F495614
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1761 | 441 | 3522 | 136 |
Family's Representative Sequence
| Representative Sequence | 3300028563|Ga0265319_1013800|Ga0265319_10138003 |
| Length | 160 |
| Sequence | MARLTAARPGGDCGTGSGCERIGDVSIDSPNIQSLERWSFDVRRVEKPWGYELIWALTDVYCGKVLFVRAGQSLSLQFHNEKDESWLVQSGRAKLELGEAGKGVLMHEVVQAGAAFHYVPGTVHRVTAIEDTTILEVSTPHLDDVVRLEDAYGREGTSAP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 2 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 3 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 4 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 5 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 8 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 10 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 12 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 15 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 25 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 42 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 43 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 48 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 51 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 59 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 61 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 62 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 63 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 65 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 66 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 67 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 68 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 69 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 70 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 71 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 72 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 73 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 74 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 75 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 76 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 78 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 79 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 80 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 81 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 82 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 83 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 84 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 85 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 86 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 88 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 89 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 90 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 91 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 92 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 93 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 94 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 95 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 96 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 98 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300012483 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610 | Metagenome | Rhizosphere |
| 115 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 126 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 130 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 132 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 133 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 134 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 135 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 136 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 137 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 192 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 195 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 196 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 197 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 198 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 199 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 200 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 201 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 202 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 203 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 204 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 205 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 206 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 207 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 208 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 209 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 210 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 211 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 212 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 213 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 214 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 215 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 216 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 217 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 218 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 219 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 220 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 221 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 222 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 223 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 224 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 225 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 226 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 227 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 228 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 229 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 230 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 231 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 232 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 233 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 234 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 235 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 236 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 237 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 238 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 239 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 240 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 241 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 242 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 243 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 244 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 245 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 246 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 247 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 248 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 249 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 250 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 251 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 252 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 253 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 254 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 255 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 256 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 257 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 258 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 259 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 260 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 261 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 262 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 263 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 264 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 265 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 266 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 267 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 268 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 269 | 3300042119 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218L_E14_082316_1902 | Metagenome | Rhizosphere |
| 270 | 3300042120 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 | Metagenome | Rhizosphere |
| 271 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 272 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 273 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 274 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 275 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 276 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 277 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 278 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 279 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 280 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 281 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 282 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 283 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 284 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 285 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 286 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 287 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 288 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 289 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 290 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 291 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 292 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 293 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 365 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 366 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 367 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 368 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 369 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 370 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 371 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 372 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 373 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 374 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 375 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 376 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 377 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 378 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 379 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 380 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 381 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 382 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 383 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 384 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 385 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 386 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 387 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 388 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 389 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 390 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 391 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 392 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 393 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 394 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 395 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 396 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 397 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 398 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 399 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 400 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 401 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 402 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 403 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 404 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 405 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 406 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 407 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 408 | 3300049689 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought | Metagenome | Rhizosphere |
