F496033
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1908 | 666 | 3814 | 226 |
Family's Representative Sequence
| Representative Sequence | 3300046516|Ga0495628_0161075|Ga0495628_0161075_332_967 |
| Length | 211 |
| Sequence | VLVVEDEDSFSDAISYLLRKEGFEVAVCSTGPDALETFDRTGADLVLLDLMLPGLPGSEVCKSLREKSNVPVIMLTAKDSEIDKVFSSRELVARMRAVLRRRGEPEDTPESALESGPVRMDVDRHVVTVRGGNVQLPLKEFELLQVLLRNADRVLTRMQLIDRVWGADYVGDTKTLDVHIKRLRAKIELDPARPQHIVTVRGLGYKFESAA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 2 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 3 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 4 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 5 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 6 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 7 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 8 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 9 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 13 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 15 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 17 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 28 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 43 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 44 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 50 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 52 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 53 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 60 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 62 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 63 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 64 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 66 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 67 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 68 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 69 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 70 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 71 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 72 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 73 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 74 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 75 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 76 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 77 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 79 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 80 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 81 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 82 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 83 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 84 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 86 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 87 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 88 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 89 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 90 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 91 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 92 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 93 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 95 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300012498 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 | Metagenome | Rhizosphere |
| 113 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 125 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 129 | 3300015688 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 | Metagenome | Rhizosphere |
| 130 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 132 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 133 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 134 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 135 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 136 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 137 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 138 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 139 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 140 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 141 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 207 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 208 | 3300028023 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 | Metagenome | Rhizosphere |
| 209 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 213 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 214 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 215 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 216 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 217 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 218 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 219 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 220 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 221 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 222 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 223 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 224 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 225 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 226 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 227 | 3300030863 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 228 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 229 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 230 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 231 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 232 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 233 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 234 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 235 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 236 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 237 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 238 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 239 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 240 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 241 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 242 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 243 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 244 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 245 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 246 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 247 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 248 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 249 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 250 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 251 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 252 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 253 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 254 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 255 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 256 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 257 | 3300033545 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 | Metagenome | Unclassified |
| 258 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 259 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 260 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 261 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 262 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 263 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 264 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 265 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 266 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 267 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 268 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 269 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 270 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 271 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 272 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 273 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 274 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 275 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 276 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 277 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 278 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 279 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 280 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 281 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 282 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 283 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 284 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 285 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 286 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 287 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 288 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 289 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 290 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 291 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 292 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 293 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 294 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 295 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 296 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 297 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 298 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 299 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 300 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 301 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 302 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 303 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 304 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 305 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 306 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 307 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 308 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 309 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 310 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 311 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 312 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 313 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 314 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 315 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 316 | 3300042126 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 | Metagenome | Rhizosphere |
| 317 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 318 | 3300042128 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 | Metagenome | Rhizosphere |
| 319 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 320 | 3300042132 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 | Metagenome | Rhizosphere |
| 321 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 322 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 323 | 3300042136 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 | Metagenome | Rhizosphere |
| 324 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 325 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 326 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 327 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 328 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 329 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 330 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 331 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 332 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 333 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 334 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 335 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 336 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 337 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 338 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 339 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 340 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 341 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 342 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 343 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 344 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 411 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 414 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 415 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 416 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 417 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 418 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 419 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 420 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 421 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 422 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 423 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 424 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 425 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 426 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 427 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 428 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 429 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 430 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 431 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 432 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 433 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 434 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 435 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 436 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 437 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 438 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 439 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 440 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 441 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 442 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 443 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 444 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 445 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 446 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 447 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 448 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 449 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 450 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 451 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 452 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 453 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 454 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 455 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 456 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 457 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 458 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 459 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 460 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 461 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 462 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 463 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 464 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 465 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 466 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 467 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 468 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 469 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 470 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 471 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 472 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 473 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 474 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 475 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 476 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 477 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 478 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 479 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 480 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 481 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 482 | 3300049767 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought | Metagenome | Rhizosphere |
| 483 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 484 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 485 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 486 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 487 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 488 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 489 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 490 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 491 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 492 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 493 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 494 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 495 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 496 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 497 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 498 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 499 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 500 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 501 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 502 | 3300053099 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere | Metagenome | Endosphere |
| 503 | 3300053106 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 endosphere | Metagenome | Endosphere |
| 504 | 3300053107 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere | Metagenome | Endosphere |
| 505 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 506 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 507 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 508 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 509 | 3300053149 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere | Metagenome | Endosphere |
| 510 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 511 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 512 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 513 | 3300053732 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere | Metagenome | Endosphere |
| 514 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 515 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 516 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 517 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 518 | 2506783011 | Frankia datiscae Dg1 | Isolate | Nodule |
| 519 | 2527291627 | Frankia casuarinae Thr | Isolate | Nodule |
| 520 | 2527291629 | Frankia sp. BMG5.23 | Isolate | Nodule |
| 521 | 2546825537 | Frankia sp. CcI6 | Isolate | Rhizoplane |
| 522 | 2547132111 | Streptomyces sp. TOR3209 | Isolate | Rhizosphere |
| 523 | 2554235005 | Streptomyces violaceusniger SPC6 | Isolate | Rhizosphere |
| 524 | 2576861822 | Frankia sp. CeD | Isolate | Nodule |
| 525 | 2579778521 | Frankia torreyi CpI1-S | Isolate | Unclassified |
| 526 | 2582581312 | Streptomyces atratus OK008 | Isolate | Rhizosphere |
| 527 | 2582581313 | Streptomyces mirabilis OV308 | Isolate | Rhizosphere |
| 528 | 2582581314 | Streptomyces mirabilis YR139 | Isolate | Rhizosphere |
| 529 | 2616644814 | Streptomyces mirabilis OK461 | Isolate | Rhizosphere |
| 530 | 2616644941 | Streptomyces atratus OK807 | Isolate | Rhizosphere |
| 531 | 2619618881 | Frankia sp. ACN1ag | Isolate | Unclassified |
| 532 | 2619619003 | Frankia sp. CpI1-P | Isolate | Nodule |
| 533 | 2622736605 | Geodermatophilus ruber DSM 45317 | Isolate | Rhizosphere |
| 534 | 2626541554 | Frankia sp. AvcI.1 | Isolate | Nodule |
| 535 | 2643221548 | Streptomyces sp. Root55 | Isolate | Unclassified |
| 536 | 2643221549 | Agromyces sp. Root1464 | Isolate | Unclassified |
| 537 | 2643221567 | Phycicoccus sp. Root563 | Isolate | Unclassified |
| 538 | 2643221578 | Streptomyces sp. Root63 | Isolate | Unclassified |
| 539 | 2643221587 | Streptomyces sp. Root66D1 | Isolate | Unclassified |
| 540 | 2643221619 | Agromyces sp. Root81 | Isolate | Unclassified |
| 541 | 2643221624 | Phycicoccus sp. Root101 | Isolate | Unclassified |
| 542 | 2643221632 | Leifsonia sp. Root112D2 | Isolate | Unclassified |
| 543 | 2643221647 | Streptomyces sp. Root369 | Isolate | Unclassified |
| 544 | 2643221670 | Streptomyces sp. Root431 | Isolate | Unclassified |
| 545 | 2643221673 | Streptomyces sp. Root1295 | Isolate | Unclassified |
| 546 | 2643221677 | Streptomyces sp. Root1304 | Isolate | Unclassified |
| 547 | 2643221678 | Streptomyces sp. Root1310 | Isolate | Unclassified |
| 548 | 2643221679 | Angustibacter sp. Root456 | Isolate | Unclassified |
| 549 | 2643221682 | Streptomyces sp. Root1319 | Isolate | Unclassified |
| 550 | 2643221711 | Terrabacter sp. Root85 | Isolate | Unclassified |
| 551 | 2643221714 | Streptomyces sp. Root264 | Isolate | Unclassified |
| 552 | 2684623036 | Frankia sp. CgIM4 | Isolate | Nodule |
| 553 | 2731639228 | Motilibacter peucedani DSM 45328 | Isolate | Rhizosphere |
| 554 | 2767802112 | Streptomyces avicenniae NRRL B-24776 | Isolate | Rhizosphere |
| 555 | 2773857924 | Frankia sp. CgIS1 | Isolate | Nodule |
| 556 | 2773857933 | Frankia sp. BMG5.30 | Isolate | Nodule |
| 557 | 2784132109 | Dermacoccus sp. DS28 SAI-028 | Isolate | Unclassified |
| 558 | 2784132148 | Streptomyces sp. E5N91 SAI-083 | Isolate | Unclassified |
| 559 | 2784746763 | Streptomyces ossamyceticus SAI-001 | Isolate | Unclassified |
| 560 | 2784746768 | Streptomyces griseorubiginosus SAI-142 | Isolate | Unclassified |
| 561 | 2786546132 | Streptomyces sp. W SAI-097 | Isolate | Unclassified |
| 562 | 2791355406 | Streptomyces rhizosphaericus NRRL B-24304 | Isolate | Unclassified |
| 563 | 2799112218 | Motilibacter rhizosphaerae DSM 45622 | Isolate | Rhizosphere |
| 564 | 2802429296 | Streptomyces sampsonii KJ40 | Isolate | Rhizosphere |
| 565 | 2808606359 | Streptomyces sp. RJA2910 | Isolate | Unclassified |
| 566 | 2808606365 | Phycicoccus sp. SLBN-51 | Isolate | Unclassified |
| 567 | 2808606375 | Streptomyces sp. SLBN-31 | Isolate | Unclassified |
| 568 | 2808606448 | Streptomyces sp. 193411 | Isolate | Unclassified |
| 569 | 2808606700 | Arthrobacter agilis UMCV2 | Isolate | Rhizosphere |
| 570 | 2808606982 | Streptomyces sp. SLBN-118 | Isolate | Unclassified |
| 571 | 2811994879 | Streptomyces sp. 4-17 | Isolate | Unclassified |
| 572 | 2811994882 | Terrabacter sp. SLBN-196 | Isolate | Unclassified |
| 573 | 2811994917 | Streptomyces sp. SLBN-134 | Isolate | Unclassified |
| 574 | 2816332305 | Kocuria rhizophila FDAARGOS_302 | Isolate | Rhizosphere |
| 575 | 2818991318 | Humibacillus xanthopallidus SLBN-155 | Isolate | Unclassified |
| 576 | 2818991458 | Terrabacter sp. 3211 | Isolate | Rhizosphere |
| 577 | 2818991462 | Terrabacter sp. 3264 | Isolate | Rhizosphere |
| 578 | 2818991463 | Streptomyces argenteolus 3259 | Isolate | Rhizosphere |
| 579 | 2818991469 | Terrabacter lapilli 3265 | Isolate | Rhizosphere |
| 580 | 2852635781 | Streptomyces sp. AK010 | Isolate | Rhizosphere |
| 581 | 2856741275 | Microbispora triticiradicis NEAU-HRDPA2-9 | Isolate | Unclassified |
| 582 | 2862178590 | Streptomyces sp. SDr-06 | Isolate | Rhizosphere |
| 583 | 2862281513 | Streptomyces sp. Act143 | Isolate | Rhizosphere |
| 584 | 2862290372 | Streptomyces triticagri NEAU-YY421 | Isolate | Rhizosphere |
| 585 | 2862382967 | Streptomyces scabiei NRRL B-2795 | Isolate | Nodule |
| 586 | 2862507626 | Streptomyces sp. NWU339 | Isolate | Unclassified |
| 587 | 2862574272 | Streptomyces sp. AcE210 | Isolate | Nodule |
| 588 | 2862705112 | Streptomyces triticirhizae NEAU-YY642 | Isolate | Rhizosphere |
| 589 | 2863404153 | Streptomyces scabiei SAI-025 (Annotation) (version 2) | Isolate | Unclassified |
| 590 | 2867346516 | Streptomyces radicis AZ1-7 | Isolate | Unclassified |
| 591 | 2867369537 | Streptomyces sp. Z26 | Isolate | Unclassified |
| 592 | 2867428634 | Streptomyces sp. RP5T | Isolate | Unclassified |
| 593 | 2867475112 | Streptomyces sp. TM32 | Isolate | Unclassified |
| 594 | 2873151551 | Streptomyces silaceus ACCC40021 | Isolate | Rhizosphere |
| 595 | 2873314349 | Sphaerisporangium siamense DSM 45784 | Isolate | Rhizosphere |
| 596 | 2875391855 | Streptomyces cavourensis 1AS2a | Isolate | Rhizosphere |
| 597 | 2877676314 | Streptomyces griseorubiginosus 3E-1 | Isolate | Unclassified |
| 598 | 2891395885 | Microbispora catharanthi CR1-09 | Isolate | Unclassified |
| 599 | 2891554331 | Microbispora sp. CL1-1 | Isolate | Unclassified |
| 600 | 2891562705 | Microbispora tritici MT50 | Isolate | Unclassified |
| 601 | 2893684298 | Kocuria palustris DSM 11925 | Isolate | Rhizosphere |
| 602 | 2905926851 | Arthrobacter sedimenti MIC A30 | Isolate | Rhizosphere |
| 603 | 2912715099 | Streptomyces sp. Z423-1 | Isolate | Rhizosphere |
| 604 | 2912723979 | Streptomyces sp. NEAU-sy36 | Isolate | Rhizosphere |
| 605 | 2912757875 | Streptomyces sp. S4.7 | Isolate | Rhizosphere |
| 606 | 2918501144 | Streptomyces sp. PvR006 | Isolate | Rhizosphere |
| 607 | 2919446982 | Phycicoccus sp. 3266 | Isolate | Rhizosphere |
| 608 | 2919468124 | Streptomyces sp. 3330 | Isolate | Rhizosphere |
| 609 | 2935390628 | Streptomyces sp. PvR034 | Isolate | Rhizosphere |
| 610 | 2946003308 | Arthrobacter agilis W3I6 | Isolate | Rhizosphere |
| 611 | 2946045630 | Streptomyces sp. W4I9-2 | Isolate | Rhizosphere |
| 612 | 2946064051 | Streptomyces luteogriseus W4I19-1 | Isolate | Rhizosphere |
| 613 | 2946072368 | Streptomyces achromogenes W4I19-2 | Isolate | Rhizosphere |
| 614 | 2947224130 | Streptomyces afghaniensis W1I20 | Isolate | Rhizosphere |
| 615 | 2954002825 | Streptomyces turgidiscabies W2I16 | Isolate | Rhizosphere |
| 616 | 2954380949 | Streptomyces ciscaucasicus W1I15 | Isolate | Rhizosphere |
| 617 | 2954673503 | Streptomyces sp. SAI-119 | Isolate | Rhizosphere |
