468 Ga0501032_0076296
3469 Ga0501032_0388240
3470 Ga0501033_0006244
3471 Ga0501033_0032215
3472 Ga0501033_0034045
3473 Ga0501033_0111002
3474 Ga0501033_0144725
3475 Ga0501033_0150444
3476 Ga0501034_0007085
3477 Ga0501034_0008257
3478 Ga0501034_0036552
3479 Ga0501034_0062389
3480 Ga0501034_0581792
3481 Ga0501036_0000154
3482 Ga0501036_0007966
3483 Ga0501036_0010321
3484 Ga0501036_0017214
3485 Ga0501036_0046676
3486 Ga0501036_0304204
3487 Ga0501037_0006107
3488 Ga0501037_0016220
3489 Ga0501037_0050588
3490 Ga0501037_0093624
3491 Ga0501037_0629464
3492 Ga0501038_0008899
3493 Ga0501038_0011859
3494 Ga0501038_0029152
3495 Ga0501038_0065187
3496 Ga0501038_0181013
3497 Ga0501038_0410994
3498 Ga0501039_0015284
3499 Ga0501039_0027179
3500 Ga0501039_0095901
3501 Ga0501039_0143434
3502 Ga0501039_0730034
3503 Ga0501040_0028569
3504 Ga0501040_0092810
3505 Ga0501040_0267729
3506 Ga0501041_0016820
3507 Ga0501041_0020014
3508 Ga0501042_0003066
3509 Ga0501042_0033230
3510 Ga0501042_0034260
3511 Ga0501042_0084146
3512 Ga0501042_0506112
3513 Ga0501043_0003227
3514 Ga0501043_0005709
3515 Ga0501043_0010922
3516 Ga0501043_0013418
3517 Ga0501043_0165569
3518 Ga0501043_0233097
3519 Ga0501046_0021502
3520 Ga0501046_0046370
3521 Ga0501046_0047282
3522 Ga0501046_0181215
3523 Ga0501047_0000033
3524 Ga0501047_0000369
3525 Ga0501047_0001481
3526 Ga0501047_0029209
3527 Ga0501047_0058613
3528 Ga0501047_0099451
3529 Ga0501047_0127143
3530 Ga0501047_0183674
3531 Ga0501047_0461742
3532 Ga0501048_0003583
3533 Ga0501048_0006936
3534 Ga0501048_0007884
3535 Ga0501048_0033083
3536 Ga0501048_0287186
3537 Ga0501067_0021266
3538 Ga0501067_0339433
3539 Ga0501068_0013033
3540 Ga0501068_0066962
3541 Ga0501068_0126056
3542 Ga0501068_0388112
3543 Ga0501069_0010447
3544 Ga0501069_0066819
3545 Ga0501069_0155485
3546 Ga0501070_0005487
3547 Ga0501070_0008402
3548 Ga0501070_0040771
3549 Ga0501070_0749249
3550 Ga0501071_0000622
3551 Ga0501071_0015459
3552 Ga0501072_0042082
3553 Ga0501072_0097045
3554 Ga0501073_0061740
3555 Ga0501073_0206183
3556 Ga0501073_0306197
3557 Ga0501074_0003420
3558 Ga0501074_0004389
3559 Ga0501074_0012014
3560 Ga0501074_0062681
3561 Ga0501075_0056288
3562 Ga0501075_0234055
3563 Ga0501076_0002267
3564 Ga0501076_0096796
3565 Ga0501077_0048562
3566 Ga0501077_0067104
3567 Ga0501079_0016047
3568 Ga0501079_0103124
3569 Ga0501080_0032359
3570 Ga0501080_0057577
3571 Ga0501080_0064310
3572 Ga0501081_0036447
3573 Ga0501083_0001270
3574 Ga0501083_0151204
3575 Ga0501270_033114
3576 Ga0501035_0050911
3577 Ga0501035_0151202
3578 Ga0501035_0171437
3579 Ga0501044_0003451
3580 Ga0501044_0014764
3581 Ga0501044_0032181
3582 Ga0501044_0042581
3583 Ga0501044_0043290
3584 Ga0501044_0117041
3585 Ga0501044_0168139
3586 Ga0501044_0292757
3587 Ga0501044_0677524
3588 Ga0501045_0000424
3589 Ga0501045_0037402
3590 Ga0501045_0057284
3591 nmdc:mga03n38_7371_c1
3592 nmdc:mga0yw44_510969_c1
3593 nmdc:mga05p37_145975_c1
3594 nmdc:mga05p37_37397_c1
3595 nmdc:mga06r32_521174_c1
3596 nmdc:mga08y16_127471_c1
3597 nmdc:mga08y16_198046_c1
3598 nmdc:mga0n895_21840_c1
3599 nmdc:mga0n895_23116_c1
3600 nmdc:mga0n895_261667_c1
3601 nmdc:mga0n895_303043_c1
3602 nmdc:mga0rr50_67504_c1
3603 nmdc:mga0rr50_93982_c1
3604 nmdc:mga08x19_12213_c1
3605 nmdc:mga08x19_135827_c1
3606 nmdc:mga08x19_19788_c1
3607 nmdc:mga08x19_253060_c1
3608 nmdc:mga0a205_12233_c1
3609 nmdc:mga0a205_152994_c1
3610 nmdc:mga0a205_18672_c1
3611 Ga0495601_0029968
3612 Ga0495601_0035862
3613 Ga0495601_0102025
3614 Ga0495601_0180603
3615 Ga0495601_0195085