| 409 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 410 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 411 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 412 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 413 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 414 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 415 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 416 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 417 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 418 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 419 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 420 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 421 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 422 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 423 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 424 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 425 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 426 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 427 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 428 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 429 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 430 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 431 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 432 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 433 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 434 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 435 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 436 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 437 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 438 | 3300059626 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 439 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 440 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 441 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.98 |
| Metatranscriptomes | 1.02 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.97 |
| Nodule | 0 |
| Rhizoplane | 8.52 |
| Rhizosphere | 89.55 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 14.03 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0265319_1013800 | 3300028563 | Bacteria | 3194 |
| 2 | JGI24744J21845_10000960 | 3300002077 | Bacteria | 5496 |
| 3 | JGI25407J50210_10001824 | 3300003373 | Bacteria | 4919 |
| 4 | JGI25405J52794_10055301 | 3300003911 | Unclassified | 854 |
| 5 | Ga0070658_10024594 | 3300005327 | Bacteria | 4830 |
| 6 | Ga0070658_10098314 | 3300005327 | Bacteria | 2417 |
| 7 | Ga0070658_10132667 | 3300005327 | Bacteria | 2076 |
| 8 | Ga0070658_10288314 | 3300005327 | Bacteria | 1398 |
| 9 | Ga0070658_10540868 | 3300005327 | Unclassified | 1008 |
| 10 | Ga0070658_10868323 | 3300005327 | Bacteria | 784 |
| 11 | Ga0070658_11094837 | 3300005327 | Bacteria | 693 |
| 12 | Ga0070658_11248204 | 3300005327 | Unclassified | 646 |
| 13 | Ga0070658_11400022 | 3300005327 | Bacteria | 607 |
| 14 | Ga0070683_100001652 | 3300005329 | Bacteria | 17281 |
| 15 | Ga0070683_100017233 | 3300005329 | Bacteria | 6381 |
| 16 | Ga0070683_100060391 | 3300005329 | Bacteria | 3523 |
| 17 | Ga0070683_100164114 | 3300005329 | Bacteria | 2108 |
| 18 | Ga0070683_100186421 | 3300005329 | Bacteria | 1969 |
| 19 | Ga0070683_100238216 | 3300005329 | Bacteria | 1730 |
| 20 | Ga0070683_100296896 | 3300005329 | Unclassified | 1537 |
| 21 | Ga0070683_100701841 | 3300005329 | Bacteria | 969 |
| 22 | Ga0070683_101947625 | 3300005329 | Unclassified | 565 |
| 23 | Ga0070683_102002313 | 3300005329 | Bacteria | 556 |
| 24 | Ga0070690_100019255 | 3300005330 | Bacteria | 4138 |
| 25 | Ga0070690_101352298 | 3300005330 | Bacteria | 572 |
| 26 | Ga0070666_11212485 | 3300005335 | Bacteria | 562 |
| 27 | Ga0070680_100008118 | 3300005336 | Bacteria | 8016 |
| 28 | Ga0070680_100153672 | 3300005336 | Bacteria | 1933 |
| 29 | Ga0070680_100154767 | 3300005336 | Bacteria | 1925 |
| 30 | Ga0070680_100951145 | 3300005336 | Bacteria | 741 |
| 31 | Ga0070680_101216723 | 3300005336 | Bacteria | 652 |
| 32 | Ga0070682_100014196 | 3300005337 | Bacteria | 4600 |
| 33 | Ga0070682_100155954 | 3300005337 | Bacteria | 1572 |
| 34 | Ga0070682_100529155 | 3300005337 | Bacteria | 918 |
| 35 | Ga0070682_100722819 | 3300005337 | Bacteria | 801 |
| 36 | Ga0070682_100778455 | 3300005337 | Bacteria | 775 |
| 37 | Ga0068868_100010092 | 3300005338 | Bacteria | 6822 |
| 38 | Ga0068868_100027493 | 3300005338 | Bacteria | 4340 |
| 39 | Ga0068868_100358715 | 3300005338 | Unclassified | 1250 |
| 40 | Ga0070660_100006026 | 3300005339 | Bacteria | 8384 |
| 41 | Ga0070660_100016383 | 3300005339 | Bacteria | 5379 |
| 42 | Ga0070660_100035757 | 3300005339 | Bacteria | 3760 |
| 43 | Ga0070660_100044741 | 3300005339 | Bacteria | 3387 |
| 44 | Ga0070660_100055265 | 3300005339 | Bacteria | 3068 |
| 45 | Ga0070660_100330381 | 3300005339 | Bacteria | 1253 |
| 46 | Ga0070660_100533962 | 3300005339 | Unclassified | 978 |
| 47 | Ga0070689_100006812 | 3300005340 | Bacteria | 7946 |
| 48 | Ga0070691_10213769 | 3300005341 | Bacteria | 1019 |
| 49 | Ga0070687_100282156 | 3300005343 | Bacteria | 1046 |
| 50 | Ga0070687_100892703 | 3300005343 | Bacteria | 637 |
| 51 | Ga0070661_100062932 | 3300005344 | Bacteria | 2724 |
| 52 | Ga0070661_100217140 | 3300005344 | Bacteria | 1465 |
| 53 | Ga0070661_101046311 | 3300005344 | Bacteria | 678 |
| 54 | Ga0070692_10007346 | 3300005345 | Bacteria | 4850 |
| 55 | Ga0070692_10674027 | 3300005345 | Unclassified | 693 |
| 56 | Ga0070668_100026182 | 3300005347 | Bacteria | 4424 |
| 57 | Ga0070668_100563009 | 3300005347 | Bacteria | 993 |
| 58 | Ga0070669_101553195 | 3300005353 | Bacteria | 576 |
| 59 | Ga0070669_101762271 | 3300005353 | Bacteria | 540 |
| 60 | Ga0070675_100037741 | 3300005354 | Bacteria | 3937 |
| 61 | Ga0070675_101476484 | 3300005354 | Bacteria | 627 |
| 62 | Ga0070671_100015983 | 3300005355 | Bacteria | 6063 |
| 63 | Ga0070671_100088093 | 3300005355 | Bacteria | 2598 |
| 64 | Ga0070674_100007583 | 3300005356 | Bacteria | 6406 |
| 65 | Ga0070674_100470683 | 3300005356 | Unclassified | 1041 |
| 66 | Ga0070673_100148872 | 3300005364 | Bacteria | 1981 |
| 67 | Ga0070673_100205245 | 3300005364 | Bacteria | 1699 |
| 68 | Ga0070688_100524924 | 3300005365 | Bacteria | 896 |
| 69 | Ga0070659_100033126 | 3300005366 | Bacteria | 4011 |
| 70 | Ga0070659_100038472 | 3300005366 | Bacteria | 3731 |
| 71 | Ga0070659_100374884 | 3300005366 | Bacteria | 1198 |
| 72 | Ga0070659_100444071 | 3300005366 | Bacteria | 1099 |
| 73 | Ga0070667_100179863 | 3300005367 | Bacteria | 1870 |
| 74 | Ga0070667_100894857 | 3300005367 | Bacteria | 826 |
| 75 | Ga0070667_101122528 | 3300005367 | Bacteria | 735 |
| 76 | Ga0070703_10139602 | 3300005406 | Bacteria | 899 |
| 77 | Ga0070709_10011026 | 3300005434 | Bacteria | 5022 |
| 78 | Ga0070709_10026548 | 3300005434 | Bacteria | 3434 |
| 79 | Ga0070709_10348405 | 3300005434 | Unclassified | 1094 |
| 80 | Ga0070709_10503170 | 3300005434 | Bacteria | 921 |
| 81 | Ga0070709_10972906 | 3300005434 | Bacteria | 674 |
| 82 | Ga0070709_11124988 | 3300005434 | Bacteria | 629 |
| 83 | Ga0070714_100028276 | 3300005435 | Bacteria | 4650 |
| 84 | Ga0070714_100032738 | 3300005435 | Bacteria | 4341 |
| 85 | Ga0070714_100178964 | 3300005435 | Bacteria | 1928 |
| 86 | Ga0070714_100266861 | 3300005435 | Bacteria | 1586 |
| 87 | Ga0070714_100388779 | 3300005435 | Bacteria | 1316 |
| 88 | Ga0070714_100657281 | 3300005435 | Bacteria | 1009 |
| 89 | Ga0070714_100911235 | 3300005435 | Bacteria | 854 |
| 90 | Ga0070714_101135771 | 3300005435 | Unclassified | 762 |
| 91 | Ga0070714_101865845 | 3300005435 | Bacteria | 587 |
| 92 | Ga0070714_102220530 | 3300005435 | Unclassified | 534 |
| 93 | Ga0070713_100013778 | 3300005436 | Bacteria | 5981 |
| 94 | Ga0070713_100037697 | 3300005436 | Bacteria | 3909 |
| 95 | Ga0070713_100115959 | 3300005436 | Bacteria | 2342 |
| 96 | Ga0070713_100213048 | 3300005436 | Bacteria | 1750 |
| 97 | Ga0070713_100495133 | 3300005436 | Bacteria | 1153 |
| 98 | Ga0070713_100595507 | 3300005436 | Unclassified | 1050 |
| 99 | Ga0070713_100954908 | 3300005436 | Bacteria | 826 |
| 100 | Ga0070710_10008474 | 3300005437 | Bacteria | 5006 |
| 101 | Ga0070710_10054659 | 3300005437 | Bacteria | 2253 |
| 102 | Ga0070710_10201695 | 3300005437 | Bacteria | 1256 |
| 103 | Ga0070710_10430744 | 3300005437 | Bacteria | 890 |
| 104 | Ga0070710_10588400 | 3300005437 | Unclassified | 773 |
| 105 | Ga0070710_10759654 | 3300005437 | Bacteria | 689 |
| 106 | Ga0070701_10033849 | 3300005438 | Bacteria | 2556 |
| 107 | Ga0070711_100001520 | 3300005439 | Bacteria | 12784 |
| 108 | Ga0070711_100023649 | 3300005439 | Bacteria | 3999 |
| 109 | Ga0070711_100093336 | 3300005439 | Bacteria | 2173 |
| 110 | Ga0070711_100173984 | 3300005439 | Unclassified | 1643 |
| 111 | Ga0070711_100355951 | 3300005439 | Bacteria | 1178 |
| 112 | Ga0070711_100582484 | 3300005439 | Unclassified | 932 |
| 113 | Ga0070711_101523951 | 3300005439 | Bacteria | 583 |
| 114 | Ga0070705_100050250 | 3300005440 | Bacteria | 2425 |
| 115 | Ga0070705_100307046 | 3300005440 | Bacteria | 1139 |
| 116 | Ga0070705_100401145 | 3300005440 | Bacteria | 1015 |
| 117 | Ga0070705_100441714 | 3300005440 | Bacteria | 974 |
| 118 | Ga0070700_100001889 | 3300005441 | Bacteria | 10586 |
| 119 | Ga0070700_100455269 | 3300005441 | Unclassified | 975 |
| 120 | Ga0070694_100020934 | 3300005444 | Bacteria | 4174 |
| 121 | Ga0070694_100113732 | 3300005444 | Bacteria | 1932 |
| 122 | Ga0070708_100023451 | 3300005445 | Bacteria | 5248 |
| 123 | Ga0070708_101330169 | 3300005445 | Bacteria | 671 |
| 124 | Ga0070663_100003865 | 3300005455 | Bacteria | 8726 |
| 125 | Ga0070663_100558516 | 3300005455 | Bacteria | 958 |
| 126 | Ga0070678_100009983 | 3300005456 | Bacteria | 5776 |
| 127 | Ga0070678_100530684 | 3300005456 | Unclassified | 1042 |
| 128 | Ga0070678_100566677 | 3300005456 | Bacteria | 1010 |
| 129 | Ga0070678_100741977 | 3300005456 | Bacteria | 887 |
| 130 | Ga0070678_102199550 | 3300005456 | Unclassified | 523 |
| 131 | Ga0070662_100622182 | 3300005457 | Bacteria | 909 |
| 132 | Ga0070662_101283885 | 3300005457 | Bacteria | 630 |
| 133 | Ga0070681_10021240 | 3300005458 | Bacteria | 6506 |
| 134 | Ga0070681_10022909 | 3300005458 | Bacteria | 6276 |
| 135 | Ga0070681_10031175 | 3300005458 | Bacteria | 5351 |
| 136 | Ga0070681_10047668 | 3300005458 | Bacteria | 4284 |
| 137 | Ga0070681_10050995 | 3300005458 | Bacteria | 4128 |
| 138 | Ga0070681_10099226 | 3300005458 | Bacteria | 2858 |
| 139 | Ga0070681_10183871 | 3300005458 | Bacteria | 2011 |
| 140 | Ga0070681_10215955 | 3300005458 | Bacteria | 1834 |
| 141 | Ga0070681_10281512 | 3300005458 | Bacteria | 1573 |
| 142 | Ga0070681_10310396 | 3300005458 | Bacteria | 1487 |
| 143 | Ga0070681_10949764 | 3300005458 | Bacteria | 779 |
| 144 | Ga0068867_100002920 | 3300005459 | Bacteria | 12048 |
| 145 | Ga0068867_100515956 | 3300005459 | Bacteria | 1030 |
| 146 | Ga0070706_100206032 | 3300005467 | Bacteria | 1837 |
| 147 | Ga0070706_100482002 | 3300005467 | Bacteria | 1154 |
| 148 | Ga0070707_100002419 | 3300005468 | Bacteria | 17795 |
| 149 | Ga0070707_100067070 | 3300005468 | Bacteria | 3451 |
| 150 | Ga0070707_100127311 | 3300005468 | Unclassified | 2475 |
| 151 | Ga0070707_100329462 | 3300005468 | Bacteria | 1483 |
| 152 | Ga0070707_101262787 | 3300005468 | Unclassified | 705 |
| 153 | Ga0070698_100016387 | 3300005471 | Bacteria | 7825 |
| 154 | Ga0070698_100017977 | 3300005471 | Bacteria | 7445 |
| 155 | Ga0070698_100197928 | 3300005471 | Bacteria | 1945 |
| 156 | Ga0070698_102061150 | 3300005471 | Unclassified | 524 |
| 157 | Ga0070699_100053515 | 3300005518 | Bacteria | 3493 |
| 158 | Ga0070699_100062020 | 3300005518 | Unclassified | 3240 |
| 159 | Ga0070699_100383779 | 3300005518 | Bacteria | 1269 |
| 160 | Ga0070699_100508273 | 3300005518 | Bacteria | 1095 |
| 161 | Ga0070679_100002604 | 3300005530 | Bacteria | 16412 |
| 162 | Ga0070679_100072801 | 3300005530 | Bacteria | 3429 |
| 163 | Ga0070679_100074082 | 3300005530 | Bacteria | 3395 |
| 164 | Ga0070679_100077707 | 3300005530 | Bacteria | 3309 |
| 165 | Ga0070679_100138708 | 3300005530 | Bacteria | 2412 |
| 166 | Ga0070679_100161901 | 3300005530 | Bacteria | 2212 |
| 167 | Ga0070679_100166241 | 3300005530 | Bacteria | 2179 |
| 168 | Ga0070679_100203356 | 3300005530 | Bacteria | 1945 |