| 618 | 2954682443 | Streptomyces sp. SAI-149 | Isolate | Rhizosphere |
| 619 | 2954691527 | Streptomyces sp. SAI-127 | Isolate | Rhizosphere |
| 620 | 2954701450 | Streptomyces sp. SAI-144 | Isolate | Rhizosphere |
| 621 | 2954711539 | Streptomyces sp. SAI-090 | Isolate | Rhizosphere |
| 622 | 2954721474 | Streptomyces sp. SAI-117 | Isolate | Rhizosphere |
| 623 | 2954731030 | Streptomyces sp. SAI-133 | Isolate | Rhizosphere |
| 624 | 2954740390 | Streptomyces sp. SAI-041 | Isolate | Rhizosphere |
| 625 | 2954749733 | Streptomyces sp. SAI-135 | Isolate | Rhizosphere |
| 626 | 2954759201 | Streptomyces sp. SAI-208 | Isolate | Rhizosphere |
| 627 | 2964326757 | Planctomonas psychrotolerans J5903 | Isolate | Rhizosphere |
| 628 | 2966598605 | Kitasatospora papulosa SLBN-177 | Isolate | Rhizosphere |
| 629 | 2966924647 | Frigoribacterium sp. 2355 | Isolate | Rhizosphere |
| 630 | 2990044586 | Streptomyces sedi JCM 16909 | Isolate | Unclassified |
| 631 | 2990059506 | Streptomyces sp. CAP261 | Isolate | Unclassified |
| 632 | 2990088156 | Streptomyces albidus CAP 215 | Isolate | Unclassified |
| 633 | 2997451912 | Streptomyces piniterrae jys28 | Isolate | Rhizosphere |
| 634 | 2997600082 | Streptomyces coffeae CA1R205 | Isolate | Unclassified |
| 635 | 3002998708 | Actinomadura barringtoniae GKU 128 | Isolate | Unclassified |
| 636 | 3006321560 | Actinacidiphila epipremni PRB2-1 | Isolate | Unclassified |
| 637 | 3006393351 | Streptomyces sp. SID4985 | Isolate | Unclassified |
| 638 | 3006425503 | Streptomyces zingiberis PLAI1-29 | Isolate | Unclassified |
| 639 | 3006486233 | Streptomyces sp. BR123 | Isolate | Rhizosphere |
| 640 | 3006493962 | Streptomyces grisecoloratus TRM S81-3 | Isolate | Rhizosphere |
| 641 | 637000116 | Frankia casuarinae CcI3 | Isolate | Nodule |
| 642 | 8008485437 | Streptomyces mimosae 3MP-10 | Isolate | Unclassified |
| 643 | 8008558824 | Streptomyces scabiei NRRL B-2795 | Isolate | Nodule |
| 644 | 8008574985 | Streptomyces sp. Jing01 | Isolate | Rhizosphere |
| 645 | 8023623736 | Streptomyces sp. 111WW2 | Isolate | Unclassified |
| 646 | 8025478263 | Streptomyces telluris AA8 | Isolate | Rhizosphere |
| 647 | 8025524527 | Streptomyces sp. 3MP-14 | Isolate | Unclassified |
| 648 | 8025530807 | Streptomyces sp. 4R-3d | Isolate | Unclassified |
| 649 | 8033684223 | Streptomyces phytophilus PIP175 | Isolate | Unclassified |
| 650 | 8047893842 | Streptomyces cangkringensis DSM 41769 | Isolate | Rhizosphere |
| 651 | 8048127548 | Streptomyces samsunensis DSM 42010 | Isolate | Rhizosphere |
| 652 | 8048356638 | Streptomyces rhizosphaericus DSM 41760 | Isolate | Rhizosphere |
| 653 | 8048369669 | Streptomyces indonesiensis DSM 41759 | Isolate | Rhizoplane |
| 654 | 8048379754 | Streptomyces asiaticus DSM 41761 | Isolate | Rhizosphere |
| 655 | 8048406513 | Streptomyces heilongjiangensis NEAU-W2 | Isolate | Unclassified |
| 656 | 8053945823 | Actinomadura terrae OS3-83 | Isolate | Rhizosphere |
| 657 | 8054160619 | Streptomyces rhizoryzae RS10V-4 | Isolate | Rhizosphere |
| 658 | 8054913762 | Frankia gtarii Agncl-10 | Isolate | Nodule |
| 659 | 8054920844 | Frankia tisae Agncl-8 | Isolate | Nodule |
| 660 | 8055066027 | Sphaerisporangium corydalis NEAU-YHS15 | Isolate | Unclassified |
| 661 | 8055157932 | Frankia umida Ag45/Mut15 | Isolate | Nodule |
| 662 | 8055172936 | Sphaerisporangium perillae NEAU-ZS1 | Isolate | Unclassified |
| 663 | 8056060235 | Nocardiopsis endophytica RSe5-2 | Isolate | Unclassified |
| 664 | 8056447290 | Streptomyces huiliensis SCA2-4 | Isolate | Rhizosphere |
| 665 | 8056667051 | Streptomyces sichuanensis SCA3-4 | Isolate | Rhizosphere |
| 666 | 8056829672 | Streptomyces barringtoniae JA03 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 91.25 |
| Metatranscriptomes | 0.94 |
| Isolates | 7.81 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.57 |
| Nodule | 0.89 |
| Rhizoplane | 7.02 |
| Rhizosphere | 83.28 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0495628_0161075 | 3300046516 | Bacteria | 1705 |
| 2 | JGI24735J21928_10011146 | 3300002067 | Bacteria | 2855 |
| 3 | JGI24738J21930_10011186 | 3300002075 | Bacteria | 1978 |
| 4 | JGI25153J46596_10032512 | 3300003215 | Bacteria | 1739 |
| 5 | rootH1_10002967 | 3300003323 | Bacteria | 2103 |
| 6 | JGI25160J50197_1016566 | 3300003354 | Bacteria | 2371 |
| 7 | Ga0006562J51391_1011721 | 3300003578 | Bacteria | 3437 |
| 8 | Ga0006562J51391_1011722 | 3300003578 | Bacteria | 3240 |
| 9 | Ga0006562J51391_1056397 | 3300003578 | Bacteria | 2982 |
| 10 | Ga0006562J51391_1071703 | 3300003578 | Bacteria | 1630 |
| 11 | Ga0006562J51391_1071704 | 3300003578 | Bacteria | 2500 |
| 12 | Ga0065714_10006949 | 3300005288 | Bacteria | 4902 |
| 13 | Ga0070658_10001387 | 3300005327 | Bacteria | 20694 |
| 14 | Ga0070658_10184078 | 3300005327 | Bacteria | 1758 |
| 15 | Ga0070658_10250538 | 3300005327 | Bacteria | 1502 |
| 16 | Ga0070676_10072473 | 3300005328 | Bacteria | 2071 |
| 17 | Ga0070683_100166867 | 3300005329 | Bacteria | 2089 |
| 18 | Ga0070683_100348384 | 3300005329 | Bacteria | 1410 |
| 19 | Ga0068869_100036149 | 3300005334 | Bacteria | 3506 |
| 20 | Ga0068869_100364963 | 3300005334 | Bacteria | 1180 |
| 21 | Ga0070666_10007558 | 3300005335 | Bacteria | 6702 |
| 22 | Ga0070666_10061196 | 3300005335 | Bacteria | 2549 |
| 23 | Ga0070666_10136575 | 3300005335 | Bacteria | 1706 |
| 24 | Ga0070680_100013093 | 3300005336 | Bacteria | 6456 |
| 25 | Ga0070680_100035119 | 3300005336 | Bacteria | 4046 |
| 26 | Ga0070680_100337751 | 3300005336 | Bacteria | 1280 |
| 27 | Ga0070682_100005056 | 3300005337 | Bacteria | 7328 |
| 28 | Ga0068868_100067018 | 3300005338 | Bacteria | 2856 |
| 29 | Ga0070660_100038049 | 3300005339 | Bacteria | 3650 |
| 30 | Ga0070660_100084706 | 3300005339 | Bacteria | 2492 |
| 31 | Ga0070660_100559084 | 3300005339 | Bacteria | 955 |
| 32 | Ga0070689_100028136 | 3300005340 | Bacteria | 4246 |
| 33 | Ga0070691_10014121 | 3300005341 | Bacteria | 3661 |
| 34 | Ga0070691_10017039 | 3300005341 | Bacteria | 3343 |
| 35 | Ga0070661_100228940 | 3300005344 | Bacteria | 1428 |
| 36 | Ga0070661_100560851 | 3300005344 | Bacteria | 920 |
| 37 | Ga0070692_10021193 | 3300005345 | Bacteria | 3159 |
| 38 | Ga0070692_10170923 | 3300005345 | Bacteria | 1253 |
| 39 | Ga0070668_100022918 | 3300005347 | Bacteria | 4721 |
| 40 | Ga0070668_100046575 | 3300005347 | Bacteria | 3330 |
| 41 | Ga0070668_100067218 | 3300005347 | Bacteria | 2784 |
| 42 | Ga0070675_100221788 | 3300005354 | Bacteria | 1647 |
| 43 | Ga0070675_100300602 | 3300005354 | Bacteria | 1414 |
| 44 | Ga0070671_100014896 | 3300005355 | Bacteria | 6282 |
| 45 | Ga0070671_100132739 | 3300005355 | Bacteria | 2098 |
| 46 | Ga0070674_100201836 | 3300005356 | Bacteria | 1536 |
| 47 | Ga0070674_100228758 | 3300005356 | Bacteria | 1450 |
| 48 | Ga0070673_100059069 | 3300005364 | Bacteria | 3035 |
| 49 | Ga0070673_100066970 | 3300005364 | Bacteria | 2870 |
| 50 | Ga0070673_100274444 | 3300005364 | Bacteria | 1477 |
| 51 | Ga0070688_100080165 | 3300005365 | Bacteria | 2111 |
| 52 | Ga0070659_100051008 | 3300005366 | Bacteria | 3252 |
| 53 | Ga0070667_100018998 | 3300005367 | Bacteria | 5698 |
| 54 | Ga0070667_100349927 | 3300005367 | Bacteria | 1337 |
| 55 | Ga0070703_10017010 | 3300005406 | Bacteria | 2093 |
| 56 | Ga0070709_10000220 | 3300005434 | Bacteria | 37035 |
| 57 | Ga0070709_10003796 | 3300005434 | Bacteria | 8125 |
| 58 | Ga0070709_10026469 | 3300005434 | Bacteria | 3438 |
| 59 | Ga0070709_10093584 | 3300005434 | Bacteria | 1987 |
| 60 | Ga0070714_100000010 | 3300005435 | Bacteria | 262871 |
| 61 | Ga0070714_100001618 | 3300005435 | Bacteria | 16378 |
| 62 | Ga0070714_100012670 | 3300005435 | Bacteria | 6735 |
| 63 | Ga0070714_100044829 | 3300005435 | Bacteria | 3745 |
| 64 | Ga0070714_100053229 | 3300005435 | Bacteria | 3454 |
| 65 | Ga0070714_100070235 | 3300005435 | Bacteria | 3027 |
| 66 | Ga0070714_100077141 | 3300005435 | Bacteria | 2894 |
| 67 | Ga0070714_100136718 | 3300005435 | Bacteria | 2196 |
| 68 | Ga0070714_100325816 | 3300005435 | Bacteria | 1437 |
| 69 | Ga0070714_100489764 | 3300005435 | Bacteria | 1171 |
| 70 | Ga0070714_100805068 | 3300005435 | Bacteria | 910 |
| 71 | Ga0070713_100002276 | 3300005436 | Bacteria | 12477 |
| 72 | Ga0070713_100033632 | 3300005436 | Bacteria | 4109 |
| 73 | Ga0070713_100040074 | 3300005436 | Bacteria | 3806 |
| 74 | Ga0070713_100059945 | 3300005436 | Bacteria | 3180 |
| 75 | Ga0070713_100124310 | 3300005436 | Bacteria | 2267 |
| 76 | Ga0070713_100154448 | 3300005436 | Bacteria | 2044 |
| 77 | Ga0070713_100234602 | 3300005436 | Bacteria | 1669 |
| 78 | Ga0070713_100263889 | 3300005436 | Bacteria | 1575 |
| 79 | Ga0070710_10000122 | 3300005437 | Bacteria | 36506 |
| 80 | Ga0070710_10002549 | 3300005437 | Bacteria | 8642 |
| 81 | Ga0070710_10005500 | 3300005437 | Bacteria | 6022 |
| 82 | Ga0070710_10024969 | 3300005437 | Bacteria | 3159 |
| 83 | Ga0070710_10041832 | 3300005437 | Bacteria | 2531 |
| 84 | Ga0070710_10071555 | 3300005437 | Bacteria | 2000 |
| 85 | Ga0070710_10117994 | 3300005437 | Bacteria | 1602 |
| 86 | Ga0070711_100000421 | 3300005439 | Bacteria | 21991 |
| 87 | Ga0070711_100023470 | 3300005439 | Bacteria | 4012 |
| 88 | Ga0070711_100052212 | 3300005439 | Bacteria | 2812 |
| 89 | Ga0070711_100426264 | 3300005439 | Bacteria | 1082 |
| 90 | Ga0070711_100484054 | 3300005439 | Bacteria | 1018 |
| 91 | Ga0070711_100682168 | 3300005439 | Bacteria | 864 |
| 92 | Ga0070705_100003344 | 3300005440 | Bacteria | 7872 |
| 93 | Ga0070700_100000064 | 3300005441 | Bacteria | 78318 |
| 94 | Ga0070694_100173076 | 3300005444 | Bacteria | 1592 |
| 95 | Ga0070708_100026861 | 3300005445 | Bacteria | 4932 |
| 96 | Ga0070708_100043452 | 3300005445 | Bacteria | 3949 |
| 97 | Ga0070708_100104614 | 3300005445 | Bacteria | 2596 |
| 98 | Ga0070708_100132463 | 3300005445 | Bacteria | 2308 |
| 99 | Ga0070708_100364242 | 3300005445 | Bacteria | 1362 |
| 100 | Ga0070708_100366596 | 3300005445 | Bacteria | 1358 |
| 101 | Ga0070708_101081058 | 3300005445 | Bacteria | 751 |
| 102 | Ga0070663_100063514 | 3300005455 | Bacteria | 2666 |
| 103 | Ga0070663_100155171 | 3300005455 | Bacteria | 1758 |
| 104 | Ga0070678_100010423 | 3300005456 | Bacteria | 5677 |
| 105 | Ga0070678_100030918 | 3300005456 | Bacteria | 3687 |
| 106 | Ga0070678_100139558 | 3300005456 | Bacteria | 1937 |
| 107 | Ga0070681_10014130 | 3300005458 | Bacteria | 7946 |
| 108 | Ga0070681_10318200 | 3300005458 | Bacteria | 1465 |
| 109 | Ga0070681_10396346 | 3300005458 | Bacteria | 1291 |
| 110 | Ga0068867_100151666 | 3300005459 | Bacteria | 1821 |
| 111 | Ga0068867_100702227 | 3300005459 | Bacteria | 893 |
| 112 | Ga0070685_10173891 | 3300005466 | Bacteria | 1382 |
| 113 | Ga0070685_10215640 | 3300005466 | Bacteria | 1255 |
| 114 | Ga0070706_100004020 | 3300005467 | Bacteria | 14287 |
| 115 | Ga0070706_100005122 | 3300005467 | Bacteria | 12505 |
| 116 | Ga0070706_100005997 | 3300005467 | Bacteria | 11485 |
| 117 | Ga0070706_100008150 | 3300005467 | Bacteria | 9773 |
| 118 | Ga0070706_100009991 | 3300005467 | Bacteria | 8813 |
| 119 | Ga0070706_100021245 | 3300005467 | Bacteria | 5979 |
| 120 | Ga0070706_100026563 | 3300005467 | Bacteria | 5326 |
| 121 | Ga0070706_100064829 | 3300005467 | Bacteria | 3377 |
| 122 | Ga0070706_100106943 | 3300005467 | Bacteria | 2602 |
| 123 | Ga0070706_100125381 | 3300005467 | Bacteria | 2394 |
| 124 | Ga0070706_100276953 | 3300005467 | Bacteria | 1566 |
| 125 | Ga0070707_100000293 | 3300005468 | Bacteria | 49051 |
| 126 | Ga0070707_100003142 | 3300005468 | Bacteria | 15629 |
| 127 | Ga0070707_100005742 | 3300005468 | Bacteria | 11572 |
| 128 | Ga0070707_100015007 | 3300005468 | Bacteria | 7270 |
| 129 | Ga0070707_100021756 | 3300005468 | Bacteria | 6061 |
| 130 | Ga0070707_100029552 | 3300005468 | Bacteria | 5217 |
| 131 | Ga0070707_100058063 | 3300005468 | Bacteria | 3712 |
| 132 | Ga0070707_100090007 | 3300005468 | Bacteria | 2970 |
| 133 | Ga0070698_100000106 | 3300005471 | Bacteria | 69519 |
| 134 | Ga0070698_100000546 | 3300005471 | Bacteria | 40175 |
| 135 | Ga0070698_100004555 | 3300005471 | Bacteria | 15224 |
| 136 | Ga0070698_100007047 | 3300005471 | Bacteria | 12176 |
| 137 | Ga0070698_100014280 | 3300005471 | Bacteria | 8396 |
| 138 | Ga0070698_100018347 | 3300005471 | Bacteria | 7367 |
| 139 | Ga0070698_100019863 | 3300005471 | Bacteria | 7048 |
| 140 | Ga0070698_100046444 | 3300005471 | Bacteria | 4440 |
| 141 | Ga0070698_100070830 | 3300005471 | Bacteria | 3498 |
| 142 | Ga0070698_100079441 | 3300005471 | Bacteria | 3277 |
| 143 | Ga0070698_100206013 | 3300005471 | Bacteria | 1902 |
| 144 | Ga0070699_100000577 | 3300005518 | Bacteria | 34742 |
| 145 | Ga0070699_100459552 | 3300005518 | Bacteria | 1154 |
| 146 | Ga0070679_100084639 | 3300005530 | Bacteria | 3159 |
| 147 | Ga0070679_100093574 | 3300005530 | Bacteria | 2993 |
| 148 | Ga0070684_100013575 | 3300005535 | Bacteria | 6572 |
| 149 | Ga0070684_100604614 | 3300005535 | Bacteria | 1020 |
| 150 | Ga0070684_100621911 | 3300005535 | Bacteria | 1005 |
| 151 | Ga0070697_100029422 | 3300005536 | Bacteria | 4404 |
| 152 | Ga0070697_100069331 | 3300005536 | Bacteria | 2888 |
| 153 | Ga0070697_100357258 | 3300005536 | Bacteria | 1263 |
| 154 | Ga0068853_100073071 | 3300005539 | Bacteria | 2989 |
| 155 | Ga0068853_100275373 | 3300005539 | Bacteria | 1550 |
| 156 | Ga0070672_100075534 | 3300005543 | Bacteria | 2690 |
| 157 | Ga0070672_100143140 | 3300005543 | Bacteria | 1974 |
| 158 | Ga0070686_100026601 | 3300005544 | Bacteria | 3493 |
| 159 | Ga0070686_100035430 | 3300005544 | Bacteria | 3082 |
| 160 | Ga0070695_100059329 | 3300005545 | Bacteria | 2477 |
| 161 | Ga0070695_100341141 | 3300005545 | Bacteria | 1119 |
| 162 | Ga0070696_100097078 | 3300005546 | Bacteria | 2106 |
| 163 | Ga0070696_100187297 | 3300005546 | Bacteria | 1538 |
| 164 | Ga0070693_100035744 | 3300005547 | Bacteria | 2758 |
| 165 | Ga0070665_100000401 | 3300005548 | Bacteria | 63343 |
| 166 | Ga0070665_100032363 | 3300005548 | Bacteria | 5263 |
| 167 | Ga0070665_100087185 | 3300005548 | Bacteria | 3126 |
| 168 | Ga0070665_100141565 | 3300005548 | Bacteria | 2408 |
| 169 | Ga0068855_100050361 | 3300005563 | Bacteria | 4908 |
| 170 | Ga0068855_100077738 | 3300005563 | Bacteria | 3851 |
| 171 | Ga0070664_100078425 | 3300005564 | Bacteria | 2841 |
| 172 | Ga0070664_100422789 | 3300005564 | Bacteria | 1221 |
| 173 | Ga0068857_100138478 | 3300005577 | Bacteria | 2199 |
| 174 | Ga0068857_100153423 | 3300005577 | Bacteria | 2088 |
| 175 | Ga0068857_100319118 | 3300005577 | Bacteria | 1434 |
| 176 | Ga0068854_100020711 | 3300005578 | Bacteria | 4456 |
| 177 | Ga0068854_100270222 | 3300005578 | Bacteria | 1365 |
| 178 | Ga0068854_100560443 | 3300005578 | Bacteria | 970 |
| 179 | Ga0068856_100015966 | 3300005614 | Bacteria | 7260 |
| 180 | Ga0068856_100025089 | 3300005614 | Bacteria | 5809 |
| 181 | Ga0068856_100035500 | 3300005614 | Bacteria | 4887 |
| 182 | Ga0068856_100042199 | 3300005614 | Bacteria | 4487 |
| 183 | Ga0068856_100268510 | 3300005614 | Bacteria | 1722 |
| 184 | Ga0068856_100749395 | 3300005614 | Bacteria | 997 |
| 185 | Ga0070702_100014799 | 3300005615 | Bacteria | 3967 |
| 186 | Ga0070702_100022796 | 3300005615 | Bacteria | 3317 |
| 187 | Ga0070702_100291093 | 3300005615 | Bacteria | 1125 |
| 188 | Ga0068852_100022811 | 3300005616 | Bacteria | 5026 |
| 189 | Ga0068852_100050239 | 3300005616 | Bacteria | 3572 |
| 190 | Ga0068852_100148003 | 3300005616 | Bacteria | 2180 |
| 191 | Ga0068852_100203210 | 3300005616 | Bacteria | 1876 |
| 192 | Ga0068852_100212067 | 3300005616 | Bacteria | 1838 |
| 193 | Ga0068852_100395840 | 3300005616 | Bacteria | 1358 |
| 194 | Ga0068859_100099277 | 3300005617 | Bacteria | 2967 |
| 195 | Ga0068859_100145116 | 3300005617 | Bacteria | 2448 |
| 196 | Ga0068859_100575966 | 3300005617 | Bacteria | 1219 |
| 197 | Ga0068864_100006862 | 3300005618 | Bacteria | 9328 |
| 198 | Ga0068864_100064036 | 3300005618 | Bacteria | 3187 |
| 199 | Ga0068864_100193491 | 3300005618 | Bacteria | 1865 |
| 200 | Ga0068861_100337992 | 3300005719 | Bacteria | 1317 |
| 201 | Ga0068870_10118853 | 3300005840 | Bacteria | 1520 |
| 202 | Ga0068870_10266306 | 3300005840 | Bacteria | 1069 |
| 203 | Ga0068863_100001365 | 3300005841 | Bacteria | 24282 |
| 204 | Ga0068863_100043562 | 3300005841 | Bacteria | 4260 |
| 205 | Ga0068863_100055890 | 3300005841 | Bacteria | 3737 |
| 206 | Ga0068863_100080467 | 3300005841 | Bacteria | 3086 |
| 207 | Ga0068863_100306575 | 3300005841 | Bacteria | 1541 |
| 208 | Ga0068858_100000732 | 3300005842 | Bacteria | 34375 |
| 209 | Ga0068858_100027030 | 3300005842 | Bacteria | 5329 |
| 210 | Ga0068858_100059448 | 3300005842 | Bacteria | 3532 |
| 211 | Ga0068858_100382570 | 3300005842 | Bacteria | 1350 |
| 212 | Ga0068860_100000114 | 3300005843 | Bacteria | 128789 |
| 213 | Ga0068860_100038551 | 3300005843 | Bacteria | 4572 |
| 214 | Ga0068860_100054813 | 3300005843 | Bacteria | 3789 |
| 215 | Ga0068860_100254576 | 3300005843 | Bacteria | 1710 |
| 216 | Ga0068862_100077659 | 3300005844 | Bacteria | 2875 |
| 217 | Ga0068862_100220064 | 3300005844 | Bacteria | 1718 |
| 218 | Ga0081455_10000575 | 3300005937 | Bacteria | 47885 |
| 219 | Ga0081455_10020190 | 3300005937 | Bacteria | 6283 |
| 220 | Ga0081455_10167176 | 3300005937 | Bacteria | 1679 |
| 221 | Ga0081455_10540228 | 3300005937 | Bacteria | 773 |
| 222 | Ga0081540_1000171 | 3300005983 | Bacteria | 67920 |
| 223 | Ga0081540_1001613 | 3300005983 | Bacteria | 19226 |
| 224 | Ga0081540_1038105 | 3300005983 | Bacteria | 2538 |
| 225 | Ga0081540_1042201 | 3300005983 | Bacteria | 2355 |
| 226 | Ga0081539_10001059 | 3300005985 | Bacteria | 50280 |
| 227 | Ga0070717_10022210 | 3300006028 | Bacteria | 5012 |
| 228 | Ga0070717_10028429 | 3300006028 | Bacteria | 4476 |
| 229 | Ga0070717_10045339 | 3300006028 | Bacteria | 3594 |
| 230 | Ga0070717_10067916 | 3300006028 | Bacteria | 2967 |
| 231 | Ga0070717_10115085 | 3300006028 | Bacteria | 2298 |
| 232 | Ga0070717_10115967 | 3300006028 | Bacteria | 2289 |
| 233 | Ga0070717_10355399 | 3300006028 | Bacteria | 1310 |
| 234 | Ga0075365_10281722 | 3300006038 | Bacteria | 1170 |
| 235 | Ga0075365_10498273 | 3300006038 | Bacteria | 861 |
| 236 | Ga0075368_10265944 | 3300006042 | Bacteria | 735 |
| 237 | Ga0075363_100007574 | 3300006048 | Bacteria | 5003 |
| 238 | Ga0070715_10001293 | 3300006163 | Bacteria | 7179 |
| 239 | Ga0070715_10130593 | 3300006163 | Bacteria | 1208 |
| 240 | Ga0070715_10254649 | 3300006163 | Bacteria | 919 |
| 241 | Ga0070716_100003270 | 3300006173 | Bacteria | 7612 |
| 242 | Ga0070716_100027653 | 3300006173 | Bacteria | 3049 |
| 243 | Ga0070712_100005041 | 3300006175 | Bacteria | 8181 |
| 244 | Ga0070712_100005233 | 3300006175 | Bacteria | 8028 |
| 245 | Ga0070712_100021380 | 3300006175 | Bacteria | 4250 |
| 246 | Ga0070712_100088909 | 3300006175 | Bacteria | 2258 |
| 247 | Ga0070712_100110354 | 3300006175 | Bacteria | 2051 |
| 248 | Ga0070712_100571470 | 3300006175 | Bacteria | 954 |
| 249 | Ga0070712_100717585 | 3300006175 | Bacteria | 853 |
| 250 | Ga0097621_100024496 | 3300006237 | Bacteria | 4714 |
| 251 | Ga0097621_100117863 | 3300006237 | Bacteria | 2250 |
| 252 | Ga0075370_10103451 | 3300006353 | Bacteria | 1650 |
| 253 | Ga0068871_100036095 | 3300006358 | Bacteria | 3933 |
| 254 | Ga0068871_100704884 | 3300006358 | Bacteria | 925 |
| 255 | Ga0075428_100042278 | 3300006844 | Bacteria | 5011 |
| 256 | Ga0075428_100366688 | 3300006844 | Bacteria | 1545 |
| 257 | Ga0075431_100146985 | 3300006847 | Bacteria | 2429 |
| 258 | Ga0075433_10010525 | 3300006852 | Bacteria | 7430 |
| 259 | Ga0075433_10052150 | 3300006852 | Bacteria | 3564 |
| 260 | Ga0075433_10198443 | 3300006852 | Bacteria | 1784 |
| 261 | Ga0075434_100019525 | 3300006871 | Bacteria | 6560 |
| 262 | Ga0075434_100023481 | 3300006871 | Bacteria | 6011 |
| 263 | Ga0075434_100061569 | 3300006871 | Bacteria | 3734 |
| 264 | Ga0075434_100394683 | 3300006871 | Bacteria | 1404 |
| 265 | Ga0068865_100468726 | 3300006881 | Bacteria | 1044 |
| 266 | Ga0075436_100011256 | 3300006914 | Bacteria | 6136 |
| 267 | Ga0075436_100095199 | 3300006914 | Bacteria | 2071 |
| 268 | Ga0075436_100204030 | 3300006914 | Bacteria | 1401 |
| 269 | Ga0075436_100215724 | 3300006914 | Bacteria | 1361 |
| 270 | Ga0097620_100099277 | 3300006931 | Bacteria | 2967 |
| 271 | Ga0097620_100145123 | 3300006931 | Bacteria | 2448 |
| 272 | Ga0097620_100575958 | 3300006931 | Bacteria | 1219 |
| 273 | Ga0075435_100061791 | 3300007076 | Bacteria | 3039 |
| 274 | Ga0075435_100310246 | 3300007076 | Bacteria | 1350 |
| 275 | Ga0105251_10008325 | 3300009011 | Bacteria | 6260 |
| 276 | Ga0105251_10009100 | 3300009011 | Bacteria | 5910 |
| 277 | Ga0105251_10030150 | 3300009011 | Bacteria | 2726 |
| 278 | Ga0105244_10201807 | 3300009036 | Bacteria | 937 |
| 279 | Ga0105250_10016018 | 3300009092 | Bacteria | 3060 |
| 280 | Ga0105240_10058787 | 3300009093 | Bacteria | 4799 |
| 281 | Ga0105240_10085449 | 3300009093 | Bacteria | 3865 |
| 282 | Ga0105240_10088061 | 3300009093 | Bacteria | 3800 |
| 283 | Ga0111539_10015815 | 3300009094 | Bacteria | 9372 |
| 284 | Ga0111539_10143921 | 3300009094 | Bacteria | 2791 |
| 285 | Ga0105245_10008898 | 3300009098 | Bacteria | 8764 |
| 286 | Ga0105245_10090979 | 3300009098 | Bacteria | 2807 |
| 287 | Ga0105245_10104042 | 3300009098 | Bacteria | 2631 |
| 288 | Ga0105245_10360280 | 3300009098 | Bacteria | 1443 |
| 289 | Ga0105245_10373998 | 3300009098 | Bacteria | 1417 |
| 290 | Ga0105247_10000038 | 3300009101 | Bacteria | 164083 |
| 291 | Ga0105247_10003476 | 3300009101 | Bacteria | 10268 |
| 292 | Ga0105247_10030438 | 3300009101 | Bacteria | 3272 |
| 293 | Ga0105247_10186374 | 3300009101 | Bacteria | 1387 |
| 294 | Ga0114129_10011093 | 3300009147 | Bacteria | 12838 |
| 295 | Ga0114129_10093489 | 3300009147 | Bacteria | 4165 |
| 296 | Ga0105243_10007184 | 3300009148 | Bacteria | 8559 |
| 297 | Ga0105243_10013663 | 3300009148 | Bacteria | 6143 |
| 298 | Ga0105243_10021441 | 3300009148 | Bacteria | 4905 |
| 299 | Ga0105243_10037350 | 3300009148 | Bacteria | 3774 |
| 300 | Ga0105243_10126903 | 3300009148 | Bacteria | 2160 |
| 301 | Ga0105243_10470862 | 3300009148 | Bacteria | 1183 |
| 302 | Ga0105241_10021949 | 3300009174 | Bacteria | 4726 |
| 303 | Ga0105241_10026480 | 3300009174 | Bacteria | 4315 |
| 304 | Ga0105241_10026744 | 3300009174 | Bacteria | 4294 |
| 305 | Ga0105242_10040426 | 3300009176 | Bacteria | 3758 |
| 306 | Ga0105242_10055746 | 3300009176 | Bacteria | 3233 |
| 307 | Ga0105242_10172795 | 3300009176 | Bacteria | 1900 |
| 308 | Ga0105248_10004635 | 3300009177 | Bacteria | 15206 |
| 309 | Ga0105248_10150351 | 3300009177 | Bacteria | 2627 |
| 310 | Ga0105248_10299483 | 3300009177 | Bacteria | 1811 |
| 311 | Ga0105248_10785059 | 3300009177 | Bacteria | 1075 |
| 312 | Ga0105237_10095315 | 3300009545 | Bacteria | 2965 |
| 313 | Ga0105237_10201033 | 3300009545 | Bacteria | 1993 |
| 314 | Ga0105237_10797605 | 3300009545 | Bacteria | 951 |
| 315 | Ga0105238_10009629 | 3300009551 | Bacteria | 9667 |
| 316 | Ga0105238_10089976 | 3300009551 | Bacteria | 3057 |
| 317 | Ga0105238_10107688 | 3300009551 | Bacteria | 2768 |
| 318 | Ga0105238_10603642 | 3300009551 | Bacteria | 1106 |
| 319 | Ga0105249_10011339 | 3300009553 | Bacteria | 7826 |
| 320 | Ga0105249_10059762 | 3300009553 | Bacteria | 3496 |
| 321 | Ga0105249_10109889 | 3300009553 | Bacteria | 2604 |
| 322 | Ga0105249_10460205 | 3300009553 | Bacteria | 1312 |
| 323 | Ga0105249_10523618 | 3300009553 | Bacteria | 1233 |
| 324 | Ga0105249_10523642 | 3300009553 | Bacteria | 1233 |
| 325 | Ga0105239_10031946 | 3300010375 | Bacteria | 5784 |
| 326 | Ga0105239_10088101 | 3300010375 | Bacteria | 3422 |
| 327 | Ga0105239_10191487 | 3300010375 | Bacteria | 2289 |
| 328 | Ga0105239_10537759 | 3300010375 | Bacteria | 1330 |
| 329 | Ga0105239_10624742 | 3300010375 | Bacteria | 1229 |
| 330 | Ga0105239_10770420 | 3300010375 | Bacteria | 1102 |
| 331 | Ga0105246_10029622 | 3300011119 | Bacteria | 3606 |
| 332 | Ga0105246_10034148 | 3300011119 | Bacteria | 3386 |
| 333 | Ga0105246_10046747 | 3300011119 | Bacteria | 2953 |
| 334 | Ga0105246_10066977 | 3300011119 | Bacteria | 2515 |
| 335 | Ga0157345_1003149 | 3300012498 | Bacteria | 1193 |
| 336 | Ga0157373_10137647 | 3300013100 | Bacteria | 1717 |
| 337 | Ga0157371_10317202 | 3300013102 | Bacteria | 1130 |
| 338 | Ga0157370_10070210 | 3300013104 | Bacteria | 3307 |
| 339 | Ga0157370_10130425 | 3300013104 | Bacteria | 2345 |
| 340 | Ga0157370_10337002 | 3300013104 | Bacteria | 1390 |
| 341 | Ga0157370_10608524 | 3300013104 | Bacteria | 1000 |
| 342 | Ga0157369_10007003 | 3300013105 | Bacteria | 13010 |
| 343 | Ga0157369_10007588 | 3300013105 | Bacteria | 12482 |
| 344 | Ga0157369_10071651 | 3300013105 | Bacteria | 3720 |
| 345 | Ga0157369_10135443 | 3300013105 | Bacteria | 2608 |
| 346 | Ga0157369_10483585 | 3300013105 | Bacteria | 1281 |
| 347 | Ga0157374_10022784 | 3300013296 | Bacteria | 5592 |
| 348 | Ga0157374_10229451 | 3300013296 | Bacteria | 1823 |
| 349 | Ga0157374_10266988 | 3300013296 | Bacteria | 1687 |
| 350 | Ga0157374_10801467 | 3300013296 | Bacteria | 958 |
| 351 | Ga0157378_10284544 | 3300013297 | Bacteria | 1595 |
| 352 | Ga0163162_10127024 | 3300013306 | Bacteria | 2657 |
| 353 | Ga0163162_10217095 | 3300013306 | Bacteria | 2043 |
| 354 | Ga0163162_10255261 | 3300013306 | Bacteria | 1885 |
| 355 | Ga0163162_10400351 | 3300013306 | Bacteria | 1505 |
| 356 | Ga0163162_10793150 | 3300013306 | Bacteria | 1065 |
| 357 | Ga0157372_10000658 | 3300013307 | Bacteria | 37942 |
| 358 | Ga0157372_10084295 | 3300013307 | Bacteria | 3602 |
| 359 | Ga0157372_10158826 | 3300013307 | Bacteria | 2612 |
| 360 | Ga0157375_10026112 | 3300013308 | Bacteria | 5438 |
| 361 | Ga0157375_10306208 | 3300013308 | Bacteria | 1753 |
| 362 | Ga0157375_10381066 | 3300013308 | Bacteria | 1577 |
| 363 | Ga0157375_10421579 | 3300013308 | Bacteria | 1501 |
| 364 | Ga0157375_10544018 | 3300013308 | Bacteria | 1323 |
| 365 | Ga0157375_11064287 | 3300013308 | Bacteria | 946 |
| 366 | Ga0163163_10021634 | 3300014325 | Bacteria | 6073 |