3616 Ga0495601_0291558
3617 Ga0495601_0361339
3618 Ga0495612_0015838
3619 Ga0495612_0023246
3620 Ga0495612_0031195
3621 Ga0495612_0048953
3622 Ga0495612_0116533
3623 Ga0495612_0169220
3624 Ga0495612_0172639
3625 Ga0495655_0004208
3626 Ga0495655_0048185
3627 Ga0495595_0004203
3628 Ga0495595_0010359
3629 Ga0495595_0027343
3630 Ga0495619_0005533
3631 Ga0495619_0055462
3632 Ga0495619_0062929
3633 Ga0495619_0095675
3634 Ga0495619_0111525
3635 Ga0495619_0137360
3636 Ga0500578_0102675
3637 Ga0500583_0160244
3638 Ga0500654_149730
3639 Ga0500558_069221
3640 Ga0500560_002512
3641 Ga0500652_032895
3642 Ga0500658_0174001
3643 Ga0500568_0003761
3644 Ga0500573_0064343
3645 Ga0500600_0067524
3646 Ga0500616_0001111
3647 Ga0500616_0001619
3648 Ga0500616_0102913
3649 Ga0500624_003031
3650 Ga0500634_0186514
3651 Ga0500656_018751
3652 Ga0501084_0032890
3653 Ga0501084_0041617
3654 Ga0501084_1116875
3655 Ga0501082_0062906
3656 Ga0501082_0077792
3657 Ga0466962_0015486
3658 Ga0466962_0017787
3659 Ga0466962_0036829
3660 Ga0466962_0036934
3661 Ga0466962_0058723
3662 Ga0466962_0063712
3663 Ga0466962_0198539
3664 Ga0530510_0020733
3665 Ga0530510_0052918
3666 2506868635
3667 2528204225
3668 2528214638
3669 2546947015
3670 2547408247
3671 2554257211
3672 2579747476
3673 2579854487
3674 2585299269
3675 2585308921
3676 2585313613
3677 2616694936
3678 2616904593
3679 2619853873
3680 2620349444
3681 2623497760
3682 2626634784
3683 2643765071
3684 2643768460
3685 2643852315
3686 2643899160
3687 2643942410
3688 2644111838
3689 2644136837
3690 2644182548
3691 2644262424
3692 2644390034
3693 2644403343
3694 2644429491
3695 2644437260
3696 2644446901
3697 2644461090
3698 2644607748
3699 2644628998
3700 2686543471
3701 2731905894
3702 2768643471
3703 2774867137
3704 2774905405
3705 2784473081
3706 2784588713
3707 2785343161
3708 2785369642
3709 2786670728
3710 2793978334
3711 2799185849
3712 2804846760
3713 2808842163
3714 2808871871
3715 2808920696
3716 2809232323
3717 2810363084
3718 2811849168
3719 2812357965
3720 2812373249
3721 2812480415
3722 2817509797
3723 2819426049
3724 2819665107
3725 2819692822
3726 2819695531
3727 2819727221
3728 2852636533
3729 2856742975
3730 2862179355
3731 2862285778
3732 2862297060
3733 2862392144
3734 2862511694
3735 2862579128
3736 2862706478
3737 2863404461
3738 2867348931
3739 2867371996
3740 2867432461
3741 2867478816
3742 2873155610
3743 2873314482
3744 2875395565
3745 2877680984
3746 2891401193
3747 2891560109
3748 2891563541
3749 2893686216
3750 2905930823
3751 2912719829
3752 2912724225
3753 2912760902
3754 2918505451
3755 2919448242
3756 2919469412
3757 2935393297
3758 2946006964
3759 2946049874
3760 2946067878
3761 2946076017
3762 2947229069
3763 2954007256
3764 2954386094
3765 2954677053
3766 2954687103
3767 2954696734
3768 2954705404
3769 2954716115
3770 2954726058
3771 2954735752
3772 2954744984
3773 2954754607
3774 2954763956
3775 2964328590
3776 2966601770
3777 2966927025
3778 2990045326
3779 2990063211
3780 2990088366
3781 2997457727
3782 2997600299
3783 3003004922
3784 3006325195
3785 3006394459
3786 3006428808
3787 3006490861
3788 3006500871
3789 637877802
3790 8008490301
3791 8008567119
3792 8008578779
3793 8023627098
3794 8025482475
3795 8025529603
3796 8025537899
3797 8033690855
3798 8047897968
3799 8048133048
3800 8048360926
3801 8048374931
3802 8048383274
3803 8048413926
3804 8053952145
3805 8054161755
3806 8054917380
3807 8054921994
3808 8055072721
3809 8055160494
3810 8055175942
3811 8056062084
3812 8056450884
3813 8056671245
3814 8056833498