| 169 | Ga0070679_100315289 | 3300005530 | Bacteria | 1513 |
| 170 | Ga0070679_100429186 | 3300005530 | Bacteria | 1267 |
| 171 | Ga0070679_100798995 | 3300005530 | Bacteria | 887 |
| 172 | Ga0070679_101290883 | 3300005530 | Bacteria | 676 |
| 173 | Ga0070679_101337935 | 3300005530 | Unclassified | 662 |
| 174 | Ga0070679_101902483 | 3300005530 | Bacteria | 544 |
| 175 | Ga0070684_100022931 | 3300005535 | Bacteria | 5214 |
| 176 | Ga0070684_100027893 | 3300005535 | Bacteria | 4771 |
| 177 | Ga0070684_100100928 | 3300005535 | Bacteria | 2578 |
| 178 | Ga0070684_100101097 | 3300005535 | Bacteria | 2576 |
| 179 | Ga0070684_100119575 | 3300005535 | Bacteria | 2369 |
| 180 | Ga0070684_100236949 | 3300005535 | Bacteria | 1667 |
| 181 | Ga0070684_100322093 | 3300005535 | Bacteria | 1420 |
| 182 | Ga0070697_100221110 | 3300005536 | Bacteria | 1614 |
| 183 | Ga0070697_100232065 | 3300005536 | Bacteria | 1574 |
| 184 | Ga0070697_101134415 | 3300005536 | Bacteria | 696 |
| 185 | Ga0068853_100044117 | 3300005539 | Bacteria | 3816 |
| 186 | Ga0068853_100140662 | 3300005539 | Bacteria | 2166 |
| 187 | Ga0068853_100712984 | 3300005539 | Bacteria | 957 |
| 188 | Ga0068853_101255591 | 3300005539 | Bacteria | 716 |
| 189 | Ga0068853_101267975 | 3300005539 | Bacteria | 712 |
| 190 | Ga0068853_101356012 | 3300005539 | Bacteria | 688 |
| 191 | Ga0070672_100014159 | 3300005543 | Bacteria | 5644 |
| 192 | Ga0070686_100003711 | 3300005544 | Bacteria | 8393 |
| 193 | Ga0070695_100000691 | 3300005545 | Bacteria | 18047 |
| 194 | Ga0070695_100042188 | 3300005545 | Bacteria | 2895 |
| 195 | Ga0070695_100141937 | 3300005545 | Unclassified | 1666 |
| 196 | Ga0070695_100142749 | 3300005545 | Bacteria | 1662 |
| 197 | Ga0070696_100020674 | 3300005546 | Bacteria | 4461 |
| 198 | Ga0070696_100062600 | 3300005546 | Bacteria | 2604 |
| 199 | Ga0070696_100213638 | 3300005546 | Unclassified | 1445 |
| 200 | Ga0070696_101250719 | 3300005546 | Bacteria | 629 |
| 201 | Ga0070693_100124306 | 3300005547 | Bacteria | 1604 |
| 202 | Ga0070665_100045306 | 3300005548 | Bacteria | 4418 |
| 203 | Ga0070665_100310022 | 3300005548 | Bacteria | 1582 |
| 204 | Ga0070665_100338765 | 3300005548 | Bacteria | 1508 |
| 205 | Ga0070704_100009470 | 3300005549 | Bacteria | 5886 |
| 206 | Ga0070704_100031449 | 3300005549 | Bacteria | 3570 |
| 207 | Ga0070704_100081794 | 3300005549 | Bacteria | 2380 |
| 208 | Ga0070704_101862636 | 3300005549 | Unclassified | 557 |
| 209 | Ga0068855_100005599 | 3300005563 | Bacteria | 15336 |
| 210 | Ga0068855_100071082 | 3300005563 | Bacteria | 4047 |
| 211 | Ga0068855_100076427 | 3300005563 | Bacteria | 3886 |
| 212 | Ga0068855_100192962 | 3300005563 | Bacteria | 2296 |
| 213 | Ga0068855_100200635 | 3300005563 | Unclassified | 2245 |
| 214 | Ga0068855_100248330 | 3300005563 | Bacteria | 1985 |
| 215 | Ga0068855_100254836 | 3300005563 | Bacteria | 1956 |
| 216 | Ga0068855_100264783 | 3300005563 | Bacteria | 1914 |
| 217 | Ga0068855_100387366 | 3300005563 | Bacteria | 1534 |
| 218 | Ga0068855_100481544 | 3300005563 | Bacteria | 1351 |
| 219 | Ga0068855_100606051 | 3300005563 | Bacteria | 1180 |
| 220 | Ga0070664_100778101 | 3300005564 | Bacteria | 894 |
| 221 | Ga0070664_100934191 | 3300005564 | Bacteria | 814 |
| 222 | Ga0070664_101134218 | 3300005564 | Bacteria | 737 |
| 223 | Ga0068857_100007740 | 3300005577 | Bacteria | 9255 |
| 224 | Ga0068857_100043448 | 3300005577 | Bacteria | 3986 |
| 225 | Ga0068857_100131252 | 3300005577 | Bacteria | 2260 |
| 226 | Ga0068857_100308824 | 3300005577 | Bacteria | 1459 |
| 227 | Ga0068857_100507964 | 3300005577 | Bacteria | 1132 |
| 228 | Ga0068854_100657788 | 3300005578 | Bacteria | 900 |
| 229 | Ga0068856_100014835 | 3300005614 | Bacteria | 7520 |
| 230 | Ga0068856_100109583 | 3300005614 | Bacteria | 2757 |
| 231 | Ga0068856_100217295 | 3300005614 | Bacteria | 1927 |
| 232 | Ga0068856_100281439 | 3300005614 | Bacteria | 1680 |
| 233 | Ga0068856_100389413 | 3300005614 | Bacteria | 1413 |
| 234 | Ga0070702_100080089 | 3300005615 | Bacteria | 1953 |
| 235 | Ga0070702_100107332 | 3300005615 | Bacteria | 1724 |
| 236 | Ga0070702_100346172 | 3300005615 | Bacteria | 1045 |
| 237 | Ga0068852_100057219 | 3300005616 | Bacteria | 3373 |
| 238 | Ga0068852_100373780 | 3300005616 | Bacteria | 1397 |
| 239 | Ga0068852_100655178 | 3300005616 | Unclassified | 1058 |
| 240 | Ga0068859_100229612 | 3300005617 | Bacteria | 1944 |
| 241 | Ga0068864_100275486 | 3300005618 | Bacteria | 1569 |
| 242 | Ga0068866_10182170 | 3300005718 | Bacteria | 1242 |
| 243 | Ga0068866_10430769 | 3300005718 | Bacteria | 858 |
| 244 | Ga0068861_100050711 | 3300005719 | Bacteria | 3148 |
| 245 | Ga0068861_100136400 | 3300005719 | Bacteria | 1997 |
| 246 | Ga0068851_10805172 | 3300005834 | Bacteria | 584 |
| 247 | Ga0068863_100297160 | 3300005841 | Bacteria | 1566 |
| 248 | Ga0068863_101481101 | 3300005841 | Bacteria | 687 |
| 249 | Ga0068860_100067587 | 3300005843 | Bacteria | 3395 |
| 250 | Ga0068860_101009480 | 3300005843 | Bacteria | 850 |
| 251 | Ga0068862_100954482 | 3300005844 | Unclassified | 846 |
| 252 | Ga0068862_101037874 | 3300005844 | Bacteria | 812 |
| 253 | Ga0081455_10003877 | 3300005937 | Bacteria | 17035 |
| 254 | Ga0081455_10007079 | 3300005937 | Bacteria | 11900 |
| 255 | Ga0081455_10025023 | 3300005937 | Bacteria | 5515 |
| 256 | Ga0081455_10102019 | 3300005937 | Bacteria | 2302 |
| 257 | Ga0081455_10124214 | 3300005937 | Bacteria | 2028 |
| 258 | Ga0081455_10175429 | 3300005937 | Bacteria | 1628 |
| 259 | Ga0081455_10649859 | 3300005937 | Bacteria | 679 |
| 260 | Ga0081538_10000012 | 3300005981 | Bacteria | 153046 |
| 261 | Ga0081538_10000078 | 3300005981 | Bacteria | 92826 |
| 262 | Ga0081538_10001260 | 3300005981 | Bacteria | 26428 |
| 263 | Ga0081538_10002330 | 3300005981 | Bacteria | 18723 |
| 264 | Ga0081538_10042481 | 3300005981 | Bacteria | 2868 |
| 265 | Ga0081540_1000116 | 3300005983 | Bacteria | 84152 |
| 266 | Ga0070717_10006695 | 3300006028 | Bacteria | 8499 |
| 267 | Ga0070717_10009605 | 3300006028 | Bacteria | 7279 |
| 268 | Ga0070717_10027420 | 3300006028 | Bacteria | 4553 |
| 269 | Ga0070717_10049312 | 3300006028 | Bacteria | 3456 |
| 270 | Ga0070717_10094914 | 3300006028 | Bacteria | 2524 |
| 271 | Ga0070717_10345788 | 3300006028 | Bacteria | 1329 |
| 272 | Ga0070717_10403668 | 3300006028 | Bacteria | 1228 |
| 273 | Ga0070717_10590095 | 3300006028 | Unclassified | 1008 |
| 274 | Ga0070717_10650705 | 3300006028 | Bacteria | 957 |
| 275 | Ga0070717_10712468 | 3300006028 | Bacteria | 912 |
| 276 | Ga0075365_10101165 | 3300006038 | Bacteria | 1973 |
| 277 | Ga0075365_10195851 | 3300006038 | Bacteria | 1415 |
| 278 | Ga0075363_100381614 | 3300006048 | Unclassified | 826 |
| 279 | Ga0075363_100818780 | 3300006048 | Unclassified | 567 |
| 280 | Ga0075364_10001371 | 3300006051 | Bacteria | 13151 |
| 281 | Ga0075364_10841640 | 3300006051 | Bacteria | 625 |
| 282 | Ga0070715_10001548 | 3300006163 | Bacteria | 6735 |
| 283 | Ga0070715_10009984 | 3300006163 | Bacteria | 3368 |
| 284 | Ga0070716_100016873 | 3300006173 | Bacteria | 3776 |
| 285 | Ga0070716_100040809 | 3300006173 | Archaea | 2583 |
| 286 | Ga0070716_100073522 | 3300006173 | Bacteria | 2017 |
| 287 | Ga0070712_100029829 | 3300006175 | Bacteria | 3660 |
| 288 | Ga0070712_100043886 | 3300006175 | Bacteria | 3080 |
| 289 | Ga0070712_100059409 | 3300006175 | Bacteria | 2693 |
| 290 | Ga0070712_100061449 | 3300006175 | Bacteria | 2654 |
| 291 | Ga0070712_100375737 | 3300006175 | Unclassified | 1169 |
| 292 | Ga0070712_100510274 | 3300006175 | Bacteria | 1009 |
| 293 | Ga0070712_100561746 | 3300006175 | Bacteria | 962 |
| 294 | Ga0070712_100810849 | 3300006175 | Bacteria | 803 |
| 295 | Ga0070712_101184656 | 3300006175 | Bacteria | 664 |
| 296 | Ga0075362_10027773 | 3300006177 | Bacteria | 2425 |
| 297 | Ga0075367_10415664 | 3300006178 | Bacteria | 851 |
| 298 | Ga0075366_10184632 | 3300006195 | Unclassified | 1267 |
| 299 | Ga0097621_100490334 | 3300006237 | Bacteria | 1112 |
| 300 | Ga0097621_100837618 | 3300006237 | Unclassified | 854 |
| 301 | Ga0097621_101468119 | 3300006237 | Bacteria | 647 |
| 302 | Ga0068871_100170604 | 3300006358 | Bacteria | 1865 |
| 303 | Ga0068871_101767907 | 3300006358 | Bacteria | 587 |
| 304 | Ga0075428_100040344 | 3300006844 | Bacteria | 5136 |
| 305 | Ga0075430_100006540 | 3300006846 | Bacteria | 9829 |
| 306 | Ga0075430_100026469 | 3300006846 | Bacteria | 4934 |
| 307 | Ga0075431_100013118 | 3300006847 | Bacteria | 8373 |
| 308 | Ga0075431_100442740 | 3300006847 | Bacteria | 1296 |
| 309 | Ga0075433_10017067 | 3300006852 | Bacteria | 6002 |
| 310 | Ga0075433_10026810 | 3300006852 | Bacteria | 4883 |
| 311 | Ga0075433_10121657 | 3300006852 | Bacteria | 2318 |
| 312 | Ga0075433_10547873 | 3300006852 | Unclassified | 1017 |
| 313 | Ga0075433_11106208 | 3300006852 | Bacteria | 689 |
| 314 | Ga0075434_100032514 | 3300006871 | Bacteria | 5144 |
| 315 | Ga0075434_100063037 | 3300006871 | Bacteria | 3690 |
| 316 | Ga0075434_100133540 | 3300006871 | Bacteria | 2501 |
| 317 | Ga0075434_100216440 | 3300006871 | Bacteria | 1936 |
| 318 | Ga0075434_100786585 | 3300006871 | Bacteria | 968 |
| 319 | Ga0075429_100009626 | 3300006880 | Bacteria | 8383 |
| 320 | Ga0068865_100007182 | 3300006881 | Bacteria | 6840 |
| 321 | Ga0068865_100290110 | 3300006881 | Bacteria | 1306 |
| 322 | Ga0068865_100300021 | 3300006881 | Bacteria | 1285 |
| 323 | Ga0068865_100420595 | 3300006881 | Bacteria | 1099 |
| 324 | Ga0068865_100890978 | 3300006881 | Bacteria | 773 |
| 325 | Ga0075436_100021159 | 3300006914 | Bacteria | 4463 |
| 326 | Ga0075436_100028623 | 3300006914 | Bacteria | 3833 |
| 327 | Ga0097620_100229628 | 3300006931 | Bacteria | 1944 |
| 328 | Ga0075435_100024010 | 3300007076 | Bacteria | 4725 |
| 329 | Ga0075435_100061568 | 3300007076 | Bacteria | 3045 |
| 330 | Ga0075435_100084943 | 3300007076 | Bacteria | 2605 |
| 331 | Ga0075435_100142487 | 3300007076 | Bacteria | 2011 |
| 332 | Ga0105251_10574308 | 3300009011 | Bacteria | 533 |
| 333 | Ga0105244_10088778 | 3300009036 | Bacteria | 1522 |
| 334 | Ga0105240_10010904 | 3300009093 | Bacteria | 12734 |
| 335 | Ga0105240_10016187 | 3300009093 | Bacteria | 10106 |
| 336 | Ga0105240_10033728 | 3300009093 | Bacteria | 6610 |
| 337 | Ga0105240_10160432 | 3300009093 | Bacteria | 2671 |
| 338 | Ga0105240_10390751 | 3300009093 | Bacteria | 1569 |
| 339 | Ga0105240_10452674 | 3300009093 | Bacteria | 1436 |
| 340 | Ga0105240_10508609 | 3300009093 | Unclassified | 1338 |
| 341 | Ga0105240_11581991 | 3300009093 | Unclassified | 686 |
| 342 | Ga0111539_10044312 | 3300009094 | Bacteria | 5330 |
| 343 | Ga0111539_10191336 | 3300009094 | Bacteria | 2387 |
| 344 | Ga0111539_10442030 | 3300009094 | Bacteria | 1514 |
| 345 | Ga0111539_10518157 | 3300009094 | Bacteria | 1389 |
| 346 | Ga0111539_10816133 | 3300009094 | Bacteria | 1085 |
| 347 | Ga0111539_11243655 | 3300009094 | Bacteria | 864 |
| 348 | Ga0105245_10012468 | 3300009098 | Bacteria | 7396 |
| 349 | Ga0105245_10070234 | 3300009098 | Bacteria | 3177 |
| 350 | Ga0105245_10119963 | 3300009098 | Bacteria | 2455 |
| 351 | Ga0105245_10188190 | 3300009098 | Bacteria | 1976 |
| 352 | Ga0105245_10280652 | 3300009098 | Bacteria | 1628 |
| 353 | Ga0105245_11266626 | 3300009098 | Bacteria | 786 |
| 354 | Ga0105245_11860478 | 3300009098 | Bacteria | 655 |
| 355 | Ga0105245_12296602 | 3300009098 | Unclassified | 593 |
| 356 | Ga0105245_12302965 | 3300009098 | Bacteria | 592 |
| 357 | Ga0105245_13066406 | 3300009098 | Bacteria | 518 |
| 358 | Ga0105247_10026522 | 3300009101 | Bacteria | 3499 |
| 359 | Ga0114129_10065208 | 3300009147 | Bacteria | 5083 |
| 360 | Ga0114129_10087913 | 3300009147 | Bacteria | 4309 |
| 361 | Ga0114129_10172141 | 3300009147 | Bacteria | 2951 |
| 362 | Ga0114129_10507177 | 3300009147 | Bacteria | 1575 |
| 363 | Ga0114129_11433331 | 3300009147 | Bacteria | 851 |
| 364 | Ga0114129_11667125 | 3300009147 | Bacteria | 779 |
| 365 | Ga0105243_10044346 | 3300009148 | Bacteria | 3489 |
| 366 | Ga0105243_10169796 | 3300009148 | Bacteria | 1888 |
| 367 | Ga0105243_10343153 | 3300009148 | Bacteria | 1369 |
| 368 | Ga0105243_11092827 | 3300009148 | Bacteria | 805 |
| 369 | Ga0105241_10014582 | 3300009174 | Bacteria | 5756 |
| 370 | Ga0105241_10082598 | 3300009174 | Bacteria | 2519 |
| 371 | Ga0105241_10643072 | 3300009174 | Bacteria | 962 |