| 367 | Ga0163163_10022975 | 3300014325 | Bacteria | 5913 |
| 368 | Ga0163163_10058181 | 3300014325 | Bacteria | 3822 |
| 369 | Ga0163163_10061951 | 3300014325 | Bacteria | 3706 |
| 370 | Ga0157380_10019875 | 3300014326 | Bacteria | 5012 |
| 371 | Ga0157380_10051491 | 3300014326 | Bacteria | 3256 |
| 372 | Ga0157380_10091361 | 3300014326 | Bacteria | 2513 |
| 373 | Ga0182008_10001457 | 3300014497 | Bacteria | 15816 |
| 374 | Ga0157377_10061621 | 3300014745 | Bacteria | 2144 |
| 375 | Ga0157377_10094225 | 3300014745 | Bacteria | 1773 |
| 376 | Ga0157379_10085479 | 3300014968 | Bacteria | 2827 |
| 377 | Ga0157379_10115944 | 3300014968 | Bacteria | 2408 |
| 378 | Ga0157379_10140904 | 3300014968 | Bacteria | 2174 |
| 379 | Ga0157376_10253081 | 3300014969 | Bacteria | 1646 |
| 380 | Ga0157376_10306358 | 3300014969 | Bacteria | 1505 |
| 381 | Ga0182007_10011898 | 3300015262 | Bacteria | 3367 |
| 382 | Ga0183367_1005 | 3300015688 | Bacteria | 652063 |
| 383 | Ga0163161_10102864 | 3300017792 | Bacteria | 2128 |
| 384 | Ga0163161_10192161 | 3300017792 | Bacteria | 1570 |
| 385 | Ga0163161_10334050 | 3300017792 | Bacteria | 1201 |
| 386 | Ga0197907_11486011 | 3300020069 | Bacteria | 1055 |
| 387 | Ga0206356_10464819 | 3300020070 | Bacteria | 1199 |
| 388 | Ga0206355_1573660 | 3300020076 | Bacteria | 2383 |
| 389 | Ga0206354_10632267 | 3300020081 | Bacteria | 1102 |
| 390 | Ga0206353_10972019 | 3300020082 | Bacteria | 1345 |
| 391 | Ga0206353_11335110 | 3300020082 | Bacteria | 784 |
| 392 | Ga0213874_10059141 | 3300021377 | Bacteria | 1196 |
| 393 | Ga0213875_10000537 | 3300021388 | Bacteria | 31171 |
| 394 | Ga0213875_10001614 | 3300021388 | Bacteria | 14256 |
| 395 | Ga0213875_10016464 | 3300021388 | Bacteria | 3583 |
| 396 | Ga0213875_10024228 | 3300021388 | Bacteria | 2895 |
| 397 | Ga0213875_10299394 | 3300021388 | Bacteria | 761 |
| 398 | Ga0224712_10004812 | 3300022467 | Bacteria | 3687 |
| 399 | Ga0224712_10012350 | 3300022467 | Bacteria | 2684 |
| 400 | Ga0224712_10016046 | 3300022467 | Bacteria | 2451 |
| 401 | Ga0224712_10050508 | 3300022467 | Bacteria | 1616 |
| 402 | Ga0224712_10122252 | 3300022467 | Bacteria | 1128 |
| 403 | Ga0224712_10138911 | 3300022467 | Bacteria | 1068 |
| 404 | Ga0209758_1005482 | 3300025297 | Bacteria | 9735 |
| 405 | Ga0207426_1004843 | 3300025302 | Bacteria | 6378 |
| 406 | Ga0207426_1008083 | 3300025302 | Bacteria | 4310 |
| 407 | Ga0207426_1010813 | 3300025302 | Bacteria | 3520 |
| 408 | Ga0207426_1048669 | 3300025302 | Bacteria | 1272 |
| 409 | Ga0207696_1048405 | 3300025711 | Bacteria | 1222 |
| 410 | Ga0207713_1005803 | 3300025735 | Bacteria | 7640 |
| 411 | Ga0207653_10009551 | 3300025885 | Bacteria | 3024 |
| 412 | Ga0207692_10002006 | 3300025898 | Bacteria | 7775 |
| 413 | Ga0207692_10012366 | 3300025898 | Bacteria | 3664 |
| 414 | Ga0207692_10015787 | 3300025898 | Bacteria | 3330 |
| 415 | Ga0207692_10026337 | 3300025898 | Bacteria | 2727 |
| 416 | Ga0207692_10056251 | 3300025898 | Bacteria | 2017 |
| 417 | Ga0207692_10118251 | 3300025898 | Bacteria | 1480 |
| 418 | Ga0207710_10000054 | 3300025900 | Bacteria | 180103 |
| 419 | Ga0207710_10000199 | 3300025900 | Bacteria | 56491 |
| 420 | Ga0207710_10009019 | 3300025900 | Bacteria | 4198 |
| 421 | Ga0207688_10013036 | 3300025901 | Bacteria | 4521 |
| 422 | Ga0207688_10022652 | 3300025901 | Bacteria | 3438 |
| 423 | Ga0207680_10024029 | 3300025903 | Bacteria | 3338 |
| 424 | Ga0207680_10121741 | 3300025903 | Bacteria | 1707 |
| 425 | Ga0207647_10013191 | 3300025904 | Bacteria | 5738 |
| 426 | Ga0207647_10027943 | 3300025904 | Bacteria | 3673 |
| 427 | Ga0207647_10052960 | 3300025904 | Bacteria | 2503 |
| 428 | Ga0207685_10008336 | 3300025905 | Bacteria | 2947 |
| 429 | Ga0207685_10021703 | 3300025905 | Bacteria | 2157 |
| 430 | Ga0207699_10000684 | 3300025906 | Bacteria | 16276 |
| 431 | Ga0207699_10002656 | 3300025906 | Bacteria | 8440 |
| 432 | Ga0207699_10005707 | 3300025906 | Bacteria | 5983 |
| 433 | Ga0207699_10014662 | 3300025906 | Bacteria | 4048 |
| 434 | Ga0207699_10014727 | 3300025906 | Bacteria | 4041 |
| 435 | Ga0207699_10037612 | 3300025906 | Bacteria | 2768 |
| 436 | Ga0207699_10337033 | 3300025906 | Bacteria | 1062 |
| 437 | Ga0207645_10051702 | 3300025907 | Bacteria | 2625 |
| 438 | Ga0207643_10022418 | 3300025908 | Bacteria | 3477 |
| 439 | Ga0207643_10166592 | 3300025908 | Bacteria | 1328 |
| 440 | Ga0207705_10000573 | 3300025909 | Bacteria | 30814 |
| 441 | Ga0207684_10000571 | 3300025910 | Bacteria | 44831 |
| 442 | Ga0207684_10001806 | 3300025910 | Bacteria | 22396 |
| 443 | Ga0207684_10014224 | 3300025910 | Bacteria | 6868 |
| 444 | Ga0207684_10019030 | 3300025910 | Bacteria | 5874 |
| 445 | Ga0207684_10025959 | 3300025910 | Bacteria | 4994 |
| 446 | Ga0207684_10061832 | 3300025910 | Bacteria | 3179 |
| 447 | Ga0207684_10066992 | 3300025910 | Bacteria | 3050 |
| 448 | Ga0207684_10073685 | 3300025910 | Bacteria | 2900 |
| 449 | Ga0207684_10144332 | 3300025910 | Bacteria | 2047 |
| 450 | Ga0207684_10236281 | 3300025910 | Bacteria | 1577 |
| 451 | Ga0207684_10282490 | 3300025910 | Bacteria | 1431 |
| 452 | Ga0207654_10024354 | 3300025911 | Bacteria | 3253 |
| 453 | Ga0207654_10036321 | 3300025911 | Bacteria | 2752 |
| 454 | Ga0207654_10534008 | 3300025911 | Bacteria | 832 |
| 455 | Ga0207707_10003446 | 3300025912 | Bacteria | 14027 |
| 456 | Ga0207707_10258377 | 3300025912 | Bacteria | 1512 |
| 457 | Ga0207695_10008627 | 3300025913 | Bacteria | 12733 |
| 458 | Ga0207695_10195826 | 3300025913 | Bacteria | 1937 |
| 459 | Ga0207695_10236258 | 3300025913 | Bacteria | 1730 |
| 460 | Ga0207695_10380506 | 3300025913 | Bacteria | 1297 |
| 461 | Ga0207671_10000188 | 3300025914 | Bacteria | 95365 |
| 462 | Ga0207671_10047172 | 3300025914 | Bacteria | 3189 |
| 463 | Ga0207671_10074718 | 3300025914 | Bacteria | 2533 |
| 464 | Ga0207693_10003796 | 3300025915 | Bacteria | 12867 |
| 465 | Ga0207693_10006369 | 3300025915 | Bacteria | 9780 |
| 466 | Ga0207693_10007211 | 3300025915 | Bacteria | 9152 |
| 467 | Ga0207693_10010872 | 3300025915 | Bacteria | 7385 |
| 468 | Ga0207693_10018090 | 3300025915 | Bacteria | 5615 |
| 469 | Ga0207693_10055665 | 3300025915 | Bacteria | 3103 |
| 470 | Ga0207693_10240941 | 3300025915 | Bacteria | 1420 |
| 471 | Ga0207693_10599488 | 3300025915 | Bacteria | 858 |
| 472 | Ga0207663_10001400 | 3300025916 | Bacteria | 11181 |
| 473 | Ga0207663_10003417 | 3300025916 | Bacteria | 7767 |
| 474 | Ga0207663_10016411 | 3300025916 | Bacteria | 4106 |
| 475 | Ga0207663_10022703 | 3300025916 | Bacteria | 3591 |
| 476 | Ga0207663_10034580 | 3300025916 | Bacteria | 3024 |
| 477 | Ga0207663_10056942 | 3300025916 | Bacteria | 2461 |
| 478 | Ga0207663_10129919 | 3300025916 | Bacteria | 1739 |
| 479 | Ga0207663_10494520 | 3300025916 | Bacteria | 949 |
| 480 | Ga0207660_10237112 | 3300025917 | Bacteria | 1436 |
| 481 | Ga0207660_10304771 | 3300025917 | Bacteria | 1269 |
| 482 | Ga0207660_10380767 | 3300025917 | Bacteria | 1134 |
| 483 | Ga0207662_10008460 | 3300025918 | Bacteria | 5634 |
| 484 | Ga0207662_10083704 | 3300025918 | Bacteria | 1950 |
| 485 | Ga0207657_10004980 | 3300025919 | Bacteria | 13974 |
| 486 | Ga0207657_10028697 | 3300025919 | Bacteria | 5072 |
| 487 | Ga0207657_10037201 | 3300025919 | Bacteria | 4349 |
| 488 | Ga0207652_10031799 | 3300025921 | Bacteria | 4433 |
| 489 | Ga0207652_10078417 | 3300025921 | Bacteria | 2884 |
| 490 | Ga0207652_10236479 | 3300025921 | Bacteria | 1647 |
| 491 | Ga0207646_10000050 | 3300025922 | Bacteria | 171554 |
| 492 | Ga0207646_10001770 | 3300025922 | Bacteria | 26156 |
| 493 | Ga0207646_10002450 | 3300025922 | Bacteria | 21909 |
| 494 | Ga0207646_10009108 | 3300025922 | Bacteria | 9854 |
| 495 | Ga0207646_10011667 | 3300025922 | Bacteria | 8497 |
| 496 | Ga0207646_10123924 | 3300025922 | Bacteria | 2323 |
| 497 | Ga0207694_10004684 | 3300025924 | Bacteria | 10647 |
| 498 | Ga0207694_10127303 | 3300025924 | Bacteria | 2039 |
| 499 | Ga0207694_10369184 | 3300025924 | Bacteria | 1190 |
| 500 | Ga0207650_10356812 | 3300025925 | Bacteria | 1204 |
| 501 | Ga0207659_10279814 | 3300025926 | Bacteria | 1364 |
| 502 | Ga0207687_10017480 | 3300025927 | Bacteria | 4723 |
| 503 | Ga0207687_10076551 | 3300025927 | Bacteria | 2404 |
| 504 | Ga0207687_10106279 | 3300025927 | Bacteria | 2075 |
| 505 | Ga0207687_10118225 | 3300025927 | Bacteria | 1978 |
| 506 | Ga0207687_10264640 | 3300025927 | Bacteria | 1372 |
| 507 | Ga0207687_10346363 | 3300025927 | Bacteria | 1209 |
| 508 | Ga0207700_10001148 | 3300025928 | Bacteria | 15212 |
| 509 | Ga0207700_10011993 | 3300025928 | Bacteria | 5562 |
| 510 | Ga0207700_10041144 | 3300025928 | Bacteria | 3379 |
| 511 | Ga0207700_10046488 | 3300025928 | Bacteria | 3210 |
| 512 | Ga0207700_10060814 | 3300025928 | Bacteria | 2862 |
| 513 | Ga0207700_10077499 | 3300025928 | Bacteria | 2582 |
| 514 | Ga0207700_10078444 | 3300025928 | Bacteria | 2569 |
| 515 | Ga0207700_10089443 | 3300025928 | Bacteria | 2427 |
| 516 | Ga0207700_10188450 | 3300025928 | Bacteria | 1732 |
| 517 | Ga0207700_10529867 | 3300025928 | Bacteria | 1044 |
| 518 | Ga0207664_10000009 | 3300025929 | Bacteria | 299246 |
| 519 | Ga0207664_10000298 | 3300025929 | Bacteria | 37109 |
| 520 | Ga0207664_10003123 | 3300025929 | Bacteria | 11003 |
| 521 | Ga0207664_10004567 | 3300025929 | Bacteria | 9378 |
| 522 | Ga0207664_10006510 | 3300025929 | Bacteria | 8038 |
| 523 | Ga0207664_10012203 | 3300025929 | Bacteria | 6141 |
| 524 | Ga0207664_10016910 | 3300025929 | Bacteria | 5334 |
| 525 | Ga0207664_10028591 | 3300025929 | Bacteria | 4238 |
| 526 | Ga0207664_10033127 | 3300025929 | Bacteria | 3967 |
| 527 | Ga0207664_10067915 | 3300025929 | Bacteria | 2862 |
| 528 | Ga0207664_10193522 | 3300025929 | Bacteria | 1752 |
| 529 | Ga0207664_10194744 | 3300025929 | Bacteria | 1747 |
| 530 | Ga0207664_10265488 | 3300025929 | Bacteria | 1502 |
| 531 | Ga0207664_10672954 | 3300025929 | Bacteria | 930 |
| 532 | Ga0207644_10376549 | 3300025931 | Bacteria | 1157 |
| 533 | Ga0207690_10715941 | 3300025932 | Bacteria | 824 |
| 534 | Ga0207706_10020091 | 3300025933 | Bacteria | 6002 |
| 535 | Ga0207686_10118300 | 3300025934 | Bacteria | 1799 |
| 536 | Ga0207709_10047213 | 3300025935 | Bacteria | 2616 |
| 537 | Ga0207709_10066719 | 3300025935 | Bacteria | 2268 |
| 538 | Ga0207670_10010705 | 3300025936 | Bacteria | 5294 |
| 539 | Ga0207670_10459137 | 3300025936 | Bacteria | 1028 |
| 540 | Ga0207669_10178475 | 3300025937 | Bacteria | 1520 |
| 541 | Ga0207669_10191156 | 3300025937 | Bacteria | 1477 |
| 542 | Ga0207704_10219204 | 3300025938 | Bacteria | 1406 |
| 543 | Ga0207665_10001293 | 3300025939 | Bacteria | 16911 |
| 544 | Ga0207665_10006161 | 3300025939 | Bacteria | 7965 |
| 545 | Ga0207665_10007145 | 3300025939 | Bacteria | 7391 |
| 546 | Ga0207665_10009393 | 3300025939 | Bacteria | 6417 |
| 547 | Ga0207665_10009599 | 3300025939 | Bacteria | 6355 |
| 548 | Ga0207665_10022631 | 3300025939 | Bacteria | 4136 |
| 549 | Ga0207665_10027491 | 3300025939 | Bacteria | 3758 |
| 550 | Ga0207665_10422739 | 3300025939 | Bacteria | 1018 |
| 551 | Ga0207691_10018488 | 3300025940 | Bacteria | 6606 |
| 552 | Ga0207691_10220118 | 3300025940 | Bacteria | 1646 |
| 553 | Ga0207711_10038262 | 3300025941 | Bacteria | 4078 |
| 554 | Ga0207711_10069180 | 3300025941 | Bacteria | 3059 |
| 555 | Ga0207711_10143807 | 3300025941 | Bacteria | 2147 |
| 556 | Ga0207711_10474577 | 3300025941 | Bacteria | 1165 |
| 557 | Ga0207689_10011071 | 3300025942 | Bacteria | 7751 |
| 558 | Ga0207689_10116096 | 3300025942 | Bacteria | 2200 |
| 559 | Ga0207689_10886559 | 3300025942 | Bacteria | 753 |
| 560 | Ga0207661_10044710 | 3300025944 | Bacteria | 3502 |
| 561 | Ga0207661_10295793 | 3300025944 | Bacteria | 1450 |
| 562 | Ga0207661_10761574 | 3300025944 | Bacteria | 891 |
| 563 | Ga0207679_10088282 | 3300025945 | Bacteria | 2390 |
| 564 | Ga0207667_10034292 | 3300025949 | Bacteria | 5451 |
| 565 | Ga0207667_10067860 | 3300025949 | Bacteria | 3715 |
| 566 | Ga0207667_10114334 | 3300025949 | Bacteria | 2782 |
| 567 | Ga0207667_10338389 | 3300025949 | Bacteria | 1536 |
| 568 | Ga0207667_10664637 | 3300025949 | Bacteria | 1046 |
| 569 | Ga0207667_10692040 | 3300025949 | Bacteria | 1022 |
| 570 | Ga0207667_10740105 | 3300025949 | Bacteria | 983 |
| 571 | Ga0207651_10126687 | 3300025960 | Bacteria | 1947 |
| 572 | Ga0207651_10298946 | 3300025960 | Bacteria | 1338 |
| 573 | Ga0207712_10056414 | 3300025961 | Bacteria | 2767 |
| 574 | Ga0207712_10164450 | 3300025961 | Bacteria | 1728 |
| 575 | Ga0207668_10024607 | 3300025972 | Bacteria | 3889 |
| 576 | Ga0207668_10130099 | 3300025972 | Bacteria | 1921 |
| 577 | Ga0207668_10328361 | 3300025972 | Bacteria | 1272 |
| 578 | Ga0207640_10031406 | 3300025981 | Bacteria | 3281 |
| 579 | Ga0207640_10560147 | 3300025981 | Bacteria | 962 |
| 580 | Ga0207658_10042016 | 3300025986 | Bacteria | 3314 |
| 581 | Ga0207677_10038407 | 3300026023 | Bacteria | 3139 |
| 582 | Ga0207677_10405190 | 3300026023 | Bacteria | 1157 |
| 583 | Ga0207677_10900324 | 3300026023 | Bacteria | 797 |
| 584 | Ga0207703_10000047 | 3300026035 | Bacteria | 151177 |
| 585 | Ga0207703_10033367 | 3300026035 | Bacteria | 4080 |
| 586 | Ga0207639_10019625 | 3300026041 | Bacteria | 4824 |
| 587 | Ga0207639_10055105 | 3300026041 | Bacteria | 3042 |
| 588 | Ga0207639_10087274 | 3300026041 | Bacteria | 2486 |
| 589 | Ga0207678_10006256 | 3300026067 | Bacteria | 10574 |
| 590 | Ga0207678_10007661 | 3300026067 | Bacteria | 9536 |
| 591 | Ga0207678_10016809 | 3300026067 | Bacteria | 6426 |
| 592 | Ga0207678_10032239 | 3300026067 | Bacteria | 4567 |
| 593 | Ga0207678_10327538 | 3300026067 | Bacteria | 1318 |
| 594 | Ga0207708_10000076 | 3300026075 | Bacteria | 78340 |
| 595 | Ga0207708_10453641 | 3300026075 | Bacteria | 1068 |
| 596 | Ga0207702_10018387 | 3300026078 | Bacteria | 5783 |
| 597 | Ga0207702_10211140 | 3300026078 | Bacteria | 1805 |
| 598 | Ga0207702_10230973 | 3300026078 | Bacteria | 1729 |
| 599 | Ga0207702_10357366 | 3300026078 | Bacteria | 1399 |
| 600 | Ga0207702_10655929 | 3300026078 | Bacteria | 1032 |
| 601 | Ga0207702_10659437 | 3300026078 | Bacteria | 1029 |
| 602 | Ga0207702_10866727 | 3300026078 | Bacteria | 894 |
| 603 | Ga0207641_10043271 | 3300026088 | Bacteria | 3781 |
| 604 | Ga0207641_10315816 | 3300026088 | Bacteria | 1480 |
| 605 | Ga0207676_10071926 | 3300026095 | Bacteria | 2778 |
| 606 | Ga0207676_10112106 | 3300026095 | Bacteria | 2284 |
| 607 | Ga0207674_10105018 | 3300026116 | Bacteria | 2803 |
| 608 | Ga0207674_10161644 | 3300026116 | Bacteria | 2194 |
| 609 | Ga0207674_10190137 | 3300026116 | Bacteria | 2003 |
| 610 | Ga0207674_10470158 | 3300026116 | Bacteria | 1215 |
| 611 | Ga0207674_10672536 | 3300026116 | Bacteria | 1000 |
| 612 | Ga0207675_100036213 | 3300026118 | Bacteria | 4603 |
| 613 | Ga0207675_100083772 | 3300026118 | Bacteria | 2991 |
| 614 | Ga0207683_10008027 | 3300026121 | Bacteria | 9026 |
| 615 | Ga0207683_10010511 | 3300026121 | Bacteria | 7896 |
| 616 | Ga0207683_10019796 | 3300026121 | Bacteria | 5748 |
| 617 | Ga0207683_10118006 | 3300026121 | Bacteria | 2380 |
| 618 | Ga0207683_10591025 | 3300026121 | Bacteria | 1027 |
| 619 | Ga0207683_10785520 | 3300026121 | Bacteria | 884 |
| 620 | Ga0207698_10014788 | 3300026142 | Bacteria | 5201 |
| 621 | Ga0207698_10070428 | 3300026142 | Bacteria | 2771 |
| 622 | Ga0207698_10215039 | 3300026142 | Bacteria | 1732 |
| 623 | Ga0207698_10299760 | 3300026142 | Bacteria | 1496 |
| 624 | Ga0207698_10464844 | 3300026142 | Bacteria | 1224 |
| 625 | Ga0209371_1036492 | 3300027312 | Bacteria | 1027 |
| 626 | Ga0209179_1013955 | 3300027512 | Bacteria | 1468 |
| 627 | Ga0209282_1104653 | 3300027666 | Bacteria | 1450 |
| 628 | Ga0207428_10109901 | 3300027907 | Bacteria | 2123 |
| 629 | Ga0265357_1000648 | 3300028023 | Bacteria | 2169 |
| 630 | Ga0268266_10003295 | 3300028379 | Bacteria | 16228 |
| 631 | Ga0268266_10113916 | 3300028379 | Bacteria | 2399 |
| 632 | Ga0268266_10318640 | 3300028379 | Bacteria | 1455 |
| 633 | Ga0268266_10543717 | 3300028379 | Bacteria | 1112 |
| 634 | Ga0268265_10482871 | 3300028380 | Bacteria | 1164 |
| 635 | Ga0268264_10000147 | 3300028381 | Bacteria | 164790 |
| 636 | Ga0268264_10024763 | 3300028381 | Bacteria | 4902 |
| 637 | Ga0268264_10472530 | 3300028381 | Bacteria | 1218 |
| 638 | Ga0265337_1010294 | 3300028556 | Bacteria | 3282 |
| 639 | Ga0265326_10016736 | 3300028558 | Bacteria | 2117 |
| 640 | Ga0265319_1002778 | 3300028563 | Bacteria | 9388 |
| 641 | Ga0265334_10001473 | 3300028573 | Bacteria | 11343 |
| 642 | Ga0265334_10010969 | 3300028573 | Bacteria | 3823 |
| 643 | Ga0265318_10013803 | 3300028577 | Bacteria | 3403 |
| 644 | Ga0265323_10007434 | 3300028653 | Bacteria | 4552 |
| 645 | Ga0265322_10128498 | 3300028654 | Bacteria | 722 |
| 646 | Ga0265336_10009823 | 3300028666 | Bacteria | 3297 |
| 647 | Ga0307517_10010734 | 3300028786 | Bacteria | 12774 |
| 648 | Ga0307517_10016489 | 3300028786 | Bacteria | 9705 |
| 649 | Ga0307515_10003702 | 3300028794 | Bacteria | 32085 |
| 650 | Ga0307515_10043028 | 3300028794 | Bacteria | 7038 |
| 651 | Ga0307515_10078912 | 3300028794 | Bacteria | 4321 |
| 652 | Ga0307515_10113925 | 3300028794 | Bacteria | 3130 |
| 653 | Ga0307515_10346082 | 3300028794 | Bacteria | 1136 |
| 654 | Ga0307515_10355630 | 3300028794 | Bacteria | 1108 |
| 655 | Ga0307515_10421519 | 3300028794 | Bacteria | 955 |
| 656 | Ga0265338_10000125 | 3300028800 | Bacteria | 141151 |
| 657 | Ga0265338_10001588 | 3300028800 | Bacteria | 36478 |
| 658 | Ga0265338_10003580 | 3300028800 | Bacteria | 21688 |
| 659 | Ga0265338_10012554 | 3300028800 | Bacteria | 9650 |
| 660 | Ga0265324_10005383 | 3300029957 | Bacteria | 5539 |
| 661 | Ga0268256_1030226 | 3300030500 | Bacteria | 1315 |
| 662 | Ga0307511_10001286 | 3300030521 | Bacteria | 26612 |
| 663 | Ga0307511_10056779 | 3300030521 | Bacteria | 3055 |
| 664 | Ga0307512_10001726 | 3300030522 | Bacteria | 29809 |
| 665 | Ga0307512_10006664 | 3300030522 | Bacteria | 11634 |
| 666 | Ga0265766_1003975 | 3300030863 | Bacteria | 886 |
| 667 | Ga0265332_10059749 | 3300031238 | Bacteria | 1631 |
| 668 | Ga0265320_10007329 | 3300031240 | Bacteria | 6851 |
| 669 | Ga0265325_10018697 | 3300031241 | Bacteria | 3842 |
| 670 | Ga0265340_10000127 | 3300031247 | Bacteria | 37974 |
| 671 | Ga0265340_10047965 | 3300031247 | Bacteria | 2077 |
| 672 | Ga0265339_10036771 | 3300031249 | Bacteria | 2738 |
| 673 | Ga0265316_10374245 | 3300031344 | Bacteria | 1028 |
| 674 | Ga0307513_10003878 | 3300031456 | Bacteria | 20119 |
| 675 | Ga0307513_10069197 | 3300031456 | Bacteria | 3694 |
| 676 | Ga0307509_10079436 | 3300031507 | Bacteria | 3396 |
| 677 | Ga0307509_10114455 | 3300031507 | Bacteria | 2692 |
| 678 | Ga0307508_10008805 | 3300031616 | Bacteria | 9311 |
| 679 | Ga0307508_10063253 | 3300031616 | Bacteria | 3265 |
| 680 | Ga0307508_10075915 | 3300031616 | Bacteria | 2938 |
| 681 | Ga0307514_10011203 | 3300031649 | Bacteria | 7460 |
| 682 | Ga0307514_10074227 | 3300031649 | Bacteria | 2539 |
| 683 | Ga0307514_10153866 | 3300031649 | Bacteria | 1537 |
| 684 | Ga0307514_10236484 | 3300031649 | Bacteria | 1100 |
| 685 | Ga0316579_10000077 | 3300031691 | Bacteria | 24927 |
| 686 | Ga0316579_10007071 | 3300031691 | Bacteria | 4617 |
| 687 | Ga0316579_10032470 | 3300031691 | Bacteria | 2394 |
| 688 | Ga0265314_10010681 | 3300031711 | Bacteria | 7641 |
| 689 | Ga0265342_10013026 | 3300031712 | Bacteria | 5603 |
| 690 | Ga0316576_10038983 | 3300031727 | Bacteria | 3409 |
| 691 | Ga0316576_10168165 | 3300031727 | Bacteria | 1654 |
| 692 | Ga0316576_10258203 | 3300031727 | Bacteria | 1307 |
| 693 | Ga0316578_10037179 | 3300031728 | Bacteria | 2804 |
| 694 | Ga0307516_10053784 | 3300031730 | Bacteria | 3936 |
| 695 | Ga0307516_10085042 | 3300031730 | Bacteria | 3001 |
| 696 | Ga0307516_10212121 | 3300031730 | Bacteria | 1650 |
| 697 | Ga0316577_10051727 | 3300031733 | Bacteria | 2292 |
| 698 | Ga0307410_10062443 | 3300031852 | Bacteria | 2553 |
| 699 | Ga0307410_10401842 | 3300031852 | Bacteria | 1107 |
| 700 | Ga0307406_10051528 | 3300031901 | Bacteria | 2614 |
| 701 | Ga0307407_10100086 | 3300031903 | Bacteria | 1797 |
| 702 | Ga0307407_10261421 | 3300031903 | Bacteria | 1191 |
| 703 | Ga0307412_10311139 | 3300031911 | Bacteria | 1249 |
| 704 | Ga0307409_100007448 | 3300031995 | Bacteria | 6547 |
| 705 | Ga0307409_100102486 | 3300031995 | Bacteria | 2378 |
| 706 | Ga0307409_100257551 | 3300031995 | Bacteria | 1599 |
| 707 | Ga0307409_100418407 | 3300031995 | Bacteria | 1285 |
| 708 | Ga0307409_100423753 | 3300031995 | Bacteria | 1277 |
| 709 | Ga0307409_100502748 | 3300031995 | Bacteria | 1181 |
| 710 | Ga0307409_100720625 | 3300031995 | Bacteria | 999 |
| 711 | Ga0307409_100778800 | 3300031995 | Bacteria | 962 |
| 712 | Ga0307409_101051235 | 3300031995 | Bacteria | 834 |
| 713 | Ga0307416_100010494 | 3300032002 | Bacteria | 6121 |
| 714 | Ga0307416_100748499 | 3300032002 | Bacteria | 1070 |
| 715 | Ga0307411_10179029 | 3300032005 | Bacteria | 1607 |
| 716 | Ga0307415_100017174 | 3300032126 | Bacteria | 4332 |
| 717 | Ga0307415_100670522 | 3300032126 | Bacteria | 932 |
| 718 | Ga0316583_10037382 | 3300032133 | Bacteria | 1721 |
| 719 | Ga0316580_10083713 | 3300032139 | Bacteria | 975 |
| 720 | Ga0307507_10000009 | 3300033179 | Bacteria | 265992 |
| 721 | Ga0307507_10065207 | 3300033179 | Bacteria | 3351 |
| 722 | Ga0307507_10152268 | 3300033179 | Bacteria | 1736 |
| 723 | Ga0307507_10198775 | 3300033179 | Bacteria | 1392 |
| 724 | Ga0307510_10046657 | 3300033180 | Bacteria | 4654 |
| 725 | Ga0316214_1000866 | 3300033545 | Bacteria | 3319 |
| 726 | Ga0316214_1001110 | 3300033545 | Bacteria | 3027 |
| 727 | Ga0316214_1029015 | 3300033545 | Bacteria | 784 |
| 728 | Ga0373930_0013153 | 3300034816 | Bacteria | 1521 |
| 729 | Ga0373959_0009081 | 3300034820 | Bacteria | 1706 |
| 730 | Ga0373938_0001761 | 3300034957 | Bacteria | 3454 |
| 731 | Ga0373926_0000156 | 3300035083 | Bacteria | 15071 |
| 732 | Ga0373926_0000832 | 3300035083 | Bacteria | 8754 |
| 733 | Ga0373926_0035486 | 3300035083 | Bacteria | 1769 |
| 734 | Ga0373926_0048779 | 3300035083 | Bacteria | 1523 |
| 735 | Ga0373934_0000058 | 3300035086 | Bacteria | 37451 |
| 736 | Ga0373934_0004599 | 3300035086 | Bacteria | 5101 |
| 737 | Ga0373934_0025399 | 3300035086 | Bacteria | 2294 |
| 738 | Ga0373934_0035510 | 3300035086 | Bacteria | 1961 |
| 739 | Ga0373934_0039886 | 3300035086 | Bacteria | 1851 |
| 740 | Ga0373940_0005394 | 3300035088 | Bacteria | 2768 |
| 741 | Ga0373944_0000925 | 3300035089 | Bacteria | 7261 |
| 742 | Ga0373944_0003386 | 3300035089 | Bacteria | 4112 |
| 743 | Ga0373949_0036185 | 3300035090 | Bacteria | 1196 |
| 744 | Ga0373951_0005589 | 3300035091 | Bacteria | 2914 |
| 745 | Ga0373952_0005808 | 3300035092 | Bacteria | 2267 |
| 746 | Ga0373923_0003028 | 3300035111 | Bacteria | 5313 |
| 747 | Ga0373923_0015058 | 3300035111 | Bacteria | 2914 |
| 748 | Ga0373923_0033594 | 3300035111 | Bacteria | 2077 |
| 749 | Ga0373923_0044608 | 3300035111 | Bacteria | 1838 |
| 750 | Ga0373923_0156828 | 3300035111 | Bacteria | 1036 |
| 751 | Ga0373932_0026901 | 3300035112 | Bacteria | 1569 |
| 752 | Ga0373936_0005337 | 3300035113 | Bacteria | 4837 |
| 753 | Ga0373936_0017711 | 3300035113 | Bacteria | 2745 |
| 754 | Ga0373939_0015568 | 3300035114 | Bacteria | 1992 |
| 755 | Ga0373941_0066178 | 3300035115 | Bacteria | 1188 |
| 756 | Ga0373945_0000023 | 3300035116 | Bacteria | 31398 |
| 757 | Ga0373945_0047461 | 3300035116 | Bacteria | 1570 |
| 758 | Ga0373953_0000217 | 3300035117 | Bacteria | 15671 |
| 759 | Ga0373953_0003800 | 3300035117 | Bacteria | 4753 |
| 760 | Ga0373953_0008649 | 3300035117 | Bacteria | 3467 |
| 761 | Ga0373953_0022344 | 3300035117 | Bacteria | 2384 |
| 762 | Ga0373954_0004267 | 3300035118 | Bacteria | 6144 |
| 763 | Ga0373954_0008892 | 3300035118 | Bacteria | 4419 |
| 764 | Ga0373954_0009716 | 3300035118 | Bacteria | 4236 |
| 765 | Ga0373954_0013477 | 3300035118 | Bacteria | 3643 |
| 766 | Ga0373954_0055904 | 3300035118 | Bacteria | 1857 |
| 767 | Ga0373954_0212017 | 3300035118 | Bacteria | 952 |
| 768 | Ga0373954_0325356 | 3300035118 | Bacteria | 759 |
| 769 | Ga0373956_0002963 | 3300035119 | Bacteria | 6871 |
| 770 | Ga0373956_0025873 | 3300035119 | Bacteria | 2538 |
| 771 | Ga0373956_0067870 | 3300035119 | Bacteria | 1624 |
| 772 | Ga0373956_0070348 | 3300035119 | Bacteria | 1596 |
| 773 | Ga0373956_0080149 | 3300035119 | Bacteria | 1497 |
| 774 | Ga0373956_0086580 | 3300035119 | Bacteria | 1442 |
| 775 | Ga0373956_0155156 | 3300035119 | Bacteria | 1078 |
| 776 | Ga0373957_0001086 | 3300035120 | Bacteria | 7184 |
| 777 | Ga0373957_0004423 | 3300035120 | Bacteria | 4277 |
| 778 | Ga0373957_0009415 | 3300035120 | Bacteria | 3196 |
| 779 | Ga0373957_0018314 | 3300035120 | Bacteria | 2451 |
| 780 | Ga0373957_0062251 | 3300035120 | Bacteria | 1447 |
| 781 | Ga0373957_0084453 | 3300035120 | Bacteria | 1256 |
| 782 | Ga0373957_0102878 | 3300035120 | Bacteria | 1145 |
| 783 | Ga0373960_0006179 | 3300035121 | Bacteria | 2801 |
| 784 | Ga0373960_0056719 | 3300035121 | Bacteria | 1177 |
| 785 | Ga0373943_0013589 | 3300035170 | Bacteria | 3678 |
| 786 | Ga0373943_0017395 | 3300035170 | Bacteria | 3289 |
| 787 | Ga0373943_0073664 | 3300035170 | Bacteria | 1735 |
| 788 | Ga0373943_0095458 | 3300035170 | Bacteria | 1546 |
| 789 | Ga0373943_0163722 | 3300035170 | Bacteria | 1213 |
| 790 | Ga0373946_0000155 | 3300035171 | Bacteria | 20705 |
| 791 | Ga0373946_0026077 | 3300035171 | Bacteria | 2302 |
| 792 | Ga0373946_0169938 | 3300035171 | Bacteria | 1028 |
| 793 | Ga0373955_0000156 | 3300035172 | Bacteria | 27424 |
| 794 | Ga0373955_0001996 | 3300035172 | Bacteria | 8807 |
| 795 | Ga0373955_0036158 | 3300035172 | Bacteria | 2619 |
| 796 | Ga0373955_0107816 | 3300035172 | Bacteria | 1607 |
| 797 | Ga0373955_0242601 | 3300035172 | Bacteria | 1079 |
| 798 | Ga0373955_0267249 | 3300035172 | Bacteria | 1027 |
| 799 | Ga0373955_0291805 | 3300035172 | Bacteria | 982 |
| 800 | Ga0373942_0007720 | 3300035207 | Bacteria | 2502 |
| 801 | Ga0373942_0012258 | 3300035207 | Bacteria | 2045 |
| 802 | Ga0373942_0143813 | 3300035207 | Bacteria | 761 |