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00486

Trans_reg_C

Transcriptional regulatory protein, C terminal

131

207

0.97

PF00072

Response_reg

Response regulator receiver domain

1

100

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
7cci-assembly1.cif.gz_A acinetobacter baumannii response regulator ader with disordered n terminus 0.9685 2 120
2a9r-assembly1.cif.gz_A-2 rr02-rec phosphate in the active site 0.9534 3 118
1nxt-assembly1.cif.gz_A-2 micarec ph 4.0 0.9526 3 118
8fk2-assembly1.cif.gz_B the n-terminal vicr from streptococcus mutans 0.9519 1 121
2iyn-assembly4.cif.gz_B the co-factor-induced pre-active conformation in phob 0.9512 2 118
ID Description Score Start End Superfamily
af_P9WGN1_2_80_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9876 2 80 3.40.50.2300
af_P21866_1_80_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9839 1 80 3.40.50.2300
af_P69228_9_89_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9818 1 80 3.40.50.2300
af_O69730_8_88_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.98 1 80 3.40.50.2300
af_Q2FXN6_3_86_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9791 3 82 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A1I3A8P6-F1-model_v4 DNA-binding response regulator, OmpR family, contains REC and winged-helix (WHTH) domain 0.8096 2 227 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993
AF-A0A1I3A8P6-F1-model_v4 DNA-binding response regulator, OmpR family, contains REC and winged-helix (WHTH) domain 0.797 2 227 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993
AF-A0A158KL75-F1-model_v4 DNA-binding response regulator KdpE 0.7673 1 153 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993
AF-A0A855HH93-F1-model_v4 deleted 0.7537 2 153
AF-A0A527HBX6-F1-model_v4 Response regulator 0.7442 2 153 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993

Map