| 372 | Ga0105241_10897852 | 3300009174 | Unclassified | 823 |
| 373 | Ga0105241_12208815 | 3300009174 | Bacteria | 546 |
| 374 | Ga0105242_10082032 | 3300009176 | Bacteria | 2698 |
| 375 | Ga0105242_10085846 | 3300009176 | Bacteria | 2640 |
| 376 | Ga0105242_10157190 | 3300009176 | Unclassified | 1987 |
| 377 | Ga0105242_10212648 | 3300009176 | Bacteria | 1724 |
| 378 | Ga0105242_10241859 | 3300009176 | Bacteria | 1623 |
| 379 | Ga0105242_10368737 | 3300009176 | Bacteria | 1331 |
| 380 | Ga0105242_10574160 | 3300009176 | Bacteria | 1085 |
| 381 | Ga0105242_11721043 | 3300009176 | Bacteria | 664 |
| 382 | Ga0105242_13274448 | 3300009176 | Bacteria | 503 |
| 383 | Ga0105248_10045187 | 3300009177 | Bacteria | 4939 |
| 384 | Ga0105248_10045265 | 3300009177 | Bacteria | 4935 |
| 385 | Ga0105248_11488110 | 3300009177 | Unclassified | 766 |
| 386 | Ga0105237_10027161 | 3300009545 | Bacteria | 5846 |
| 387 | Ga0105237_10054796 | 3300009545 | Bacteria | 3995 |
| 388 | Ga0105237_10089459 | 3300009545 | Bacteria | 3068 |
| 389 | Ga0105237_10503301 | 3300009545 | Bacteria | 1218 |
| 390 | Ga0105237_10784243 | 3300009545 | Bacteria | 960 |
| 391 | Ga0105238_10066774 | 3300009551 | Bacteria | 3598 |
| 392 | Ga0105238_10105267 | 3300009551 | Bacteria | 2803 |
| 393 | Ga0105238_10527386 | 3300009551 | Bacteria | 1184 |
| 394 | Ga0105238_12045809 | 3300009551 | Bacteria | 607 |
| 395 | Ga0105249_10002311 | 3300009553 | Bacteria | 16556 |
| 396 | Ga0105249_10142322 | 3300009553 | Bacteria | 2301 |
| 397 | Ga0105239_10109788 | 3300010375 | Bacteria | 3057 |
| 398 | Ga0105239_10146373 | 3300010375 | Bacteria | 2635 |
| 399 | Ga0105239_10253720 | 3300010375 | Bacteria | 1976 |
| 400 | Ga0105239_10759394 | 3300010375 | Bacteria | 1110 |
| 401 | Ga0105239_10829290 | 3300010375 | Bacteria | 1060 |
| 402 | Ga0105239_10890811 | 3300010375 | Bacteria | 1021 |
| 403 | Ga0105239_11481799 | 3300010375 | Bacteria | 784 |
| 404 | Ga0105246_10042425 | 3300011119 | Bacteria | 3081 |
| 405 | Ga0105246_10154305 | 3300011119 | Bacteria | 1742 |
| 406 | Ga0105246_10350141 | 3300011119 | Bacteria | 1210 |
| 407 | Ga0105246_10403802 | 3300011119 | Bacteria | 1135 |
| 408 | Ga0105246_10603213 | 3300011119 | Unclassified | 949 |
| 409 | Ga0105246_11850611 | 3300011119 | Bacteria | 578 |
| 410 | Ga0157337_1025093 | 3300012483 | Bacteria | 577 |
| 411 | Ga0157373_10305154 | 3300013100 | Bacteria | 1130 |
| 412 | Ga0157371_10061380 | 3300013102 | Bacteria | 2665 |
| 413 | Ga0157371_10339801 | 3300013102 | Bacteria | 1092 |
| 414 | Ga0157371_11504605 | 3300013102 | Bacteria | 525 |
| 415 | Ga0157370_10007783 | 3300013104 | Bacteria | 11617 |
| 416 | Ga0157370_10028661 | 3300013104 | Bacteria | 5475 |
| 417 | Ga0157370_10070188 | 3300013104 | Bacteria | 3308 |
| 418 | Ga0157370_10234264 | 3300013104 | Bacteria | 1699 |
| 419 | Ga0157370_10272896 | 3300013104 | Unclassified | 1562 |
| 420 | Ga0157370_10797342 | 3300013104 | Unclassified | 859 |
| 421 | Ga0157370_11067564 | 3300013104 | Unclassified | 730 |
| 422 | Ga0157369_10005385 | 3300013105 | Bacteria | 14901 |
| 423 | Ga0157369_10067238 | 3300013105 | Bacteria | 3854 |
| 424 | Ga0157369_10113649 | 3300013105 | Bacteria | 2876 |
| 425 | Ga0157369_10131550 | 3300013105 | Bacteria | 2651 |
| 426 | Ga0157369_10353190 | 3300013105 | Bacteria | 1527 |
| 427 | Ga0157369_10368586 | 3300013105 | Bacteria | 1491 |
| 428 | Ga0157369_10458950 | 3300013105 | Bacteria | 1319 |
| 429 | Ga0157369_10642757 | 3300013105 | Bacteria | 1094 |
| 430 | Ga0157369_10696725 | 3300013105 | Unclassified | 1046 |
| 431 | Ga0157369_10814064 | 3300013105 | Bacteria | 959 |
| 432 | Ga0157369_11079524 | 3300013105 | Unclassified | 821 |
| 433 | Ga0157369_11122821 | 3300013105 | Bacteria | 803 |
| 434 | Ga0157369_11198070 | 3300013105 | Unclassified | 775 |
| 435 | Ga0157369_11469115 | 3300013105 | Bacteria | 694 |
| 436 | Ga0157369_11623934 | 3300013105 | Unclassified | 657 |
| 437 | Ga0157374_10113993 | 3300013296 | Bacteria | 2602 |
| 438 | Ga0157374_10138765 | 3300013296 | Bacteria | 2359 |
| 439 | Ga0157374_10280588 | 3300013296 | Bacteria | 1645 |
| 440 | Ga0157374_10537651 | 3300013296 | Unclassified | 1176 |
| 441 | Ga0157374_10759110 | 3300013296 | Bacteria | 985 |
| 442 | Ga0157374_12793686 | 3300013296 | Bacteria | 516 |
| 443 | Ga0157378_10021004 | 3300013297 | Bacteria | 5744 |
| 444 | Ga0157378_10087210 | 3300013297 | Bacteria | 2831 |
| 445 | Ga0157378_10408102 | 3300013297 | Bacteria | 1340 |
| 446 | Ga0157378_10536445 | 3300013297 | Bacteria | 1174 |
| 447 | Ga0163162_10004416 | 3300013306 | Bacteria | 13536 |
| 448 | Ga0163162_10343122 | 3300013306 | Bacteria | 1626 |
| 449 | Ga0163162_10560935 | 3300013306 | Bacteria | 1270 |
| 450 | Ga0157372_10026695 | 3300013307 | Bacteria | 6286 |
| 451 | Ga0157372_10149581 | 3300013307 | Bacteria | 2694 |
| 452 | Ga0157372_10217095 | 3300013307 | Bacteria | 2217 |
| 453 | Ga0157372_10314311 | 3300013307 | Bacteria | 1823 |
| 454 | Ga0157372_10931619 | 3300013307 | Bacteria | 1007 |
| 455 | Ga0157372_11104666 | 3300013307 | Bacteria | 917 |
| 456 | Ga0157372_11321390 | 3300013307 | Bacteria | 832 |
| 457 | Ga0157372_11843288 | 3300013307 | Bacteria | 695 |
| 458 | Ga0157372_13401283 | 3300013307 | Bacteria | 506 |
| 459 | Ga0157375_10192709 | 3300013308 | Bacteria | 2193 |
| 460 | Ga0157375_10244167 | 3300013308 | Bacteria | 1955 |
| 461 | Ga0157375_10272096 | 3300013308 | Bacteria | 1856 |
| 462 | Ga0157375_10779489 | 3300013308 | Unclassified | 1106 |
| 463 | Ga0163163_11323794 | 3300014325 | Bacteria | 782 |
| 464 | Ga0163163_11632325 | 3300014325 | Bacteria | 706 |
| 465 | Ga0163163_11692322 | 3300014325 | Bacteria | 693 |
| 466 | Ga0182008_10109139 | 3300014497 | Unclassified | 1371 |
| 467 | Ga0157377_10025713 | 3300014745 | Bacteria | 3142 |
| 468 | Ga0157379_10693949 | 3300014968 | Bacteria | 955 |
| 469 | Ga0157376_10071132 | 3300014969 | Bacteria | 2955 |
| 470 | Ga0157376_10163508 | 3300014969 | Bacteria | 2020 |
| 471 | Ga0157376_10191107 | 3300014969 | Bacteria | 1878 |
| 472 | Ga0157376_10460680 | 3300014969 | Bacteria | 1242 |
| 473 | Ga0157376_11718042 | 3300014969 | Unclassified | 663 |
| 474 | Ga0182007_10317775 | 3300015262 | Bacteria | 576 |
| 475 | Ga0163161_10264080 | 3300017792 | Bacteria | 1345 |
| 476 | Ga0197907_10416825 | 3300020069 | Unclassified | 1236 |
| 477 | Ga0197907_10716303 | 3300020069 | Bacteria | 2015 |
| 478 | Ga0206356_10667790 | 3300020070 | Bacteria | 2747 |
| 479 | Ga0206356_10700751 | 3300020070 | Bacteria | 839 |
| 480 | Ga0206356_10788852 | 3300020070 | Bacteria | 1013 |
| 481 | Ga0206356_11812622 | 3300020070 | Bacteria | 902 |
| 482 | Ga0206354_10974213 | 3300020081 | Unclassified | 502 |
| 483 | Ga0206353_10211289 | 3300020082 | Bacteria | 2031 |
| 484 | Ga0206353_10322309 | 3300020082 | Unclassified | 1134 |
| 485 | Ga0206353_10467431 | 3300020082 | Bacteria | 2054 |
| 486 | Ga0206353_10600212 | 3300020082 | Bacteria | 2644 |
| 487 | Ga0206353_10730077 | 3300020082 | Bacteria | 4085 |
| 488 | Ga0206353_11412740 | 3300020082 | Bacteria | 4308 |
| 489 | Ga0206353_11615196 | 3300020082 | Bacteria | 610 |
| 490 | Ga0206353_11994009 | 3300020082 | Bacteria | 621 |
| 491 | Ga0213876_10115045 | 3300021384 | Bacteria | 1428 |
| 492 | Ga0224712_10170402 | 3300022467 | Unclassified | 976 |
| 493 | Ga0207692_10010590 | 3300025898 | Bacteria | 3892 |
| 494 | Ga0207692_10167535 | 3300025898 | Unclassified | 1271 |
| 495 | Ga0207692_10229497 | 3300025898 | Unclassified | 1104 |
| 496 | Ga0207692_11183417 | 3300025898 | Bacteria | 507 |
| 497 | Ga0207642_10564405 | 3300025899 | Bacteria | 704 |
| 498 | Ga0207647_10117127 | 3300025904 | Bacteria | 1573 |
| 499 | Ga0207685_10015934 | 3300025905 | Bacteria | 2394 |
| 500 | Ga0207685_10017607 | 3300025905 | Bacteria | 2315 |
| 501 | Ga0207685_10019805 | 3300025905 | Bacteria | 2223 |
| 502 | Ga0207699_10022148 | 3300025906 | Bacteria | 3439 |
| 503 | Ga0207699_10241345 | 3300025906 | Unclassified | 1241 |
| 504 | Ga0207699_10921918 | 3300025906 | Bacteria | 645 |
| 505 | Ga0207699_11484705 | 3300025906 | Bacteria | 501 |
| 506 | Ga0207705_10021089 | 3300025909 | Bacteria | 4647 |
| 507 | Ga0207705_10048604 | 3300025909 | Bacteria | 3052 |
| 508 | Ga0207705_10135407 | 3300025909 | Unclassified | 1836 |
| 509 | Ga0207705_10138782 | 3300025909 | Bacteria | 1814 |
| 510 | Ga0207705_10330500 | 3300025909 | Bacteria | 1172 |
| 511 | Ga0207705_10395274 | 3300025909 | Unclassified | 1069 |
| 512 | Ga0207705_10684079 | 3300025909 | Bacteria | 798 |
| 513 | Ga0207705_11004201 | 3300025909 | Bacteria | 645 |
| 514 | Ga0207705_11411075 | 3300025909 | Bacteria | 529 |
| 515 | Ga0207684_10148199 | 3300025910 | Bacteria | 2018 |
| 516 | Ga0207684_10489198 | 3300025910 | Bacteria | 1055 |
| 517 | Ga0207684_11180863 | 3300025910 | Bacteria | 634 |
| 518 | Ga0207654_10169436 | 3300025911 | Bacteria | 1417 |
| 519 | Ga0207707_10006267 | 3300025912 | Bacteria | 10387 |
| 520 | Ga0207707_10034982 | 3300025912 | Bacteria | 4393 |
| 521 | Ga0207707_10039960 | 3300025912 | Bacteria | 4099 |
| 522 | Ga0207707_10092655 | 3300025912 | Bacteria | 2640 |
| 523 | Ga0207707_10313782 | 3300025912 | Bacteria | 1354 |
| 524 | Ga0207707_10440447 | 3300025912 | Bacteria | 1115 |
| 525 | Ga0207707_10451098 | 3300025912 | Bacteria | 1100 |
| 526 | Ga0207707_11039655 | 3300025912 | Bacteria | 670 |
| 527 | Ga0207695_10080725 | 3300025913 | Bacteria | 3293 |
| 528 | Ga0207695_10273768 | 3300025913 | Bacteria | 1583 |
| 529 | Ga0207695_11231663 | 3300025913 | Bacteria | 629 |
| 530 | Ga0207671_10031468 | 3300025914 | Bacteria | 3954 |
| 531 | Ga0207671_10088321 | 3300025914 | Bacteria | 2332 |
| 532 | Ga0207671_10287835 | 3300025914 | Bacteria | 1297 |
| 533 | Ga0207693_10000371 | 3300025915 | Bacteria | 41227 |
| 534 | Ga0207693_10000990 | 3300025915 | Bacteria | 25494 |
| 535 | Ga0207693_10001398 | 3300025915 | Bacteria | 21387 |
| 536 | Ga0207693_10058963 | 3300025915 | Bacteria | 3007 |
| 537 | Ga0207693_10121497 | 3300025915 | Unclassified | 2051 |
| 538 | Ga0207693_10127706 | 3300025915 | Bacteria | 1999 |
| 539 | Ga0207693_10399238 | 3300025915 | Bacteria | 1075 |
| 540 | Ga0207693_10607752 | 3300025915 | Bacteria | 851 |
| 541 | Ga0207693_10744333 | 3300025915 | Unclassified | 757 |
| 542 | Ga0207663_10012460 | 3300025916 | Bacteria | 4599 |
| 543 | Ga0207663_10038778 | 3300025916 | Bacteria | 2883 |
| 544 | Ga0207663_10156398 | 3300025916 | Bacteria | 1604 |
| 545 | Ga0207663_10222310 | 3300025916 | Unclassified | 1375 |
| 546 | Ga0207663_10955668 | 3300025916 | Unclassified | 686 |
| 547 | Ga0207663_11001241 | 3300025916 | Bacteria | 670 |
| 548 | Ga0207660_10085959 | 3300025917 | Bacteria | 2321 |
| 549 | Ga0207660_10097423 | 3300025917 | Bacteria | 2191 |
| 550 | Ga0207660_10146812 | 3300025917 | Bacteria | 1808 |
| 551 | Ga0207660_10181111 | 3300025917 | Bacteria | 1636 |
| 552 | Ga0207660_10523083 | 3300025917 | Unclassified | 963 |
| 553 | Ga0207660_10738588 | 3300025917 | Bacteria | 803 |
| 554 | Ga0207662_10291487 | 3300025918 | Bacteria | 1082 |
| 555 | Ga0207657_10000207 | 3300025919 | Bacteria | 60795 |
| 556 | Ga0207657_10013395 | 3300025919 | Bacteria | 8047 |
| 557 | Ga0207657_10015777 | 3300025919 | Bacteria | 7302 |
| 558 | Ga0207657_10018969 | 3300025919 | Bacteria | 6546 |
| 559 | Ga0207657_10021934 | 3300025919 | Bacteria | 5996 |
| 560 | Ga0207657_10025349 | 3300025919 | Bacteria | 5469 |
| 561 | Ga0207657_10066404 | 3300025919 | Bacteria | 3071 |
| 562 | Ga0207657_10234060 | 3300025919 | Bacteria | 1468 |
| 563 | Ga0207657_10332882 | 3300025919 | Unclassified | 1199 |
| 564 | Ga0207657_10549748 | 3300025919 | Bacteria | 903 |
| 565 | Ga0207657_10804666 | 3300025919 | Bacteria | 726 |
| 566 | Ga0207657_11239371 | 3300025919 | Bacteria | 566 |
| 567 | Ga0207649_10096381 | 3300025920 | Bacteria | 1949 |
| 568 | Ga0207649_10260675 | 3300025920 | Bacteria | 1252 |
| 569 | Ga0207649_10342542 | 3300025920 | Bacteria | 1104 |
| 570 | Ga0207649_10688646 | 3300025920 | Unclassified | 792 |
| 571 | Ga0207652_10021218 | 3300025921 | Bacteria | 5360 |
| 572 | Ga0207652_10110214 | 3300025921 | Bacteria | 2441 |
| 573 | Ga0207652_10113557 | 3300025921 | Bacteria | 2405 |
| 574 | Ga0207652_10121469 | 3300025921 | Bacteria | 2324 |
| 575 | Ga0207652_10125053 | 3300025921 | Bacteria | 2290 |
| 576 | Ga0207652_10241419 | 3300025921 | Bacteria | 1629 |