| 803 | Ga0373962_0010234 | 3300035242 | Bacteria | 2334 |
| 804 | Ga0316574_0001785 | 3300035398 | Bacteria | 10457 |
| 805 | Ga0316574_0053143 | 3300035398 | Bacteria | 2528 |
| 806 | Ga0316574_0378355 | 3300035398 | Bacteria | 893 |
| 807 | Ga0373924_0001561 | 3300035410 | Bacteria | 7480 |
| 808 | Ga0373924_0004802 | 3300035410 | Bacteria | 4748 |
| 809 | Ga0373924_0021005 | 3300035410 | Bacteria | 2543 |
| 810 | Ga0373924_0173181 | 3300035410 | Bacteria | 949 |
| 811 | Ga0373931_0042796 | 3300035691 | Bacteria | 2382 |
| 812 | Ga0373931_0086392 | 3300035691 | Bacteria | 1740 |
| 813 | Ga0373931_0262341 | 3300035691 | Bacteria | 1054 |
| 814 | Ga0373935_0002708 | 3300035692 | Bacteria | 10195 |
| 815 | Ga0373935_0005390 | 3300035692 | Bacteria | 7535 |
| 816 | Ga0373935_0034511 | 3300035692 | Bacteria | 3153 |
| 817 | Ga0373935_0138420 | 3300035692 | Bacteria | 1642 |
| 818 | Ga0373927_0019143 | 3300035695 | Bacteria | 4489 |
| 819 | Ga0373927_0137679 | 3300035695 | Bacteria | 1596 |
| 820 | Ga0373927_0159577 | 3300035695 | Bacteria | 1477 |
| 821 | Ga0373927_0477572 | 3300035695 | Bacteria | 824 |
| 822 | Ga0373933_0000009 | 3300035724 | Bacteria | 112662 |
| 823 | Ga0373933_0004934 | 3300035724 | Bacteria | 7277 |
| 824 | Ga0373933_0029843 | 3300035724 | Bacteria | 3155 |
| 825 | Ga0373933_0069097 | 3300035724 | Bacteria | 2146 |
| 826 | Ga0373933_0103878 | 3300035724 | Bacteria | 1766 |
| 827 | Ga0373933_0130932 | 3300035724 | Bacteria | 1577 |
| 828 | Ga0373947_0000075 | 3300035725 | Bacteria | 50183 |
| 829 | Ga0373947_0137705 | 3300035725 | Bacteria | 1563 |
| 830 | Ga0373937_0000012 | 3300036401 | Bacteria | 159418 |
| 831 | Ga0373937_0035586 | 3300036401 | Bacteria | 4533 |
| 832 | Ga0373937_0046636 | 3300036401 | Bacteria | 3963 |
| 833 | Ga0373937_0085585 | 3300036401 | Bacteria | 2917 |
| 834 | Ga0373937_0092882 | 3300036401 | Bacteria | 2797 |
| 835 | Ga0373937_0133778 | 3300036401 | Bacteria | 2317 |
| 836 | Ga0373937_0214266 | 3300036401 | Bacteria | 1812 |
| 837 | Ga0373937_0355260 | 3300036401 | Bacteria | 1388 |
| 838 | Ga0316582_0013111 | 3300036647 | Bacteria | 4655 |
| 839 | Ga0316582_0029915 | 3300036647 | Bacteria | 3312 |
| 840 | Ga0316582_0220683 | 3300036647 | Bacteria | 1296 |
| 841 | Ga0316584_0060140 | 3300036712 | Bacteria | 2845 |
| 842 | Ga0373925_0000262 | 3300037068 | Bacteria | 54852 |
| 843 | Ga0373925_0001964 | 3300037068 | Bacteria | 17017 |
| 844 | Ga0373925_0011639 | 3300037068 | Bacteria | 6362 |
| 845 | Ga0373925_0015148 | 3300037068 | Bacteria | 5574 |
| 846 | Ga0373925_0146501 | 3300037068 | Bacteria | 1851 |
| 847 | Ga0373925_0202415 | 3300037068 | Bacteria | 1579 |
| 848 | Ga0373925_0254379 | 3300037068 | Bacteria | 1409 |
| 849 | Ga0373925_0254485 | 3300037068 | Bacteria | 1409 |
| 850 | Ga0395899_0007409 | 3300037312 | Bacteria | 8479 |
| 851 | Ga0395899_0065818 | 3300037312 | Bacteria | 2663 |
| 852 | Ga0395900_0030148 | 3300037418 | Bacteria | 5568 |
| 853 | Ga0395900_0110138 | 3300037418 | Bacteria | 2829 |
| 854 | Ga0395900_0248527 | 3300037418 | Bacteria | 1781 |
| 855 | Ga0395898_0005654 | 3300037466 | Bacteria | 13479 |
| 856 | Ga0395898_0005710 | 3300037466 | Bacteria | 13410 |
| 857 | Ga0395898_0048693 | 3300037466 | Bacteria | 4155 |
| 858 | Ga0395898_0066020 | 3300037466 | Bacteria | 3507 |
| 859 | Ga0395898_0117049 | 3300037466 | Bacteria | 2553 |
| 860 | Ga0395898_0123137 | 3300037466 | Bacteria | 2485 |
| 861 | Ga0395898_0139143 | 3300037466 | Bacteria | 2324 |
| 862 | Ga0395898_0182253 | 3300037466 | Bacteria | 2007 |
| 863 | Ga0395898_0431093 | 3300037466 | Bacteria | 1256 |
| 864 | Ga0436364_0109924 | 3300037853 | Bacteria | 16000 |
| 865 | Ga0436364_0138124 | 3300037853 | Bacteria | 7843 |
| 866 | Ga0436364_0392443 | 3300037853 | Bacteria | 1867 |
| 867 | Ga0436364_0647259 | 3300037853 | Bacteria | 794 |
| 868 | Ga0436364_0858481 | 3300037853 | Bacteria | 17713 |
| 869 | Ga0436364_0891745 | 3300037853 | Bacteria | 1734 |
| 870 | Ga0436364_0932176 | 3300037853 | Bacteria | 1054 |
| 871 | Ga0436364_1059010 | 3300037853 | Bacteria | 60327 |
| 872 | Ga0395901_0020046 | 3300038443 | Bacteria | 6842 |
| 873 | Ga0395901_0029954 | 3300038443 | Bacteria | 5606 |
| 874 | Ga0395901_0043581 | 3300038443 | Bacteria | 4653 |
| 875 | Ga0395901_0203596 | 3300038443 | Bacteria | 2074 |
| 876 | Ga0395901_0362343 | 3300038443 | Bacteria | 1495 |
| 877 | Ga0395901_0373590 | 3300038443 | Bacteria | 1468 |
| 878 | Ga0395901_0488586 | 3300038443 | Bacteria | 1255 |
| 879 | Ga0395901_0516645 | 3300038443 | Bacteria | 1214 |
| 880 | Ga0395901_0594418 | 3300038443 | Bacteria | 1116 |
| 881 | Ga0395901_0749100 | 3300038443 | Bacteria | 970 |
| 882 | Ga0395901_1081816 | 3300038443 | Bacteria | 773 |
| 883 | Ga0436365_0144311 | 3300039437 | Bacteria | 2167 |
| 884 | Ga0436365_0789144 | 3300039437 | Bacteria | 4499 |
| 885 | Ga0436365_1434079 | 3300039437 | Bacteria | 3109 |
| 886 | Ga0436360_0666661 | 3300039438 | Bacteria | 1110 |
| 887 | Ga0436363_0382238 | 3300039450 | Bacteria | 980 |
| 888 | Ga0436363_0859415 | 3300039450 | Bacteria | 1353 |
| 889 | Ga0436363_0995323 | 3300039450 | Bacteria | 822 |
| 890 | Ga0436362_0025783 | 3300039453 | Bacteria | 1834 |
| 891 | Ga0436362_0488032 | 3300039453 | Bacteria | 1153 |
| 892 | Ga0436362_0638503 | 3300039453 | Bacteria | 900 |
| 893 | Ga0436362_0944772 | 3300039453 | Bacteria | 1445 |
| 894 | Ga0439436_0000221 | 3300041404 | Bacteria | 13685 |
| 895 | Ga0439436_0000369 | 3300041404 | Bacteria | 11193 |
| 896 | Ga0439436_0008523 | 3300041404 | Bacteria | 3154 |
| 897 | Ga0439439_0004672 | 3300041406 | Bacteria | 3094 |
| 898 | Ga0439439_0071063 | 3300041406 | Bacteria | 932 |
| 899 | Ga0439439_0076794 | 3300041406 | Bacteria | 899 |
| 900 | Ga0439466_0037874 | 3300041411 | Bacteria | 1622 |
| 901 | Ga0451789_0394708 | 3300041443 | Bacteria | 864 |
| 902 | Ga0451793_1930165 | 3300041452 | Bacteria | 1084 |
| 903 | Ga0451833_1303516 | 3300041491 | Bacteria | 1405 |
| 904 | Ga0451837_0319373 | 3300041494 | Bacteria | 3822 |
| 905 | Ga0439433_0001075 | 3300041999 | Bacteria | 5544 |
| 906 | Ga0439433_0007557 | 3300041999 | Bacteria | 2348 |
| 907 | Ga0439448_0049198 | 3300042005 | Bacteria | 1378 |
| 908 | Ga0439448_0085699 | 3300042005 | Bacteria | 1061 |
| 909 | Ga0439449_0001351 | 3300042007 | Bacteria | 9619 |
| 910 | Ga0439449_0047792 | 3300042007 | Bacteria | 1584 |
| 911 | Ga0439449_0139201 | 3300042007 | Bacteria | 903 |
| 912 | Ga0439457_000912 | 3300042014 | Bacteria | 8905 |
| 913 | Ga0439457_003251 | 3300042014 | Bacteria | 4457 |
| 914 | Ga0439462_0003322 | 3300042015 | Bacteria | 3850 |
| 915 | Ga0450888_023225 | 3300042126 | Bacteria | 800 |
| 916 | Ga0450890_004402 | 3300042127 | Bacteria | 1841 |
| 917 | Ga0450897_002158 | 3300042128 | Bacteria | 1441 |
| 918 | Ga0450894_000165 | 3300042131 | Bacteria | 11729 |
| 919 | Ga0450895_001091 | 3300042132 | Bacteria | 1809 |
| 920 | Ga0450896_000843 | 3300042133 | Bacteria | 3488 |
| 921 | Ga0450898_026543 | 3300042134 | Bacteria | 1044 |
| 922 | Ga0450900_017926 | 3300042136 | Bacteria | 968 |
| 923 | Ga0450902_004816 | 3300042137 | Bacteria | 2018 |
| 924 | Ga0450903_003902 | 3300042138 | Bacteria | 2562 |
| 925 | Ga0450906_002967 | 3300042145 | Bacteria | 3681 |
| 926 | Ga0439458_0005305 | 3300042157 | Bacteria | 2899 |
| 927 | Ga0450908_000484 | 3300042184 | Bacteria | 7648 |
| 928 | Ga0439460_0064916 | 3300042461 | Bacteria | 1121 |
| 929 | Ga0466969_0011075 | 3300044656 | Bacteria | 4776 |
| 930 | Ga0466969_0014683 | 3300044656 | Bacteria | 4117 |
| 931 | Ga0466969_0029467 | 3300044656 | Bacteria | 2802 |
| 932 | Ga0466969_0140123 | 3300044656 | Bacteria | 1118 |
| 933 | Ga0466972_0003842 | 3300044658 | Bacteria | 7474 |
| 934 | Ga0466972_0003903 | 3300044658 | Bacteria | 7432 |
| 935 | Ga0466972_0010829 | 3300044658 | Bacteria | 4578 |
| 936 | Ga0466972_0143263 | 3300044658 | Bacteria | 1124 |
| 937 | Ga0466965_0000304 | 3300044683 | Bacteria | 16357 |
| 938 | Ga0466965_0028551 | 3300044683 | Bacteria | 2711 |
| 939 | Ga0466965_0042100 | 3300044683 | Bacteria | 2251 |
| 940 | Ga0466965_0104011 | 3300044683 | Bacteria | 1454 |
| 941 | Ga0466965_0171166 | 3300044683 | Bacteria | 1143 |
| 942 | Ga0466965_0198379 | 3300044683 | Bacteria | 1064 |
| 943 | Ga0466966_0008603 | 3300044684 | Bacteria | 6757 |
| 944 | Ga0466966_0043489 | 3300044684 | Bacteria | 2879 |
| 945 | Ga0466966_0045850 | 3300044684 | Bacteria | 2793 |
| 946 | Ga0466966_0050263 | 3300044684 | Bacteria | 2653 |
| 947 | Ga0466966_0063589 | 3300044684 | Bacteria | 2325 |
| 948 | Ga0466966_0457228 | 3300044684 | Bacteria | 767 |
| 949 | Ga0466961_0006417 | 3300044693 | Bacteria | 7468 |
| 950 | Ga0466961_0009741 | 3300044693 | Bacteria | 6114 |
| 951 | Ga0466961_0094517 | 3300044693 | Bacteria | 1886 |
| 952 | Ga0466961_0219468 | 3300044693 | Bacteria | 1172 |
| 953 | Ga0466961_0219638 | 3300044693 | Bacteria | 1172 |
| 954 | Ga0466961_0281864 | 3300044693 | Bacteria | 1017 |
| 955 | Ga0466963_0001543 | 3300044694 | Bacteria | 12482 |
| 956 | Ga0466963_0001954 | 3300044694 | Bacteria | 11303 |
| 957 | Ga0466963_0004547 | 3300044694 | Bacteria | 8078 |
| 958 | Ga0466963_0032003 | 3300044694 | Bacteria | 3403 |
| 959 | Ga0466963_0038082 | 3300044694 | Bacteria | 3144 |
| 960 | Ga0466963_0054026 | 3300044694 | Bacteria | 2669 |
| 961 | Ga0466963_0074239 | 3300044694 | Bacteria | 2293 |
| 962 | Ga0466963_0083702 | 3300044694 | Bacteria | 2164 |
| 963 | Ga0466963_0096421 | 3300044694 | Bacteria | 2020 |
| 964 | Ga0466963_0318529 | 3300044694 | Bacteria | 1094 |
| 965 | Ga0466964_0009875 | 3300044706 | Bacteria | 3597 |
| 966 | Ga0466971_0006461 | 3300044719 | Bacteria | 5092 |
| 967 | Ga0466971_0011590 | 3300044719 | Bacteria | 3861 |
| 968 | Ga0466971_0028559 | 3300044719 | Bacteria | 2495 |
| 969 | Ga0466971_0034980 | 3300044719 | Bacteria | 2252 |
| 970 | Ga0466971_0041072 | 3300044719 | Bacteria | 2077 |
| 971 | Ga0466971_0041165 | 3300044719 | Bacteria | 2075 |
| 972 | Ga0466971_0280450 | 3300044719 | Bacteria | 797 |
| 973 | Ga0466970_0000179 | 3300044765 | Bacteria | 30305 |
| 974 | Ga0466970_0006119 | 3300044765 | Bacteria | 5995 |
| 975 | Ga0466970_0096053 | 3300044765 | Bacteria | 1611 |
| 976 | Ga0466970_0119935 | 3300044765 | Bacteria | 1440 |
| 977 | Ga0466970_0272429 | 3300044765 | Bacteria | 951 |
| 978 | Ga0466957_0001101 | 3300044842 | Bacteria | 13974 |
| 979 | Ga0466957_0046598 | 3300044842 | Bacteria | 2632 |
| 980 | Ga0466957_0047119 | 3300044842 | Bacteria | 2618 |
| 981 | Ga0466957_0236810 | 3300044842 | Bacteria | 1210 |
| 982 | Ga0466957_0269937 | 3300044842 | Bacteria | 1136 |
| 983 | Ga0466957_0355331 | 3300044842 | Bacteria | 995 |
| 984 | Ga0466960_0002996 | 3300044901 | Bacteria | 6441 |
| 985 | Ga0466960_0043520 | 3300044901 | Bacteria | 2136 |
| 986 | Ga0466960_0184606 | 3300044901 | Bacteria | 1132 |
| 987 | Ga0466960_0310670 | 3300044901 | Bacteria | 890 |
| 988 | Ga0466959_0002789 | 3300045049 | Bacteria | 11249 |
| 989 | Ga0466959_0064052 | 3300045049 | Bacteria | 2669 |
| 990 | Ga0466959_0080783 | 3300045049 | Bacteria | 2343 |
| 991 | Ga0466959_0353256 | 3300045049 | Bacteria | 1002 |
| 992 | Ga0466958_0010946 | 3300045836 | Bacteria | 5096 |
| 993 | Ga0466958_0014015 | 3300045836 | Bacteria | 4573 |
| 994 | Ga0466958_0019871 | 3300045836 | Bacteria | 3913 |
| 995 | Ga0466958_0032131 | 3300045836 | Bacteria | 3121 |
| 996 | Ga0466958_0241273 | 3300045836 | Bacteria | 1155 |
| 997 | Ga0466958_0248102 | 3300045836 | Bacteria | 1138 |
| 998 | Ga0466958_0315677 | 3300045836 | Bacteria | 1004 |
| 999 | Ga0466967_0011410 | 3300045976 | Bacteria | 6728 |
| 1000 | Ga0466967_0028007 | 3300045976 | Bacteria | 4696 |
| 1001 | Ga0466967_0031778 | 3300045976 | Bacteria | 4450 |
| 1002 | Ga0466967_0065600 | 3300045976 | Bacteria | 3232 |
| 1003 | Ga0466967_0128608 | 3300045976 | Bacteria | 2349 |
| 1004 | Ga0466967_0155973 | 3300045976 | Bacteria | 2138 |
| 1005 | Ga0466967_0211964 | 3300045976 | Bacteria | 1837 |
| 1006 | Ga0466967_0415282 | 3300045976 | Bacteria | 1311 |
| 1007 | Ga0466967_0519108 | 3300045976 | Bacteria | 1170 |
| 1008 | Ga0466967_0678940 | 3300045976 | Bacteria | 1019 |
| 1009 | Ga0466967_0776438 | 3300045976 | Bacteria | 951 |
| 1010 | Ga0466967_1004868 | 3300045976 | Bacteria | 830 |
| 1011 | Ga0466967_1075215 | 3300045976 | Bacteria | 801 |
| 1012 | Ga0466967_1298927 | 3300045976 | Bacteria | 725 |
| 1013 | Ga0495617_002534 | 3300046452 | Bacteria | 7221 |
| 1014 | Ga0495617_157897 | 3300046452 | Bacteria | 720 |
| 1015 | Ga0495627_013158 | 3300046453 | Bacteria | 2916 |
| 1016 | Ga0495627_042990 | 3300046453 | Bacteria | 1383 |
| 1017 | Ga0495592_0000049 | 3300046454 | Bacteria | 113704 |
| 1018 | Ga0495592_0014903 | 3300046454 | Bacteria | 5899 |
| 1019 | Ga0495592_0040961 | 3300046454 | Bacteria | 3473 |
| 1020 | Ga0495592_0046032 | 3300046454 | Bacteria | 3253 |
| 1021 | Ga0495592_0070946 | 3300046454 | Bacteria | 2536 |
| 1022 | Ga0495592_0074524 | 3300046454 | Bacteria | 2465 |
| 1023 | Ga0495592_0099155 | 3300046454 | Bacteria | 2078 |
| 1024 | Ga0495603_0001554 | 3300046455 | Bacteria | 13423 |
| 1025 | Ga0495603_0001594 | 3300046455 | Bacteria | 13301 |
| 1026 | Ga0495603_0013288 | 3300046455 | Bacteria | 4977 |
| 1027 | Ga0495603_0016215 | 3300046455 | Bacteria | 4507 |
| 1028 | Ga0495603_0031472 | 3300046455 | Bacteria | 3194 |
| 1029 | Ga0495603_0046082 | 3300046455 | Bacteria | 2599 |
| 1030 | Ga0495603_0082929 | 3300046455 | Bacteria | 1877 |
| 1031 | Ga0495603_0146545 | 3300046455 | Bacteria | 1372 |
| 1032 | Ga0495603_0364295 | 3300046455 | Bacteria | 829 |
| 1033 | Ga0495590_0022011 | 3300046457 | Bacteria | 2256 |
| 1034 | Ga0495590_0044639 | 3300046457 | Bacteria | 1545 |
| 1035 | Ga0495590_0093346 | 3300046457 | Bacteria | 1066 |
| 1036 | Ga0495629_0002112 | 3300046459 | Bacteria | 15396 |
| 1037 | Ga0495629_0010288 | 3300046459 | Bacteria | 6813 |
| 1038 | Ga0495629_0048873 | 3300046459 | Bacteria | 2965 |
| 1039 | Ga0495629_0050531 | 3300046459 | Bacteria | 2911 |
| 1040 | Ga0495629_0056568 | 3300046459 | Bacteria | 2742 |
| 1041 | Ga0495629_0093561 | 3300046459 | Bacteria | 2097 |
| 1042 | Ga0495629_0109496 | 3300046459 | Bacteria | 1926 |
| 1043 | Ga0495629_0186003 | 3300046459 | Bacteria | 1439 |
| 1044 | Ga0495629_0188609 | 3300046459 | Bacteria | 1427 |
| 1045 | Ga0495629_0366042 | 3300046459 | Bacteria | 982 |
| 1046 | Ga0495638_0051975 | 3300046460 | Bacteria | 2554 |
| 1047 | Ga0495638_0077718 | 3300046460 | Bacteria | 2020 |
| 1048 | Ga0495638_0152161 | 3300046460 | Bacteria | 1341 |
| 1049 | Ga0495638_0163491 | 3300046460 | Bacteria | 1282 |
| 1050 | Ga0495641_0006736 | 3300046461 | Bacteria | 7379 |
| 1051 | Ga0495641_0016436 | 3300046461 | Bacteria | 3899 |
| 1052 | Ga0495641_0025068 | 3300046461 | Bacteria | 2930 |
| 1053 | Ga0495641_0065678 | 3300046461 | Bacteria | 1633 |
| 1054 | Ga0495641_0122110 | 3300046461 | Bacteria | 1162 |
| 1055 | Ga0495641_0174597 | 3300046461 | Bacteria | 961 |
| 1056 | Ga0495651_0000007 | 3300046462 | Bacteria | 158577 |
| 1057 | Ga0495651_0001322 | 3300046462 | Bacteria | 19203 |
| 1058 | Ga0495651_0001709 | 3300046462 | Bacteria | 16956 |
| 1059 | Ga0495651_0011440 | 3300046462 | Bacteria | 6817 |
| 1060 | Ga0495651_0013776 | 3300046462 | Bacteria | 6252 |
| 1061 | Ga0495651_0032077 | 3300046462 | Bacteria | 4098 |
| 1062 | Ga0495651_0047460 | 3300046462 | Bacteria | 3320 |
| 1063 | Ga0495651_0196207 | 3300046462 | Bacteria | 1416 |
| 1064 | Ga0495651_0276742 | 3300046462 | Bacteria | 1135 |
| 1065 | Ga0495653_0002706 | 3300046463 | Bacteria | 14128 |
| 1066 | Ga0495653_0009356 | 3300046463 | Bacteria | 8017 |
| 1067 | Ga0495653_0011729 | 3300046463 | Bacteria | 7155 |
| 1068 | Ga0495653_0069063 | 3300046463 | Bacteria | 2648 |
| 1069 | Ga0495653_0069203 | 3300046463 | Bacteria | 2645 |
| 1070 | Ga0495653_0072394 | 3300046463 | Bacteria | 2573 |
| 1071 | Ga0495653_0076433 | 3300046463 | Bacteria | 2489 |
| 1072 | Ga0495653_0105415 | 3300046463 | Bacteria | 2035 |
| 1073 | Ga0495653_0187823 | 3300046463 | Bacteria | 1412 |
| 1074 | Ga0495580_0088787 | 3300046472 | Bacteria | 2152 |
| 1075 | Ga0495580_0116065 | 3300046472 | Bacteria | 1859 |
| 1076 | Ga0495580_0203805 | 3300046472 | Bacteria | 1362 |
| 1077 | Ga0495582_0008843 | 3300046473 | Bacteria | 5555 |
| 1078 | Ga0495582_0018157 | 3300046473 | Bacteria | 3849 |
| 1079 | Ga0495582_0019820 | 3300046473 | Bacteria | 3677 |
| 1080 | Ga0495582_0034601 | 3300046473 | Bacteria | 2777 |
| 1081 | Ga0495582_0097616 | 3300046473 | Bacteria | 1643 |
| 1082 | Ga0495582_0173155 | 3300046473 | Bacteria | 1229 |
| 1083 | Ga0495605_0019223 | 3300046474 | Bacteria | 3654 |
| 1084 | Ga0495605_0081391 | 3300046474 | Bacteria | 1514 |
| 1085 | Ga0495605_0145250 | 3300046474 | Bacteria | 1061 |
| 1086 | Ga0495639_0008986 | 3300046475 | Bacteria | 4283 |
| 1087 | Ga0495639_0010613 | 3300046475 | Bacteria | 3967 |
| 1088 | Ga0495639_0022556 | 3300046475 | Bacteria | 2762 |
| 1089 | Ga0495639_0077375 | 3300046475 | Bacteria | 1544 |
| 1090 | Ga0495639_0142709 | 3300046475 | Bacteria | 1152 |
| 1091 | Ga0495662_0000163 | 3300046476 | Bacteria | 26131 |
| 1092 | Ga0495662_0010357 | 3300046476 | Bacteria | 4568 |
| 1093 | Ga0495662_0015181 | 3300046476 | Bacteria | 3741 |
| 1094 | Ga0495662_0051644 | 3300046476 | Bacteria | 1985 |
| 1095 | Ga0495662_0065279 | 3300046476 | Bacteria | 1759 |
| 1096 | Ga0495662_0103865 | 3300046476 | Bacteria | 1390 |
| 1097 | Ga0495664_0001047 | 3300046477 | Bacteria | 14288 |
| 1098 | Ga0495664_0005749 | 3300046477 | Bacteria | 6829 |
| 1099 | Ga0495664_0012698 | 3300046477 | Bacteria | 4770 |
| 1100 | Ga0495664_0032570 | 3300046477 | Bacteria | 3059 |
| 1101 | Ga0495664_0049010 | 3300046477 | Bacteria | 2507 |
| 1102 | Ga0495664_0049582 | 3300046477 | Bacteria | 2492 |
| 1103 | Ga0495664_0051332 | 3300046477 | Bacteria | 2448 |
| 1104 | Ga0495664_0077271 | 3300046477 | Bacteria | 1993 |
| 1105 | Ga0495664_0198339 | 3300046477 | Bacteria | 1216 |
| 1106 | Ga0495664_0299212 | 3300046477 | Bacteria | 971 |
| 1107 | Ga0495585_0003798 | 3300046492 | Bacteria | 10058 |
| 1108 | Ga0495585_0031254 | 3300046492 | Bacteria | 3023 |
| 1109 | Ga0495594_0016102 | 3300046499 | Bacteria | 3934 |
| 1110 | Ga0495594_0020549 | 3300046499 | Bacteria | 3517 |
| 1111 | Ga0495594_0057855 | 3300046499 | Bacteria | 2141 |
| 1112 | Ga0495594_0113890 | 3300046499 | Bacteria | 1526 |
| 1113 | Ga0495594_0128827 | 3300046499 | Bacteria | 1432 |
| 1114 | Ga0495594_0326107 | 3300046499 | Bacteria | 874 |
| 1115 | Ga0495596_0050341 | 3300046500 | Bacteria | 1632 |
| 1116 | Ga0495607_0254833 | 3300046501 | Bacteria | 843 |
| 1117 | Ga0495606_0013625 | 3300046507 | Bacteria | 6410 |
| 1118 | Ga0495608_0000015 | 3300046511 | Bacteria | 200266 |
| 1119 | Ga0495608_0017575 | 3300046511 | Bacteria | 4946 |
| 1120 | Ga0495608_0021907 | 3300046511 | Bacteria | 4382 |
| 1121 | Ga0495608_0024177 | 3300046511 | Bacteria | 4156 |
| 1122 | Ga0495608_0155193 | 3300046511 | Bacteria | 1457 |
| 1123 | Ga0495608_0159614 | 3300046511 | Bacteria | 1434 |
| 1124 | Ga0495608_0202332 | 3300046511 | Bacteria | 1251 |
| 1125 | Ga0495608_0366617 | 3300046511 | Bacteria | 885 |
| 1126 | Ga0495610_0004959 | 3300046512 | Bacteria | 9640 |
| 1127 | Ga0495616_0008463 | 3300046513 | Bacteria | 6094 |
| 1128 | Ga0495618_0006907 | 3300046514 | Bacteria | 6881 |
| 1129 | Ga0495618_0024295 | 3300046514 | Bacteria | 3753 |
| 1130 | Ga0495618_0089136 | 3300046514 | Bacteria | 1972 |
| 1131 | Ga0495618_0092236 | 3300046514 | Bacteria | 1936 |
| 1132 | Ga0495618_0101126 | 3300046514 | Bacteria | 1845 |
| 1133 | Ga0495618_0154577 | 3300046514 | Bacteria | 1464 |
| 1134 | Ga0495618_0167406 | 3300046514 | Bacteria | 1399 |
| 1135 | Ga0495618_0179717 | 3300046514 | Bacteria | 1345 |
| 1136 | Ga0495620_0047482 | 3300046515 | Bacteria | 1847 |
| 1137 | Ga0495620_0224594 | 3300046515 | Bacteria | 718 |
| 1138 | Ga0495628_0001681 | 3300046516 | Bacteria | 20199 |
| 1139 | Ga0495628_0002433 | 3300046516 | Bacteria | 16783 |
| 1140 | Ga0495628_0025594 | 3300046516 | Bacteria | 4820 |
| 1141 | Ga0495628_0074087 | 3300046516 | Bacteria | 2653 |
| 1142 | Ga0495628_0095221 | 3300046516 | Bacteria | 2300 |
| 1143 | Ga0495628_0116863 | 3300046516 | Bacteria | 2048 |
| 1144 | Ga0495628_0184372 | 3300046516 | Bacteria | 1577 |
| 1145 | Ga0495628_0219730 | 3300046516 | Bacteria | 1427 |
| 1146 | Ga0495630_0003597 | 3300046517 | Bacteria | 10796 |
| 1147 | Ga0495630_0030861 | 3300046517 | Bacteria | 3989 |
| 1148 | Ga0495630_0131528 | 3300046517 | Bacteria | 1900 |
| 1149 | Ga0495630_0303413 | 3300046517 | Bacteria | 1220 |
| 1150 | Ga0495630_0333377 | 3300046517 | Bacteria | 1160 |
| 1151 | Ga0495631_0005911 | 3300046518 | Bacteria | 6370 |
| 1152 | Ga0495637_0058397 | 3300046520 | Bacteria | 1590 |
| 1153 | Ga0495643_0012121 | 3300046522 | Bacteria | 5211 |
| 1154 | Ga0495648_0151473 | 3300046524 | Bacteria | 1209 |
| 1155 | Ga0495666_0026609 | 3300046526 | Bacteria | 2850 |
| 1156 | Ga0495666_0093232 | 3300046526 | Bacteria | 1420 |
| 1157 | Ga0495666_0123361 | 3300046526 | Bacteria | 1212 |
| 1158 | Ga0495666_0179321 | 3300046526 | Bacteria | 978 |
| 1159 | Ga0495642_0287921 | 3300046528 | Bacteria | 719 |
| 1160 | Ga0495652_0001157 | 3300046529 | Bacteria | 29740 |
| 1161 | Ga0495652_0001969 | 3300046529 | Bacteria | 21864 |
| 1162 | Ga0495652_0046161 | 3300046529 | Bacteria | 3741 |
| 1163 | Ga0495652_0049508 | 3300046529 | Bacteria | 3597 |
| 1164 | Ga0495652_0061099 | 3300046529 | Bacteria | 3182 |
| 1165 | Ga0495652_0064207 | 3300046529 | Bacteria | 3088 |
| 1166 | Ga0495652_0073989 | 3300046529 | Bacteria | 2834 |
| 1167 | Ga0495652_0284389 | 3300046529 | Bacteria | 1209 |
| 1168 | Ga0495652_0389385 | 3300046529 | Bacteria | 989 |
| 1169 | Ga0495654_0052892 | 3300046530 | Bacteria | 1975 |
| 1170 | Ga0495665_0004214 | 3300046531 | Bacteria | 7765 |
| 1171 | Ga0495665_0004805 | 3300046531 | Bacteria | 7292 |
| 1172 | Ga0495665_0034731 | 3300046531 | Bacteria | 2696 |
| 1173 | Ga0495665_0046298 | 3300046531 | Bacteria | 2310 |
| 1174 | Ga0495665_0166448 | 3300046531 | Bacteria | 1148 |
| 1175 | Ga0495640_0005364 | 3300046533 | Bacteria | 10196 |
| 1176 | Ga0495640_0008144 | 3300046533 | Bacteria | 8232 |
| 1177 | Ga0495640_0056612 | 3300046533 | Bacteria | 2678 |
| 1178 | Ga0495640_0074622 | 3300046533 | Bacteria | 2267 |
| 1179 | Ga0495640_0088651 | 3300046533 | Bacteria | 2044 |
| 1180 | Ga0495640_0099308 | 3300046533 | Bacteria | 1912 |
| 1181 | Ga0495640_0104125 | 3300046533 | Bacteria | 1860 |
| 1182 | Ga0495640_0165867 | 3300046533 | Bacteria | 1413 |
| 1183 | Ga0495640_0176501 | 3300046533 | Bacteria | 1363 |
| 1184 | Ga0495640_0268862 | 3300046533 | Bacteria | 1063 |
| 1185 | Ga0495586_0030108 | 3300046535 | Bacteria | 2905 |
| 1186 | Ga0495586_0071294 | 3300046535 | Bacteria | 1898 |
| 1187 | Ga0495587_0000032 | 3300046536 | Bacteria | 124143 |
| 1188 | Ga0495587_0004304 | 3300046536 | Bacteria | 9399 |
| 1189 | Ga0495587_0030319 | 3300046536 | Bacteria | 3280 |
| 1190 | Ga0495587_0036355 | 3300046536 | Bacteria | 2962 |
| 1191 | Ga0495587_0046097 | 3300046536 | Bacteria | 2588 |
| 1192 | Ga0495587_0157803 | 3300046536 | Bacteria | 1292 |
| 1193 | Ga0495587_0167586 | 3300046536 | Bacteria | 1248 |
| 1194 | Ga0495609_0008249 | 3300046538 | Bacteria | 5114 |
| 1195 | Ga0495597_0073531 | 3300046542 | Bacteria | 1469 |
| 1196 | Ga0495645_0013643 | 3300046543 | Bacteria | 5755 |
| 1197 | Ga0495645_0016859 | 3300046543 | Bacteria | 5228 |
| 1198 | Ga0495645_0061156 | 3300046543 | Bacteria | 2729 |
| 1199 | Ga0495645_0062886 | 3300046543 | Bacteria | 2688 |
| 1200 | Ga0495645_0068949 | 3300046543 | Bacteria | 2552 |
| 1201 | Ga0495645_0096810 | 3300046543 | Bacteria | 2102 |
| 1202 | Ga0495645_0099814 | 3300046543 | Bacteria | 2065 |
| 1203 | Ga0495645_0162284 | 3300046543 | Bacteria | 1544 |
| 1204 | Ga0495645_0242182 | 3300046543 | Bacteria | 1203 |
| 1205 | Ga0495645_0267136 | 3300046543 | Bacteria | 1130 |
| 1206 | Ga0495622_0005947 | 3300046557 | Bacteria | 5669 |
| 1207 | Ga0495622_0021107 | 3300046557 | Bacteria | 3034 |
| 1208 | Ga0495633_0288298 | 3300046558 | Bacteria | 746 |
| 1209 | Ga0495667_0008628 | 3300046559 | Bacteria | 6920 |
| 1210 | Ga0495667_0014297 | 3300046559 | Bacteria | 5361 |
| 1211 | Ga0495667_0127095 | 3300046559 | Bacteria | 1644 |
| 1212 | Ga0495667_0144359 | 3300046559 | Bacteria | 1533 |
| 1213 | Ga0495667_0162988 | 3300046559 | Bacteria | 1434 |
| 1214 | Ga0495667_0194755 | 3300046559 | Bacteria | 1298 |
| 1215 | Ga0495634_0006405 | 3300046642 | Bacteria | 8947 |
| 1216 | Ga0495634_0006867 | 3300046642 | Bacteria | 8606 |
| 1217 | Ga0495634_0016697 | 3300046642 | Bacteria | 5245 |
| 1218 | Ga0495634_0024117 | 3300046642 | Bacteria | 4271 |
| 1219 | Ga0495634_0029978 | 3300046642 | Bacteria | 3761 |
| 1220 | Ga0495634_0030299 | 3300046642 | Bacteria | 3738 |
| 1221 | Ga0495634_0233947 | 3300046642 | Bacteria | 1129 |
| 1222 | Ga0495611_0069557 | 3300046648 | Bacteria | 1608 |
| 1223 | Ga0495611_0090842 | 3300046648 | Bacteria | 1411 |
| 1224 | Ga0495625_0001776 | 3300046660 | Bacteria | 24861 |
| 1225 | Ga0495625_0038628 | 3300046660 | Bacteria | 3493 |
| 1226 | Ga0495625_0070707 | 3300046660 | Bacteria | 2450 |
| 1227 | Ga0495625_0150283 | 3300046660 | Bacteria | 1566 |
| 1228 | Ga0495635_0002928 | 3300046663 | Bacteria | 11723 |
| 1229 | Ga0495635_0006534 | 3300046663 | Bacteria | 8136 |
| 1230 | Ga0495635_0014928 | 3300046663 | Bacteria | 5434 |
| 1231 | Ga0495635_0016716 | 3300046663 | Bacteria | 5125 |
| 1232 | Ga0495635_0030421 | 3300046663 | Bacteria | 3752 |
| 1233 | Ga0495635_0041587 | 3300046663 | Bacteria | 3174 |
| 1234 | Ga0495635_0231708 | 3300046663 | Bacteria | 1248 |
| 1235 | Ga0495659_0115846 | 3300046664 | Bacteria | 1051 |
| 1236 | Ga0495661_0021386 | 3300046665 | Bacteria | 4218 |
| 1237 | Ga0495588_0005660 | 3300046674 | Bacteria | 5572 |
| 1238 | Ga0495588_0030229 | 3300046674 | Bacteria | 2722 |
| 1239 | Ga0495588_0053948 | 3300046674 | Bacteria | 2073 |
| 1240 | Ga0495657_0000106 | 3300046675 | Bacteria | 74585 |