| 577 | Ga0207652_10501255 | 3300025921 | Unclassified | 1093 |
| 578 | Ga0207652_10641387 | 3300025921 | Bacteria | 950 |
| 579 | Ga0207652_10672200 | 3300025921 | Bacteria | 925 |
| 580 | Ga0207652_10687440 | 3300025921 | Bacteria | 913 |
| 581 | Ga0207652_11120811 | 3300025921 | Bacteria | 688 |
| 582 | Ga0207652_11187617 | 3300025921 | Bacteria | 664 |
| 583 | Ga0207652_11312725 | 3300025921 | Bacteria | 626 |
| 584 | Ga0207652_11523253 | 3300025921 | Bacteria | 573 |
| 585 | Ga0207646_10041496 | 3300025922 | Bacteria | 4137 |
| 586 | Ga0207646_10309384 | 3300025922 | Unclassified | 1427 |
| 587 | Ga0207694_10120419 | 3300025924 | Bacteria | 2095 |
| 588 | Ga0207694_10290985 | 3300025924 | Unclassified | 1343 |
| 589 | Ga0207694_10571791 | 3300025924 | Bacteria | 949 |
| 590 | Ga0207694_11490055 | 3300025924 | Bacteria | 571 |
| 591 | Ga0207659_11179850 | 3300025926 | Unclassified | 658 |
| 592 | Ga0207687_10026601 | 3300025927 | Bacteria | 3875 |
| 593 | Ga0207687_10081102 | 3300025927 | Bacteria | 2343 |
| 594 | Ga0207687_10212967 | 3300025927 | Bacteria | 1517 |
| 595 | Ga0207687_10421187 | 3300025927 | Bacteria | 1102 |
| 596 | Ga0207687_10836011 | 3300025927 | Unclassified | 786 |
| 597 | Ga0207700_10058843 | 3300025928 | Bacteria | 2905 |
| 598 | Ga0207700_10081201 | 3300025928 | Bacteria | 2531 |
| 599 | Ga0207700_10100185 | 3300025928 | Bacteria | 2308 |
| 600 | Ga0207700_10298148 | 3300025928 | Bacteria | 1391 |
| 601 | Ga0207700_10457358 | 3300025928 | Unclassified | 1126 |
| 602 | Ga0207700_10543438 | 3300025928 | Unclassified | 1031 |
| 603 | Ga0207700_11099365 | 3300025928 | Bacteria | 711 |
| 604 | Ga0207664_10021231 | 3300025929 | Bacteria | 4824 |
| 605 | Ga0207664_10046845 | 3300025929 | Bacteria | 3395 |
| 606 | Ga0207664_10078067 | 3300025929 | Bacteria | 2685 |
| 607 | Ga0207664_10148314 | 3300025929 | Unclassified | 1991 |
| 608 | Ga0207664_10566979 | 3300025929 | Unclassified | 1019 |
| 609 | Ga0207664_10986580 | 3300025929 | Bacteria | 755 |
| 610 | Ga0207664_11146981 | 3300025929 | Unclassified | 694 |
| 611 | Ga0207664_11168656 | 3300025929 | Unclassified | 687 |
| 612 | Ga0207644_10048422 | 3300025931 | Bacteria | 3039 |
| 613 | Ga0207644_10161976 | 3300025931 | Bacteria | 1740 |
| 614 | Ga0207644_10613073 | 3300025931 | Unclassified | 904 |
| 615 | Ga0207690_10239537 | 3300025932 | Bacteria | 1397 |
| 616 | Ga0207690_10396115 | 3300025932 | Unclassified | 1100 |
| 617 | Ga0207690_10538125 | 3300025932 | Bacteria | 948 |
| 618 | Ga0207690_10984609 | 3300025932 | Bacteria | 701 |
| 619 | Ga0207706_10581926 | 3300025933 | Bacteria | 962 |
| 620 | Ga0207706_11325612 | 3300025933 | Unclassified | 594 |
| 621 | Ga0207686_10008123 | 3300025934 | Bacteria | 5661 |
| 622 | Ga0207686_10050347 | 3300025934 | Bacteria | 2590 |
| 623 | Ga0207686_10148931 | 3300025934 | Bacteria | 1627 |
| 624 | Ga0207686_10638204 | 3300025934 | Unclassified | 841 |
| 625 | Ga0207709_10001704 | 3300025935 | Bacteria | 14807 |
| 626 | Ga0207709_10068099 | 3300025935 | Bacteria | 2249 |
| 627 | Ga0207670_10827760 | 3300025936 | Bacteria | 772 |
| 628 | Ga0207669_10368899 | 3300025937 | Bacteria | 1115 |
| 629 | Ga0207669_10502020 | 3300025937 | Unclassified | 971 |
| 630 | Ga0207704_10005190 | 3300025938 | Bacteria | 5995 |
| 631 | Ga0207704_10248958 | 3300025938 | Bacteria | 1333 |
| 632 | Ga0207704_11141530 | 3300025938 | Unclassified | 663 |
| 633 | Ga0207704_11351081 | 3300025938 | Bacteria | 610 |
| 634 | Ga0207665_10000070 | 3300025939 | Bacteria | 66142 |
| 635 | Ga0207665_10010513 | 3300025939 | Bacteria | 6079 |
| 636 | Ga0207665_10079495 | 3300025939 | Bacteria | 2254 |
| 637 | Ga0207691_10070326 | 3300025940 | Bacteria | 3160 |
| 638 | Ga0207691_10198186 | 3300025940 | Bacteria | 1748 |
| 639 | Ga0207711_10410625 | 3300025941 | Bacteria | 1258 |
| 640 | Ga0207711_10490212 | 3300025941 | Bacteria | 1145 |
| 641 | Ga0207711_10727961 | 3300025941 | Bacteria | 925 |
| 642 | Ga0207711_11568913 | 3300025941 | Unclassified | 602 |
| 643 | Ga0207661_10030797 | 3300025944 | Bacteria | 4136 |
| 644 | Ga0207661_10032448 | 3300025944 | Bacteria | 4046 |
| 645 | Ga0207661_10117707 | 3300025944 | Bacteria | 2257 |
| 646 | Ga0207661_10135468 | 3300025944 | Bacteria | 2115 |
| 647 | Ga0207661_10138183 | 3300025944 | Bacteria | 2095 |
| 648 | Ga0207661_10246928 | 3300025944 | Bacteria | 1585 |
| 649 | Ga0207661_10368125 | 3300025944 | Bacteria | 1299 |
| 650 | Ga0207661_10391160 | 3300025944 | Bacteria | 1260 |
| 651 | Ga0207661_10593462 | 3300025944 | Bacteria | 1016 |
| 652 | Ga0207661_11282115 | 3300025944 | Bacteria | 673 |
| 653 | Ga0207679_10278369 | 3300025945 | Bacteria | 1434 |
| 654 | Ga0207679_10389599 | 3300025945 | Bacteria | 1223 |
| 655 | Ga0207679_10580038 | 3300025945 | Bacteria | 1009 |
| 656 | Ga0207667_10033445 | 3300025949 | Bacteria | 5527 |
| 657 | Ga0207667_10066116 | 3300025949 | Bacteria | 3769 |
| 658 | Ga0207667_10113662 | 3300025949 | Bacteria | 2791 |
| 659 | Ga0207667_10173227 | 3300025949 | Bacteria | 2218 |
| 660 | Ga0207667_10197387 | 3300025949 | Bacteria | 2064 |
| 661 | Ga0207667_10233821 | 3300025949 | Bacteria | 1881 |
| 662 | Ga0207667_10286573 | 3300025949 | Bacteria | 1683 |
| 663 | Ga0207667_10322623 | 3300025949 | Unclassified | 1577 |
| 664 | Ga0207667_11423086 | 3300025949 | Bacteria | 666 |
| 665 | Ga0207712_10006452 | 3300025961 | Bacteria | 7395 |
| 666 | Ga0207712_10277974 | 3300025961 | Bacteria | 1365 |
| 667 | Ga0207668_10063831 | 3300025972 | Bacteria | 2600 |
| 668 | Ga0207640_10717808 | 3300025981 | Bacteria | 859 |
| 669 | Ga0207640_10897192 | 3300025981 | Unclassified | 774 |
| 670 | Ga0207640_11217041 | 3300025981 | Unclassified | 670 |
| 671 | Ga0207658_10002891 | 3300025986 | Bacteria | 12311 |
| 672 | Ga0207658_10917277 | 3300025986 | Bacteria | 798 |
| 673 | Ga0207658_11574275 | 3300025986 | Bacteria | 601 |
| 674 | Ga0207677_10139189 | 3300026023 | Bacteria | 1855 |
| 675 | Ga0207677_11610400 | 3300026023 | Bacteria | 601 |
| 676 | Ga0207639_10325905 | 3300026041 | Bacteria | 1365 |
| 677 | Ga0207639_10570039 | 3300026041 | Bacteria | 1041 |
| 678 | Ga0207639_10733166 | 3300026041 | Unclassified | 918 |
| 679 | Ga0207639_11877796 | 3300026041 | Bacteria | 560 |
| 680 | Ga0207678_10113601 | 3300026067 | Bacteria | 2310 |
| 681 | Ga0207678_10444611 | 3300026067 | Bacteria | 1126 |
| 682 | Ga0207678_10622198 | 3300026067 | Bacteria | 947 |
| 683 | Ga0207708_10000833 | 3300026075 | Bacteria | 23294 |
| 684 | Ga0207708_10857466 | 3300026075 | Bacteria | 784 |
| 685 | Ga0207708_11082143 | 3300026075 | Unclassified | 698 |
| 686 | Ga0207708_11294843 | 3300026075 | Bacteria | 638 |
| 687 | Ga0207708_11793532 | 3300026075 | Bacteria | 538 |
| 688 | Ga0207702_10098954 | 3300026078 | Bacteria | 2570 |
| 689 | Ga0207702_10277260 | 3300026078 | Bacteria | 1584 |
| 690 | Ga0207702_10356568 | 3300026078 | Bacteria | 1401 |
| 691 | Ga0207702_10370390 | 3300026078 | Unclassified | 1375 |
| 692 | Ga0207702_10399638 | 3300026078 | Bacteria | 1325 |
| 693 | Ga0207702_10487433 | 3300026078 | Bacteria | 1200 |
| 694 | Ga0207702_10802490 | 3300026078 | Unclassified | 930 |
| 695 | Ga0207702_10849968 | 3300026078 | Bacteria | 903 |
| 696 | Ga0207702_11651225 | 3300026078 | Unclassified | 634 |
| 697 | Ga0207641_10427780 | 3300026088 | Bacteria | 1276 |
| 698 | Ga0207641_11068666 | 3300026088 | Bacteria | 805 |
| 699 | Ga0207648_10000806 | 3300026089 | Bacteria | 35413 |
| 700 | Ga0207676_10295065 | 3300026095 | Bacteria | 1478 |
| 701 | Ga0207674_10003353 | 3300026116 | Bacteria | 19653 |
| 702 | Ga0207674_10034494 | 3300026116 | Bacteria | 5288 |
| 703 | Ga0207674_10034801 | 3300026116 | Bacteria | 5261 |
| 704 | Ga0207674_10103688 | 3300026116 | Bacteria | 2823 |
| 705 | Ga0207674_10335926 | 3300026116 | Bacteria | 1461 |
| 706 | Ga0207674_11357543 | 3300026116 | Unclassified | 680 |
| 707 | Ga0207675_100082252 | 3300026118 | Bacteria | 3020 |
| 708 | Ga0207683_10007545 | 3300026121 | Bacteria | 9320 |
| 709 | Ga0207683_10155522 | 3300026121 | Bacteria | 2065 |
| 710 | Ga0207683_10158835 | 3300026121 | Bacteria | 2043 |
| 711 | Ga0207698_10087393 | 3300026142 | Bacteria | 2539 |
| 712 | Ga0207698_10126124 | 3300026142 | Bacteria | 2177 |
| 713 | Ga0207698_10151040 | 3300026142 | Bacteria | 2016 |
| 714 | Ga0207698_10287633 | 3300026142 | Bacteria | 1524 |
| 715 | Ga0207428_10003626 | 3300027907 | Bacteria | 14886 |
| 716 | Ga0207428_10354867 | 3300027907 | Bacteria | 1078 |
| 717 | Ga0268266_10283665 | 3300028379 | Bacteria | 1541 |
| 718 | Ga0268266_10598062 | 3300028379 | Bacteria | 1059 |
| 719 | Ga0268266_10736086 | 3300028379 | Unclassified | 951 |
| 720 | Ga0268265_10576698 | 3300028380 | Bacteria | 1072 |
| 721 | Ga0265326_10052168 | 3300028558 | Bacteria | 1158 |
| 722 | Ga0265319_1003390 | 3300028563 | Bacteria | 8334 |
| 723 | Ga0265319_1103063 | 3300028563 | Bacteria | 895 |
| 724 | Ga0265334_10030013 | 3300028573 | Bacteria | 2177 |
| 725 | Ga0265334_10100569 | 3300028573 | Bacteria | 1047 |
| 726 | Ga0265334_10121742 | 3300028573 | Bacteria | 932 |
| 727 | Ga0265318_10002905 | 3300028577 | Bacteria | 8906 |
| 728 | Ga0265318_10026357 | 3300028577 | Bacteria | 2289 |
| 729 | Ga0265318_10133877 | 3300028577 | Bacteria | 911 |
| 730 | Ga0265322_10010959 | 3300028654 | Bacteria | 2630 |
| 731 | Ga0265322_10014646 | 3300028654 | Bacteria | 2266 |
| 732 | Ga0265322_10042958 | 3300028654 | Bacteria | 1286 |
| 733 | Ga0265336_10005527 | 3300028666 | Bacteria | 4656 |
| 734 | Ga0265338_10006136 | 3300028800 | Bacteria | 15425 |
| 735 | Ga0265338_10009161 | 3300028800 | Bacteria | 11876 |
| 736 | Ga0265338_10016938 | 3300028800 | Bacteria | 7885 |
| 737 | Ga0265338_10019524 | 3300028800 | Bacteria | 7184 |
| 738 | Ga0265338_10030185 | 3300028800 | Bacteria | 5349 |
| 739 | Ga0265338_10070358 | 3300028800 | Bacteria | 3000 |
| 740 | Ga0265338_10070593 | 3300028800 | Bacteria | 2993 |
| 741 | Ga0265338_10087484 | 3300028800 | Bacteria | 2588 |
| 742 | Ga0265338_10186516 | 3300028800 | Bacteria | 1576 |
| 743 | Ga0265330_10017777 | 3300031235 | Bacteria | 3272 |
| 744 | Ga0265330_10044163 | 3300031235 | Bacteria | 1969 |
| 745 | Ga0265332_10036278 | 3300031238 | Bacteria | 2141 |
| 746 | Ga0265328_10043350 | 3300031239 | Bacteria | 1655 |
| 747 | Ga0265328_10307181 | 3300031239 | Unclassified | 613 |
| 748 | Ga0265320_10038804 | 3300031240 | Bacteria | 2386 |
| 749 | Ga0265320_10097999 | 3300031240 | Unclassified | 1352 |
| 750 | Ga0265320_10279280 | 3300031240 | Unclassified | 740 |
| 751 | Ga0265325_10019941 | 3300031241 | Bacteria | 3700 |
| 752 | Ga0265325_10050476 | 3300031241 | Bacteria | 2142 |
| 753 | Ga0265325_10106306 | 3300031241 | Bacteria | 1368 |
| 754 | Ga0265329_10020911 | 3300031242 | Bacteria | 2204 |
| 755 | Ga0265340_10207132 | 3300031247 | Bacteria | 881 |
| 756 | Ga0265340_10295630 | 3300031247 | Bacteria | 718 |
| 757 | Ga0265339_10068072 | 3300031249 | Bacteria | 1903 |
| 758 | Ga0265339_10113784 | 3300031249 | Bacteria | 1397 |
| 759 | Ga0265331_10099514 | 3300031250 | Bacteria | 1339 |
| 760 | Ga0265331_10355698 | 3300031250 | Unclassified | 656 |
| 761 | Ga0265327_10006112 | 3300031251 | Bacteria | 9751 |
| 762 | Ga0265327_10021363 | 3300031251 | Bacteria | 3908 |
| 763 | Ga0265327_10039337 | 3300031251 | Bacteria | 2570 |
| 764 | Ga0265327_10040559 | 3300031251 | Bacteria | 2516 |
| 765 | Ga0265327_10054359 | 3300031251 | Bacteria | 2073 |
| 766 | Ga0265327_10213656 | 3300031251 | Unclassified | 870 |
| 767 | Ga0265316_10008470 | 3300031344 | Bacteria | 9537 |
| 768 | Ga0265316_10029661 | 3300031344 | Bacteria | 4493 |
| 769 | Ga0265316_10049741 | 3300031344 | Bacteria | 3300 |
| 770 | Ga0307408_100114748 | 3300031548 | Bacteria | 2076 |
| 771 | Ga0307408_100176961 | 3300031548 | Bacteria | 1708 |
| 772 | Ga0307408_100246442 | 3300031548 | Bacteria | 1471 |
| 773 | Ga0265313_10004895 | 3300031595 | Bacteria | 10042 |
| 774 | Ga0265313_10199018 | 3300031595 | Bacteria | 834 |
| 775 | Ga0265314_10004374 | 3300031711 | Bacteria | 13142 |
| 776 | Ga0265314_10131538 | 3300031711 | Bacteria | 1560 |
| 777 | Ga0265314_10242230 | 3300031711 | Bacteria | 1040 |
| 778 | Ga0265314_10478885 | 3300031711 | Unclassified | 658 |
| 779 | Ga0265342_10030444 | 3300031712 | Bacteria | 3344 |
| 780 | Ga0265342_10045478 | 3300031712 | Bacteria | 2642 |
| 781 | Ga0265342_10282030 | 3300031712 | Bacteria | 879 |
| 782 | Ga0307405_10257868 | 3300031731 | Bacteria | 1301 |
| 783 | Ga0307405_10506553 | 3300031731 | Bacteria | 969 |
| 784 | Ga0307405_11637767 | 3300031731 | Bacteria | 569 |
| 785 | Ga0307413_10340511 | 3300031824 | Bacteria | 1153 |
| 786 | Ga0307413_11387490 | 3300031824 | Bacteria | 617 |
| 787 | Ga0307406_10103808 | 3300031901 | Bacteria | 1942 |
| 788 | Ga0307406_10285552 | 3300031901 | Bacteria | 1261 |
| 789 | Ga0307407_10474183 | 3300031903 | Bacteria | 913 |
| 790 | Ga0307407_10619802 | 3300031903 | Bacteria | 807 |
| 791 | Ga0307407_10668333 | 3300031903 | Bacteria | 780 |
| 792 | Ga0307412_10303935 | 3300031911 | Bacteria | 1262 |
| 793 | Ga0307409_100149342 | 3300031995 | Bacteria | 2026 |
| 794 | Ga0307409_100183933 | 3300031995 | Bacteria | 1853 |
| 795 | Ga0307409_100359945 | 3300031995 | Bacteria | 1376 |
| 796 | Ga0307409_100395667 | 3300031995 | Bacteria | 1318 |
| 797 | Ga0307409_100979340 | 3300031995 | Bacteria | 863 |
| 798 | Ga0307416_100064091 | 3300032002 | Bacteria | 3013 |
| 799 | Ga0307416_100130796 | 3300032002 | Bacteria | 2259 |
| 800 | Ga0307416_100620890 | 3300032002 | Bacteria | 1163 |
| 801 | Ga0307416_101059209 | 3300032002 | Bacteria | 915 |
| 802 | Ga0307414_10394891 | 3300032004 | Unclassified | 1200 |
| 803 | Ga0307411_11203901 | 3300032005 | Bacteria | 687 |
| 804 | Ga0307415_100070335 | 3300032126 | Bacteria | 2457 |
| 805 | Ga0307415_100133591 | 3300032126 | Bacteria | 1883 |
| 806 | Ga0307415_100215392 | 3300032126 | Bacteria | 1535 |
| 807 | Ga0307415_100882982 | 3300032126 | Unclassified | 823 |
| 808 | Ga0316583_10018438 | 3300032133 | Bacteria | 2505 |
| 809 | Ga0316583_10146969 | 3300032133 | Bacteria | 821 |
| 810 | Ga0373926_0057441 | 3300035083 | Bacteria | 1413 |
| 811 | Ga0373934_0287863 | 3300035086 | Bacteria | 681 |
| 812 | Ga0373944_0012696 | 3300035089 | Bacteria | 2326 |
| 813 | Ga0373923_0514975 | 3300035111 | Unclassified | 584 |
| 814 | Ga0373936_0024078 | 3300035113 | Bacteria | 2376 |
| 815 | Ga0373936_0136970 | 3300035113 | Bacteria | 1055 |
| 816 | Ga0373939_0291632 | 3300035114 | Unclassified | 648 |
| 817 | Ga0373945_0004024 | 3300035116 | Bacteria | 4649 |
| 818 | Ga0373945_0004453 | 3300035116 | Bacteria | 4452 |
| 819 | Ga0373953_0151967 | 3300035117 | Bacteria | 993 |
| 820 | Ga0373953_0231221 | 3300035117 | Bacteria | 802 |
| 821 | Ga0373954_0174367 | 3300035118 | Unclassified | 1054 |
| 822 | Ga0373956_0136897 | 3300035119 | Bacteria | 1149 |
| 823 | Ga0373943_0000450 | 3300035170 | Bacteria | 17418 |
| 824 | Ga0373943_0005939 | 3300035170 | Bacteria | 5476 |
| 825 | Ga0373943_0644678 | 3300035170 | Bacteria | 626 |
| 826 | Ga0373946_0000587 | 3300035171 | Bacteria | 12009 |
| 827 | Ga0373946_0006898 | 3300035171 | Bacteria | 4135 |
| 828 | Ga0373946_0245559 | 3300035171 | Bacteria | 872 |
| 829 | Ga0373955_0094356 | 3300035172 | Unclassified | 1710 |
| 830 | Ga0373955_0126715 | 3300035172 | Unclassified | 1488 |
| 831 | Ga0373955_0217730 | 3300035172 | Unclassified | 1140 |
| 832 | Ga0373961_0228349 | 3300035241 | Bacteria | 666 |
| 833 | Ga0373962_0203006 | 3300035242 | Bacteria | 672 |
| 834 | Ga0373924_0035981 | 3300035410 | Bacteria | 2010 |
| 835 | Ga0373924_0056500 | 3300035410 | Bacteria | 1635 |
| 836 | Ga0373935_0024719 | 3300035692 | Bacteria | 3700 |
| 837 | Ga0373935_0032176 | 3300035692 | Bacteria | 3258 |
| 838 | Ga0373927_0077150 | 3300035695 | Bacteria | 2158 |
| 839 | Ga0373933_0173003 | 3300035724 | Unclassified | 1375 |
| 840 | Ga0373933_1036992 | 3300035724 | Bacteria | 540 |
| 841 | Ga0373947_0004602 | 3300035725 | Bacteria | 8093 |
| 842 | Ga0373947_0022617 | 3300035725 | Bacteria | 3647 |
| 843 | Ga0373947_0071449 | 3300035725 | Bacteria | 2129 |
| 844 | Ga0373947_0238840 | 3300035725 | Bacteria | 1199 |
| 845 | Ga0373947_0417591 | 3300035725 | Unclassified | 906 |
| 846 | Ga0373937_0096706 | 3300036401 | Bacteria | 2739 |
| 847 | Ga0373937_0117201 | 3300036401 | Bacteria | 2481 |
| 848 | Ga0373937_0932355 | 3300036401 | Bacteria | 817 |
| 849 | Ga0373925_0013017 | 3300037068 | Bacteria | 6024 |
| 850 | Ga0373925_0033856 | 3300037068 | Bacteria | 3764 |
| 851 | Ga0373925_0149720 | 3300037068 | Bacteria | 1832 |
| 852 | Ga0373925_0512518 | 3300037068 | Unclassified | 985 |
| 853 | Ga0395899_0021519 | 3300037312 | Bacteria | 4891 |
| 854 | Ga0395899_0042660 | 3300037312 | Bacteria | 3386 |
| 855 | Ga0395899_0047824 | 3300037312 | Bacteria | 3184 |
| 856 | Ga0395899_0059975 | 3300037312 | Bacteria | 2803 |
| 857 | Ga0395899_0087738 | 3300037312 | Bacteria | 2257 |
| 858 | Ga0395899_0101176 | 3300037312 | Archaea | 2080 |
| 859 | Ga0395899_0114306 | 3300037312 | Bacteria | 1938 |
| 860 | Ga0395899_0156924 | 3300037312 | Bacteria | 1610 |
| 861 | Ga0395899_0196889 | 3300037312 | Bacteria | 1407 |
| 862 | Ga0395899_0355591 | 3300037312 | Bacteria | 979 |
| 863 | Ga0395899_0379853 | 3300037312 | Bacteria | 939 |
| 864 | Ga0395899_0477512 | 3300037312 | Bacteria | 812 |
| 865 | Ga0395900_0008773 | 3300037418 | Bacteria | 10389 |
| 866 | Ga0395900_0009413 | 3300037418 | Bacteria | 10016 |
| 867 | Ga0395900_0023438 | 3300037418 | Bacteria | 6317 |
| 868 | Ga0395900_0048696 | 3300037418 | Bacteria | 4366 |
| 869 | Ga0395900_0084833 | 3300037418 | Bacteria | 3255 |
| 870 | Ga0395900_0089342 | 3300037418 | Bacteria | 3167 |
| 871 | Ga0395900_0093981 | 3300037418 | Bacteria | 3080 |
| 872 | Ga0395900_0103938 | 3300037418 | Bacteria | 2918 |
| 873 | Ga0395900_0108248 | 3300037418 | Bacteria | 2855 |
| 874 | Ga0395900_0157499 | 3300037418 | Bacteria | 2319 |
| 875 | Ga0395900_0236980 | 3300037418 | Bacteria | 1832 |
| 876 | Ga0395900_0288560 | 3300037418 | Bacteria | 1630 |
| 877 | Ga0395900_0303099 | 3300037418 | Bacteria | 1583 |
| 878 | Ga0395900_0349674 | 3300037418 | Bacteria | 1452 |
| 879 | Ga0395900_0368692 | 3300037418 | Bacteria | 1406 |
| 880 | Ga0395900_0422513 | 3300037418 | Bacteria | 1294 |
| 881 | Ga0395900_0432312 | 3300037418 | Unclassified | 1275 |
| 882 | Ga0395900_0505334 | 3300037418 | Bacteria | 1158 |
| 883 | Ga0395900_0506483 | 3300037418 | Bacteria | 1157 |
| 884 | Ga0395900_0720716 | 3300037418 | Unclassified | 930 |
| 885 | Ga0395900_0869537 | 3300037418 | Bacteria | 826 |
| 886 | Ga0395900_1226098 | 3300037418 | Bacteria | 665 |
| 887 | Ga0395900_1330841 | 3300037418 | Unclassified | 632 |
| 888 | Ga0395900_1476077 | 3300037418 | Bacteria | 592 |
| 889 | Ga0395898_0002496 | 3300037466 | Bacteria | 21639 |
| 890 | Ga0395898_0005097 | 3300037466 | Bacteria | 14235 |
| 891 | Ga0395898_0005344 | 3300037466 | Bacteria | 13889 |
| 892 | Ga0395898_0005483 | 3300037466 | Bacteria | 13708 |
| 893 | Ga0395898_0015237 | 3300037466 | Bacteria | 7892 |
| 894 | Ga0395898_0019651 | 3300037466 | Bacteria | 6872 |
| 895 | Ga0395898_0042660 | 3300037466 | Bacteria | 4474 |
| 896 | Ga0395898_0046795 | 3300037466 | Bacteria | 4248 |
| 897 | Ga0395898_0050311 | 3300037466 | Bacteria | 4079 |
| 898 | Ga0395898_0080644 | 3300037466 | Bacteria | 3138 |
| 899 | Ga0395898_0174711 | 3300037466 | Bacteria | 2053 |
| 900 | Ga0395898_0285729 | 3300037466 | Bacteria | 1574 |
| 901 | Ga0395898_0298472 | 3300037466 | Bacteria | 1537 |
| 902 | Ga0395898_0372696 | 3300037466 | Bacteria | 1361 |
| 903 | Ga0395898_0391115 | 3300037466 | Bacteria | 1326 |
| 904 | Ga0395898_0410459 | 3300037466 | Bacteria | 1291 |
| 905 | Ga0395898_0451065 | 3300037466 | Unclassified | 1225 |
| 906 | Ga0395898_0572026 | 3300037466 | Bacteria | 1072 |
| 907 | Ga0395898_0717671 | 3300037466 | Bacteria | 941 |
| 908 | Ga0395898_0971853 | 3300037466 | Unclassified | 786 |
| 909 | Ga0395898_1006863 | 3300037466 | Bacteria | 769 |
| 910 | Ga0395898_1549826 | 3300037466 | Bacteria | 588 |
| 911 | Ga0395898_1733822 | 3300037466 | Unclassified | 547 |
| 912 | Ga0395905_0002871 | 3300037471 | Bacteria | 18817 |
| 913 | Ga0395905_0009104 | 3300037471 | Bacteria | 9727 |
| 914 | Ga0395905_0029771 | 3300037471 | Bacteria | 5146 |
| 915 | Ga0395905_0030658 | 3300037471 | Bacteria | 5065 |
| 916 | Ga0395905_0059967 | 3300037471 | Bacteria | 3558 |
| 917 | Ga0395905_0060087 | 3300037471 | Bacteria | 3554 |
| 918 | Ga0395905_0069148 | 3300037471 | Bacteria | 3307 |
| 919 | Ga0395905_0088690 | 3300037471 | Bacteria | 2899 |
| 920 | Ga0395905_0135976 | 3300037471 | Bacteria | 2312 |
| 921 | Ga0395905_0327047 | 3300037471 | Bacteria | 1423 |
| 922 | Ga0395905_0444910 | 3300037471 | Bacteria | 1193 |
| 923 | Ga0395905_0445892 | 3300037471 | Bacteria | 1192 |
| 924 | Ga0395905_0649887 | 3300037471 | Bacteria | 957 |
| 925 | Ga0395905_0678613 | 3300037471 | Unclassified | 933 |
| 926 | Ga0436364_1080961 | 3300037853 | Bacteria | 1042 |
| 927 | Ga0395901_0003588 | 3300038443 | Bacteria | 15650 |
| 928 | Ga0395901_0008494 | 3300038443 | Bacteria | 10379 |
| 929 | Ga0395901_0013435 | 3300038443 | Bacteria | 8323 |
| 930 | Ga0395901_0019244 | 3300038443 | Bacteria | 6980 |
| 931 | Ga0395901_0020919 | 3300038443 | Bacteria | 6702 |
| 932 | Ga0395901_0032977 | 3300038443 | Bacteria | 5343 |
| 933 | Ga0395901_0034252 | 3300038443 | Bacteria | 5244 |
| 934 | Ga0395901_0035468 | 3300038443 | Bacteria | 5153 |
| 935 | Ga0395901_0046421 | 3300038443 | Bacteria | 4512 |
| 936 | Ga0395901_0055307 | 3300038443 | Bacteria | 4127 |
| 937 | Ga0395901_0059091 | 3300038443 | Bacteria | 3989 |
| 938 | Ga0395901_0059732 | 3300038443 | Bacteria | 3967 |
| 939 | Ga0395901_0099670 | 3300038443 | Bacteria | 3046 |
| 940 | Ga0395901_0336355 | 3300038443 | Bacteria | 1560 |
| 941 | Ga0395901_0363660 | 3300038443 | Bacteria | 1491 |
| 942 | Ga0395901_0422260 | 3300038443 | Bacteria | 1367 |
| 943 | Ga0395901_0449930 | 3300038443 | Bacteria | 1317 |
| 944 | Ga0395901_0541671 | 3300038443 | Bacteria | 1180 |
| 945 | Ga0395901_0840241 | 3300038443 | Unclassified | 904 |
| 946 | Ga0395901_0895174 | 3300038443 | Unclassified | 870 |
| 947 | Ga0395901_1331290 | 3300038443 | Bacteria | 679 |
| 948 | Ga0395901_1392265 | 3300038443 | Unclassified | 660 |
| 949 | Ga0436365_0085711 | 3300039437 | Bacteria | 2892 |
| 950 | Ga0436365_0701464 | 3300039437 | Bacteria | 1800 |
| 951 | Ga0436365_0845903 | 3300039437 | Bacteria | 1154 |
| 952 | Ga0436360_1155632 | 3300039438 | Bacteria | 2053 |
| 953 | Ga0436363_0640175 | 3300039450 | Unclassified | 521 |
| 954 | Ga0436363_1570462 | 3300039450 | Bacteria | 906 |
| 955 | Ga0436363_1687957 | 3300039450 | Bacteria | 813 |
| 956 | Ga0436363_1701756 | 3300039450 | Bacteria | 1760 |
| 957 | Ga0436362_0192683 | 3300039453 | Bacteria | 1938 |
| 958 | Ga0436362_1065493 | 3300039453 | Bacteria | 567 |
| 959 | Ga0439461_0045621 | 3300041410 | Unclassified | 959 |
| 960 | Ga0439466_0122052 | 3300041411 | Unclassified | 804 |
| 961 | Ga0439465_0131463 | 3300041413 | Bacteria | 884 |
| 962 | Ga0451804_0563923 | 3300041463 | Bacteria | 1130 |
| 963 | Ga0451807_0290562 | 3300041486 | Unclassified | 575 |
| 964 | Ga0451849_1174289 | 3300041505 | Bacteria | 804 |
| 965 | Ga0451851_0413360 | 3300041507 | Bacteria | 585 |
| 966 | Ga0451853_1423786 | 3300041512 | Unclassified | 569 |
| 967 | Ga0451853_2826077 | 3300041512 | Bacteria | 1474 |
| 968 | Ga0451853_3658391 | 3300041512 | Bacteria | 741 |
| 969 | Ga0451853_3882521 | 3300041512 | Bacteria | 2326 |
| 970 | Ga0439448_0036171 | 3300042005 | Bacteria | 1583 |
| 971 | Ga0439432_059947 | 3300042006 | Bacteria | 1175 |
| 972 | Ga0439462_0097652 | 3300042015 | Unclassified | 808 |
| 973 | Ga0450915_002033 | 3300042119 | Unclassified | 1019 |
| 974 | Ga0450917_005551 | 3300042120 | Bacteria | 939 |
| 975 | Ga0450920_014823 | 3300042122 | Bacteria | 1479 |
| 976 | Ga0450898_070467 | 3300042134 | Unclassified | 700 |
| 977 | Ga0450910_023755 | 3300042147 | Unclassified | 938 |
| 978 | Ga0439446_0000515 | 3300042156 | Bacteria | 7762 |
| 979 | Ga0439446_0060293 | 3300042156 | Bacteria | 1146 |
| 980 | Ga0439434_0086783 | 3300042435 | Unclassified | 998 |
| 981 | Ga0451577_1877690 | 3300042876 | Unclassified | 525 |
| 982 | Ga0466969_0028519 | 3300044656 | Bacteria | 2853 |
| 983 | Ga0466969_0095008 | 3300044656 | Bacteria | 1409 |
| 984 | Ga0466969_0218360 | 3300044656 | Bacteria | 867 |
| 985 | Ga0466972_0522138 | 3300044658 | Bacteria | 559 |
| 986 | Ga0466965_0076490 | 3300044683 | Bacteria | 1689 |
| 987 | Ga0466965_0124314 | 3300044683 | Unclassified | 1334 |