| 1241 | Ga0495657_0002543 | 3300046675 | Bacteria | 15305 |
| 1242 | Ga0495657_0005981 | 3300046675 | Bacteria | 9551 |
| 1243 | Ga0495657_0012582 | 3300046675 | Bacteria | 6279 |
| 1244 | Ga0495657_0016670 | 3300046675 | Bacteria | 5347 |
| 1245 | Ga0495657_0020771 | 3300046675 | Bacteria | 4720 |
| 1246 | Ga0495657_0036983 | 3300046675 | Bacteria | 3368 |
| 1247 | Ga0495657_0060941 | 3300046675 | Bacteria | 2497 |
| 1248 | Ga0495657_0111171 | 3300046675 | Bacteria | 1735 |
| 1249 | Ga0495657_0265243 | 3300046675 | Bacteria | 1031 |
| 1250 | Ga0495657_0409050 | 3300046675 | Bacteria | 797 |
| 1251 | Ga0495599_0000414 | 3300046678 | Bacteria | 24387 |
| 1252 | Ga0495599_0006481 | 3300046678 | Bacteria | 7065 |
| 1253 | Ga0495599_0016216 | 3300046678 | Bacteria | 4624 |
| 1254 | Ga0495599_0032519 | 3300046678 | Bacteria | 3274 |
| 1255 | Ga0495599_0054425 | 3300046678 | Bacteria | 2506 |
| 1256 | Ga0495599_0089821 | 3300046678 | Bacteria | 1917 |
| 1257 | Ga0495623_0009879 | 3300046679 | Bacteria | 6182 |
| 1258 | Ga0495623_0019308 | 3300046679 | Bacteria | 4406 |
| 1259 | Ga0495623_0025742 | 3300046679 | Bacteria | 3789 |
| 1260 | Ga0495623_0050810 | 3300046679 | Bacteria | 2625 |
| 1261 | Ga0495623_0107046 | 3300046679 | Bacteria | 1698 |
| 1262 | Ga0495623_0252520 | 3300046679 | Bacteria | 991 |
| 1263 | Ga0495623_0332636 | 3300046679 | Bacteria | 831 |
| 1264 | Ga0495646_0002859 | 3300046680 | Bacteria | 10688 |
| 1265 | Ga0495646_0018949 | 3300046680 | Bacteria | 4357 |
| 1266 | Ga0495646_0020936 | 3300046680 | Bacteria | 4135 |
| 1267 | Ga0495646_0036623 | 3300046680 | Bacteria | 3038 |
| 1268 | Ga0495646_0038583 | 3300046680 | Bacteria | 2948 |
| 1269 | Ga0495646_0080871 | 3300046680 | Bacteria | 1894 |
| 1270 | Ga0495646_0122320 | 3300046680 | Bacteria | 1471 |
| 1271 | Ga0495647_0084457 | 3300046681 | Bacteria | 1292 |
| 1272 | Ga0495658_0047240 | 3300046683 | Bacteria | 2423 |
| 1273 | Ga0495658_0048373 | 3300046683 | Bacteria | 2398 |
| 1274 | Ga0495658_0065618 | 3300046683 | Bacteria | 2094 |
| 1275 | Ga0495658_0105565 | 3300046683 | Bacteria | 1687 |
| 1276 | Ga0495658_0456303 | 3300046683 | Bacteria | 816 |
| 1277 | Ga0495613_0002345 | 3300046689 | Bacteria | 14347 |
| 1278 | Ga0495613_0024867 | 3300046689 | Bacteria | 4462 |
| 1279 | Ga0495613_0048617 | 3300046689 | Bacteria | 3132 |
| 1280 | Ga0495613_0052053 | 3300046689 | Bacteria | 3016 |
| 1281 | Ga0495613_0094091 | 3300046689 | Bacteria | 2168 |
| 1282 | Ga0495613_0159831 | 3300046689 | Bacteria | 1603 |
| 1283 | Ga0495613_0250314 | 3300046689 | Bacteria | 1236 |
| 1284 | Ga0495613_0524589 | 3300046689 | Bacteria | 795 |
| 1285 | Ga0495613_0601785 | 3300046689 | Bacteria | 731 |
| 1286 | Ga0495624_0001191 | 3300046690 | Bacteria | 20556 |
| 1287 | Ga0495624_0002632 | 3300046690 | Bacteria | 13550 |
| 1288 | Ga0495624_0042798 | 3300046690 | Bacteria | 2893 |
| 1289 | Ga0495624_0057229 | 3300046690 | Bacteria | 2451 |
| 1290 | Ga0495624_0082408 | 3300046690 | Bacteria | 1991 |
| 1291 | Ga0495624_0129313 | 3300046690 | Bacteria | 1549 |
| 1292 | Ga0495624_0275902 | 3300046690 | Bacteria | 1015 |
| 1293 | Ga0495624_0284273 | 3300046690 | Bacteria | 998 |
| 1294 | Ga0495624_0359452 | 3300046690 | Bacteria | 875 |
| 1295 | Ga0495670_0034029 | 3300046691 | Bacteria | 2536 |
| 1296 | Ga0495670_0073647 | 3300046691 | Bacteria | 1731 |
| 1297 | Ga0495671_0104479 | 3300046692 | Bacteria | 1383 |
| 1298 | Ga0495649_0058252 | 3300046694 | Bacteria | 2082 |
| 1299 | Ga0495649_0070923 | 3300046694 | Bacteria | 1867 |
| 1300 | Ga0495589_0004731 | 3300046794 | Bacteria | 7225 |
| 1301 | Ga0495589_0043120 | 3300046794 | Bacteria | 2246 |
| 1302 | Ga0495589_0045168 | 3300046794 | Bacteria | 2189 |
| 1303 | Ga0495589_0168512 | 3300046794 | Bacteria | 1041 |
| 1304 | Ga0495600_0001446 | 3300046809 | Bacteria | 13159 |
| 1305 | Ga0495600_0004594 | 3300046809 | Bacteria | 8270 |
| 1306 | Ga0495600_0012322 | 3300046809 | Bacteria | 5344 |
| 1307 | Ga0495600_0016101 | 3300046809 | Bacteria | 4739 |
| 1308 | Ga0495600_0020341 | 3300046809 | Bacteria | 4246 |
| 1309 | Ga0495600_0022349 | 3300046809 | Bacteria | 4059 |
| 1310 | Ga0495600_0096553 | 3300046809 | Bacteria | 1926 |
| 1311 | Ga0495600_0112553 | 3300046809 | Bacteria | 1772 |
| 1312 | Ga0495600_0309098 | 3300046809 | Bacteria | 996 |
| 1313 | Ga0495660_0012621 | 3300046810 | Bacteria | 4903 |
| 1314 | Ga0495660_0255896 | 3300046810 | Bacteria | 810 |
| 1315 | Ga0495581_0030122 | 3300047315 | Bacteria | 3145 |
| 1316 | Ga0495581_0037431 | 3300047315 | Bacteria | 2808 |
| 1317 | Ga0495581_0040774 | 3300047315 | Bacteria | 2685 |
| 1318 | Ga0495581_0053224 | 3300047315 | Bacteria | 2338 |
| 1319 | Ga0495581_0064372 | 3300047315 | Bacteria | 2118 |
| 1320 | Ga0495604_0000062 | 3300047317 | Bacteria | 93264 |
| 1321 | Ga0495604_0000878 | 3300047317 | Bacteria | 25046 |
| 1322 | Ga0495604_0016358 | 3300047317 | Bacteria | 5929 |
| 1323 | Ga0495604_0031341 | 3300047317 | Bacteria | 4216 |
| 1324 | Ga0495604_0053909 | 3300047317 | Bacteria | 3105 |
| 1325 | Ga0495604_0063208 | 3300047317 | Bacteria | 2824 |
| 1326 | Ga0495604_0074780 | 3300047317 | Bacteria | 2552 |
| 1327 | Ga0495604_0097092 | 3300047317 | Bacteria | 2173 |
| 1328 | Ga0495604_0136584 | 3300047317 | Bacteria | 1756 |
| 1329 | Ga0495604_0199151 | 3300047317 | Bacteria | 1390 |
| 1330 | Ga0495604_0199416 | 3300047317 | Bacteria | 1389 |
| 1331 | Ga0495604_0262792 | 3300047317 | Bacteria | 1172 |
| 1332 | Ga0495636_0023512 | 3300047318 | Bacteria | 2495 |
| 1333 | Ga0495636_0127015 | 3300047318 | Bacteria | 1132 |
| 1334 | Ga0495674_0000654 | 3300047319 | Bacteria | 32473 |
| 1335 | Ga0495674_0014303 | 3300047319 | Bacteria | 7431 |
| 1336 | Ga0495674_0028679 | 3300047319 | Bacteria | 5070 |
| 1337 | Ga0495674_0042670 | 3300047319 | Bacteria | 4044 |
| 1338 | Ga0495674_0103586 | 3300047319 | Bacteria | 2419 |
| 1339 | Ga0495674_0120346 | 3300047319 | Bacteria | 2218 |
| 1340 | Ga0495674_0169028 | 3300047319 | Bacteria | 1825 |
| 1341 | Ga0495672_0051574 | 3300047320 | Bacteria | 2422 |
| 1342 | Ga0495676_0000150 | 3300047321 | Bacteria | 53407 |
| 1343 | Ga0495676_0001728 | 3300047321 | Bacteria | 19083 |
| 1344 | Ga0495676_0005833 | 3300047321 | Bacteria | 11302 |
| 1345 | Ga0495676_0007138 | 3300047321 | Bacteria | 10251 |
| 1346 | Ga0495676_0023708 | 3300047321 | Bacteria | 5321 |
| 1347 | Ga0495676_0036064 | 3300047321 | Bacteria | 4132 |
| 1348 | Ga0495676_0066375 | 3300047321 | Bacteria | 2796 |
| 1349 | Ga0495676_0096520 | 3300047321 | Bacteria | 2197 |
| 1350 | Ga0495676_0103858 | 3300047321 | Bacteria | 2097 |
| 1351 | Ga0495676_0198921 | 3300047321 | Bacteria | 1393 |
| 1352 | Ga0495680_0001896 | 3300047322 | Bacteria | 21959 |
| 1353 | Ga0495680_0016084 | 3300047322 | Bacteria | 6432 |
| 1354 | Ga0495680_0018955 | 3300047322 | Bacteria | 5827 |
| 1355 | Ga0495680_0020371 | 3300047322 | Bacteria | 5581 |
| 1356 | Ga0495680_0022021 | 3300047322 | Bacteria | 5322 |
| 1357 | Ga0495680_0047137 | 3300047322 | Bacteria | 3392 |
| 1358 | Ga0495680_0050025 | 3300047322 | Bacteria | 3269 |
| 1359 | Ga0495680_0057203 | 3300047322 | Bacteria | 3016 |
| 1360 | Ga0495680_0060126 | 3300047322 | Bacteria | 2931 |
| 1361 | Ga0495680_0089175 | 3300047322 | Bacteria | 2315 |
| 1362 | Ga0495680_0102082 | 3300047322 | Bacteria | 2136 |
| 1363 | Ga0495680_0144920 | 3300047322 | Bacteria | 1735 |
| 1364 | Ga0495687_002534 | 3300047443 | Bacteria | 14481 |
| 1365 | Ga0495675_0014468 | 3300047444 | Bacteria | 4986 |
| 1366 | Ga0495675_0017619 | 3300047444 | Bacteria | 4528 |
| 1367 | Ga0495675_0023625 | 3300047444 | Bacteria | 3918 |
| 1368 | Ga0495675_0102866 | 3300047444 | Bacteria | 1786 |
| 1369 | Ga0495675_0161720 | 3300047444 | Bacteria | 1378 |
| 1370 | Ga0495677_0057656 | 3300047445 | Bacteria | 1436 |
| 1371 | Ga0495685_001035 | 3300047447 | Bacteria | 8466 |
| 1372 | Ga0495685_018250 | 3300047447 | Bacteria | 2406 |
| 1373 | Ga0495685_136430 | 3300047447 | Bacteria | 800 |
| 1374 | Ga0495685_166961 | 3300047447 | Bacteria | 711 |
| 1375 | Ga0495681_0001177 | 3300047470 | Bacteria | 19878 |
| 1376 | Ga0495681_0011246 | 3300047470 | Bacteria | 5348 |
| 1377 | Ga0495681_0102854 | 3300047470 | Bacteria | 1246 |
| 1378 | Ga0495684_0004087 | 3300047471 | Bacteria | 11395 |
| 1379 | Ga0495684_0007997 | 3300047471 | Bacteria | 8174 |
| 1380 | Ga0495684_0016230 | 3300047471 | Bacteria | 5734 |
| 1381 | Ga0495684_0041054 | 3300047471 | Bacteria | 3546 |
| 1382 | Ga0495684_0050658 | 3300047471 | Bacteria | 3170 |
| 1383 | Ga0495684_0076311 | 3300047471 | Bacteria | 2545 |
| 1384 | Ga0495684_0116805 | 3300047471 | Bacteria | 2011 |
| 1385 | Ga0495684_0392390 | 3300047471 | Bacteria | 976 |
| 1386 | Ga0495686_0044711 | 3300047472 | Bacteria | 2803 |
| 1387 | Ga0495686_0374598 | 3300047472 | Bacteria | 769 |
| 1388 | Ga0495593_0008567 | 3300047673 | Bacteria | 5948 |
| 1389 | Ga0495593_0023902 | 3300047673 | Bacteria | 3391 |
| 1390 | Ga0495593_0059745 | 3300047673 | Bacteria | 1997 |
| 1391 | Ga0495593_0071813 | 3300047673 | Bacteria | 1797 |
| 1392 | Ga0495593_0115501 | 3300047673 | Bacteria | 1368 |
| 1393 | Ga0495602_0002545 | 3300048088 | Bacteria | 18578 |
| 1394 | Ga0495602_0028807 | 3300048088 | Bacteria | 5305 |
| 1395 | Ga0495602_0063161 | 3300048088 | Bacteria | 3210 |
| 1396 | Ga0495602_0094928 | 3300048088 | Bacteria | 2463 |
| 1397 | Ga0495602_0135146 | 3300048088 | Bacteria | 1960 |
| 1398 | Ga0495602_0148791 | 3300048088 | Bacteria | 1843 |
| 1399 | Ga0495602_0194062 | 3300048088 | Bacteria | 1554 |
| 1400 | Ga0495602_0215765 | 3300048088 | Bacteria | 1452 |
| 1401 | Ga0495602_0363396 | 3300048088 | Bacteria | 1041 |
| 1402 | Ga0495602_0449376 | 3300048088 | Bacteria | 910 |
| 1403 | Ga0495614_0000611 | 3300048089 | Bacteria | 14956 |
| 1404 | Ga0495614_0037662 | 3300048089 | Bacteria | 2075 |
| 1405 | Ga0495614_0044088 | 3300048089 | Bacteria | 1913 |
| 1406 | Ga0495614_0184814 | 3300048089 | Bacteria | 939 |
| 1407 | Ga0495615_0113718 | 3300048090 | Bacteria | 777 |
| 1408 | Ga0495626_0006328 | 3300048091 | Bacteria | 6752 |
| 1409 | Ga0496100_0027737 | 3300048903 | Bacteria | 3485 |
| 1410 | Ga0496100_0036636 | 3300048903 | Bacteria | 3096 |
| 1411 | Ga0496100_0078631 | 3300048903 | Bacteria | 2220 |
| 1412 | Ga0496100_0140651 | 3300048903 | Bacteria | 1710 |
| 1413 | Ga0496100_0150672 | 3300048903 | Bacteria | 1658 |
| 1414 | Ga0496100_0189882 | 3300048903 | Bacteria | 1491 |
| 1415 | Ga0496100_0229831 | 3300048903 | Bacteria | 1364 |
| 1416 | Ga0496101_0014873 | 3300048904 | Bacteria | 5237 |
| 1417 | Ga0496101_0028793 | 3300048904 | Bacteria | 3881 |
| 1418 | Ga0496101_0039436 | 3300048904 | Bacteria | 3359 |
| 1419 | Ga0496101_0057875 | 3300048904 | Bacteria | 2805 |
| 1420 | Ga0496101_0321634 | 3300048904 | Bacteria | 1214 |
| 1421 | Ga0496101_0344703 | 3300048904 | Bacteria | 1170 |
| 1422 | Ga0496101_0457770 | 3300048904 | Bacteria | 1007 |
| 1423 | Ga0496102_0006769 | 3300048905 | Bacteria | 9780 |
| 1424 | Ga0496102_0014285 | 3300048905 | Bacteria | 6901 |
| 1425 | Ga0496102_0027853 | 3300048905 | Bacteria | 5047 |
| 1426 | Ga0496102_0084947 | 3300048905 | Bacteria | 2922 |
| 1427 | Ga0496102_0093131 | 3300048905 | Bacteria | 2791 |
| 1428 | Ga0496102_0209726 | 3300048905 | Bacteria | 1837 |
| 1429 | Ga0496102_0509021 | 3300048905 | Bacteria | 1126 |
| 1430 | Ga0496102_0533770 | 3300048905 | Bacteria | 1096 |
| 1431 | Ga0496102_0653434 | 3300048905 | Bacteria | 975 |
| 1432 | Ga0496103_0020725 | 3300048906 | Bacteria | 3952 |
| 1433 | Ga0496103_0039720 | 3300048906 | Bacteria | 2891 |
| 1434 | Ga0496103_0044364 | 3300048906 | Bacteria | 2740 |
| 1435 | Ga0496103_0641226 | 3300048906 | Bacteria | 675 |
| 1436 | Ga0496104_0006175 | 3300048907 | Bacteria | 10521 |
| 1437 | Ga0496104_0008256 | 3300048907 | Bacteria | 9245 |
| 1438 | Ga0496104_0016097 | 3300048907 | Bacteria | 6787 |
| 1439 | Ga0496104_0072280 | 3300048907 | Bacteria | 3280 |
| 1440 | Ga0496104_0145656 | 3300048907 | Bacteria | 2274 |
| 1441 | Ga0496104_0162629 | 3300048907 | Bacteria | 2141 |
| 1442 | Ga0496104_0322655 | 3300048907 | Bacteria | 1457 |
| 1443 | Ga0496104_0334357 | 3300048907 | Bacteria | 1427 |
| 1444 | Ga0496104_0500953 | 3300048907 | Bacteria | 1126 |
| 1445 | Ga0496104_0570064 | 3300048907 | Bacteria | 1042 |
| 1446 | Ga0496104_0947992 | 3300048907 | Bacteria | 765 |
| 1447 | Ga0496105_0000770 | 3300048908 | Bacteria | 21786 |
| 1448 | Ga0496105_0001849 | 3300048908 | Bacteria | 15180 |
| 1449 | Ga0496105_0018813 | 3300048908 | Bacteria | 5562 |
| 1450 | Ga0496105_0032974 | 3300048908 | Bacteria | 4251 |
| 1451 | Ga0496105_0059034 | 3300048908 | Bacteria | 3165 |
| 1452 | Ga0496105_0066420 | 3300048908 | Bacteria | 2977 |
| 1453 | Ga0496105_0192886 | 3300048908 | Bacteria | 1665 |
| 1454 | Ga0496105_0387757 | 3300048908 | Bacteria | 1111 |
| 1455 | Ga0496106_0105759 | 3300048909 | Bacteria | 2187 |
| 1456 | Ga0496106_0260206 | 3300048909 | Bacteria | 1388 |
| 1457 | Ga0496106_0267558 | 3300048909 | Bacteria | 1368 |
| 1458 | Ga0496106_0351626 | 3300048909 | Bacteria | 1184 |
| 1459 | Ga0496106_0552765 | 3300048909 | Bacteria | 924 |
| 1460 | Ga0496107_0013004 | 3300048910 | Bacteria | 5815 |
| 1461 | Ga0496107_0025724 | 3300048910 | Bacteria | 4168 |
| 1462 | Ga0496107_0027912 | 3300048910 | Bacteria | 4009 |
| 1463 | Ga0496107_0151938 | 3300048910 | Bacteria | 1713 |
| 1464 | Ga0496107_0163235 | 3300048910 | Bacteria | 1652 |
| 1465 | Ga0496107_0197521 | 3300048910 | Bacteria | 1495 |
| 1466 | Ga0496107_0314608 | 3300048910 | Bacteria | 1165 |
| 1467 | Ga0496107_0360825 | 3300048910 | Bacteria | 1081 |
| 1468 | Ga0496107_0687800 | 3300048910 | Bacteria | 753 |
| 1469 | Ga0496108_0001256 | 3300048911 | Bacteria | 19832 |
| 1470 | Ga0496108_0056003 | 3300048911 | Bacteria | 3312 |
| 1471 | Ga0496108_0076757 | 3300048911 | Bacteria | 2824 |
| 1472 | Ga0496108_0077787 | 3300048911 | Bacteria | 2806 |
| 1473 | Ga0496108_0156347 | 3300048911 | Bacteria | 1969 |
| 1474 | Ga0496108_0170435 | 3300048911 | Bacteria | 1883 |
| 1475 | Ga0496108_0242654 | 3300048911 | Bacteria | 1567 |
| 1476 | Ga0496108_0274873 | 3300048911 | Bacteria | 1467 |
| 1477 | Ga0496108_0347647 | 3300048911 | Bacteria | 1294 |
| 1478 | Ga0496108_0373293 | 3300048911 | Bacteria | 1245 |
| 1479 | Ga0496108_0778364 | 3300048911 | Bacteria | 826 |
| 1480 | Ga0496109_0022092 | 3300048912 | Bacteria | 5631 |
| 1481 | Ga0496109_0028644 | 3300048912 | Bacteria | 4984 |
| 1482 | Ga0496109_0028918 | 3300048912 | Bacteria | 4962 |
| 1483 | Ga0496109_0074823 | 3300048912 | Bacteria | 3114 |
| 1484 | Ga0496109_0105066 | 3300048912 | Bacteria | 2622 |
| 1485 | Ga0496109_0117542 | 3300048912 | Bacteria | 2475 |
| 1486 | Ga0496109_0131240 | 3300048912 | Bacteria | 2338 |
| 1487 | Ga0496109_0154342 | 3300048912 | Bacteria | 2150 |
| 1488 | Ga0496109_0236245 | 3300048912 | Bacteria | 1720 |
| 1489 | Ga0496109_0251297 | 3300048912 | Bacteria | 1665 |
| 1490 | Ga0496109_0474045 | 3300048912 | Bacteria | 1182 |
| 1491 | Ga0496110_0022947 | 3300048913 | Bacteria | 5303 |
| 1492 | Ga0496110_0046500 | 3300048913 | Bacteria | 3797 |
| 1493 | Ga0496110_0049751 | 3300048913 | Bacteria | 3678 |
| 1494 | Ga0496110_0064333 | 3300048913 | Bacteria | 3241 |
| 1495 | Ga0496110_0126849 | 3300048913 | Bacteria | 2303 |
| 1496 | Ga0496110_0171323 | 3300048913 | Bacteria | 1969 |
| 1497 | Ga0496110_0193491 | 3300048913 | Bacteria | 1847 |
| 1498 | Ga0496110_0223498 | 3300048913 | Bacteria | 1712 |
| 1499 | Ga0496110_0402112 | 3300048913 | Bacteria | 1248 |
| 1500 | Ga0496110_0571790 | 3300048913 | Bacteria | 1026 |
| 1501 | Ga0496110_0874104 | 3300048913 | Bacteria | 804 |
| 1502 | Ga0496111_0001697 | 3300048914 | Bacteria | 12845 |
| 1503 | Ga0496111_0017359 | 3300048914 | Bacteria | 4976 |
| 1504 | Ga0496111_0019743 | 3300048914 | Bacteria | 4686 |
| 1505 | Ga0496111_0020319 | 3300048914 | Bacteria | 4622 |
| 1506 | Ga0496111_0035970 | 3300048914 | Bacteria | 3540 |
| 1507 | Ga0496111_0044283 | 3300048914 | Bacteria | 3199 |
| 1508 | Ga0496111_0347448 | 3300048914 | Bacteria | 1098 |
| 1509 | Ga0496111_0490330 | 3300048914 | Bacteria | 905 |
| 1510 | Ga0496112_0000586 | 3300048915 | Bacteria | 24986 |
| 1511 | Ga0496112_0028415 | 3300048915 | Bacteria | 5398 |
| 1512 | Ga0496112_0048959 | 3300048915 | Bacteria | 4141 |
| 1513 | Ga0496112_0088303 | 3300048915 | Bacteria | 3068 |
| 1514 | Ga0496112_0193140 | 3300048915 | Bacteria | 1997 |
| 1515 | Ga0496112_0674093 | 3300048915 | Bacteria | 963 |
| 1516 | Ga0496112_0905039 | 3300048915 | Bacteria | 804 |
| 1517 | Ga0496113_0015052 | 3300048916 | Bacteria | 5299 |
| 1518 | Ga0496113_0041324 | 3300048916 | Bacteria | 3402 |
| 1519 | Ga0496113_0059184 | 3300048916 | Bacteria | 2885 |
| 1520 | Ga0496113_0105996 | 3300048916 | Bacteria | 2183 |
| 1521 | Ga0496113_0119118 | 3300048916 | Bacteria | 2062 |
| 1522 | Ga0496113_0119629 | 3300048916 | Bacteria | 2058 |
| 1523 | Ga0496114_0004150 | 3300048917 | Bacteria | 11208 |
| 1524 | Ga0496114_0009285 | 3300048917 | Bacteria | 7804 |
| 1525 | Ga0496114_0028823 | 3300048917 | Bacteria | 4559 |
| 1526 | Ga0496114_0031007 | 3300048917 | Bacteria | 4398 |
| 1527 | Ga0496114_0067269 | 3300048917 | Bacteria | 3005 |
| 1528 | Ga0496114_0102807 | 3300048917 | Bacteria | 2441 |
| 1529 | Ga0496114_0134724 | 3300048917 | Bacteria | 2135 |
| 1530 | Ga0496114_0157514 | 3300048917 | Bacteria | 1972 |
| 1531 | Ga0496114_0278431 | 3300048917 | Bacteria | 1474 |
| 1532 | Ga0496114_0852798 | 3300048917 | Bacteria | 791 |
| 1533 | Ga0496114_0908831 | 3300048917 | Bacteria | 762 |
| 1534 | Ga0496115_0021963 | 3300048918 | Bacteria | 4935 |
| 1535 | Ga0496115_0028311 | 3300048918 | Bacteria | 4390 |
| 1536 | Ga0496115_0047442 | 3300048918 | Bacteria | 3435 |
| 1537 | Ga0496115_0207876 | 3300048918 | Bacteria | 1617 |
| 1538 | Ga0496115_0707159 | 3300048918 | Bacteria | 792 |
| 1539 | Ga0496119_0000200 | 3300048922 | Bacteria | 84506 |
| 1540 | Ga0496119_0000475 | 3300048922 | Bacteria | 54868 |
| 1541 | Ga0496119_0026206 | 3300048922 | Bacteria | 4047 |
| 1542 | Ga0496119_0054433 | 3300048922 | Bacteria | 2436 |
| 1543 | Ga0496120_0000353 | 3300048923 | Bacteria | 75672 |
| 1544 | Ga0496120_0002957 | 3300048923 | Bacteria | 16188 |
| 1545 | Ga0496121_0014747 | 3300048924 | Bacteria | 8256 |
| 1546 | Ga0496125_0293085 | 3300048928 | Bacteria | 1001 |
| 1547 | Ga0496126_0004952 | 3300048929 | Bacteria | 15533 |
| 1548 | Ga0496126_0026965 | 3300048929 | Bacteria | 5499 |
| 1549 | Ga0496126_0043878 | 3300048929 | Bacteria | 4121 |
| 1550 | Ga0496126_0184836 | 3300048929 | Bacteria | 1768 |
| 1551 | Ga0496126_0438497 | 3300048929 | Bacteria | 1053 |
| 1552 | Ga0495678_027678 | 3300049459 | Bacteria | 2402 |
| 1553 | Ga0495682_0041301 | 3300049460 | Bacteria | 1691 |
| 1554 | Ga0501031_0013166 | 3300049568 | Bacteria | 5398 |
| 1555 | Ga0501031_0014095 | 3300049568 | Bacteria | 5201 |
| 1556 | Ga0501031_0096162 | 3300049568 | Bacteria | 1933 |
| 1557 | Ga0501031_0310468 | 3300049568 | Bacteria | 1022 |
| 1558 | Ga0501031_0547186 | 3300049568 | Bacteria | 746 |
| 1559 | Ga0501031_0577604 | 3300049568 | Bacteria | 723 |
| 1560 | Ga0501032_0038311 | 3300049569 | Bacteria | 3265 |
| 1561 | Ga0501032_0076296 | 3300049569 | Bacteria | 2232 |
| 1562 | Ga0501032_0388240 | 3300049569 | Bacteria | 897 |
| 1563 | Ga0501033_0006244 | 3300049570 | Bacteria | 9338 |
| 1564 | Ga0501033_0032215 | 3300049570 | Bacteria | 3936 |
| 1565 | Ga0501033_0034045 | 3300049570 | Bacteria | 3822 |
| 1566 | Ga0501033_0111002 | 3300049570 | Bacteria | 1995 |
| 1567 | Ga0501033_0144725 | 3300049570 | Bacteria | 1717 |
| 1568 | Ga0501033_0150444 | 3300049570 | Bacteria | 1679 |
| 1569 | Ga0501034_0007085 | 3300049571 | Bacteria | 11960 |
| 1570 | Ga0501034_0008257 | 3300049571 | Bacteria | 11019 |
| 1571 | Ga0501034_0036552 | 3300049571 | Bacteria | 4974 |
| 1572 | Ga0501034_0062389 | 3300049571 | Bacteria | 3742 |
| 1573 | Ga0501034_0581792 | 3300049571 | Bacteria | 1026 |
| 1574 | Ga0501036_0000154 | 3300049572 | Bacteria | 45221 |
| 1575 | Ga0501036_0007966 | 3300049572 | Bacteria | 8671 |
| 1576 | Ga0501036_0010321 | 3300049572 | Bacteria | 7707 |
| 1577 | Ga0501036_0017214 | 3300049572 | Bacteria | 6041 |
| 1578 | Ga0501036_0046676 | 3300049572 | Bacteria | 3667 |
| 1579 | Ga0501036_0304204 | 3300049572 | Bacteria | 1333 |
| 1580 | Ga0501037_0006107 | 3300049573 | Bacteria | 8799 |
| 1581 | Ga0501037_0016220 | 3300049573 | Bacteria | 5482 |
| 1582 | Ga0501037_0050588 | 3300049573 | Bacteria | 3041 |
| 1583 | Ga0501037_0093624 | 3300049573 | Bacteria | 2172 |
| 1584 | Ga0501037_0629464 | 3300049573 | Bacteria | 718 |
| 1585 | Ga0501038_0008899 | 3300049574 | Bacteria | 9212 |
| 1586 | Ga0501038_0011859 | 3300049574 | Bacteria | 7955 |
| 1587 | Ga0501038_0029152 | 3300049574 | Bacteria | 4894 |
| 1588 | Ga0501038_0065187 | 3300049574 | Bacteria | 3104 |
| 1589 | Ga0501038_0181013 | 3300049574 | Bacteria | 1700 |
| 1590 | Ga0501038_0410994 | 3300049574 | Bacteria | 1045 |
| 1591 | Ga0501039_0015284 | 3300049575 | Bacteria | 5875 |
| 1592 | Ga0501039_0027179 | 3300049575 | Bacteria | 4399 |
| 1593 | Ga0501039_0095901 | 3300049575 | Bacteria | 2312 |
| 1594 | Ga0501039_0143434 | 3300049575 | Bacteria | 1876 |
| 1595 | Ga0501039_0730034 | 3300049575 | Bacteria | 774 |
| 1596 | Ga0501040_0028569 | 3300049576 | Bacteria | 3760 |
| 1597 | Ga0501040_0092810 | 3300049576 | Bacteria | 2099 |
| 1598 | Ga0501040_0267729 | 3300049576 | Bacteria | 1220 |
| 1599 | Ga0501041_0016820 | 3300049577 | Bacteria | 4352 |
| 1600 | Ga0501041_0020014 | 3300049577 | Bacteria | 3997 |
| 1601 | Ga0501042_0003066 | 3300049578 | Bacteria | 10404 |
| 1602 | Ga0501042_0033230 | 3300049578 | Bacteria | 3656 |
| 1603 | Ga0501042_0034260 | 3300049578 | Bacteria | 3601 |
| 1604 | Ga0501042_0084146 | 3300049578 | Bacteria | 2280 |
| 1605 | Ga0501042_0506112 | 3300049578 | Bacteria | 877 |
| 1606 | Ga0501043_0003227 | 3300049579 | Bacteria | 13459 |
| 1607 | Ga0501043_0005709 | 3300049579 | Bacteria | 10024 |
| 1608 | Ga0501043_0010922 | 3300049579 | Bacteria | 7112 |
| 1609 | Ga0501043_0013418 | 3300049579 | Bacteria | 6407 |
| 1610 | Ga0501043_0165569 | 3300049579 | Bacteria | 1726 |
| 1611 | Ga0501043_0233097 | 3300049579 | Bacteria | 1421 |
| 1612 | Ga0501046_0021502 | 3300049580 | Bacteria | 5323 |
| 1613 | Ga0501046_0046370 | 3300049580 | Bacteria | 3449 |
| 1614 | Ga0501046_0047282 | 3300049580 | Bacteria | 3411 |
| 1615 | Ga0501046_0181215 | 3300049580 | Bacteria | 1575 |
| 1616 | Ga0501047_0000033 | 3300049581 | Bacteria | 206961 |
| 1617 | Ga0501047_0000369 | 3300049581 | Bacteria | 50837 |
| 1618 | Ga0501047_0001481 | 3300049581 | Bacteria | 22897 |
| 1619 | Ga0501047_0029209 | 3300049581 | Bacteria | 5317 |
| 1620 | Ga0501047_0058613 | 3300049581 | Bacteria | 3719 |
| 1621 | Ga0501047_0099451 | 3300049581 | Bacteria | 2787 |
| 1622 | Ga0501047_0127143 | 3300049581 | Bacteria | 2429 |
| 1623 | Ga0501047_0183674 | 3300049581 | Bacteria | 1957 |
| 1624 | Ga0501047_0461742 | 3300049581 | Bacteria | 1098 |
| 1625 | Ga0501048_0003583 | 3300049582 | Bacteria | 11820 |
| 1626 | Ga0501048_0006936 | 3300049582 | Bacteria | 8607 |
| 1627 | Ga0501048_0007884 | 3300049582 | Bacteria | 8067 |
| 1628 | Ga0501048_0033083 | 3300049582 | Bacteria | 3736 |
| 1629 | Ga0501048_0287186 | 3300049582 | Bacteria | 1170 |
| 1630 | Ga0501067_0021266 | 3300049583 | Bacteria | 3589 |
| 1631 | Ga0501067_0339433 | 3300049583 | Bacteria | 837 |
| 1632 | Ga0501068_0013033 | 3300049584 | Bacteria | 4726 |
| 1633 | Ga0501068_0066962 | 3300049584 | Bacteria | 2188 |
| 1634 | Ga0501068_0126056 | 3300049584 | Bacteria | 1599 |
| 1635 | Ga0501068_0388112 | 3300049584 | Bacteria | 899 |
| 1636 | Ga0501069_0010447 | 3300049585 | Bacteria | 4913 |
| 1637 | Ga0501069_0066819 | 3300049585 | Bacteria | 2011 |
| 1638 | Ga0501069_0155485 | 3300049585 | Bacteria | 1315 |
| 1639 | Ga0501070_0005487 | 3300049586 | Bacteria | 10819 |
| 1640 | Ga0501070_0008402 | 3300049586 | Bacteria | 8720 |
| 1641 | Ga0501070_0040771 | 3300049586 | Bacteria | 3871 |
| 1642 | Ga0501070_0749249 | 3300049586 | Bacteria | 770 |
| 1643 | Ga0501071_0000622 | 3300049587 | Bacteria | 18372 |
| 1644 | Ga0501071_0015459 | 3300049587 | Bacteria | 5238 |
| 1645 | Ga0501072_0042082 | 3300049588 | Bacteria | 3588 |
| 1646 | Ga0501072_0097045 | 3300049588 | Bacteria | 2342 |
| 1647 | Ga0501073_0061740 | 3300049589 | Bacteria | 2614 |
| 1648 | Ga0501073_0206183 | 3300049589 | Bacteria | 1359 |
| 1649 | Ga0501073_0306197 | 3300049589 | Bacteria | 1096 |
| 1650 | Ga0501074_0003420 | 3300049590 | Bacteria | 11243 |
| 1651 | Ga0501074_0004389 | 3300049590 | Bacteria | 10081 |
| 1652 | Ga0501074_0012014 | 3300049590 | Bacteria | 6293 |
| 1653 | Ga0501074_0062681 | 3300049590 | Bacteria | 2678 |
| 1654 | Ga0501075_0056288 | 3300049591 | Bacteria | 2960 |
| 1655 | Ga0501075_0234055 | 3300049591 | Bacteria | 1401 |
| 1656 | Ga0501076_0002267 | 3300049592 | Bacteria | 13155 |
| 1657 | Ga0501076_0096796 | 3300049592 | Bacteria | 2377 |
| 1658 | Ga0501077_0048562 | 3300049593 | Bacteria | 2697 |
| 1659 | Ga0501077_0067104 | 3300049593 | Bacteria | 2275 |
| 1660 | Ga0501079_0016047 | 3300049741 | Bacteria | 5722 |
| 1661 | Ga0501079_0103124 | 3300049741 | Bacteria | 2212 |
| 1662 | Ga0501080_0032359 | 3300049742 | Bacteria | 4877 |
| 1663 | Ga0501080_0057577 | 3300049742 | Bacteria | 3618 |
| 1664 | Ga0501080_0064310 | 3300049742 | Bacteria | 3413 |
| 1665 | Ga0501081_0036447 | 3300049743 | Bacteria | 3354 |
| 1666 | Ga0501083_0001270 | 3300049744 | Bacteria | 17091 |
| 1667 | Ga0501083_0151204 | 3300049744 | Bacteria | 1520 |
| 1668 | Ga0501270_033114 | 3300049767 | Bacteria | 864 |
| 1669 | Ga0501035_0050911 | 3300049822 | Bacteria | 3709 |
| 1670 | Ga0501035_0151202 | 3300049822 | Bacteria | 2014 |
| 1671 | Ga0501035_0171437 | 3300049822 | Bacteria | 1874 |
| 1672 | Ga0501044_0003451 | 3300049823 | Bacteria | 17804 |
| 1673 | Ga0501044_0014764 | 3300049823 | Bacteria | 8420 |
| 1674 | Ga0501044_0032181 | 3300049823 | Bacteria | 5513 |