| 988 | Ga0466965_0154697 | 3300044683 | Bacteria | 1200 |
| 989 | Ga0466965_0803528 | 3300044683 | Bacteria | 544 |
| 990 | Ga0466966_0000678 | 3300044684 | Bacteria | 21592 |
| 991 | Ga0466966_0003325 | 3300044684 | Bacteria | 10594 |
| 992 | Ga0466966_0043646 | 3300044684 | Bacteria | 2873 |
| 993 | Ga0466966_0137242 | 3300044684 | Bacteria | 1495 |
| 994 | Ga0466966_0173487 | 3300044684 | Bacteria | 1310 |
| 995 | Ga0466961_0002905 | 3300044693 | Bacteria | 10634 |
| 996 | Ga0466961_0007370 | 3300044693 | Bacteria | 6998 |
| 997 | Ga0466961_0029335 | 3300044693 | Bacteria | 3537 |
| 998 | Ga0466961_0065280 | 3300044693 | Bacteria | 2313 |
| 999 | Ga0466961_0070588 | 3300044693 | Bacteria | 2217 |
| 1000 | Ga0466961_0075688 | 3300044693 | Bacteria | 2134 |
| 1001 | Ga0466961_0096457 | 3300044693 | Bacteria | 1865 |
| 1002 | Ga0466961_0159312 | 3300044693 | Bacteria | 1407 |
| 1003 | Ga0466961_0538224 | 3300044693 | Bacteria | 704 |
| 1004 | Ga0466963_0000661 | 3300044694 | Bacteria | 16639 |
| 1005 | Ga0466963_0000792 | 3300044694 | Bacteria | 15743 |
| 1006 | Ga0466963_0002009 | 3300044694 | Bacteria | 11176 |
| 1007 | Ga0466963_0002017 | 3300044694 | Bacteria | 11157 |
| 1008 | Ga0466963_0002252 | 3300044694 | Bacteria | 10714 |
| 1009 | Ga0466963_0002500 | 3300044694 | Bacteria | 10289 |
| 1010 | Ga0466963_0002999 | 3300044694 | Bacteria | 9548 |
| 1011 | Ga0466963_0003520 | 3300044694 | Bacteria | 8990 |
| 1012 | Ga0466963_0004663 | 3300044694 | Bacteria | 8000 |
| 1013 | Ga0466963_0005080 | 3300044694 | Bacteria | 7695 |
| 1014 | Ga0466963_0006726 | 3300044694 | Bacteria | 6829 |
| 1015 | Ga0466963_0006855 | 3300044694 | Bacteria | 6779 |
| 1016 | Ga0466963_0009150 | 3300044694 | Bacteria | 5958 |
| 1017 | Ga0466963_0057815 | 3300044694 | Bacteria | 2583 |
| 1018 | Ga0466963_0073487 | 3300044694 | Bacteria | 2305 |
| 1019 | Ga0466963_0087868 | 3300044694 | Bacteria | 2114 |
| 1020 | Ga0466963_0090601 | 3300044694 | Unclassified | 2082 |
| 1021 | Ga0466963_0132045 | 3300044694 | Bacteria | 1726 |
| 1022 | Ga0466963_0275348 | 3300044694 | Bacteria | 1182 |
| 1023 | Ga0466963_0427892 | 3300044694 | Bacteria | 933 |
| 1024 | Ga0466963_0478332 | 3300044694 | Bacteria | 879 |
| 1025 | Ga0466963_1049805 | 3300044694 | Bacteria | 573 |
| 1026 | Ga0466963_1092534 | 3300044694 | Bacteria | 561 |
| 1027 | Ga0466964_0000335 | 3300044706 | Bacteria | 14066 |
| 1028 | Ga0466964_0001343 | 3300044706 | Bacteria | 8395 |
| 1029 | Ga0466964_0003667 | 3300044706 | Bacteria | 5617 |
| 1030 | Ga0466964_0004919 | 3300044706 | Bacteria | 4940 |
| 1031 | Ga0466964_0013694 | 3300044706 | Bacteria | 3078 |
| 1032 | Ga0466964_0022018 | 3300044706 | Bacteria | 2469 |
| 1033 | Ga0466964_0031620 | 3300044706 | Bacteria | 2100 |
| 1034 | Ga0466964_0038061 | 3300044706 | Unclassified | 1933 |
| 1035 | Ga0466964_0042842 | 3300044706 | Bacteria | 1835 |
| 1036 | Ga0466964_0055679 | 3300044706 | Bacteria | 1633 |
| 1037 | Ga0466964_0063175 | 3300044706 | Bacteria | 1546 |
| 1038 | Ga0466964_0074447 | 3300044706 | Unclassified | 1444 |
| 1039 | Ga0466964_0187771 | 3300044706 | Unclassified | 984 |
| 1040 | Ga0466964_0265164 | 3300044706 | Unclassified | 852 |
| 1041 | Ga0466964_0593091 | 3300044706 | Unclassified | 607 |
| 1042 | Ga0466964_0730704 | 3300044706 | Bacteria | 554 |
| 1043 | Ga0466971_0003596 | 3300044719 | Bacteria | 6624 |
| 1044 | Ga0466971_0007633 | 3300044719 | Bacteria | 4716 |
| 1045 | Ga0466971_0021486 | 3300044719 | Bacteria | 2872 |
| 1046 | Ga0466971_0036982 | 3300044719 | Bacteria | 2189 |
| 1047 | Ga0466971_0189687 | 3300044719 | Unclassified | 968 |
| 1048 | Ga0466971_0209896 | 3300044719 | Unclassified | 921 |
| 1049 | Ga0466971_0489188 | 3300044719 | Bacteria | 606 |
| 1050 | Ga0466968_0002629 | 3300044735 | Bacteria | 6609 |
| 1051 | Ga0466968_0004943 | 3300044735 | Bacteria | 4993 |
| 1052 | Ga0466968_0078435 | 3300044735 | Unclassified | 1448 |
| 1053 | Ga0466968_0123473 | 3300044735 | Bacteria | 1173 |
| 1054 | Ga0466968_0146678 | 3300044735 | Unclassified | 1082 |
| 1055 | Ga0466968_0217756 | 3300044735 | Bacteria | 898 |
| 1056 | Ga0466968_0272199 | 3300044735 | Unclassified | 808 |
| 1057 | Ga0466970_0013425 | 3300044765 | Bacteria | 4199 |
| 1058 | Ga0466970_0035573 | 3300044765 | Bacteria | 2638 |
| 1059 | Ga0466970_0158393 | 3300044765 | Unclassified | 1252 |
| 1060 | Ga0466957_0000566 | 3300044842 | Bacteria | 18671 |
| 1061 | Ga0466957_0000954 | 3300044842 | Bacteria | 14837 |
| 1062 | Ga0466957_0005157 | 3300044842 | Bacteria | 7303 |
| 1063 | Ga0466957_0005764 | 3300044842 | Bacteria | 6958 |
| 1064 | Ga0466957_0013432 | 3300044842 | Bacteria | 4750 |
| 1065 | Ga0466957_0024884 | 3300044842 | Bacteria | 3546 |
| 1066 | Ga0466957_0039745 | 3300044842 | Bacteria | 2839 |
| 1067 | Ga0466957_0055884 | 3300044842 | Bacteria | 2413 |
| 1068 | Ga0466957_0060259 | 3300044842 | Bacteria | 2327 |
| 1069 | Ga0466957_0066843 | 3300044842 | Bacteria | 2217 |
| 1070 | Ga0466957_0134766 | 3300044842 | Bacteria | 1586 |
| 1071 | Ga0466957_0226235 | 3300044842 | Unclassified | 1237 |
| 1072 | Ga0466957_0451153 | 3300044842 | Bacteria | 886 |
| 1073 | Ga0466957_0943999 | 3300044842 | Unclassified | 618 |
| 1074 | Ga0466957_1089174 | 3300044842 | Bacteria | 576 |
| 1075 | Ga0466957_1191833 | 3300044842 | Unclassified | 551 |
| 1076 | Ga0466960_0013853 | 3300044901 | Bacteria | 3436 |
| 1077 | Ga0466960_0209325 | 3300044901 | Bacteria | 1069 |
| 1078 | Ga0466960_0266460 | 3300044901 | Bacteria | 956 |
| 1079 | Ga0466960_0324863 | 3300044901 | Bacteria | 872 |
| 1080 | Ga0466960_0400002 | 3300044901 | Unclassified | 791 |
| 1081 | Ga0466959_0001247 | 3300045049 | Bacteria | 15365 |
| 1082 | Ga0466959_0006694 | 3300045049 | Bacteria | 8014 |
| 1083 | Ga0466959_0033953 | 3300045049 | Bacteria | 3774 |
| 1084 | Ga0466959_0085996 | 3300045049 | Bacteria | 2262 |
| 1085 | Ga0466959_0086370 | 3300045049 | Bacteria | 2257 |
| 1086 | Ga0466959_0116728 | 3300045049 | Bacteria | 1900 |
| 1087 | Ga0466959_0121324 | 3300045049 | Bacteria | 1858 |
| 1088 | Ga0466959_0200703 | 3300045049 | Bacteria | 1389 |
| 1089 | Ga0466959_0212575 | 3300045049 | Bacteria | 1343 |
| 1090 | Ga0466959_0345420 | 3300045049 | Bacteria | 1015 |
| 1091 | Ga0451576_0943868 | 3300045051 | Bacteria | 905 |
| 1092 | Ga0451576_1344229 | 3300045051 | Unclassified | 744 |
| 1093 | Ga0451576_1427611 | 3300045051 | Bacteria | 720 |
| 1094 | Ga0466958_0000591 | 3300045836 | Bacteria | 15435 |
| 1095 | Ga0466958_0000942 | 3300045836 | Bacteria | 13132 |
| 1096 | Ga0466958_0004180 | 3300045836 | Bacteria | 7585 |
| 1097 | Ga0466958_0006462 | 3300045836 | Bacteria | 6380 |
| 1098 | Ga0466958_0012679 | 3300045836 | Bacteria | 4779 |
| 1099 | Ga0466958_0030337 | 3300045836 | Bacteria | 3211 |
| 1100 | Ga0466958_0057096 | 3300045836 | Bacteria | 2372 |
| 1101 | Ga0466958_0058161 | 3300045836 | Bacteria | 2350 |
| 1102 | Ga0466958_0066029 | 3300045836 | Bacteria | 2208 |
| 1103 | Ga0466958_0069368 | 3300045836 | Bacteria | 2155 |
| 1104 | Ga0466958_0154606 | 3300045836 | Unclassified | 1447 |
| 1105 | Ga0466958_0201625 | 3300045836 | Bacteria | 1266 |
| 1106 | Ga0466958_0217755 | 3300045836 | Bacteria | 1218 |
| 1107 | Ga0466958_0257390 | 3300045836 | Bacteria | 1117 |
| 1108 | Ga0466958_0276314 | 3300045836 | Unclassified | 1076 |
| 1109 | Ga0466958_0289655 | 3300045836 | Bacteria | 1050 |
| 1110 | Ga0466958_0507704 | 3300045836 | Unclassified | 782 |
| 1111 | Ga0466958_0622245 | 3300045836 | Bacteria | 702 |
| 1112 | Ga0466958_0808304 | 3300045836 | Bacteria | 611 |
| 1113 | Ga0466958_0897376 | 3300045836 | Unclassified | 578 |
| 1114 | Ga0466967_0000351 | 3300045976 | Bacteria | 21269 |
| 1115 | Ga0466967_0002747 | 3300045976 | Bacteria | 11130 |
| 1116 | Ga0466967_0003833 | 3300045976 | Bacteria | 9952 |
| 1117 | Ga0466967_0005871 | 3300045976 | Bacteria | 8594 |
| 1118 | Ga0466967_0007851 | 3300045976 | Bacteria | 7752 |
| 1119 | Ga0466967_0008069 | 3300045976 | Bacteria | 7677 |
| 1120 | Ga0466967_0011565 | 3300045976 | Bacteria | 6696 |
| 1121 | Ga0466967_0013044 | 3300045976 | Bacteria | 6397 |
| 1122 | Ga0466967_0014209 | 3300045976 | Bacteria | 6192 |
| 1123 | Ga0466967_0015741 | 3300045976 | Bacteria | 5940 |
| 1124 | Ga0466967_0023531 | 3300045976 | Bacteria | 5050 |
| 1125 | Ga0466967_0033429 | 3300045976 | Bacteria | 4353 |
| 1126 | Ga0466967_0037082 | 3300045976 | Bacteria | 4168 |
| 1127 | Ga0466967_0041421 | 3300045976 | Bacteria | 3971 |
| 1128 | Ga0466967_0055721 | 3300045976 | Bacteria | 3483 |
| 1129 | Ga0466967_0076077 | 3300045976 | Bacteria | 3018 |
| 1130 | Ga0466967_0076252 | 3300045976 | Bacteria | 3015 |
| 1131 | Ga0466967_0076552 | 3300045976 | Bacteria | 3010 |
| 1132 | Ga0466967_0085897 | 3300045976 | Bacteria | 2850 |
| 1133 | Ga0466967_0093121 | 3300045976 | Bacteria | 2741 |
| 1134 | Ga0466967_0101199 | 3300045976 | Bacteria | 2634 |
| 1135 | Ga0466967_0105095 | 3300045976 | Bacteria | 2586 |
| 1136 | Ga0466967_0116549 | 3300045976 | Bacteria | 2461 |
| 1137 | Ga0466967_0131492 | 3300045976 | Bacteria | 2324 |
| 1138 | Ga0466967_0141454 | 3300045976 | Bacteria | 2241 |
| 1139 | Ga0466967_0143220 | 3300045976 | Bacteria | 2228 |
| 1140 | Ga0466967_0157845 | 3300045976 | Bacteria | 2127 |
| 1141 | Ga0466967_0162460 | 3300045976 | Bacteria | 2097 |
| 1142 | Ga0466967_0206537 | 3300045976 | Bacteria | 1862 |
| 1143 | Ga0466967_0253836 | 3300045976 | Bacteria | 1681 |
| 1144 | Ga0466967_0254138 | 3300045976 | Bacteria | 1680 |
| 1145 | Ga0466967_0261440 | 3300045976 | Bacteria | 1656 |
| 1146 | Ga0466967_0264620 | 3300045976 | Bacteria | 1646 |
| 1147 | Ga0466967_0346877 | 3300045976 | Bacteria | 1436 |
| 1148 | Ga0466967_0605618 | 3300045976 | Bacteria | 1081 |
| 1149 | Ga0466967_0619634 | 3300045976 | Unclassified | 1069 |
| 1150 | Ga0466967_0889469 | 3300045976 | Unclassified | 885 |
| 1151 | Ga0466967_1132674 | 3300045976 | Unclassified | 780 |
| 1152 | Ga0466967_1832651 | 3300045976 | Bacteria | 604 |
| 1153 | Ga0466967_1986128 | 3300045976 | Bacteria | 578 |
| 1154 | Ga0466967_2160205 | 3300045976 | Bacteria | 553 |
| 1155 | Ga0495592_0064166 | 3300046454 | Bacteria | 2692 |
| 1156 | Ga0495592_0071193 | 3300046454 | Bacteria | 2531 |
| 1157 | Ga0495592_0160618 | 3300046454 | Bacteria | 1546 |
| 1158 | Ga0495592_0186727 | 3300046454 | Bacteria | 1408 |
| 1159 | Ga0495603_0054756 | 3300046455 | Bacteria | 2364 |
| 1160 | Ga0495603_0126672 | 3300046455 | Bacteria | 1488 |
| 1161 | Ga0495603_0136523 | 3300046455 | Bacteria | 1427 |
| 1162 | Ga0495591_102666 | 3300046458 | Unclassified | 708 |
| 1163 | Ga0495629_0015080 | 3300046459 | Bacteria | 5554 |
| 1164 | Ga0495629_0060748 | 3300046459 | Bacteria | 2641 |
| 1165 | Ga0495629_0209233 | 3300046459 | Bacteria | 1347 |
| 1166 | Ga0495629_0759348 | 3300046459 | Unclassified | 641 |
| 1167 | Ga0495641_0001273 | 3300046461 | Bacteria | 21638 |
| 1168 | Ga0495641_0017827 | 3300046461 | Bacteria | 3685 |
| 1169 | Ga0495641_0024718 | 3300046461 | Bacteria | 2960 |
| 1170 | Ga0495641_0024821 | 3300046461 | Bacteria | 2951 |
| 1171 | Ga0495641_0088399 | 3300046461 | Bacteria | 1386 |
| 1172 | Ga0495641_0095543 | 3300046461 | Bacteria | 1327 |
| 1173 | Ga0495641_0125139 | 3300046461 | Bacteria | 1147 |
| 1174 | Ga0495641_0257087 | 3300046461 | Bacteria | 785 |
| 1175 | Ga0495641_0330853 | 3300046461 | Unclassified | 688 |
| 1176 | Ga0495651_0014259 | 3300046462 | Bacteria | 6144 |
| 1177 | Ga0495651_0018806 | 3300046462 | Bacteria | 5352 |
| 1178 | Ga0495651_0142996 | 3300046462 | Bacteria | 1732 |
| 1179 | Ga0495651_0208638 | 3300046462 | Bacteria | 1361 |
| 1180 | Ga0495651_0289734 | 3300046462 | Bacteria | 1102 |
| 1181 | Ga0495651_0620313 | 3300046462 | Bacteria | 680 |
| 1182 | Ga0495653_0033898 | 3300046463 | Bacteria | 4042 |
| 1183 | Ga0495653_0074161 | 3300046463 | Bacteria | 2536 |
| 1184 | Ga0495653_0079235 | 3300046463 | Bacteria | 2433 |
| 1185 | Ga0495653_0189902 | 3300046463 | Bacteria | 1402 |
| 1186 | Ga0495653_0221004 | 3300046463 | Bacteria | 1273 |
| 1187 | Ga0495653_0243004 | 3300046463 | Bacteria | 1198 |
| 1188 | Ga0495653_0841278 | 3300046463 | Bacteria | 549 |
| 1189 | Ga0495580_0287600 | 3300046472 | Unclassified | 1121 |
| 1190 | Ga0495582_0000066 | 3300046473 | Bacteria | 53920 |
| 1191 | Ga0495582_0030557 | 3300046473 | Bacteria | 2957 |