| 1675 | Ga0501044_0042581 | 3300049823 | Bacteria | 4721 |
| 1676 | Ga0501044_0043290 | 3300049823 | Bacteria | 4678 |
| 1677 | Ga0501044_0117041 | 3300049823 | Bacteria | 2669 |
| 1678 | Ga0501044_0168139 | 3300049823 | Bacteria | 2165 |
| 1679 | Ga0501044_0292757 | 3300049823 | Bacteria | 1559 |
| 1680 | Ga0501044_0677524 | 3300049823 | Bacteria | 918 |
| 1681 | Ga0501045_0000424 | 3300049824 | Bacteria | 25806 |
| 1682 | Ga0501045_0037402 | 3300049824 | Bacteria | 3527 |
| 1683 | Ga0501045_0057284 | 3300049824 | Bacteria | 2852 |
| 1684 | nmdc:mga03n38_7371_c1 | 3300050490 | Bacteria | 3889 |
| 1685 | nmdc:mga0yw44_510969_c1 | 3300050492 | Bacteria | 815 |
| 1686 | nmdc:mga05p37_145975_c1 | 3300050507 | Bacteria | 2897 |
| 1687 | nmdc:mga05p37_37397_c1 | 3300050507 | Bacteria | 5951 |
| 1688 | nmdc:mga06r32_521174_c1 | 3300050510 | Bacteria | 1164 |
| 1689 | nmdc:mga08y16_127471_c1 | 3300050511 | Bacteria | 2647 |
| 1690 | nmdc:mga08y16_198046_c1 | 3300050511 | Bacteria | 2082 |
| 1691 | nmdc:mga0n895_21840_c1 | 3300050512 | Bacteria | 5992 |
| 1692 | nmdc:mga0n895_23116_c1 | 3300050512 | Bacteria | 5839 |
| 1693 | nmdc:mga0n895_261667_c1 | 3300050512 | Bacteria | 1756 |
| 1694 | nmdc:mga0n895_303043_c1 | 3300050512 | Bacteria | 1620 |
| 1695 | nmdc:mga0rr50_67504_c1 | 3300050513 | Bacteria | 2717 |
| 1696 | nmdc:mga0rr50_93982_c1 | 3300050513 | Bacteria | 2341 |
| 1697 | nmdc:mga08x19_12213_c1 | 3300050514 | Bacteria | 5170 |
| 1698 | nmdc:mga08x19_135827_c1 | 3300050514 | Bacteria | 1658 |
| 1699 | nmdc:mga08x19_19788_c1 | 3300050514 | Bacteria | 4137 |
| 1700 | nmdc:mga08x19_253060_c1 | 3300050514 | Bacteria | 1216 |
| 1701 | nmdc:mga0a205_12233_c1 | 3300050515 | Bacteria | 7935 |
| 1702 | nmdc:mga0a205_152994_c1 | 3300050515 | Bacteria | 2205 |
| 1703 | nmdc:mga0a205_18672_c1 | 3300050515 | Bacteria | 6525 |
| 1704 | Ga0495601_0029968 | 3300053077 | Bacteria | 3378 |
| 1705 | Ga0495601_0035862 | 3300053077 | Bacteria | 3097 |
| 1706 | Ga0495601_0102025 | 3300053077 | Bacteria | 1854 |
| 1707 | Ga0495601_0180603 | 3300053077 | Bacteria | 1380 |
| 1708 | Ga0495601_0195085 | 3300053077 | Bacteria | 1323 |
| 1709 | Ga0495601_0291558 | 3300053077 | Bacteria | 1063 |
| 1710 | Ga0495601_0361339 | 3300053077 | Bacteria | 943 |
| 1711 | Ga0495612_0015838 | 3300053078 | Bacteria | 3022 |
| 1712 | Ga0495612_0023246 | 3300053078 | Bacteria | 2486 |
| 1713 | Ga0495612_0031195 | 3300053078 | Bacteria | 2148 |
| 1714 | Ga0495612_0048953 | 3300053078 | Bacteria | 1733 |
| 1715 | Ga0495612_0116533 | 3300053078 | Bacteria | 1147 |
| 1716 | Ga0495612_0169220 | 3300053078 | Bacteria | 956 |
| 1717 | Ga0495612_0172639 | 3300053078 | Bacteria | 947 |
| 1718 | Ga0495655_0004208 | 3300053083 | Bacteria | 2442 |
| 1719 | Ga0495655_0048185 | 3300053083 | Bacteria | 1117 |
| 1720 | Ga0495595_0004203 | 3300053084 | Bacteria | 5792 |
| 1721 | Ga0495595_0010359 | 3300053084 | Bacteria | 3873 |
| 1722 | Ga0495595_0027343 | 3300053084 | Bacteria | 2541 |
| 1723 | Ga0495619_0005533 | 3300053085 | Bacteria | 8016 |
| 1724 | Ga0495619_0055462 | 3300053085 | Bacteria | 2624 |
| 1725 | Ga0495619_0062929 | 3300053085 | Bacteria | 2471 |
| 1726 | Ga0495619_0095675 | 3300053085 | Bacteria | 2015 |
| 1727 | Ga0495619_0111525 | 3300053085 | Bacteria | 1869 |
| 1728 | Ga0495619_0137360 | 3300053085 | Bacteria | 1682 |
| 1729 | Ga0500578_0102675 | 3300053086 | Bacteria | 1808 |
| 1730 | Ga0500583_0160244 | 3300053092 | Bacteria | 1121 |
| 1731 | Ga0500654_149730 | 3300053099 | Bacteria | 824 |
| 1732 | Ga0500558_069221 | 3300053106 | Bacteria | 1459 |
| 1733 | Ga0500560_002512 | 3300053107 | Bacteria | 3521 |
| 1734 | Ga0500652_032895 | 3300053131 | Bacteria | 2046 |
| 1735 | Ga0500658_0174001 | 3300053134 | Bacteria | 978 |
| 1736 | Ga0500568_0003761 | 3300053139 | Bacteria | 8309 |
| 1737 | Ga0500573_0064343 | 3300053140 | Bacteria | 2098 |
| 1738 | Ga0500600_0067524 | 3300053149 | Bacteria | 1971 |
| 1739 | Ga0500616_0001111 | 3300053153 | Bacteria | 27803 |
| 1740 | Ga0500616_0001619 | 3300053153 | Bacteria | 20932 |
| 1741 | Ga0500616_0102913 | 3300053153 | Bacteria | 1392 |
| 1742 | Ga0500624_003031 | 3300053157 | Bacteria | 2220 |
| 1743 | Ga0500634_0186514 | 3300053161 | Bacteria | 927 |
| 1744 | Ga0500656_018751 | 3300053732 | Bacteria | 839 |
| 1745 | Ga0501084_0032890 | 3300054114 | Bacteria | 4339 |
| 1746 | Ga0501084_0041617 | 3300054114 | Bacteria | 3843 |
| 1747 | Ga0501084_1116875 | 3300054114 | Bacteria | 662 |
| 1748 | Ga0501082_0062906 | 3300060353 | Bacteria | 3195 |
| 1749 | Ga0501082_0077792 | 3300060353 | Bacteria | 2860 |
| 1750 | Ga0466962_0015486 | 3300061719 | Bacteria | 3677 |
| 1751 | Ga0466962_0017787 | 3300061719 | Bacteria | 3421 |
| 1752 | Ga0466962_0036829 | 3300061719 | Bacteria | 2342 |
| 1753 | Ga0466962_0036934 | 3300061719 | Bacteria | 2338 |
| 1754 | Ga0466962_0058723 | 3300061719 | Bacteria | 1836 |
| 1755 | Ga0466962_0063712 | 3300061719 | Bacteria | 1760 |
| 1756 | Ga0466962_0198539 | 3300061719 | Bacteria | 980 |
| 1757 | Ga0530510_0020733 | 3300061734 | Bacteria | 4675 |
| 1758 | Ga0530510_0052918 | 3300061734 | Bacteria | 2933 |
| 1759 | 2506868635 | 2506783011 | Bacteria | 5323186 |
| 1760 | 2528204225 | 2527291627 | Bacteria | 5309833 |
| 1761 | 2528214638 | 2527291629 | Bacteria | 5267418 |
| 1762 | 2546947015 | 2546825537 | Bacteria | 5389291 |
| 1763 | 2547408247 | 2547132111 | Bacteria | 8013147 |
| 1764 | 2554257211 | 2554235005 | Bacteria | 6457341 |
| 1765 | 2579747476 | 2576861822 | Bacteria | 5004595 |
| 1766 | 2579854487 | 2579778521 | Bacteria | 7624758 |
| 1767 | 2585299269 | 2582581312 | Bacteria | 7308206 |
| 1768 | 2585308921 | 2582581313 | Bacteria | 10042643 |
| 1769 | 2585313613 | 2582581314 | Bacteria | 11452267 |
| 1770 | 2616694936 | 2616644814 | Bacteria | 11555299 |
| 1771 | 2616904593 | 2616644941 | Bacteria | 8510691 |
| 1772 | 2619853873 | 2619618881 | Bacteria | 7521104 |
| 1773 | 2620349444 | 2619619003 | Bacteria | 7619552 |
| 1774 | 2623497760 | 2622736605 | Bacteria | 4992138 |
| 1775 | 2626634784 | 2626541554 | Bacteria | 7741902 |
| 1776 | 2643765071 | 2643221548 | Bacteria | 8053412 |
| 1777 | 2643768460 | 2643221549 | Bacteria | 4042819 |
| 1778 | 2643852315 | 2643221567 | Bacteria | 4163945 |
| 1779 | 2643899160 | 2643221578 | Bacteria | 9213798 |
| 1780 | 2643942410 | 2643221587 | Bacteria | 7586415 |
| 1781 | 2644111838 | 2643221619 | Bacteria | 4158469 |
| 1782 | 2644136837 | 2643221624 | Bacteria | 4384879 |
| 1783 | 2644182548 | 2643221632 | Bacteria | 3406696 |
| 1784 | 2644262424 | 2643221647 | Bacteria | 10741251 |
| 1785 | 2644390034 | 2643221670 | Bacteria | 6497041 |
| 1786 | 2644403343 | 2643221673 | Bacteria | 9196637 |
| 1787 | 2644429491 | 2643221677 | Bacteria | 7584031 |
| 1788 | 2644437260 | 2643221678 | Bacteria | 9540101 |
| 1789 | 2644446901 | 2643221679 | Bacteria | 3839507 |
| 1790 | 2644461090 | 2643221682 | Bacteria | 6743283 |
| 1791 | 2644607748 | 2643221711 | Bacteria | 4865335 |
| 1792 | 2644628998 | 2643221714 | Bacteria | 9015452 |
| 1793 | 2686543471 | 2684623036 | Bacteria | 5199090 |
| 1794 | 2731905894 | 2731639228 | Bacteria | 4187555 |
| 1795 | 2768643471 | 2767802112 | Bacteria | 6465194 |
| 1796 | 2774867137 | 2773857924 | Bacteria | 5256821 |
| 1797 | 2774905405 | 2773857933 | Bacteria | 5818019 |
| 1798 | 2784473081 | 2784132109 | Bacteria | 3141763 |
| 1799 | 2784588713 | 2784132148 | Bacteria | 8627943 |
| 1800 | 2785343161 | 2784746763 | Bacteria | 9783172 |
| 1801 | 2785369642 | 2784746768 | Bacteria | 10036182 |
| 1802 | 2786670728 | 2786546132 | Bacteria | 10419719 |
| 1803 | 2793978334 | 2791355406 | Bacteria | 11364898 |
| 1804 | 2799185849 | 2799112218 | Bacteria | 4315149 |
| 1805 | 2804846760 | 2802429296 | Bacteria | 7227771 |
| 1806 | 2808842163 | 2808606359 | Bacteria | 9866990 |
| 1807 | 2808871871 | 2808606365 | Bacteria | 4301966 |
| 1808 | 2808920696 | 2808606375 | Bacteria | 9466072 |
| 1809 | 2809232323 | 2808606448 | Bacteria | 8656184 |
| 1810 | 2810363084 | 2808606700 | Bacteria | 3482157 |
| 1811 | 2811849168 | 2808606982 | Bacteria | 7791042 |
| 1812 | 2812357965 | 2811994879 | Bacteria | 9313447 |
| 1813 | 2812373249 | 2811994882 | Bacteria | 4688362 |
| 1814 | 2812480415 | 2811994917 | Bacteria | 7761064 |
| 1815 | 2817509797 | 2816332305 | Bacteria | 2697803 |
| 1816 | 2819426049 | 2818991318 | Bacteria | 5266538 |
| 1817 | 2819665107 | 2818991458 | Bacteria | 4794049 |
| 1818 | 2819692822 | 2818991462 | Bacteria | 4320267 |
| 1819 | 2819695531 | 2818991463 | Bacteria | 7948711 |
| 1820 | 2819727221 | 2818991469 | Bacteria | 4644110 |
| 1821 | 2852636533 | 2852635781 | Bacteria | 8251373 |
| 1822 | 2856742975 | 2856741275 | Bacteria | 8096094 |
| 1823 | 2862179355 | 2862178590 | Bacteria | 8583590 |
| 1824 | 2862285778 | 2862281513 | Bacteria | 9621493 |
| 1825 | 2862297060 | 2862290372 | Bacteria | 7471434 |
| 1826 | 2862392144 | 2862382967 | Bacteria | 10317375 |
| 1827 | 2862511694 | 2862507626 | Bacteria | 9425308 |
| 1828 | 2862579128 | 2862574272 | Bacteria | 10567477 |
| 1829 | 2862706478 | 2862705112 | Bacteria | 6563286 |
| 1830 | 2863404461 | 2863404153 | Bacteria | 9672205 |
| 1831 | 2867348931 | 2867346516 | Bacteria | 7608576 |
| 1832 | 2867371996 | 2867369537 | Bacteria | 6501581 |
| 1833 | 2867432461 | 2867428634 | Bacteria | 9590268 |
| 1834 | 2867478816 | 2867475112 | Bacteria | 6909112 |
| 1835 | 2873155610 | 2873151551 | Bacteria | 8625867 |
| 1836 | 2873314482 | 2873314349 | Bacteria | 8512634 |
| 1837 | 2875395565 | 2875391855 | Bacteria | 7600475 |
| 1838 | 2877680984 | 2877676314 | Bacteria | 9512378 |
| 1839 | 2891401193 | 2891395885 | Bacteria | 9251614 |
| 1840 | 2891560109 | 2891554331 | Bacteria | 8812224 |
| 1841 | 2891563541 | 2891562705 | Bacteria | 8039471 |
| 1842 | 2893686216 | 2893684298 | Bacteria | 2897960 |
| 1843 | 2905930823 | 2905926851 | Bacteria | 4423176 |
| 1844 | 2912719829 | 2912715099 | Bacteria | 9460473 |
| 1845 | 2912724225 | 2912723979 | Bacteria | 8557534 |
| 1846 | 2912760902 | 2912757875 | Bacteria | 7940295 |
| 1847 | 2918505451 | 2918501144 | Bacteria | 8668083 |
| 1848 | 2919448242 | 2919446982 | Bacteria | 3994487 |
| 1849 | 2919469412 | 2919468124 | Bacteria | 9133025 |
| 1850 | 2935393297 | 2935390628 | Bacteria | 7043367 |
| 1851 | 2946006964 | 2946003308 | Bacteria | 3857229 |
| 1852 | 2946049874 | 2946045630 | Bacteria | 8527308 |
| 1853 | 2946067878 | 2946064051 | Bacteria | 8957905 |
| 1854 | 2946076017 | 2946072368 | Bacteria | 8999607 |
| 1855 | 2947229069 | 2947224130 | Bacteria | 9938529 |
| 1856 | 2954007256 | 2954002825 | Bacteria | 9173742 |
| 1857 | 2954386094 | 2954380949 | Bacteria | 10050426 |
| 1858 | 2954677053 | 2954673503 | Bacteria | 9685905 |
| 1859 | 2954687103 | 2954682443 | Bacteria | 9862841 |
| 1860 | 2954696734 | 2954691527 | Bacteria | 10720516 |
| 1861 | 2954705404 | 2954701450 | Bacteria | 10834262 |
| 1862 | 2954716115 | 2954711539 | Bacteria | 10867210 |
| 1863 | 2954726058 | 2954721474 | Bacteria | 10456478 |
| 1864 | 2954735752 | 2954731030 | Bacteria | 10243860 |
| 1865 | 2954744984 | 2954740390 | Bacteria | 10229294 |
| 1866 | 2954754607 | 2954749733 | Bacteria | 10366972 |
| 1867 | 2954763956 | 2954759201 | Bacteria | 9358192 |
| 1868 | 2964328590 | 2964326757 | Bacteria | 3290868 |
| 1869 | 2966601770 | 2966598605 | Bacteria | 7676064 |
| 1870 | 2966927025 | 2966924647 | Bacteria | 3268643 |
| 1871 | 2990045326 | 2990044586 | Bacteria | 6603797 |
| 1872 | 2990063211 | 2990059506 | Bacteria | 9321252 |
| 1873 | 2990088366 | 2990088156 | Bacteria | 6657676 |
| 1874 | 2997457727 | 2997451912 | Bacteria | 8492419 |
| 1875 | 2997600299 | 2997600082 | Bacteria | 9896405 |
| 1876 | 3003004922 | 3002998708 | Bacteria | 11715108 |
| 1877 | 3006325195 | 3006321560 | Bacteria | 8247479 |
| 1878 | 3006394459 | 3006393351 | Bacteria | 6615579 |
| 1879 | 3006428808 | 3006425503 | Bacteria | 6491253 |
| 1880 | 3006490861 | 3006486233 | Bacteria | 8157040 |
| 1881 | 3006500871 | 3006493962 | Bacteria | 8825450 |
| 1882 | 637877802 | 637000116 | Bacteria | 5433628 |
| 1883 | 8008490301 | 8008485437 | Bacteria | 7198341 |
| 1884 | 8008567119 | 8008558824 | Bacteria | 10610750 |
| 1885 | 8008578779 | 8008574985 | Bacteria | 7815457 |
| 1886 | 8023627098 | 8023623736 | Bacteria | 8593882 |
| 1887 | 8025482475 | 8025478263 | Bacteria | 8209203 |
| 1888 | 8025529603 | 8025524527 | Bacteria | 7197316 |
| 1889 | 8025537899 | 8025530807 | Bacteria | 8495698 |
| 1890 | 8033690855 | 8033684223 | Bacteria | 6906479 |
| 1891 | 8047897968 | 8047893842 | Bacteria | 11723082 |
| 1892 | 8048133048 | 8048127548 | Bacteria | 11053136 |
| 1893 | 8048360926 | 8048356638 | Bacteria | 11044339 |
| 1894 | 8048374931 | 8048369669 | Bacteria | 11666822 |
| 1895 | 8048383274 | 8048379754 | Bacteria | 11877923 |
| 1896 | 8048413926 | 8048406513 | Bacteria | 8936924 |
| 1897 | 8053952145 | 8053945823 | Bacteria | 8962862 |
| 1898 | 8054161755 | 8054160619 | Bacteria | 7783213 |
| 1899 | 8054917380 | 8054913762 | Bacteria | 7713009 |
| 1900 | 8054921994 | 8054920844 | Bacteria | 7068637 |
| 1901 | 8055072721 | 8055066027 | Bacteria | 9479577 |
| 1902 | 8055160494 | 8055157932 | Bacteria | 6429399 |
| 1903 | 8055175942 | 8055172936 | Bacteria | 9305943 |
| 1904 | 8056062084 | 8056060235 | Bacteria | 7259403 |
| 1905 | 8056450884 | 8056447290 | Bacteria | 7680491 |
| 1906 | 8056671245 | 8056667051 | Bacteria | 6953971 |
| 1907 | 8056833498 | 8056829672 | Bacteria | 9045328 |
| 1908 | Ga0495628_0161075 | |||
| 1909 | JGI24735J21928_10011146 | |||
| 1910 | JGI24738J21930_10011186 | |||
| 1911 | JGI25153J46596_10032512 | |||
| 1912 | rootH1_10002967 | |||
| 1913 | JGI25160J50197_1016566 | |||
| 1914 | Ga0006562J51391_1011721 | |||
| 1915 | Ga0006562J51391_1011722 | |||
| 1916 | Ga0006562J51391_1056397 | |||
| 1917 | Ga0006562J51391_1071703 | |||
| 1918 | Ga0006562J51391_1071704 | |||
| 1919 | Ga0065714_10006949 | |||
| 1920 | Ga0070658_10001387 | |||
| 1921 | Ga0070658_10184078 | |||
| 1922 | Ga0070658_10250538 | |||
| 1923 | Ga0070676_10072473 | |||
| 1924 | Ga0070683_100166867 | |||
| 1925 | Ga0070683_100348384 | |||
| 1926 | Ga0068869_100036149 | |||
| 1927 | Ga0068869_100364963 | |||
| 1928 | Ga0070666_10007558 | |||
| 1929 | Ga0070666_10061196 | |||
| 1930 | Ga0070666_10136575 | |||
| 1931 | Ga0070680_100013093 | |||
| 1932 | Ga0070680_100035119 | |||
| 1933 | Ga0070680_100337751 | |||
| 1934 | Ga0070682_100005056 | |||
| 1935 | Ga0068868_100067018 | |||
| 1936 | Ga0070660_100038049 | |||
| 1937 | Ga0070660_100084706 | |||
| 1938 | Ga0070660_100559084 | |||
| 1939 | Ga0070689_100028136 | |||
| 1940 | Ga0070691_10014121 | |||
| 1941 | Ga0070691_10017039 | |||
| 1942 | Ga0070661_100228940 | |||
| 1943 | Ga0070661_100560851 | |||
| 1944 | Ga0070692_10021193 | |||
| 1945 | Ga0070692_10170923 | |||
| 1946 | Ga0070668_100022918 | |||
| 1947 | Ga0070668_100046575 | |||
| 1948 | Ga0070668_100067218 | |||
| 1949 | Ga0070675_100221788 | |||
| 1950 | Ga0070675_100300602 | |||
| 1951 | Ga0070671_100014896 | |||
| 1952 | Ga0070671_100132739 | |||
| 1953 | Ga0070674_100201836 | |||
| 1954 | Ga0070674_100228758 | |||
| 1955 | Ga0070673_100059069 | |||
| 1956 | Ga0070673_100066970 | |||
| 1957 | Ga0070673_100274444 | |||
| 1958 | Ga0070688_100080165 | |||
| 1959 | Ga0070659_100051008 | |||
| 1960 | Ga0070667_100018998 | |||
| 1961 | Ga0070667_100349927 | |||
| 1962 | Ga0070703_10017010 | |||
| 1963 | Ga0070709_10000220 | |||
| 1964 | Ga0070709_10003796 | |||
| 1965 | Ga0070709_10026469 | |||
| 1966 | Ga0070709_10093584 | |||
| 1967 | Ga0070714_100000010 | |||
| 1968 | Ga0070714_100001618 | |||
| 1969 | Ga0070714_100012670 | |||
| 1970 | Ga0070714_100044829 | |||
| 1971 | Ga0070714_100053229 | |||
| 1972 | Ga0070714_100070235 | |||
| 1973 | Ga0070714_100077141 | |||
| 1974 | Ga0070714_100136718 | |||
| 1975 | Ga0070714_100325816 | |||
| 1976 | Ga0070714_100489764 | |||
| 1977 | Ga0070714_100805068 | |||
| 1978 | Ga0070713_100002276 | |||
| 1979 | Ga0070713_100033632 | |||
| 1980 | Ga0070713_100040074 | |||
| 1981 | Ga0070713_100059945 | |||
| 1982 | Ga0070713_100124310 | |||
| 1983 | Ga0070713_100154448 | |||
| 1984 | Ga0070713_100234602 | |||
| 1985 | Ga0070713_100263889 | |||
| 1986 | Ga0070710_10000122 | |||
| 1987 | Ga0070710_10002549 | |||
| 1988 | Ga0070710_10005500 | |||
| 1989 | Ga0070710_10024969 | |||
| 1990 | Ga0070710_10041832 | |||
| 1991 | Ga0070710_10071555 | |||
| 1992 | Ga0070710_10117994 | |||
| 1993 | Ga0070711_100000421 | |||
| 1994 | Ga0070711_100023470 | |||
| 1995 | Ga0070711_100052212 | |||
| 1996 | Ga0070711_100426264 | |||
| 1997 | Ga0070711_100484054 | |||
| 1998 | Ga0070711_100682168 | |||
| 1999 | Ga0070705_100003344 | |||
| 2000 | Ga0070700_100000064 | |||
| 2001 | Ga0070694_100173076 | |||
| 2002 | Ga0070708_100026861 | |||
| 2003 | Ga0070708_100043452 | |||
| 2004 | Ga0070708_100104614 | |||
| 2005 | Ga0070708_100132463 | |||
| 2006 | Ga0070708_100364242 | |||
| 2007 | Ga0070708_100366596 | |||
| 2008 | Ga0070708_101081058 | |||
| 2009 | Ga0070663_100063514 | |||
| 2010 | Ga0070663_100155171 | |||
| 2011 | Ga0070678_100010423 | |||
| 2012 | Ga0070678_100030918 | |||
| 2013 | Ga0070678_100139558 | |||
| 2014 | Ga0070681_10014130 | |||
| 2015 | Ga0070681_10318200 | |||
| 2016 | Ga0070681_10396346 | |||
| 2017 | Ga0068867_100151666 | |||
| 2018 | Ga0068867_100702227 | |||
| 2019 | Ga0070685_10173891 | |||
| 2020 | Ga0070685_10215640 | |||
| 2021 | Ga0070706_100004020 | |||
| 2022 | Ga0070706_100005122 | |||
| 2023 | Ga0070706_100005997 | |||
| 2024 | Ga0070706_100008150 | |||
| 2025 | Ga0070706_100009991 | |||
| 2026 | Ga0070706_100021245 | |||
| 2027 | Ga0070706_100026563 | |||
| 2028 | Ga0070706_100064829 | |||
| 2029 | Ga0070706_100106943 | |||
| 2030 | Ga0070706_100125381 | |||
| 2031 | Ga0070706_100276953 | |||
| 2032 | Ga0070707_100000293 | |||
| 2033 | Ga0070707_100003142 | |||
| 2034 | Ga0070707_100005742 | |||
| 2035 | Ga0070707_100015007 | |||
| 2036 | Ga0070707_100021756 | |||
| 2037 | Ga0070707_100029552 | |||
| 2038 | Ga0070707_100058063 | |||
| 2039 | Ga0070707_100090007 | |||
| 2040 | Ga0070698_100000106 | |||
| 2041 | Ga0070698_100000546 | |||
| 2042 | Ga0070698_100004555 | |||
| 2043 | Ga0070698_100007047 | |||
| 2044 | Ga0070698_100014280 | |||
| 2045 | Ga0070698_100018347 | |||
| 2046 | Ga0070698_100019863 | |||
| 2047 | Ga0070698_100046444 | |||
| 2048 | Ga0070698_100070830 | |||
| 2049 | Ga0070698_100079441 | |||
| 2050 | Ga0070698_100206013 | |||
| 2051 | Ga0070699_100000577 | |||
| 2052 | Ga0070699_100459552 | |||
| 2053 | Ga0070679_100084639 | |||
| 2054 | Ga0070679_100093574 | |||
| 2055 | Ga0070684_100013575 | |||
| 2056 | Ga0070684_100604614 | |||
| 2057 | Ga0070684_100621911 | |||
| 2058 | Ga0070697_100029422 | |||
| 2059 | Ga0070697_100069331 | |||
| 2060 | Ga0070697_100357258 | |||
| 2061 | Ga0068853_100073071 | |||
| 2062 | Ga0068853_100275373 | |||
| 2063 | Ga0070672_100075534 | |||
| 2064 | Ga0070672_100143140 | |||
| 2065 | Ga0070686_100026601 | |||
| 2066 | Ga0070686_100035430 | |||
| 2067 | Ga0070695_100059329 | |||
| 2068 | Ga0070695_100341141 | |||
| 2069 | Ga0070696_100097078 | |||
| 2070 | Ga0070696_100187297 | |||
| 2071 | Ga0070693_100035744 | |||
| 2072 | Ga0070665_100000401 | |||
| 2073 | Ga0070665_100032363 | |||
| 2074 | Ga0070665_100087185 | |||
| 2075 | Ga0070665_100141565 | |||
| 2076 | Ga0068855_100050361 | |||
| 2077 | Ga0068855_100077738 | |||
| 2078 | Ga0070664_100078425 | |||
| 2079 | Ga0070664_100422789 | |||
| 2080 | Ga0068857_100138478 | |||
| 2081 | Ga0068857_100153423 | |||
| 2082 | Ga0068857_100319118 | |||
| 2083 | Ga0068854_100020711 | |||
| 2084 | Ga0068854_100270222 | |||
| 2085 | Ga0068854_100560443 | |||
| 2086 | Ga0068856_100015966 | |||
| 2087 | Ga0068856_100025089 | |||
| 2088 | Ga0068856_100035500 | |||
| 2089 | Ga0068856_100042199 | |||
| 2090 | Ga0068856_100268510 | |||
| 2091 | Ga0068856_100749395 | |||
| 2092 | Ga0070702_100014799 | |||
| 2093 | Ga0070702_100022796 | |||
| 2094 | Ga0070702_100291093 | |||
| 2095 | Ga0068852_100022811 | |||
| 2096 | Ga0068852_100050239 | |||
| 2097 | Ga0068852_100148003 | |||
| 2098 | Ga0068852_100203210 | |||
| 2099 | Ga0068852_100212067 | |||
| 2100 | Ga0068852_100395840 | |||
| 2101 | Ga0068859_100099277 | |||
| 2102 | Ga0068859_100145116 | |||
| 2103 | Ga0068859_100575966 | |||
| 2104 | Ga0068864_100006862 | |||
| 2105 | Ga0068864_100064036 | |||
| 2106 | Ga0068864_100193491 | |||
| 2107 | Ga0068861_100337992 | |||
| 2108 | Ga0068870_10118853 | |||
| 2109 | Ga0068870_10266306 | |||
| 2110 | Ga0068863_100001365 | |||
| 2111 | Ga0068863_100043562 | |||
| 2112 | Ga0068863_100055890 | |||
| 2113 | Ga0068863_100080467 | |||
| 2114 | Ga0068863_100306575 | |||
| 2115 | Ga0068858_100000732 | |||
| 2116 | Ga0068858_100027030 | |||
| 2117 | Ga0068858_100059448 | |||
| 2118 | Ga0068858_100382570 | |||
| 2119 | Ga0068860_100000114 | |||
| 2120 | Ga0068860_100038551 | |||
| 2121 | Ga0068860_100054813 | |||
| 2122 | Ga0068860_100254576 | |||
| 2123 | Ga0068862_100077659 | |||
| 2124 | Ga0068862_100220064 | |||
| 2125 | Ga0081455_10000575 | |||
| 2126 | Ga0081455_10020190 | |||
| 2127 | Ga0081455_10167176 | |||
| 2128 | Ga0081455_10540228 | |||
| 2129 | Ga0081540_1000171 | |||
| 2130 | Ga0081540_1001613 | |||
| 2131 | Ga0081540_1038105 | |||
| 2132 | Ga0081540_1042201 | |||
| 2133 | Ga0081539_10001059 | |||
| 2134 | Ga0070717_10022210 | |||
| 2135 | Ga0070717_10028429 | |||
| 2136 | Ga0070717_10045339 | |||
| 2137 | Ga0070717_10067916 | |||
| 2138 | Ga0070717_10115085 | |||
| 2139 | Ga0070717_10115967 | |||
| 2140 | Ga0070717_10355399 | |||
| 2141 | Ga0075365_10281722 | |||
| 2142 | Ga0075365_10498273 | |||
| 2143 | Ga0075368_10265944 | |||
| 2144 | Ga0075363_100007574 | |||
| 2145 | Ga0070715_10001293 | |||
| 2146 | Ga0070715_10130593 | |||
| 2147 | Ga0070715_10254649 | |||
| 2148 | Ga0070716_100003270 | |||
| 2149 | Ga0070716_100027653 | |||
| 2150 | Ga0070712_100005041 | |||
| 2151 | Ga0070712_100005233 | |||
| 2152 | Ga0070712_100021380 | |||
| 2153 | Ga0070712_100088909 | |||
| 2154 | Ga0070712_100110354 | |||
| 2155 | Ga0070712_100571470 | |||
| 2156 | Ga0070712_100717585 | |||
| 2157 | Ga0097621_100024496 | |||
| 2158 | Ga0097621_100117863 | |||
| 2159 | Ga0075370_10103451 | |||
| 2160 | Ga0068871_100036095 | |||
| 2161 | Ga0068871_100704884 | |||
| 2162 | Ga0075428_100042278 | |||
| 2163 | Ga0075428_100366688 | |||
| 2164 | Ga0075431_100146985 | |||
| 2165 | Ga0075433_10010525 | |||
| 2166 | Ga0075433_10052150 | |||
| 2167 | Ga0075433_10198443 | |||
| 2168 | Ga0075434_100019525 | |||
| 2169 | Ga0075434_100023481 | |||
| 2170 | Ga0075434_100061569 | |||
| 2171 | Ga0075434_100394683 | |||
| 2172 | Ga0068865_100468726 | |||
| 2173 | Ga0075436_100011256 | |||
| 2174 | Ga0075436_100095199 | |||
| 2175 | Ga0075436_100204030 | |||
| 2176 | Ga0075436_100215724 | |||
| 2177 | Ga0097620_100099277 | |||
| 2178 | Ga0097620_100145123 | |||
| 2179 | Ga0097620_100575958 | |||
| 2180 | Ga0075435_100061791 | |||
| 2181 | Ga0075435_100310246 | |||
| 2182 | Ga0105251_10008325 | |||
| 2183 | Ga0105251_10009100 | |||
| 2184 | Ga0105251_10030150 | |||
| 2185 | Ga0105244_10201807 | |||
| 2186 | Ga0105250_10016018 | |||
| 2187 | Ga0105240_10058787 | |||
| 2188 | Ga0105240_10085449 | |||
| 2189 | Ga0105240_10088061 | |||
| 2190 | Ga0111539_10015815 | |||
| 2191 | Ga0111539_10143921 | |||
| 2192 | Ga0105245_10008898 | |||
| 2193 | Ga0105245_10090979 | |||
| 2194 | Ga0105245_10104042 | |||
| 2195 | Ga0105245_10360280 | |||
| 2196 | Ga0105245_10373998 | |||
| 2197 | Ga0105247_10000038 | |||
| 2198 | Ga0105247_10003476 | |||
| 2199 | Ga0105247_10030438 | |||
| 2200 | Ga0105247_10186374 | |||
| 2201 | Ga0114129_10011093 | |||
| 2202 | Ga0114129_10093489 | |||
| 2203 | Ga0105243_10007184 | |||
| 2204 | Ga0105243_10013663 | |||
| 2205 | Ga0105243_10021441 | |||
| 2206 | Ga0105243_10037350 | |||
| 2207 | Ga0105243_10126903 | |||
| 2208 | Ga0105243_10470862 | |||
| 2209 | Ga0105241_10021949 | |||
| 2210 | Ga0105241_10026480 | |||
| 2211 | Ga0105241_10026744 | |||
| 2212 | Ga0105242_10040426 | |||
| 2213 | Ga0105242_10055746 | |||
| 2214 | Ga0105242_10172795 | |||
| 2215 | Ga0105248_10004635 | |||
| 2216 | Ga0105248_10150351 | |||
| 2217 | Ga0105248_10299483 | |||
| 2218 | Ga0105248_10785059 | |||
| 2219 | Ga0105237_10095315 | |||
| 2220 | Ga0105237_10201033 | |||
| 2221 | Ga0105237_10797605 | |||
| 2222 | Ga0105238_10009629 | |||
| 2223 | Ga0105238_10089976 | |||
| 2224 | Ga0105238_10107688 | |||
| 2225 | Ga0105238_10603642 | |||
| 2226 | Ga0105249_10011339 | |||
| 2227 | Ga0105249_10059762 | |||
| 2228 | Ga0105249_10109889 | |||
| 2229 | Ga0105249_10460205 | |||
| 2230 | Ga0105249_10523618 | |||
| 2231 | Ga0105249_10523642 | |||
| 2232 | Ga0105239_10031946 | |||
| 2233 | Ga0105239_10088101 | |||
| 2234 | Ga0105239_10191487 | |||
| 2235 | Ga0105239_10537759 | |||
| 2236 | Ga0105239_10624742 | |||
| 2237 | Ga0105239_10770420 | |||
| 2238 | Ga0105246_10029622 | |||
| 2239 | Ga0105246_10034148 | |||
| 2240 | Ga0105246_10046747 | |||
| 2241 | Ga0105246_10066977 | |||
| 2242 | Ga0157345_1003149 | |||
| 2243 | Ga0157373_10137647 | |||
| 2244 | Ga0157371_10317202 | |||
| 2245 | Ga0157370_10070210 | |||
| 2246 | Ga0157370_10130425 | |||
| 2247 | Ga0157370_10337002 | |||
| 2248 | Ga0157370_10608524 | |||
| 2249 | Ga0157369_10007003 | |||
| 2250 | Ga0157369_10007588 | |||
| 2251 | Ga0157369_10071651 | |||
| 2252 | Ga0157369_10135443 | |||
| 2253 | Ga0157369_10483585 | |||
| 2254 | Ga0157374_10022784 | |||
| 2255 | Ga0157374_10229451 | |||
| 2256 | Ga0157374_10266988 | |||
| 2257 | Ga0157374_10801467 | |||
| 2258 | Ga0157378_10284544 | |||
| 2259 | Ga0163162_10127024 | |||
| 2260 | Ga0163162_10217095 | |||
| 2261 | Ga0163162_10255261 | |||
| 2262 | Ga0163162_10400351 | |||
| 2263 | Ga0163162_10793150 | |||
| 2264 | Ga0157372_10000658 | |||
| 2265 | Ga0157372_10084295 | |||
| 2266 | Ga0157372_10158826 | |||
| 2267 | Ga0157375_10026112 | |||
| 2268 | Ga0157375_10306208 | |||
| 2269 | Ga0157375_10381066 | |||
| 2270 | Ga0157375_10421579 | |||
| 2271 | Ga0157375_10544018 | |||
| 2272 | Ga0157375_11064287 | |||
| 2273 | Ga0163163_10021634 | |||
| 2274 | Ga0163163_10022975 | |||
| 2275 | Ga0163163_10058181 | |||
| 2276 | Ga0163163_10061951 | |||
| 2277 | Ga0157380_10019875 | |||
| 2278 | Ga0157380_10051491 | |||
| 2279 | Ga0157380_10091361 | |||
| 2280 | Ga0182008_10001457 | |||
| 2281 | Ga0157377_10061621 | |||
| 2282 | Ga0157377_10094225 | |||
| 2283 | Ga0157379_10085479 | |||
| 2284 | Ga0157379_10115944 | |||
| 2285 | Ga0157379_10140904 | |||
| 2286 | Ga0157376_10253081 | |||
| 2287 | Ga0157376_10306358 | |||
| 2288 | Ga0182007_10011898 | |||
| 2289 | Ga0183367_1005 | |||
| 2290 | Ga0163161_10102864 | |||
| 2291 | Ga0163161_10192161 | |||
| 2292 | Ga0163161_10334050 | |||
| 2293 | Ga0197907_11486011 | |||
| 2294 | Ga0206356_10464819 | |||
| 2295 | Ga0206355_1573660 | |||
| 2296 | Ga0206354_10632267 | |||
| 2297 | Ga0206353_10972019 | |||
| 2298 | Ga0206353_11335110 | |||
| 2299 | Ga0213874_10059141 | |||
| 2300 | Ga0213875_10000537 | |||
| 2301 | Ga0213875_10001614 | |||
| 2302 | Ga0213875_10016464 | |||
| 2303 | Ga0213875_10024228 | |||
| 2304 | Ga0213875_10299394 | |||
| 2305 | Ga0224712_10004812 | |||
| 2306 | Ga0224712_10012350 | |||
| 2307 | Ga0224712_10016046 | |||
| 2308 | Ga0224712_10050508 | |||
| 2309 | Ga0224712_10122252 | |||
| 2310 | Ga0224712_10138911 | |||
| 2311 | Ga0209758_1005482 | |||
| 2312 | Ga0207426_1004843 | |||
| 2313 | Ga0207426_1008083 | |||
| 2314 | Ga0207426_1010813 | |||
| 2315 | Ga0207426_1048669 | |||
| 2316 | Ga0207696_1048405 | |||
| 2317 | Ga0207713_1005803 | |||
| 2318 | Ga0207653_10009551 | |||
| 2319 | Ga0207692_10002006 | |||
| 2320 | Ga0207692_10012366 | |||
| 2321 | Ga0207692_10015787 | |||
| 2322 | Ga0207692_10026337 | |||
| 2323 | Ga0207692_10056251 | |||
| 2324 | Ga0207692_10118251 | |||
| 2325 | Ga0207710_10000054 | |||
| 2326 | Ga0207710_10000199 | |||
| 2327 | Ga0207710_10009019 | |||
| 2328 | Ga0207688_10013036 | |||
| 2329 | Ga0207688_10022652 | |||
| 2330 | Ga0207680_10024029 | |||
| 2331 | Ga0207680_10121741 | |||
| 2332 | Ga0207647_10013191 | |||
| 2333 | Ga0207647_10027943 | |||
| 2334 | Ga0207647_10052960 | |||
| 2335 | Ga0207685_10008336 | |||
| 2336 | Ga0207685_10021703 | |||
| 2337 | Ga0207699_10000684 | |||
| 2338 | Ga0207699_10002656 | |||
| 2339 | Ga0207699_10005707 | |||
| 2340 | Ga0207699_10014662 | |||
| 2341 | Ga0207699_10014727 | |||
| 2342 | Ga0207699_10037612 | |||
| 2343 | Ga0207699_10337033 | |||
| 2344 | Ga0207645_10051702 | |||
| 2345 | Ga0207643_10022418 | |||
| 2346 | Ga0207643_10166592 | |||
| 2347 | Ga0207705_10000573 | |||
| 2348 | Ga0207684_10000571 | |||
| 2349 | Ga0207684_10001806 | |||
| 2350 | Ga0207684_10014224 | |||
| 2351 | Ga0207684_10019030 | |||
| 2352 | Ga0207684_10025959 | |||
| 2353 | Ga0207684_10061832 | |||
| 2354 | Ga0207684_10066992 | |||
| 2355 | Ga0207684_10073685 | |||
| 2356 | Ga0207684_10144332 | |||
| 2357 | Ga0207684_10236281 | |||
| 2358 | Ga0207684_10282490 | |||
| 2359 | Ga0207654_10024354 | |||
| 2360 | Ga0207654_10036321 | |||
| 2361 | Ga0207654_10534008 | |||
| 2362 | Ga0207707_10003446 | |||
| 2363 | Ga0207707_10258377 | |||
| 2364 | Ga0207695_10008627 | |||
| 2365 | Ga0207695_10195826 | |||
| 2366 | Ga0207695_10236258 | |||
| 2367 | Ga0207695_10380506 | |||
| 2368 | Ga0207671_10000188 | |||
| 2369 | Ga0207671_10047172 | |||
| 2370 | Ga0207671_10074718 | |||
| 2371 | Ga0207693_10003796 | |||
| 2372 | Ga0207693_10006369 | |||
| 2373 | Ga0207693_10007211 | |||
| 2374 | Ga0207693_10010872 | |||
| 2375 | Ga0207693_10018090 | |||
| 2376 | Ga0207693_10055665 | |||
| 2377 | Ga0207693_10240941 | |||
| 2378 | Ga0207693_10599488 | |||
| 2379 | Ga0207663_10001400 | |||
| 2380 | Ga0207663_10003417 | |||
| 2381 | Ga0207663_10016411 | |||
| 2382 | Ga0207663_10022703 | |||
| 2383 | Ga0207663_10034580 | |||
| 2384 | Ga0207663_10056942 | |||
| 2385 | Ga0207663_10129919 | |||
| 2386 | Ga0207663_10494520 | |||
| 2387 | Ga0207660_10237112 | |||
| 2388 | Ga0207660_10304771 | |||
| 2389 | Ga0207660_10380767 | |||
| 2390 | Ga0207662_10008460 | |||
| 2391 | Ga0207662_10083704 | |||
| 2392 | Ga0207657_10004980 | |||
| 2393 | Ga0207657_10028697 | |||
| 2394 | Ga0207657_10037201 | |||
| 2395 | Ga0207652_10031799 | |||
| 2396 | Ga0207652_10078417 | |||
| 2397 | Ga0207652_10236479 | |||
| 2398 | Ga0207646_10000050 | |||
| 2399 | Ga0207646_10001770 | |||
| 2400 | Ga0207646_10002450 | |||
| 2401 | Ga0207646_10009108 | |||
| 2402 | Ga0207646_10011667 | |||
| 2403 | Ga0207646_10123924 | |||
| 2404 | Ga0207694_10004684 | |||
| 2405 | Ga0207694_10127303 | |||
| 2406 | Ga0207694_10369184 | |||
| 2407 | Ga0207650_10356812 | |||
| 2408 | Ga0207659_10279814 | |||
| 2409 | Ga0207687_10017480 | |||
| 2410 | Ga0207687_10076551 | |||
| 2411 | Ga0207687_10106279 | |||
| 2412 | Ga0207687_10118225 | |||
| 2413 | Ga0207687_10264640 | |||
| 2414 | Ga0207687_10346363 | |||
| 2415 | Ga0207700_10001148 | |||
| 2416 | Ga0207700_10011993 | |||
| 2417 | Ga0207700_10041144 | |||
| 2418 | Ga0207700_10046488 | |||
| 2419 | Ga0207700_10060814 | |||
| 2420 | Ga0207700_10077499 | |||
| 2421 | Ga0207700_10078444 | |||
| 2422 | Ga0207700_10089443 | |||
| 2423 | Ga0207700_10188450 | |||
| 2424 | Ga0207700_10529867 | |||
| 2425 | Ga0207664_10000009 | |||
| 2426 | Ga0207664_10000298 | |||
| 2427 | Ga0207664_10003123 | |||
| 2428 | Ga0207664_10004567 | |||
| 2429 | Ga0207664_10006510 | |||
| 2430 | Ga0207664_10012203 | |||
| 2431 | Ga0207664_10016910 | |||
| 2432 | Ga0207664_10028591 | |||
| 2433 | Ga0207664_10033127 | |||
| 2434 | Ga0207664_10067915 | |||
| 2435 | Ga0207664_10193522 | |||
| 2436 | Ga0207664_10194744 | |||
| 2437 | Ga0207664_10265488 | |||
| 2438 | Ga0207664_10672954 | |||
| 2439 | Ga0207644_10376549 | |||
| 2440 | Ga0207690_10715941 | |||
| 2441 | Ga0207706_10020091 | |||
| 2442 | Ga0207686_10118300 | |||
| 2443 | Ga0207709_10047213 | |||
| 2444 | Ga0207709_10066719 | |||
| 2445 | Ga0207670_10010705 | |||
| 2446 | Ga0207670_10459137 | |||
| 2447 | Ga0207669_10178475 | |||
| 2448 | Ga0207669_10191156 | |||
| 2449 | Ga0207704_10219204 | |||
| 2450 | Ga0207665_10001293 | |||
| 2451 | Ga0207665_10006161 | |||
| 2452 | Ga0207665_10007145 | |||
| 2453 | Ga0207665_10009393 | |||
| 2454 | Ga0207665_10009599 | |||
| 2455 | Ga0207665_10022631 | |||
| 2456 | Ga0207665_10027491 | |||
| 2457 | Ga0207665_10422739 | |||
| 2458 | Ga0207691_10018488 | |||
| 2459 | Ga0207691_10220118 | |||
| 2460 | Ga0207711_10038262 | |||
| 2461 | Ga0207711_10069180 | |||
| 2462 | Ga0207711_10143807 | |||
| 2463 | Ga0207711_10474577 | |||
| 2464 | Ga0207689_10011071 | |||
| 2465 | Ga0207689_10116096 | |||
| 2466 | Ga0207689_10886559 | |||
| 2467 | Ga0207661_10044710 | |||
| 2468 | Ga0207661_10295793 | |||
| 2469 | Ga0207661_10761574 | |||
| 2470 | Ga0207679_10088282 | |||
| 2471 | Ga0207667_10034292 | |||
| 2472 | Ga0207667_10067860 | |||
| 2473 | Ga0207667_10114334 | |||
| 2474 | Ga0207667_10338389 | |||
| 2475 | Ga0207667_10664637 | |||
| 2476 | Ga0207667_10692040 | |||
| 2477 | Ga0207667_10740105 | |||
| 2478 | Ga0207651_10126687 | |||
| 2479 | Ga0207651_10298946 | |||
| 2480 | Ga0207712_10056414 | |||
| 2481 | Ga0207712_10164450 | |||
| 2482 | Ga0207668_10024607 | |||
| 2483 | Ga0207668_10130099 | |||
| 2484 | Ga0207668_10328361 | |||
| 2485 | Ga0207640_10031406 | |||
| 2486 | Ga0207640_10560147 | |||
| 2487 | Ga0207658_10042016 | |||
| 2488 | Ga0207677_10038407 | |||
| 2489 | Ga0207677_10405190 | |||
| 2490 | Ga0207677_10900324 | |||
| 2491 | Ga0207703_10000047 | |||
| 2492 | Ga0207703_10033367 | |||
| 2493 | Ga0207639_10019625 | |||
| 2494 | Ga0207639_10055105 | |||
| 2495 | Ga0207639_10087274 | |||
| 2496 | Ga0207678_10006256 | |||
| 2497 | Ga0207678_10007661 | |||
| 2498 | Ga0207678_10016809 | |||
| 2499 | Ga0207678_10032239 | |||
| 2500 | Ga0207678_10327538 | |||
| 2501 | Ga0207708_10000076 | |||
| 2502 | Ga0207708_10453641 | |||
| 2503 | Ga0207702_10018387 | |||
| 2504 | Ga0207702_10211140 | |||
| 2505 | Ga0207702_10230973 | |||
| 2506 | Ga0207702_10357366 | |||
| 2507 | Ga0207702_10655929 | |||
| 2508 | Ga0207702_10659437 | |||
| 2509 | Ga0207702_10866727 | |||
| 2510 | Ga0207641_10043271 | |||
| 2511 | Ga0207641_10315816 | |||
| 2512 | Ga0207676_10071926 | |||
| 2513 | Ga0207676_10112106 | |||
| 2514 | Ga0207674_10105018 | |||
| 2515 | Ga0207674_10161644 | |||
| 2516 | Ga0207674_10190137 | |||
| 2517 | Ga0207674_10470158 | |||
| 2518 | Ga0207674_10672536 | |||
| 2519 | Ga0207675_100036213 | |||
| 2520 | Ga0207675_100083772 | |||
| 2521 | Ga0207683_10008027 | |||
| 2522 | Ga0207683_10010511 | |||
| 2523 | Ga0207683_10019796 | |||
| 2524 | Ga0207683_10118006 | |||
| 2525 | Ga0207683_10591025 | |||
| 2526 | Ga0207683_10785520 | |||
| 2527 | Ga0207698_10014788 | |||
| 2528 | Ga0207698_10070428 | |||
| 2529 | Ga0207698_10215039 | |||
| 2530 | Ga0207698_10299760 | |||
| 2531 | Ga0207698_10464844 | |||
| 2532 | Ga0209371_1036492 | |||
| 2533 | Ga0209179_1013955 | |||
| 2534 | Ga0209282_1104653 | |||
| 2535 | Ga0207428_10109901 | |||
| 2536 | Ga0265357_1000648 | |||
| 2537 | Ga0268266_10003295 | |||
| 2538 | Ga0268266_10113916 | |||
| 2539 | Ga0268266_10318640 | |||
| 2540 | Ga0268266_10543717 | |||
| 2541 | Ga0268265_10482871 | |||
| 2542 | Ga0268264_10000147 | |||
| 2543 | Ga0268264_10024763 | |||
| 2544 | Ga0268264_10472530 | |||
| 2545 | Ga0265337_1010294 | |||
| 2546 | Ga0265326_10016736 | |||
| 2547 | Ga0265319_1002778 | |||
| 2548 | Ga0265334_10001473 | |||
| 2549 | Ga0265334_10010969 | |||
| 2550 | Ga0265318_10013803 | |||
| 2551 | Ga0265323_10007434 | |||
| 2552 | Ga0265322_10128498 | |||
| 2553 | Ga0265336_10009823 | |||
| 2554 | Ga0307517_10010734 | |||
| 2555 | Ga0307517_10016489 | |||
| 2556 | Ga0307515_10003702 | |||
| 2557 | Ga0307515_10043028 | |||
| 2558 | Ga0307515_10078912 | |||
| 2559 | Ga0307515_10113925 | |||
| 2560 | Ga0307515_10346082 | |||
| 2561 | Ga0307515_10355630 | |||
| 2562 | Ga0307515_10421519 | |||
| 2563 | Ga0265338_10000125 | |||
| 2564 | Ga0265338_10001588 | |||
| 2565 | Ga0265338_10003580 | |||
| 2566 | Ga0265338_10012554 | |||
| 2567 | Ga0265324_10005383 | |||
| 2568 | Ga0268256_1030226 | |||
| 2569 | Ga0307511_10001286 | |||
| 2570 | Ga0307511_10056779 | |||
| 2571 | Ga0307512_10001726 | |||
| 2572 | Ga0307512_10006664 | |||
| 2573 | Ga0265766_1003975 | |||
| 2574 | Ga0265332_10059749 | |||
| 2575 | Ga0265320_10007329 | |||
| 2576 | Ga0265325_10018697 | |||
| 2577 | Ga0265340_10000127 | |||
| 2578 | Ga0265340_10047965 | |||
| 2579 | Ga0265339_10036771 | |||
| 2580 | Ga0265316_10374245 | |||
| 2581 | Ga0307513_10003878 | |||
| 2582 | Ga0307513_10069197 | |||
| 2583 | Ga0307509_10079436 | |||
| 2584 | Ga0307509_10114455 | |||
| 2585 | Ga0307508_10008805 | |||
| 2586 | Ga0307508_10063253 | |||
| 2587 | Ga0307508_10075915 | |||
| 2588 | Ga0307514_10011203 | |||
| 2589 | Ga0307514_10074227 | |||
| 2590 | Ga0307514_10153866 | |||
| 2591 | Ga0307514_10236484 | |||
| 2592 | Ga0316579_10000077 | |||
| 2593 | Ga0316579_10007071 | |||
| 2594 | Ga0316579_10032470 | |||
| 2595 | Ga0265314_10010681 | |||
| 2596 | Ga0265342_10013026 | |||
| 2597 | Ga0316576_10038983 | |||
| 2598 | Ga0316576_10168165 | |||
| 2599 | Ga0316576_10258203 | |||
| 2600 | Ga0316578_10037179 | |||
| 2601 | Ga0307516_10053784 | |||
| 2602 | Ga0307516_10085042 | |||
| 2603 | Ga0307516_10212121 | |||
| 2604 | Ga0316577_10051727 | |||
| 2605 | Ga0307410_10062443 | |||
| 2606 | Ga0307410_10401842 | |||
| 2607 | Ga0307406_10051528 | |||
| 2608 | Ga0307407_10100086 | |||
| 2609 | Ga0307407_10261421 | |||
| 2610 | Ga0307412_10311139 | |||
| 2611 | Ga0307409_100007448 | |||
| 2612 | Ga0307409_100102486 | |||
| 2613 | Ga0307409_100257551 | |||
| 2614 | Ga0307409_100418407 | |||
| 2615 | Ga0307409_100423753 | |||
| 2616 | Ga0307409_100502748 | |||
| 2617 | Ga0307409_100720625 | |||
| 2618 | Ga0307409_100778800 | |||
| 2619 | Ga0307409_101051235 | |||
| 2620 | Ga0307416_100010494 | |||
| 2621 | Ga0307416_100748499 | |||
| 2622 | Ga0307411_10179029 | |||
| 2623 | Ga0307415_100017174 | |||
| 2624 | Ga0307415_100670522 | |||
| 2625 | Ga0316583_10037382 | |||
| 2626 | Ga0316580_10083713 | |||
| 2627 | Ga0307507_10000009 | |||
| 2628 | Ga0307507_10065207 | |||
| 2629 | Ga0307507_10152268 | |||
| 2630 | Ga0307507_10198775 | |||
| 2631 | Ga0307510_10046657 | |||
| 2632 | Ga0316214_1000866 | |||
| 2633 | Ga0316214_1001110 | |||
| 2634 | Ga0316214_1029015 | |||
| 2635 | Ga0373930_0013153 | |||
| 2636 | Ga0373959_0009081 | |||
| 2637 | Ga0373938_0001761 | |||
| 2638 | Ga0373926_0000156 | |||
| 2639 | Ga0373926_0000832 | |||
| 2640 | Ga0373926_0035486 | |||
| 2641 | Ga0373926_0048779 | |||
| 2642 | Ga0373934_0000058 | |||
| 2643 | Ga0373934_0004599 | |||
| 2644 | Ga0373934_0025399 | |||
| 2645 | Ga0373934_0035510 | |||
| 2646 | Ga0373934_0039886 | |||
| 2647 | Ga0373940_0005394 | |||
| 2648 | Ga0373944_0000925 | |||
| 2649 | Ga0373944_0003386 | |||
| 2650 | Ga0373949_0036185 | |||
| 2651 | Ga0373951_0005589 | |||
| 2652 | Ga0373952_0005808 | |||
| 2653 | Ga0373923_0003028 | |||
| 2654 | Ga0373923_0015058 | |||
| 2655 | Ga0373923_0033594 | |||
| 2656 | Ga0373923_0044608 | |||
| 2657 | Ga0373923_0156828 | |||
| 2658 | Ga0373932_0026901 | |||
| 2659 | Ga0373936_0005337 | |||
| 2660 | Ga0373936_0017711 | |||
| 2661 | Ga0373939_0015568 | |||
| 2662 | Ga0373941_0066178 | |||
| 2663 | Ga0373945_0000023 | |||
| 2664 | Ga0373945_0047461 | |||
| 2665 | Ga0373953_0000217 | |||
| 2666 | Ga0373953_0003800 | |||
| 2667 | Ga0373953_0008649 | |||
| 2668 | Ga0373953_0022344 | |||
| 2669 | Ga0373954_0004267 | |||
| 2670 | Ga0373954_0008892 | |||
| 2671 | Ga0373954_0009716 | |||
| 2672 | Ga0373954_0013477 | |||
| 2673 | Ga0373954_0055904 | |||
| 2674 | Ga0373954_0212017 | |||
| 2675 | Ga0373954_0325356 | |||
| 2676 | Ga0373956_0002963 | |||
| 2677 | Ga0373956_0025873 | |||
| 2678 | Ga0373956_0067870 | |||
| 2679 | Ga0373956_0070348 | |||
| 2680 | Ga0373956_0080149 | |||
| 2681 | Ga0373956_0086580 | |||
| 2682 | Ga0373956_0155156 | |||
| 2683 | Ga0373957_0001086 | |||
| 2684 | Ga0373957_0004423 | |||
| 2685 | Ga0373957_0009415 | |||
| 2686 | Ga0373957_0018314 | |||
| 2687 | Ga0373957_0062251 | |||
| 2688 | Ga0373957_0084453 | |||
| 2689 | Ga0373957_0102878 | |||
| 2690 | Ga0373960_0006179 | |||
| 2691 | Ga0373960_0056719 | |||
| 2692 | Ga0373943_0013589 | |||
| 2693 | Ga0373943_0017395 | |||
| 2694 | Ga0373943_0073664 | |||
| 2695 | Ga0373943_0095458 | |||
| 2696 | Ga0373943_0163722 | |||
| 2697 | Ga0373946_0000155 | |||
| 2698 | Ga0373946_0026077 | |||
| 2699 | Ga0373946_0169938 | |||
| 2700 | Ga0373955_0000156 | |||
| 2701 | Ga0373955_0001996 | |||
| 2702 | Ga0373955_0036158 | |||
| 2703 | Ga0373955_0107816 | |||
| 2704 | Ga0373955_0242601 | |||
| 2705 | Ga0373955_0267249 | |||
| 2706 | Ga0373955_0291805 | |||
| 2707 | Ga0373942_0007720 | |||
| 2708 | Ga0373942_0012258 | |||
| 2709 | Ga0373942_0143813 | |||
| 2710 | Ga0373962_0010234 | |||
| 2711 | Ga0316574_0001785 | |||
| 2712 | Ga0316574_0053143 | |||
| 2713 | Ga0316574_0378355 | |||
| 2714 | Ga0373924_0001561 | |||
| 2715 | Ga0373924_0004802 | |||
| 2716 | Ga0373924_0021005 | |||
| 2717 | Ga0373924_0173181 | |||
| 2718 | Ga0373931_0042796 | |||
| 2719 | Ga0373931_0086392 | |||
| 2720 | Ga0373931_0262341 | |||
| 2721 | Ga0373935_0002708 | |||
| 2722 | Ga0373935_0005390 | |||
| 2723 | Ga0373935_0034511 | |||
| 2724 | Ga0373935_0138420 | |||
| 2725 | Ga0373927_0019143 | |||
| 2726 | Ga0373927_0137679 | |||
| 2727 | Ga0373927_0159577 | |||
| 2728 | Ga0373927_0477572 | |||
| 2729 | Ga0373933_0000009 | |||
| 2730 | Ga0373933_0004934 | |||
| 2731 | Ga0373933_0029843 | |||
| 2732 | Ga0373933_0069097 | |||
| 2733 | Ga0373933_0103878 | |||
| 2734 | Ga0373933_0130932 | |||
| 2735 | Ga0373947_0000075 | |||
| 2736 | Ga0373947_0137705 | |||
| 2737 | Ga0373937_0000012 | |||
| 2738 | Ga0373937_0035586 | |||
| 2739 | Ga0373937_0046636 | |||
| 2740 | Ga0373937_0085585 | |||
| 2741 | Ga0373937_0092882 | |||
| 2742 | Ga0373937_0133778 | |||
| 2743 | Ga0373937_0214266 | |||
| 2744 | Ga0373937_0355260 | |||
| 2745 | Ga0316582_0013111 | |||
| 2746 | Ga0316582_0029915 | |||
| 2747 | Ga0316582_0220683 | |||
| 2748 | Ga0316584_0060140 | |||
| 2749 | Ga0373925_0000262 | |||
| 2750 | Ga0373925_0001964 | |||
| 2751 | Ga0373925_0011639 | |||
| 2752 | Ga0373925_0015148 | |||
| 2753 | Ga0373925_0146501 | |||
| 2754 | Ga0373925_0202415 | |||
| 2755 | Ga0373925_0254379 | |||
| 2756 | Ga0373925_0254485 | |||
| 2757 | Ga0395899_0007409 | |||
| 2758 | Ga0395899_0065818 | |||
| 2759 | Ga0395900_0030148 | |||
| 2760 | Ga0395900_0110138 | |||
| 2761 | Ga0395900_0248527 | |||
| 2762 | Ga0395898_0005654 | |||
| 2763 | Ga0395898_0005710 | |||
| 2764 | Ga0395898_0048693 | |||
| 2765 | Ga0395898_0066020 | |||
| 2766 | Ga0395898_0117049 | |||
| 2767 | Ga0395898_0123137 | |||
| 2768 | Ga0395898_0139143 | |||
| 2769 | Ga0395898_0182253 | |||
| 2770 | Ga0395898_0431093 | |||
| 2771 | Ga0436364_0109924 | |||
| 2772 | Ga0436364_0138124 | |||
| 2773 | Ga0436364_0392443 | |||
| 2774 | Ga0436364_0647259 | |||
| 2775 | Ga0436364_0858481 | |||
| 2776 | Ga0436364_0891745 | |||
| 2777 | Ga0436364_0932176 | |||
| 2778 | Ga0436364_1059010 | |||
| 2779 | Ga0395901_0020046 | |||
| 2780 | Ga0395901_0029954 | |||
| 2781 | Ga0395901_0043581 | |||
| 2782 | Ga0395901_0203596 | |||
| 2783 | Ga0395901_0362343 | |||
| 2784 | Ga0395901_0373590 | |||
| 2785 | Ga0395901_0488586 | |||
| 2786 | Ga0395901_0516645 | |||
| 2787 | Ga0395901_0594418 | |||
| 2788 | Ga0395901_0749100 | |||
| 2789 | Ga0395901_1081816 | |||
| 2790 | Ga0436365_0144311 | |||
| 2791 | Ga0436365_0789144 | |||
| 2792 | Ga0436365_1434079 | |||
| 2793 | Ga0436360_0666661 | |||
| 2794 | Ga0436363_0382238 | |||
| 2795 | Ga0436363_0859415 | |||
| 2796 | Ga0436363_0995323 | |||
| 2797 | Ga0436362_0025783 | |||
| 2798 | Ga0436362_0488032 | |||
| 2799 | Ga0436362_0638503 | |||
| 2800 | Ga0436362_0944772 | |||
| 2801 | Ga0439436_0000221 | |||
| 2802 | Ga0439436_0000369 | |||
| 2803 | Ga0439436_0008523 | |||
| 2804 | Ga0439439_0004672 | |||
| 2805 | Ga0439439_0071063 | |||
| 2806 | Ga0439439_0076794 | |||
| 2807 | Ga0439466_0037874 | |||
| 2808 | Ga0451789_0394708 | |||
| 2809 | Ga0451793_1930165 | |||
| 2810 | Ga0451833_1303516 | |||
| 2811 | Ga0451837_0319373 | |||
| 2812 | Ga0439433_0001075 | |||
| 2813 | Ga0439433_0007557 | |||
| 2814 | Ga0439448_0049198 | |||
| 2815 | Ga0439448_0085699 | |||
| 2816 | Ga0439449_0001351 | |||
| 2817 | Ga0439449_0047792 | |||
| 2818 | Ga0439449_0139201 | |||
| 2819 | Ga0439457_000912 | |||
| 2820 | Ga0439457_003251 | |||
| 2821 | Ga0439462_0003322 | |||
| 2822 | Ga0450888_023225 | |||
| 2823 | Ga0450890_004402 | |||
| 2824 | Ga0450897_002158 | |||
| 2825 | Ga0450894_000165 | |||
| 2826 | Ga0450895_001091 | |||
| 2827 | Ga0450896_000843 | |||
| 2828 | Ga0450898_026543 | |||
| 2829 | Ga0450900_017926 | |||
| 2830 | Ga0450902_004816 | |||
| 2831 | Ga0450903_003902 | |||
| 2832 | Ga0450906_002967 | |||
| 2833 | Ga0439458_0005305 | |||
| 2834 | Ga0450908_000484 | |||
| 2835 | Ga0439460_0064916 | |||
| 2836 | Ga0466969_0011075 | |||
| 2837 | Ga0466969_0014683 | |||
| 2838 | Ga0466969_0029467 | |||
| 2839 | Ga0466969_0140123 | |||
| 2840 | Ga0466972_0003842 | |||
| 2841 | Ga0466972_0003903 | |||
| 2842 | Ga0466972_0010829 | |||
| 2843 | Ga0466972_0143263 | |||
| 2844 | Ga0466965_0000304 | |||
| 2845 | Ga0466965_0028551 | |||
| 2846 | Ga0466965_0042100 | |||
| 2847 | Ga0466965_0104011 | |||
| 2848 | Ga0466965_0171166 | |||
| 2849 | Ga0466965_0198379 | |||
| 2850 | Ga0466966_0008603 | |||
| 2851 | Ga0466966_0043489 | |||
| 2852 | Ga0466966_0045850 | |||
| 2853 | Ga0466966_0050263 | |||
| 2854 | Ga0466966_0063589 | |||
| 2855 | Ga0466966_0457228 | |||
| 2856 | Ga0466961_0006417 | |||
| 2857 | Ga0466961_0009741 | |||
| 2858 | Ga0466961_0094517 | |||
| 2859 | Ga0466961_0219468 | |||
| 2860 | Ga0466961_0219638 | |||
| 2861 | Ga0466961_0281864 | |||
| 2862 | Ga0466963_0001543 | |||
| 2863 | Ga0466963_0001954 | |||
| 2864 | Ga0466963_0004547 | |||
| 2865 | Ga0466963_0032003 | |||
| 2866 | Ga0466963_0038082 | |||
| 2867 | Ga0466963_0054026 | |||
| 2868 | Ga0466963_0074239 | |||
| 2869 | Ga0466963_0083702 | |||
| 2870 | Ga0466963_0096421 | |||
| 2871 | Ga0466963_0318529 | |||
| 2872 | Ga0466964_0009875 | |||
| 2873 | Ga0466971_0006461 | |||
| 2874 | Ga0466971_0011590 | |||
| 2875 | Ga0466971_0028559 | |||
| 2876 | Ga0466971_0034980 | |||
| 2877 | Ga0466971_0041072 | |||
| 2878 | Ga0466971_0041165 | |||
| 2879 | Ga0466971_0280450 | |||
| 2880 | Ga0466970_0000179 | |||
| 2881 | Ga0466970_0006119 | |||
| 2882 | Ga0466970_0096053 | |||
| 2883 | Ga0466970_0119935 | |||
| 2884 | Ga0466970_0272429 | |||
| 2885 | Ga0466957_0001101 | |||
| 2886 | Ga0466957_0046598 | |||
| 2887 | Ga0466957_0047119 | |||
| 2888 | Ga0466957_0236810 | |||
| 2889 | Ga0466957_0269937 | |||
| 2890 | Ga0466957_0355331 | |||
| 2891 | Ga0466960_0002996 | |||
| 2892 | Ga0466960_0043520 | |||
| 2893 | Ga0466960_0184606 | |||
| 2894 | Ga0466960_0310670 | |||
| 2895 | Ga0466959_0002789 | |||
| 2896 | Ga0466959_0064052 | |||
| 2897 | Ga0466959_0080783 | |||
| 2898 | Ga0466959_0353256 | |||
| 2899 | Ga0466958_0010946 | |||
| 2900 | Ga0466958_0014015 | |||
| 2901 | Ga0466958_0019871 | |||
| 2902 | Ga0466958_0032131 | |||
| 2903 | Ga0466958_0241273 | |||
| 2904 | Ga0466958_0248102 | |||
| 2905 | Ga0466958_0315677 | |||
| 2906 | Ga0466967_0011410 | |||
| 2907 | Ga0466967_0028007 | |||
| 2908 | Ga0466967_0031778 | |||
| 2909 | Ga0466967_0065600 | |||
| 2910 | Ga0466967_0128608 | |||
| 2911 | Ga0466967_0155973 | |||
| 2912 | Ga0466967_0211964 | |||
| 2913 | Ga0466967_0415282 | |||
| 2914 | Ga0466967_0519108 | |||
| 2915 | Ga0466967_0678940 | |||
| 2916 | Ga0466967_0776438 | |||
| 2917 | Ga0466967_1004868 | |||
| 2918 | Ga0466967_1075215 | |||
| 2919 | Ga0466967_1298927 | |||
| 2920 | Ga0495617_002534 | |||
| 2921 | Ga0495617_157897 | |||
| 2922 | Ga0495627_013158 | |||
| 2923 | Ga0495627_042990 | |||
| 2924 | Ga0495592_0000049 | |||
| 2925 | Ga0495592_0014903 | |||
| 2926 | Ga0495592_0040961 | |||
| 2927 | Ga0495592_0046032 | |||
| 2928 | Ga0495592_0070946 | |||
| 2929 | Ga0495592_0074524 | |||
| 2930 | Ga0495592_0099155 | |||
| 2931 | Ga0495603_0001554 | |||
| 2932 | Ga0495603_0001594 | |||
| 2933 | Ga0495603_0013288 | |||
| 2934 | Ga0495603_0016215 | |||
| 2935 | Ga0495603_0031472 | |||
| 2936 | Ga0495603_0046082 | |||
| 2937 | Ga0495603_0082929 | |||
| 2938 | Ga0495603_0146545 | |||
| 2939 | Ga0495603_0364295 | |||
| 2940 | Ga0495590_0022011 | |||
| 2941 | Ga0495590_0044639 | |||
| 2942 | Ga0495590_0093346 | |||
| 2943 | Ga0495629_0002112 | |||
| 2944 | Ga0495629_0010288 | |||
| 2945 | Ga0495629_0048873 | |||
| 2946 | Ga0495629_0050531 | |||
| 2947 | Ga0495629_0056568 | |||
| 2948 | Ga0495629_0093561 | |||
| 2949 | Ga0495629_0109496 | |||
| 2950 | Ga0495629_0186003 | |||
| 2951 | Ga0495629_0188609 | |||
| 2952 | Ga0495629_0366042 | |||
| 2953 | Ga0495638_0051975 | |||
| 2954 | Ga0495638_0077718 | |||
| 2955 | Ga0495638_0152161 | |||
| 2956 | Ga0495638_0163491 | |||
| 2957 | Ga0495641_0006736 | |||
| 2958 | Ga0495641_0016436 | |||
| 2959 | Ga0495641_0025068 | |||
| 2960 | Ga0495641_0065678 | |||
| 2961 | Ga0495641_0122110 | |||
| 2962 | Ga0495641_0174597 | |||
| 2963 | Ga0495651_0000007 | |||
| 2964 | Ga0495651_0001322 | |||
| 2965 | Ga0495651_0001709 | |||
| 2966 | Ga0495651_0011440 | |||
| 2967 | Ga0495651_0013776 | |||
| 2968 | Ga0495651_0032077 | |||
| 2969 | Ga0495651_0047460 | |||
| 2970 | Ga0495651_0196207 | |||
| 2971 | Ga0495651_0276742 | |||
| 2972 | Ga0495653_0002706 | |||
| 2973 | Ga0495653_0009356 | |||
| 2974 | Ga0495653_0011729 | |||
| 2975 | Ga0495653_0069063 | |||
| 2976 | Ga0495653_0069203 | |||
| 2977 | Ga0495653_0072394 | |||
| 2978 | Ga0495653_0076433 | |||
| 2979 | Ga0495653_0105415 | |||
| 2980 | Ga0495653_0187823 | |||
| 2981 | Ga0495580_0088787 | |||
| 2982 | Ga0495580_0116065 | |||
| 2983 | Ga0495580_0203805 | |||
| 2984 | Ga0495582_0008843 | |||
| 2985 | Ga0495582_0018157 | |||
| 2986 | Ga0495582_0019820 | |||
| 2987 | Ga0495582_0034601 | |||
| 2988 | Ga0495582_0097616 | |||
| 2989 | Ga0495582_0173155 | |||
| 2990 | Ga0495605_0019223 | |||
| 2991 | Ga0495605_0081391 | |||
| 2992 | Ga0495605_0145250 | |||
| 2993 | Ga0495639_0008986 | |||
| 2994 | Ga0495639_0010613 | |||
| 2995 | Ga0495639_0022556 | |||
| 2996 | Ga0495639_0077375 | |||
| 2997 | Ga0495639_0142709 | |||
| 2998 | Ga0495662_0000163 | |||
| 2999 | Ga0495662_0010357 | |||
| 3000 | Ga0495662_0015181 | |||
| 3001 | Ga0495662_0051644 | |||
| 3002 | Ga0495662_0065279 | |||
| 3003 | Ga0495662_0103865 | |||
| 3004 | Ga0495664_0001047 | |||
| 3005 | Ga0495664_0005749 | |||
| 3006 | Ga0495664_0012698 | |||
| 3007 | Ga0495664_0032570 | |||
| 3008 | Ga0495664_0049010 | |||
| 3009 | Ga0495664_0049582 | |||
| 3010 | Ga0495664_0051332 | |||
| 3011 | Ga0495664_0077271 | |||
| 3012 | Ga0495664_0198339 | |||
| 3013 | Ga0495664_0299212 | |||
| 3014 | Ga0495585_0003798 | |||
| 3015 | Ga0495585_0031254 | |||
| 3016 | Ga0495594_0016102 | |||
| 3017 | Ga0495594_0020549 | |||
| 3018 | Ga0495594_0057855 | |||
| 3019 | Ga0495594_0113890 | |||
| 3020 | Ga0495594_0128827 | |||
| 3021 | Ga0495594_0326107 | |||
| 3022 | Ga0495596_0050341 | |||
| 3023 | Ga0495607_0254833 | |||
| 3024 | Ga0495606_0013625 | |||
| 3025 | Ga0495608_0000015 | |||
| 3026 | Ga0495608_0017575 | |||
| 3027 | Ga0495608_0021907 | |||
| 3028 | Ga0495608_0024177 | |||
| 3029 | Ga0495608_0155193 | |||
| 3030 | Ga0495608_0159614 | |||
| 3031 | Ga0495608_0202332 | |||
| 3032 | Ga0495608_0366617 | |||
| 3033 | Ga0495610_0004959 | |||
| 3034 | Ga0495616_0008463 | |||
| 3035 | Ga0495618_0006907 | |||
| 3036 | Ga0495618_0024295 | |||
| 3037 | Ga0495618_0089136 | |||
| 3038 | Ga0495618_0092236 | |||
| 3039 | Ga0495618_0101126 | |||
| 3040 | Ga0495618_0154577 | |||
| 3041 | Ga0495618_0167406 | |||
| 3042 | Ga0495618_0179717 | |||
| 3043 | Ga0495620_0047482 | |||
| 3044 | Ga0495620_0224594 | |||
| 3045 | Ga0495628_0001681 | |||
| 3046 | Ga0495628_0002433 | |||
| 3047 | Ga0495628_0025594 | |||
| 3048 | Ga0495628_0074087 | |||
| 3049 | Ga0495628_0095221 | |||
| 3050 | Ga0495628_0116863 | |||
| 3051 | Ga0495628_0184372 | |||
| 3052 | Ga0495628_0219730 | |||
| 3053 | Ga0495630_0003597 | |||
| 3054 | Ga0495630_0030861 | |||
| 3055 | Ga0495630_0131528 | |||
| 3056 | Ga0495630_0303413 | |||
| 3057 | Ga0495630_0333377 | |||
| 3058 | Ga0495631_0005911 | |||
| 3059 | Ga0495637_0058397 | |||
| 3060 | Ga0495643_0012121 | |||
| 3061 | Ga0495648_0151473 | |||
| 3062 | Ga0495666_0026609 | |||
| 3063 | Ga0495666_0093232 | |||
| 3064 | Ga0495666_0123361 | |||
| 3065 | Ga0495666_0179321 | |||
| 3066 | Ga0495642_0287921 | |||
| 3067 | Ga0495652_0001157 | |||
| 3068 | Ga0495652_0001969 | |||
| 3069 | Ga0495652_0046161 | |||
| 3070 | Ga0495652_0049508 | |||
| 3071 | Ga0495652_0061099 | |||
| 3072 | Ga0495652_0064207 | |||
| 3073 | Ga0495652_0073989 | |||
| 3074 | Ga0495652_0284389 | |||
| 3075 | Ga0495652_0389385 | |||
| 3076 | Ga0495654_0052892 | |||
| 3077 | Ga0495665_0004214 | |||
| 3078 | Ga0495665_0004805 | |||
| 3079 | Ga0495665_0034731 | |||
| 3080 | Ga0495665_0046298 | |||
| 3081 | Ga0495665_0166448 | |||
| 3082 | Ga0495640_0005364 | |||
| 3083 | Ga0495640_0008144 | |||
| 3084 | Ga0495640_0056612 | |||
| 3085 | Ga0495640_0074622 | |||
| 3086 | Ga0495640_0088651 | |||
| 3087 | Ga0495640_0099308 | |||
| 3088 | Ga0495640_0104125 | |||
| 3089 | Ga0495640_0165867 | |||
| 3090 | Ga0495640_0176501 | |||
| 3091 | Ga0495640_0268862 | |||
| 3092 | Ga0495586_0030108 | |||
| 3093 | Ga0495586_0071294 | |||
| 3094 | Ga0495587_0000032 | |||
| 3095 | Ga0495587_0004304 | |||
| 3096 | Ga0495587_0030319 | |||
| 3097 | Ga0495587_0036355 | |||
| 3098 | Ga0495587_0046097 | |||
| 3099 | Ga0495587_0157803 | |||
| 3100 | Ga0495587_0167586 | |||
| 3101 | Ga0495609_0008249 | |||
| 3102 | Ga0495597_0073531 | |||
| 3103 | Ga0495645_0013643 | |||
| 3104 | Ga0495645_0016859 | |||
| 3105 | Ga0495645_0061156 | |||
| 3106 | Ga0495645_0062886 | |||
| 3107 | Ga0495645_0068949 | |||
| 3108 | Ga0495645_0096810 | |||
| 3109 | Ga0495645_0099814 | |||
| 3110 | Ga0495645_0162284 | |||
| 3111 | Ga0495645_0242182 | |||
| 3112 | Ga0495645_0267136 | |||
| 3113 | Ga0495622_0005947 | |||
| 3114 | Ga0495622_0021107 | |||
| 3115 | Ga0495633_0288298 | |||
| 3116 | Ga0495667_0008628 | |||
| 3117 | Ga0495667_0014297 | |||
| 3118 | Ga0495667_0127095 | |||
| 3119 | Ga0495667_0144359 | |||
| 3120 | Ga0495667_0162988 | |||
| 3121 | Ga0495667_0194755 | |||
| 3122 | Ga0495634_0006405 | |||
| 3123 | Ga0495634_0006867 | |||
| 3124 | Ga0495634_0016697 | |||
| 3125 | Ga0495634_0024117 | |||
| 3126 | Ga0495634_0029978 | |||
| 3127 | Ga0495634_0030299 | |||
| 3128 | Ga0495634_0233947 | |||
| 3129 | Ga0495611_0069557 | |||
| 3130 | Ga0495611_0090842 | |||
| 3131 | Ga0495625_0001776 | |||
| 3132 | Ga0495625_0038628 | |||
| 3133 | Ga0495625_0070707 | |||
| 3134 | Ga0495625_0150283 | |||
| 3135 | Ga0495635_0002928 | |||
| 3136 | Ga0495635_0006534 | |||
| 3137 | Ga0495635_0014928 | |||
| 3138 | Ga0495635_0016716 | |||
| 3139 | Ga0495635_0030421 | |||
| 3140 | Ga0495635_0041587 | |||
| 3141 | Ga0495635_0231708 | |||
| 3142 | Ga0495659_0115846 | |||
| 3143 | Ga0495661_0021386 | |||
| 3144 | Ga0495588_0005660 | |||
| 3145 | Ga0495588_0030229 | |||
| 3146 | Ga0495588_0053948 | |||
| 3147 | Ga0495657_0000106 | |||
| 3148 | Ga0495657_0002543 | |||
| 3149 | Ga0495657_0005981 | |||
| 3150 | Ga0495657_0012582 | |||
| 3151 | Ga0495657_0016670 | |||
| 3152 | Ga0495657_0020771 | |||
| 3153 | Ga0495657_0036983 | |||
| 3154 | Ga0495657_0060941 | |||
| 3155 | Ga0495657_0111171 | |||
| 3156 | Ga0495657_0265243 | |||
| 3157 | Ga0495657_0409050 | |||
| 3158 | Ga0495599_0000414 | |||
| 3159 | Ga0495599_0006481 | |||
| 3160 | Ga0495599_0016216 | |||
| 3161 | Ga0495599_0032519 | |||
| 3162 | Ga0495599_0054425 | |||
| 3163 | Ga0495599_0089821 | |||
| 3164 | Ga0495623_0009879 | |||
| 3165 | Ga0495623_0019308 | |||
| 3166 | Ga0495623_0025742 | |||
| 3167 | Ga0495623_0050810 | |||
| 3168 | Ga0495623_0107046 | |||
| 3169 | Ga0495623_0252520 | |||
| 3170 | Ga0495623_0332636 | |||
| 3171 | Ga0495646_0002859 | |||
| 3172 | Ga0495646_0018949 | |||
| 3173 | Ga0495646_0020936 | |||
| 3174 | Ga0495646_0036623 | |||
| 3175 | Ga0495646_0038583 | |||
| 3176 | Ga0495646_0080871 | |||
| 3177 | Ga0495646_0122320 | |||
| 3178 | Ga0495647_0084457 | |||
| 3179 | Ga0495658_0047240 | |||
| 3180 | Ga0495658_0048373 | |||
| 3181 | Ga0495658_0065618 | |||
| 3182 | Ga0495658_0105565 | |||
| 3183 | Ga0495658_0456303 | |||
| 3184 | Ga0495613_0002345 | |||
| 3185 | Ga0495613_0024867 | |||
| 3186 | Ga0495613_0048617 | |||
| 3187 | Ga0495613_0052053 | |||
| 3188 | Ga0495613_0094091 | |||
| 3189 | Ga0495613_0159831 | |||
| 3190 | Ga0495613_0250314 | |||
| 3191 | Ga0495613_0524589 | |||
| 3192 | Ga0495613_0601785 | |||
| 3193 | Ga0495624_0001191 | |||
| 3194 | Ga0495624_0002632 | |||
| 3195 | Ga0495624_0042798 | |||
| 3196 | Ga0495624_0057229 | |||
| 3197 | Ga0495624_0082408 | |||
| 3198 | Ga0495624_0129313 | |||
| 3199 | Ga0495624_0275902 | |||
| 3200 | Ga0495624_0284273 | |||
| 3201 | Ga0495624_0359452 | |||
| 3202 | Ga0495670_0034029 | |||
| 3203 | Ga0495670_0073647 | |||
| 3204 | Ga0495671_0104479 | |||
| 3205 | Ga0495649_0058252 | |||
| 3206 | Ga0495649_0070923 | |||
| 3207 | Ga0495589_0004731 | |||
| 3208 | Ga0495589_0043120 | |||
| 3209 | Ga0495589_0045168 | |||
| 3210 | Ga0495589_0168512 | |||
| 3211 | Ga0495600_0001446 | |||
| 3212 | Ga0495600_0004594 | |||
| 3213 | Ga0495600_0012322 | |||
| 3214 | Ga0495600_0016101 | |||
| 3215 | Ga0495600_0020341 | |||
| 3216 | Ga0495600_0022349 | |||
| 3217 | Ga0495600_0096553 | |||
| 3218 | Ga0495600_0112553 | |||
| 3219 | Ga0495600_0309098 | |||
| 3220 | Ga0495660_0012621 | |||
| 3221 | Ga0495660_0255896 | |||
| 3222 | Ga0495581_0030122 | |||
| 3223 | Ga0495581_0037431 | |||
| 3224 | Ga0495581_0040774 | |||
| 3225 | Ga0495581_0053224 | |||
| 3226 | Ga0495581_0064372 | |||
| 3227 | Ga0495604_0000062 | |||
| 3228 | Ga0495604_0000878 | |||
| 3229 | Ga0495604_0016358 | |||
| 3230 | Ga0495604_0031341 | |||
| 3231 | Ga0495604_0053909 | |||
| 3232 | Ga0495604_0063208 | |||
| 3233 | Ga0495604_0074780 | |||
| 3234 | Ga0495604_0097092 | |||
| 3235 | Ga0495604_0136584 | |||
| 3236 | Ga0495604_0199151 | |||
| 3237 | Ga0495604_0199416 | |||
| 3238 | Ga0495604_0262792 | |||
| 3239 | Ga0495636_0023512 | |||
| 3240 | Ga0495636_0127015 | |||
| 3241 | Ga0495674_0000654 | |||
| 3242 | Ga0495674_0014303 | |||
| 3243 | Ga0495674_0028679 | |||
| 3244 | Ga0495674_0042670 | |||
| 3245 | Ga0495674_0103586 | |||
| 3246 | Ga0495674_0120346 | |||
| 3247 | Ga0495674_0169028 | |||
| 3248 | Ga0495672_0051574 | |||
| 3249 | Ga0495676_0000150 | |||
| 3250 | Ga0495676_0001728 | |||
| 3251 | Ga0495676_0005833 | |||
| 3252 | Ga0495676_0007138 | |||
| 3253 | Ga0495676_0023708 | |||
| 3254 | Ga0495676_0036064 | |||
| 3255 | Ga0495676_0066375 | |||
| 3256 | Ga0495676_0096520 | |||
| 3257 | Ga0495676_0103858 | |||
| 3258 | Ga0495676_0198921 | |||
| 3259 | Ga0495680_0001896 | |||
| 3260 | Ga0495680_0016084 | |||
| 3261 | Ga0495680_0018955 | |||
| 3262 | Ga0495680_0020371 | |||
| 3263 | Ga0495680_0022021 | |||
| 3264 | Ga0495680_0047137 | |||
| 3265 | Ga0495680_0050025 | |||
| 3266 | Ga0495680_0057203 | |||
| 3267 | Ga0495680_0060126 | |||
| 3268 | Ga0495680_0089175 | |||
| 3269 | Ga0495680_0102082 | |||
| 3270 | Ga0495680_0144920 | |||
| 3271 | Ga0495687_002534 | |||
| 3272 | Ga0495675_0014468 | |||
| 3273 | Ga0495675_0017619 | |||
| 3274 | Ga0495675_0023625 | |||
| 3275 | Ga0495675_0102866 | |||
| 3276 | Ga0495675_0161720 | |||
| 3277 | Ga0495677_0057656 | |||
| 3278 | Ga0495685_001035 | |||
| 3279 | Ga0495685_018250 | |||
| 3280 | Ga0495685_136430 | |||
| 3281 | Ga0495685_166961 | |||
| 3282 | Ga0495681_0001177 | |||
| 3283 | Ga0495681_0011246 | |||
| 3284 | Ga0495681_0102854 | |||
| 3285 | Ga0495684_0004087 | |||
| 3286 | Ga0495684_0007997 | |||
| 3287 | Ga0495684_0016230 | |||
| 3288 | Ga0495684_0041054 | |||
| 3289 | Ga0495684_0050658 | |||
| 3290 | Ga0495684_0076311 | |||
| 3291 | Ga0495684_0116805 | |||
| 3292 | Ga0495684_0392390 | |||
| 3293 | Ga0495686_0044711 | |||
| 3294 | Ga0495686_0374598 | |||
| 3295 | Ga0495593_0008567 | |||
| 3296 | Ga0495593_0023902 | |||
| 3297 | Ga0495593_0059745 | |||
| 3298 | Ga0495593_0071813 | |||
| 3299 | Ga0495593_0115501 | |||
| 3300 | Ga0495602_0002545 | |||
| 3301 | Ga0495602_0028807 | |||
| 3302 | Ga0495602_0063161 | |||
| 3303 | Ga0495602_0094928 | |||
| 3304 | Ga0495602_0135146 | |||
| 3305 | Ga0495602_0148791 | |||
| 3306 | Ga0495602_0194062 | |||
| 3307 | Ga0495602_0215765 | |||
| 3308 | Ga0495602_0363396 | |||
| 3309 | Ga0495602_0449376 | |||
| 3310 | Ga0495614_0000611 | |||
| 3311 | Ga0495614_0037662 | |||
| 3312 | Ga0495614_0044088 | |||
| 3313 | Ga0495614_0184814 | |||
| 3314 | Ga0495615_0113718 | |||
| 3315 | Ga0495626_0006328 | |||
| 3316 | Ga0496100_0027737 | |||
| 3317 | Ga0496100_0036636 | |||
| 3318 | Ga0496100_0078631 | |||
| 3319 | Ga0496100_0140651 | |||
| 3320 | Ga0496100_0150672 | |||
| 3321 | Ga0496100_0189882 | |||
| 3322 | Ga0496100_0229831 | |||
| 3323 | Ga0496101_0014873 | |||
| 3324 | Ga0496101_0028793 | |||
| 3325 | Ga0496101_0039436 | |||
| 3326 | Ga0496101_0057875 | |||
| 3327 | Ga0496101_0321634 | |||
| 3328 | Ga0496101_0344703 | |||
| 3329 | Ga0496101_0457770 | |||
| 3330 | Ga0496102_0006769 | |||
| 3331 | Ga0496102_0014285 | |||
| 3332 | Ga0496102_0027853 | |||
| 3333 | Ga0496102_0084947 | |||
| 3334 | Ga0496102_0093131 | |||
| 3335 | Ga0496102_0209726 | |||
| 3336 | Ga0496102_0509021 | |||
| 3337 | Ga0496102_0533770 | |||
| 3338 | Ga0496102_0653434 | |||
| 3339 | Ga0496103_0020725 | |||
| 3340 | Ga0496103_0039720 | |||
| 3341 | Ga0496103_0044364 | |||
| 3342 | Ga0496103_0641226 | |||
| 3343 | Ga0496104_0006175 | |||
| 3344 | Ga0496104_0008256 | |||
| 3345 | Ga0496104_0016097 | |||
| 3346 | Ga0496104_0072280 | |||
| 3347 | Ga0496104_0145656 | |||
| 3348 | Ga0496104_0162629 | |||
| 3349 | Ga0496104_0322655 | |||
| 3350 | Ga0496104_0334357 | |||
| 3351 | Ga0496104_0500953 | |||
| 3352 | Ga0496104_0570064 | |||
| 3353 | Ga0496104_0947992 | |||
| 3354 | Ga0496105_0000770 | |||
| 3355 | Ga0496105_0001849 | |||
| 3356 | Ga0496105_0018813 | |||
| 3357 | Ga0496105_0032974 | |||
| 3358 | Ga0496105_0059034 | |||
| 3359 | Ga0496105_0066420 | |||
| 3360 | Ga0496105_0192886 | |||
| 3361 | Ga0496105_0387757 | |||
| 3362 | Ga0496106_0105759 | |||
| 3363 | Ga0496106_0260206 | |||
| 3364 | Ga0496106_0267558 | |||
| 3365 | Ga0496106_0351626 | |||
| 3366 | Ga0496106_0552765 | |||
| 3367 | Ga0496107_0013004 | |||
| 3368 | Ga0496107_0025724 | |||
| 3369 | Ga0496107_0027912 | |||
| 3370 | Ga0496107_0151938 | |||
| 3371 | Ga0496107_0163235 | |||
| 3372 | Ga0496107_0197521 | |||
| 3373 | Ga0496107_0314608 | |||
| 3374 | Ga0496107_0360825 | |||
| 3375 | Ga0496107_0687800 | |||
| 3376 | Ga0496108_0001256 | |||
| 3377 | Ga0496108_0056003 | |||
| 3378 | Ga0496108_0076757 | |||
| 3379 | Ga0496108_0077787 | |||
| 3380 | Ga0496108_0156347 | |||
| 3381 | Ga0496108_0170435 | |||
| 3382 | Ga0496108_0242654 | |||
| 3383 | Ga0496108_0274873 | |||
| 3384 | Ga0496108_0347647 | |||
| 3385 | Ga0496108_0373293 | |||
| 3386 | Ga0496108_0778364 | |||
| 3387 | Ga0496109_0022092 | |||
| 3388 | Ga0496109_0028644 | |||
| 3389 | Ga0496109_0028918 | |||
| 3390 | Ga0496109_0074823 | |||
| 3391 | Ga0496109_0105066 | |||
| 3392 | Ga0496109_0117542 | |||
| 3393 | Ga0496109_0131240 | |||
| 3394 | Ga0496109_0154342 | |||
| 3395 | Ga0496109_0236245 | |||
| 3396 | Ga0496109_0251297 | |||
| 3397 | Ga0496109_0474045 | |||
| 3398 | Ga0496110_0022947 | |||
| 3399 | Ga0496110_0046500 | |||
| 3400 | Ga0496110_0049751 | |||
| 3401 | Ga0496110_0064333 | |||
| 3402 | Ga0496110_0126849 | |||
| 3403 | Ga0496110_0171323 | |||
| 3404 | Ga0496110_0193491 | |||
| 3405 | Ga0496110_0223498 | |||
| 3406 | Ga0496110_0402112 | |||
| 3407 | Ga0496110_0571790 | |||
| 3408 | Ga0496110_0874104 | |||
| 3409 | Ga0496111_0001697 | |||
| 3410 | Ga0496111_0017359 | |||
| 3411 | Ga0496111_0019743 | |||
| 3412 | Ga0496111_0020319 | |||
| 3413 | Ga0496111_0035970 | |||
| 3414 | Ga0496111_0044283 | |||
| 3415 | Ga0496111_0347448 | |||
| 3416 | Ga0496111_0490330 | |||
| 3417 | Ga0496112_0000586 | |||
| 3418 | Ga0496112_0028415 | |||
| 3419 | Ga0496112_0048959 | |||
| 3420 | Ga0496112_0088303 | |||
| 3421 | Ga0496112_0193140 | |||
| 3422 | Ga0496112_0674093 | |||
| 3423 | Ga0496112_0905039 | |||
| 3424 | Ga0496113_0015052 | |||
| 3425 | Ga0496113_0041324 | |||
| 3426 | Ga0496113_0059184 | |||
| 3427 | Ga0496113_0105996 | |||
| 3428 | Ga0496113_0119118 | |||
| 3429 | Ga0496113_0119629 | |||
| 3430 | Ga0496114_0004150 | |||
| 3431 | Ga0496114_0009285 | |||
| 3432 | Ga0496114_0028823 | |||
| 3433 | Ga0496114_0031007 | |||
| 3434 | Ga0496114_0067269 | |||
| 3435 | Ga0496114_0102807 | |||
| 3436 | Ga0496114_0134724 | |||
| 3437 | Ga0496114_0157514 | |||
| 3438 | Ga0496114_0278431 | |||
| 3439 | Ga0496114_0852798 | |||
| 3440 | Ga0496114_0908831 | |||
| 3441 | Ga0496115_0021963 | |||
| 3442 | Ga0496115_0028311 | |||
| 3443 | Ga0496115_0047442 | |||
| 3444 | Ga0496115_0207876 | |||
| 3445 | Ga0496115_0707159 | |||
| 3446 | Ga0496119_0000200 | |||
| 3447 | Ga0496119_0000475 | |||
| 3448 | Ga0496119_0026206 | |||
| 3449 | Ga0496119_0054433 | |||
| 3450 | Ga0496120_0000353 | |||
| 3451 | Ga0496120_0002957 | |||
| 3452 | Ga0496121_0014747 | |||
| 3453 | Ga0496125_0293085 | |||
| 3454 | Ga0496126_0004952 | |||
| 3455 | Ga0496126_0026965 | |||
| 3456 | Ga0496126_0043878 | |||
| 3457 | Ga0496126_0184836 | |||
| 3458 | Ga0496126_0438497 | |||
| 3459 | Ga0495678_027678 | |||
| 3460 | Ga0495682_0041301 | |||
| 3461 | Ga0501031_0013166 | |||
| 3462 | Ga0501031_0014095 | |||
| 3463 | Ga0501031_0096162 | |||
| 3464 | Ga0501031_0310468 | |||
| 3465 | Ga0501031_0547186 | |||
| 3466 | Ga0501031_0577604 | |||
| 3467 | Ga0501032_0038311 | |||
| 3468 | Ga0501032_0076296 | |||
| 3469 | Ga0501032_0388240 | |||
| 3470 | Ga0501033_0006244 | |||
| 3471 | Ga0501033_0032215 | |||
| 3472 | Ga0501033_0034045 | |||
| 3473 | Ga0501033_0111002 | |||
| 3474 | Ga0501033_0144725 | |||
| 3475 | Ga0501033_0150444 | |||
| 3476 | Ga0501034_0007085 | |||
| 3477 | Ga0501034_0008257 | |||
| 3478 | Ga0501034_0036552 | |||
| 3479 | Ga0501034_0062389 | |||
| 3480 | Ga0501034_0581792 | |||
| 3481 | Ga0501036_0000154 | |||
| 3482 | Ga0501036_0007966 | |||
| 3483 | Ga0501036_0010321 | |||
| 3484 | Ga0501036_0017214 | |||
| 3485 | Ga0501036_0046676 | |||
| 3486 | Ga0501036_0304204 | |||
| 3487 | Ga0501037_0006107 | |||
| 3488 | Ga0501037_0016220 | |||
| 3489 | Ga0501037_0050588 | |||
| 3490 | Ga0501037_0093624 | |||
| 3491 | Ga0501037_0629464 | |||
| 3492 | Ga0501038_0008899 | |||
| 3493 | Ga0501038_0011859 | |||
| 3494 | Ga0501038_0029152 | |||
| 3495 | Ga0501038_0065187 | |||
| 3496 | Ga0501038_0181013 | |||
| 3497 | Ga0501038_0410994 | |||
| 3498 | Ga0501039_0015284 | |||
| 3499 | Ga0501039_0027179 | |||
| 3500 | Ga0501039_0095901 | |||
| 3501 | Ga0501039_0143434 | |||
| 3502 | Ga0501039_0730034 | |||
| 3503 | Ga0501040_0028569 | |||
| 3504 | Ga0501040_0092810 | |||
| 3505 | Ga0501040_0267729 | |||
| 3506 | Ga0501041_0016820 | |||
| 3507 | Ga0501041_0020014 | |||
| 3508 | Ga0501042_0003066 | |||
| 3509 | Ga0501042_0033230 | |||
| 3510 | Ga0501042_0034260 | |||
| 3511 | Ga0501042_0084146 | |||
| 3512 | Ga0501042_0506112 | |||
| 3513 | Ga0501043_0003227 | |||
| 3514 | Ga0501043_0005709 | |||
| 3515 | Ga0501043_0010922 | |||
| 3516 | Ga0501043_0013418 | |||
| 3517 | Ga0501043_0165569 | |||
| 3518 | Ga0501043_0233097 | |||
| 3519 | Ga0501046_0021502 | |||
| 3520 | Ga0501046_0046370 | |||
| 3521 | Ga0501046_0047282 | |||
| 3522 | Ga0501046_0181215 | |||
| 3523 | Ga0501047_0000033 | |||
| 3524 | Ga0501047_0000369 | |||
| 3525 | Ga0501047_0001481 | |||
| 3526 | Ga0501047_0029209 | |||
| 3527 | Ga0501047_0058613 | |||
| 3528 | Ga0501047_0099451 | |||
| 3529 | Ga0501047_0127143 | |||
| 3530 | Ga0501047_0183674 | |||
| 3531 | Ga0501047_0461742 | |||
| 3532 | Ga0501048_0003583 | |||
| 3533 | Ga0501048_0006936 | |||
| 3534 | Ga0501048_0007884 | |||
| 3535 | Ga0501048_0033083 | |||
| 3536 | Ga0501048_0287186 | |||
| 3537 | Ga0501067_0021266 | |||
| 3538 | Ga0501067_0339433 | |||
| 3539 | Ga0501068_0013033 | |||
| 3540 | Ga0501068_0066962 | |||
| 3541 | Ga0501068_0126056 | |||
| 3542 | Ga0501068_0388112 | |||
| 3543 | Ga0501069_0010447 | |||
| 3544 | Ga0501069_0066819 | |||
| 3545 | Ga0501069_0155485 | |||
| 3546 | Ga0501070_0005487 | |||
| 3547 | Ga0501070_0008402 | |||
| 3548 | Ga0501070_0040771 | |||
| 3549 | Ga0501070_0749249 | |||
| 3550 | Ga0501071_0000622 | |||
| 3551 | Ga0501071_0015459 | |||
| 3552 | Ga0501072_0042082 | |||
| 3553 | Ga0501072_0097045 | |||
| 3554 | Ga0501073_0061740 | |||
| 3555 | Ga0501073_0206183 | |||
| 3556 | Ga0501073_0306197 | |||
| 3557 | Ga0501074_0003420 | |||
| 3558 | Ga0501074_0004389 | |||
| 3559 | Ga0501074_0012014 | |||
| 3560 | Ga0501074_0062681 | |||
| 3561 | Ga0501075_0056288 | |||
| 3562 | Ga0501075_0234055 | |||
| 3563 | Ga0501076_0002267 | |||
| 3564 | Ga0501076_0096796 | |||
| 3565 | Ga0501077_0048562 | |||
| 3566 | Ga0501077_0067104 | |||
| 3567 | Ga0501079_0016047 | |||
| 3568 | Ga0501079_0103124 | |||
| 3569 | Ga0501080_0032359 | |||
| 3570 | Ga0501080_0057577 | |||
| 3571 | Ga0501080_0064310 | |||
| 3572 | Ga0501081_0036447 | |||
| 3573 | Ga0501083_0001270 | |||
| 3574 | Ga0501083_0151204 | |||
| 3575 | Ga0501270_033114 | |||
| 3576 | Ga0501035_0050911 | |||
| 3577 | Ga0501035_0151202 | |||
| 3578 | Ga0501035_0171437 | |||
| 3579 | Ga0501044_0003451 | |||
| 3580 | Ga0501044_0014764 | |||
| 3581 | Ga0501044_0032181 | |||
| 3582 | Ga0501044_0042581 | |||
| 3583 | Ga0501044_0043290 | |||
| 3584 | Ga0501044_0117041 | |||
| 3585 | Ga0501044_0168139 | |||
| 3586 | Ga0501044_0292757 | |||
| 3587 | Ga0501044_0677524 | |||
| 3588 | Ga0501045_0000424 | |||
| 3589 | Ga0501045_0037402 | |||
| 3590 | Ga0501045_0057284 | |||
| 3591 | nmdc:mga03n38_7371_c1 | |||
| 3592 | nmdc:mga0yw44_510969_c1 | |||
| 3593 | nmdc:mga05p37_145975_c1 | |||
| 3594 | nmdc:mga05p37_37397_c1 | |||
| 3595 | nmdc:mga06r32_521174_c1 | |||
| 3596 | nmdc:mga08y16_127471_c1 | |||
| 3597 | nmdc:mga08y16_198046_c1 | |||
| 3598 | nmdc:mga0n895_21840_c1 | |||
| 3599 | nmdc:mga0n895_23116_c1 | |||
| 3600 | nmdc:mga0n895_261667_c1 | |||
| 3601 | nmdc:mga0n895_303043_c1 | |||
| 3602 | nmdc:mga0rr50_67504_c1 | |||
| 3603 | nmdc:mga0rr50_93982_c1 | |||
| 3604 | nmdc:mga08x19_12213_c1 | |||
| 3605 | nmdc:mga08x19_135827_c1 | |||
| 3606 | nmdc:mga08x19_19788_c1 | |||
| 3607 | nmdc:mga08x19_253060_c1 | |||
| 3608 | nmdc:mga0a205_12233_c1 | |||
| 3609 | nmdc:mga0a205_152994_c1 | |||
| 3610 | nmdc:mga0a205_18672_c1 | |||
| 3611 | Ga0495601_0029968 | |||
| 3612 | Ga0495601_0035862 | |||
| 3613 | Ga0495601_0102025 | |||
| 3614 | Ga0495601_0180603 | |||
| 3615 | Ga0495601_0195085 | |||
| 3616 | Ga0495601_0291558 | |||
| 3617 | Ga0495601_0361339 | |||
| 3618 | Ga0495612_0015838 | |||
| 3619 | Ga0495612_0023246 | |||
| 3620 | Ga0495612_0031195 | |||
| 3621 | Ga0495612_0048953 | |||
| 3622 | Ga0495612_0116533 | |||
| 3623 | Ga0495612_0169220 | |||
| 3624 | Ga0495612_0172639 | |||
| 3625 | Ga0495655_0004208 | |||
| 3626 | Ga0495655_0048185 | |||
| 3627 | Ga0495595_0004203 | |||
| 3628 | Ga0495595_0010359 | |||
| 3629 | Ga0495595_0027343 | |||
| 3630 | Ga0495619_0005533 | |||
| 3631 | Ga0495619_0055462 | |||
| 3632 | Ga0495619_0062929 | |||
| 3633 | Ga0495619_0095675 | |||
| 3634 | Ga0495619_0111525 | |||
| 3635 | Ga0495619_0137360 | |||
| 3636 | Ga0500578_0102675 | |||
| 3637 | Ga0500583_0160244 | |||
| 3638 | Ga0500654_149730 | |||
| 3639 | Ga0500558_069221 | |||
| 3640 | Ga0500560_002512 | |||
| 3641 | Ga0500652_032895 | |||
| 3642 | Ga0500658_0174001 | |||
| 3643 | Ga0500568_0003761 | |||
| 3644 | Ga0500573_0064343 | |||
| 3645 | Ga0500600_0067524 | |||
| 3646 | Ga0500616_0001111 | |||
| 3647 | Ga0500616_0001619 | |||
| 3648 | Ga0500616_0102913 | |||
| 3649 | Ga0500624_003031 | |||
| 3650 | Ga0500634_0186514 | |||
| 3651 | Ga0500656_018751 | |||
| 3652 | Ga0501084_0032890 | |||
| 3653 | Ga0501084_0041617 | |||
| 3654 | Ga0501084_1116875 | |||
| 3655 | Ga0501082_0062906 | |||
| 3656 | Ga0501082_0077792 | |||
| 3657 | Ga0466962_0015486 | |||
| 3658 | Ga0466962_0017787 | |||
| 3659 | Ga0466962_0036829 | |||
| 3660 | Ga0466962_0036934 | |||
| 3661 | Ga0466962_0058723 | |||
| 3662 | Ga0466962_0063712 | |||
| 3663 | Ga0466962_0198539 | |||
| 3664 | Ga0530510_0020733 | |||
| 3665 | Ga0530510_0052918 | |||
| 3666 | 2506868635 | |||
| 3667 | 2528204225 | |||
| 3668 | 2528214638 | |||
| 3669 | 2546947015 | |||
| 3670 | 2547408247 | |||
| 3671 | 2554257211 | |||
| 3672 | 2579747476 | |||
| 3673 | 2579854487 | |||
| 3674 | 2585299269 | |||
| 3675 | 2585308921 | |||
| 3676 | 2585313613 | |||
| 3677 | 2616694936 | |||
| 3678 | 2616904593 | |||
| 3679 | 2619853873 | |||
| 3680 | 2620349444 | |||
| 3681 | 2623497760 | |||
| 3682 | 2626634784 | |||
| 3683 | 2643765071 | |||
| 3684 | 2643768460 | |||
| 3685 | 2643852315 | |||
| 3686 | 2643899160 | |||
| 3687 | 2643942410 | |||
| 3688 | 2644111838 | |||
| 3689 | 2644136837 | |||
| 3690 | 2644182548 | |||
| 3691 | 2644262424 | |||
| 3692 | 2644390034 | |||
| 3693 | 2644403343 | |||
| 3694 | 2644429491 | |||
| 3695 | 2644437260 | |||
| 3696 | 2644446901 | |||
| 3697 | 2644461090 | |||
| 3698 | 2644607748 | |||
| 3699 | 2644628998 | |||
| 3700 | 2686543471 | |||
| 3701 | 2731905894 | |||
| 3702 | 2768643471 | |||
| 3703 | 2774867137 | |||
| 3704 | 2774905405 | |||
| 3705 | 2784473081 | |||
| 3706 | 2784588713 | |||
| 3707 | 2785343161 | |||
| 3708 | 2785369642 | |||
| 3709 | 2786670728 | |||
| 3710 | 2793978334 | |||
| 3711 | 2799185849 | |||
| 3712 | 2804846760 | |||
| 3713 | 2808842163 | |||
| 3714 | 2808871871 | |||
| 3715 | 2808920696 | |||
| 3716 | 2809232323 | |||
| 3717 | 2810363084 | |||
| 3718 | 2811849168 | |||
| 3719 | 2812357965 | |||
| 3720 | 2812373249 | |||
| 3721 | 2812480415 | |||
| 3722 | 2817509797 | |||
| 3723 | 2819426049 | |||
| 3724 | 2819665107 | |||
| 3725 | 2819692822 | |||
| 3726 | 2819695531 | |||
| 3727 | 2819727221 | |||
| 3728 | 2852636533 | |||
| 3729 | 2856742975 | |||
| 3730 | 2862179355 | |||
| 3731 | 2862285778 | |||
| 3732 | 2862297060 | |||
| 3733 | 2862392144 | |||
| 3734 | 2862511694 | |||
| 3735 | 2862579128 | |||
| 3736 | 2862706478 | |||
| 3737 | 2863404461 | |||
| 3738 | 2867348931 | |||
| 3739 | 2867371996 | |||
| 3740 | 2867432461 | |||
| 3741 | 2867478816 | |||
| 3742 | 2873155610 | |||
| 3743 | 2873314482 | |||
| 3744 | 2875395565 | |||
| 3745 | 2877680984 | |||
| 3746 | 2891401193 | |||
| 3747 | 2891560109 | |||
| 3748 | 2891563541 | |||
| 3749 | 2893686216 | |||
| 3750 | 2905930823 | |||
| 3751 | 2912719829 | |||
| 3752 | 2912724225 | |||
| 3753 | 2912760902 | |||
| 3754 | 2918505451 | |||
| 3755 | 2919448242 | |||
| 3756 | 2919469412 | |||
| 3757 | 2935393297 | |||
| 3758 | 2946006964 | |||
| 3759 | 2946049874 | |||
| 3760 | 2946067878 | |||
| 3761 | 2946076017 | |||
| 3762 | 2947229069 | |||
| 3763 | 2954007256 | |||
| 3764 | 2954386094 | |||
| 3765 | 2954677053 | |||
| 3766 | 2954687103 | |||
| 3767 | 2954696734 | |||
| 3768 | 2954705404 | |||
| 3769 | 2954716115 | |||
| 3770 | 2954726058 | |||
| 3771 | 2954735752 | |||
| 3772 | 2954744984 | |||
| 3773 | 2954754607 | |||
| 3774 | 2954763956 | |||
| 3775 | 2964328590 | |||
| 3776 | 2966601770 | |||
| 3777 | 2966927025 | |||
| 3778 | 2990045326 | |||
| 3779 | 2990063211 | |||
| 3780 | 2990088366 | |||
| 3781 | 2997457727 | |||
| 3782 | 2997600299 | |||
| 3783 | 3003004922 | |||
| 3784 | 3006325195 | |||
| 3785 | 3006394459 | |||
| 3786 | 3006428808 | |||
| 3787 | 3006490861 | |||
| 3788 | 3006500871 | |||
| 3789 | 637877802 | |||
| 3790 | 8008490301 | |||
| 3791 | 8008567119 | |||
| 3792 | 8008578779 | |||
| 3793 | 8023627098 | |||
| 3794 | 8025482475 | |||
| 3795 | 8025529603 | |||
| 3796 | 8025537899 | |||
| 3797 | 8033690855 | |||
| 3798 | 8047897968 | |||
| 3799 | 8048133048 | |||
| 3800 | 8048360926 | |||
| 3801 | 8048374931 | |||
| 3802 | 8048383274 | |||
| 3803 | 8048413926 | |||
| 3804 | 8053952145 | |||
| 3805 | 8054161755 | |||
| 3806 | 8054917380 | |||
| 3807 | 8054921994 | |||
| 3808 | 8055072721 | |||
| 3809 | 8055160494 | |||
| 3810 | 8055175942 | |||
| 3811 | 8056062084 | |||
| 3812 | 8056450884 | |||
| 3813 | 8056671245 | |||
| 3814 | 8056833498 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7cci-assembly1.cif.gz_A | acinetobacter baumannii response regulator ader with disordered n terminus | 0.9685 | 2 | 120 |
| 2a9r-assembly1.cif.gz_A-2 | rr02-rec phosphate in the active site | 0.9534 | 3 | 118 |
| 1nxt-assembly1.cif.gz_A-2 | micarec ph 4.0 | 0.9526 | 3 | 118 |
| 8fk2-assembly1.cif.gz_B | the n-terminal vicr from streptococcus mutans | 0.9519 | 1 | 121 |
| 2iyn-assembly4.cif.gz_B | the co-factor-induced pre-active conformation in phob | 0.9512 | 2 | 118 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WGN1_2_80_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9876 | 2 | 80 | 3.40.50.2300 |
| af_P21866_1_80_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9839 | 1 | 80 | 3.40.50.2300 |
| af_P69228_9_89_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9818 | 1 | 80 | 3.40.50.2300 |
| af_O69730_8_88_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.98 | 1 | 80 | 3.40.50.2300 |
| af_Q2FXN6_3_86_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9791 | 3 | 82 | 3.40.50.2300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1I3A8P6-F1-model_v4 | DNA-binding response regulator, OmpR family, contains REC and winged-helix (WHTH) domain | 0.8096 | 2 | 227 |
GO:0000156
GO:0000976 GO:0005829 GO:0006355 GO:0032993 |
| AF-A0A1I3A8P6-F1-model_v4 | DNA-binding response regulator, OmpR family, contains REC and winged-helix (WHTH) domain | 0.797 | 2 | 227 |
GO:0000156
GO:0000976 GO:0005829 GO:0006355 GO:0032993 |
| AF-A0A158KL75-F1-model_v4 | DNA-binding response regulator KdpE | 0.7673 | 1 | 153 |
GO:0000156
GO:0000976 GO:0005829 GO:0006355 GO:0032993 |
| AF-A0A855HH93-F1-model_v4 | deleted | 0.7537 | 2 | 153 |
|
| AF-A0A527HBX6-F1-model_v4 | Response regulator | 0.7442 | 2 | 153 |
GO:0000156
GO:0000976 GO:0005829 GO:0006355 GO:0032993 |