| 1192 | Ga0495582_0069815 | 3300046473 | Bacteria | 1943 |
| 1193 | Ga0495582_0085011 | 3300046473 | Bacteria | 1759 |
| 1194 | Ga0495582_0110881 | 3300046473 | Bacteria | 1541 |
| 1195 | Ga0495582_0139706 | 3300046473 | Unclassified | 1372 |
| 1196 | Ga0495582_0329052 | 3300046473 | Unclassified | 879 |
| 1197 | Ga0495582_0908106 | 3300046473 | Bacteria | 509 |
| 1198 | Ga0495605_0084608 | 3300046474 | Bacteria | 1479 |
| 1199 | Ga0495639_0001852 | 3300046475 | Bacteria | 9359 |
| 1200 | Ga0495639_0286102 | 3300046475 | Bacteria | 820 |
| 1201 | Ga0495639_0303501 | 3300046475 | Unclassified | 796 |
| 1202 | Ga0495639_0305899 | 3300046475 | Unclassified | 793 |
| 1203 | Ga0495662_0012277 | 3300046476 | Bacteria | 4183 |
| 1204 | Ga0495662_0054097 | 3300046476 | Bacteria | 1939 |
| 1205 | Ga0495662_0337123 | 3300046476 | Bacteria | 741 |
| 1206 | Ga0495664_0081951 | 3300046477 | Bacteria | 1934 |
| 1207 | Ga0495664_0119293 | 3300046477 | Bacteria | 1595 |
| 1208 | Ga0495664_0173805 | 3300046477 | Bacteria | 1307 |
| 1209 | Ga0495664_0209427 | 3300046477 | Bacteria | 1181 |
| 1210 | Ga0495664_0723630 | 3300046477 | Bacteria | 587 |
| 1211 | Ga0495584_0023265 | 3300046491 | Bacteria | 3142 |
| 1212 | Ga0495584_0277062 | 3300046491 | Unclassified | 852 |
| 1213 | Ga0495584_0322986 | 3300046491 | Unclassified | 784 |
| 1214 | Ga0495585_0111918 | 3300046492 | Bacteria | 1451 |
| 1215 | Ga0495585_0190734 | 3300046492 | Bacteria | 1049 |
| 1216 | Ga0495594_0023442 | 3300046499 | Bacteria | 3308 |
| 1217 | Ga0495594_0024618 | 3300046499 | Bacteria | 3235 |
| 1218 | Ga0495594_0565863 | 3300046499 | Bacteria | 645 |
| 1219 | Ga0495596_0387852 | 3300046500 | Unclassified | 544 |
| 1220 | Ga0495607_0120295 | 3300046501 | Unclassified | 1380 |
| 1221 | Ga0495608_0004630 | 3300046511 | Bacteria | 9825 |
| 1222 | Ga0495608_0024814 | 3300046511 | Bacteria | 4096 |
| 1223 | Ga0495608_0029249 | 3300046511 | Bacteria | 3739 |
| 1224 | Ga0495608_0030695 | 3300046511 | Bacteria | 3637 |
| 1225 | Ga0495608_0073652 | 3300046511 | Bacteria | 2227 |
| 1226 | Ga0495608_0136560 | 3300046511 | Bacteria | 1567 |
| 1227 | Ga0495616_0411639 | 3300046513 | Bacteria | 554 |
| 1228 | Ga0495618_0016102 | 3300046514 | Bacteria | 4569 |
| 1229 | Ga0495618_0030541 | 3300046514 | Bacteria | 3366 |
| 1230 | Ga0495618_0123974 | 3300046514 | Bacteria | 1654 |
| 1231 | Ga0495618_0678414 | 3300046514 | Bacteria | 607 |
| 1232 | Ga0495618_0785582 | 3300046514 | Bacteria | 555 |
| 1233 | Ga0495620_0101546 | 3300046515 | Bacteria | 1146 |
| 1234 | Ga0495628_0023992 | 3300046516 | Bacteria | 4999 |
| 1235 | Ga0495628_0093798 | 3300046516 | Bacteria | 2321 |
| 1236 | Ga0495628_0100432 | 3300046516 | Bacteria | 2233 |
| 1237 | Ga0495628_0129587 | 3300046516 | Bacteria | 1930 |
| 1238 | Ga0495628_0188031 | 3300046516 | Unclassified | 1560 |
| 1239 | Ga0495630_0004203 | 3300046517 | Bacteria | 10081 |
| 1240 | Ga0495630_0017638 | 3300046517 | Bacteria | 5233 |
| 1241 | Ga0495630_0019933 | 3300046517 | Bacteria | 4937 |
| 1242 | Ga0495630_0039229 | 3300046517 | Bacteria | 3542 |
| 1243 | Ga0495630_0153665 | 3300046517 | Bacteria | 1751 |
| 1244 | Ga0495630_0295613 | 3300046517 | Unclassified | 1237 |
| 1245 | Ga0495630_0317760 | 3300046517 | Unclassified | 1190 |
| 1246 | Ga0495630_0416195 | 3300046517 | Bacteria | 1030 |
| 1247 | Ga0495630_1131683 | 3300046517 | Bacteria | 593 |
| 1248 | Ga0495631_0423484 | 3300046518 | Bacteria | 567 |
| 1249 | Ga0495632_0215938 | 3300046519 | Unclassified | 869 |
| 1250 | Ga0495644_0005854 | 3300046523 | Bacteria | 4803 |
| 1251 | Ga0495644_0081365 | 3300046523 | Bacteria | 1221 |
| 1252 | Ga0495644_0161187 | 3300046523 | Bacteria | 860 |
| 1253 | Ga0495663_0018218 | 3300046525 | Bacteria | 1998 |
| 1254 | Ga0495663_0233255 | 3300046525 | Bacteria | 650 |
| 1255 | Ga0495663_0274678 | 3300046525 | Bacteria | 603 |
| 1256 | Ga0495666_0015553 | 3300046526 | Bacteria | 3788 |
| 1257 | Ga0495642_0025963 | 3300046528 | Bacteria | 2324 |
| 1258 | Ga0495642_0210232 | 3300046528 | Unclassified | 849 |
| 1259 | Ga0495652_0030319 | 3300046529 | Bacteria | 4744 |
| 1260 | Ga0495652_0037661 | 3300046529 | Bacteria | 4194 |
| 1261 | Ga0495652_0068143 | 3300046529 | Bacteria | 2981 |
| 1262 | Ga0495652_0099102 | 3300046529 | Bacteria | 2367 |
| 1263 | Ga0495652_0105101 | 3300046529 | Bacteria | 2282 |
| 1264 | Ga0495652_0246943 | 3300046529 | Bacteria | 1325 |
| 1265 | Ga0495665_0000252 | 3300046531 | Bacteria | 26953 |
| 1266 | Ga0495665_0079447 | 3300046531 | Unclassified | 1726 |
| 1267 | Ga0495640_0004199 | 3300046533 | Bacteria | 11523 |
| 1268 | Ga0495640_0035408 | 3300046533 | Bacteria | 3533 |
| 1269 | Ga0495640_0037865 | 3300046533 | Bacteria | 3398 |
| 1270 | Ga0495640_0041162 | 3300046533 | Bacteria | 3230 |
| 1271 | Ga0495640_0096912 | 3300046533 | Unclassified | 1940 |
| 1272 | Ga0495640_0141064 | 3300046533 | Bacteria | 1553 |
| 1273 | Ga0495640_0425162 | 3300046533 | Bacteria | 814 |
| 1274 | Ga0495640_0442347 | 3300046533 | Bacteria | 795 |
| 1275 | Ga0495586_0067463 | 3300046535 | Bacteria | 1951 |
| 1276 | Ga0495586_0098240 | 3300046535 | Unclassified | 1623 |
| 1277 | Ga0495587_0064972 | 3300046536 | Unclassified | 2131 |
| 1278 | Ga0495609_0062392 | 3300046538 | Bacteria | 1646 |
| 1279 | Ga0495645_0023030 | 3300046543 | Bacteria | 4508 |
| 1280 | Ga0495645_0072249 | 3300046543 | Bacteria | 2486 |
| 1281 | Ga0495645_0143988 | 3300046543 | Bacteria | 1660 |
| 1282 | Ga0495645_0235316 | 3300046543 | Bacteria | 1225 |
| 1283 | Ga0495645_0954216 | 3300046543 | Bacteria | 506 |
| 1284 | Ga0495667_0038165 | 3300046559 | Bacteria | 3199 |
| 1285 | Ga0495667_0060705 | 3300046559 | Bacteria | 2479 |
| 1286 | Ga0495667_0064192 | 3300046559 | Bacteria | 2402 |
| 1287 | Ga0495667_0073244 | 3300046559 | Bacteria | 2231 |
| 1288 | Ga0495667_0093489 | 3300046559 | Bacteria | 1947 |
| 1289 | Ga0495667_0101119 | 3300046559 | Unclassified | 1865 |
| 1290 | Ga0495667_0116916 | 3300046559 | Bacteria | 1722 |
| 1291 | Ga0495667_0228351 | 3300046559 | Unclassified | 1187 |
| 1292 | Ga0495656_0002578 | 3300046615 | Bacteria | 6041 |
| 1293 | Ga0495656_0046483 | 3300046615 | Bacteria | 1837 |
| 1294 | Ga0495656_0056216 | 3300046615 | Bacteria | 1700 |
| 1295 | Ga0495656_0057693 | 3300046615 | Bacteria | 1682 |
| 1296 | Ga0495656_0076188 | 3300046615 | Bacteria | 1502 |
| 1297 | Ga0495656_0630054 | 3300046615 | Unclassified | 575 |
| 1298 | Ga0495668_0061246 | 3300046616 | Bacteria | 2076 |
| 1299 | Ga0495634_0117304 | 3300046642 | Bacteria | 1707 |
| 1300 | Ga0495634_0124792 | 3300046642 | Bacteria | 1646 |
| 1301 | Ga0495611_0156954 | 3300046648 | Bacteria | 1063 |
| 1302 | Ga0495635_0010487 | 3300046663 | Bacteria | 6483 |
| 1303 | Ga0495635_0073551 | 3300046663 | Bacteria | 2341 |
| 1304 | Ga0495635_0125878 | 3300046663 | Bacteria | 1747 |
| 1305 | Ga0495635_0147042 | 3300046663 | Bacteria | 1604 |
| 1306 | Ga0495635_0509116 | 3300046663 | Bacteria | 792 |
| 1307 | Ga0495659_0042593 | 3300046664 | Bacteria | 1626 |
| 1308 | Ga0495661_0309628 | 3300046665 | Unclassified | 788 |
| 1309 | Ga0495588_0307545 | 3300046674 | Bacteria | 834 |
| 1310 | Ga0495588_0561431 | 3300046674 | Unclassified | 598 |
| 1311 | Ga0495657_0012211 | 3300046675 | Bacteria | 6388 |
| 1312 | Ga0495657_0027103 | 3300046675 | Bacteria | 4049 |
| 1313 | Ga0495657_0041419 | 3300046675 | Bacteria | 3151 |
| 1314 | Ga0495657_0095513 | 3300046675 | Bacteria | 1900 |
| 1315 | Ga0495657_0167394 | 3300046675 | Unclassified | 1356 |
| 1316 | Ga0495657_0183623 | 3300046675 | Bacteria | 1282 |
| 1317 | Ga0495657_0323357 | 3300046675 | Bacteria | 916 |
| 1318 | Ga0495599_0014073 | 3300046678 | Bacteria | 4953 |
| 1319 | Ga0495599_0014224 | 3300046678 | Bacteria | 4926 |
| 1320 | Ga0495599_0089905 | 3300046678 | Bacteria | 1916 |
| 1321 | Ga0495623_0043281 | 3300046679 | Bacteria | 2866 |
| 1322 | Ga0495623_0054740 | 3300046679 | Bacteria | 2516 |
| 1323 | Ga0495623_0269927 | 3300046679 | Unclassified | 950 |
| 1324 | Ga0495646_0007463 | 3300046680 | Bacteria | 6950 |
| 1325 | Ga0495646_0092320 | 3300046680 | Bacteria | 1746 |
| 1326 | Ga0495647_0008142 | 3300046681 | Bacteria | 3523 |
| 1327 | Ga0495647_0021676 | 3300046681 | Bacteria | 2315 |
| 1328 | Ga0495647_0058933 | 3300046681 | Bacteria | 1510 |
| 1329 | Ga0495647_0187063 | 3300046681 | Bacteria | 903 |
| 1330 | Ga0495658_0001642 | 3300046683 | Bacteria | 11629 |
| 1331 | Ga0495658_0022084 | 3300046683 | Bacteria | 3362 |
| 1332 | Ga0495658_0034755 | 3300046683 | Bacteria | 2768 |
| 1333 | Ga0495658_0053250 | 3300046683 | Bacteria | 2298 |
| 1334 | Ga0495658_0173305 | 3300046683 | Unclassified | 1336 |
| 1335 | Ga0495658_0415517 | 3300046683 | Unclassified | 858 |
| 1336 | Ga0495613_0006002 | 3300046689 | Bacteria | 9090 |
| 1337 | Ga0495613_0013886 | 3300046689 | Bacteria | 5977 |
| 1338 | Ga0495613_0070553 | 3300046689 | Bacteria | 2547 |
| 1339 | Ga0495613_0075604 | 3300046689 | Bacteria | 2452 |
| 1340 | Ga0495613_0150056 | 3300046689 | Bacteria | 1663 |
| 1341 | Ga0495613_0185108 | 3300046689 | Unclassified | 1474 |
| 1342 | Ga0495613_0215310 | 3300046689 | Bacteria | 1350 |
| 1343 | Ga0495613_0569643 | 3300046689 | Unclassified | 756 |
| 1344 | Ga0495624_0009967 | 3300046690 | Bacteria | 6569 |
| 1345 | Ga0495624_0112022 | 3300046690 | Bacteria | 1677 |
| 1346 | Ga0495624_0283149 | 3300046690 | Bacteria | 1001 |
| 1347 | Ga0495624_0333682 | 3300046690 | Bacteria | 912 |
| 1348 | Ga0495624_0344877 | 3300046690 | Unclassified | 896 |
| 1349 | Ga0495624_0426251 | 3300046690 | Bacteria | 795 |
| 1350 | Ga0495624_0568532 | 3300046690 | Unclassified | 677 |
| 1351 | Ga0495670_0216565 | 3300046691 | Bacteria | 1017 |
| 1352 | Ga0495589_0064595 | 3300046794 | Bacteria | 1794 |
| 1353 | Ga0495589_0086462 | 3300046794 | Bacteria | 1523 |
| 1354 | Ga0495589_0111071 | 3300046794 | Bacteria | 1323 |
| 1355 | Ga0495589_0332038 | 3300046794 | Unclassified | 702 |
| 1356 | Ga0495600_0008159 | 3300046809 | Bacteria | 6428 |
| 1357 | Ga0495600_0053184 | 3300046809 | Bacteria | 2644 |
| 1358 | Ga0495600_0088725 | 3300046809 | Bacteria | 2017 |
| 1359 | Ga0495600_0351667 | 3300046809 | Bacteria | 923 |
| 1360 | Ga0495581_0005422 | 3300047315 | Bacteria | 7380 |
| 1361 | Ga0495581_0006426 | 3300047315 | Bacteria | 6819 |
| 1362 | Ga0495581_0011634 | 3300047315 | Bacteria | 5093 |
| 1363 | Ga0495581_0203138 | 3300047315 | Bacteria | 1159 |
| 1364 | Ga0495604_0010501 | 3300047317 | Bacteria | 7341 |
| 1365 | Ga0495604_0022565 | 3300047317 | Bacteria | 5025 |
| 1366 | Ga0495604_0188050 | 3300047317 | Bacteria | 1441 |
| 1367 | Ga0495604_0190498 | 3300047317 | Bacteria | 1429 |
| 1368 | Ga0495604_0540819 | 3300047317 | Bacteria | 752 |
| 1369 | Ga0495604_0952056 | 3300047317 | Unclassified | 534 |
| 1370 | Ga0495636_0128771 | 3300047318 | Bacteria | 1125 |
| 1371 | Ga0495674_0005260 | 3300047319 | Bacteria | 12417 |
| 1372 | Ga0495674_0023461 | 3300047319 | Bacteria | 5685 |
| 1373 | Ga0495674_0074298 | 3300047319 | Bacteria | 2928 |
| 1374 | Ga0495674_0093031 | 3300047319 | Bacteria | 2573 |
| 1375 | Ga0495674_0326296 | 3300047319 | Bacteria | 1249 |
| 1376 | Ga0495676_0046046 | 3300047321 | Bacteria | 3545 |
| 1377 | Ga0495676_0056767 | 3300047321 | Bacteria | 3094 |
| 1378 | Ga0495676_0069211 | 3300047321 | Bacteria | 2724 |
| 1379 | Ga0495676_0098020 | 3300047321 | Bacteria | 2176 |
| 1380 | Ga0495676_0114975 | 3300047321 | Bacteria | 1968 |
| 1381 | Ga0495676_0156430 | 3300047321 | Bacteria | 1617 |
| 1382 | Ga0495676_0176907 | 3300047321 | Bacteria | 1498 |
| 1383 | Ga0495676_0309972 | 3300047321 | Bacteria | 1062 |
| 1384 | Ga0495676_0409202 | 3300047321 | Bacteria | 899 |
| 1385 | Ga0495676_0687772 | 3300047321 | Unclassified | 662 |
| 1386 | Ga0495680_0004019 | 3300047322 | Bacteria | 14195 |
| 1387 | Ga0495680_0007901 | 3300047322 | Bacteria | 9707 |
| 1388 | Ga0495680_0012789 | 3300047322 | Bacteria | 7359 |
| 1389 | Ga0495680_0031439 | 3300047322 | Bacteria | 4321 |
| 1390 | Ga0495680_0033161 | 3300047322 | Bacteria | 4183 |
| 1391 | Ga0495680_0048842 | 3300047322 | Bacteria | 3320 |
| 1392 | Ga0495680_0121450 | 3300047322 | Bacteria | 1928 |
| 1393 | Ga0495680_0158648 | 3300047322 | Bacteria | 1644 |
| 1394 | Ga0495680_0256859 | 3300047322 | Bacteria | 1237 |
| 1395 | Ga0495680_0281896 | 3300047322 | Bacteria | 1171 |
| 1396 | Ga0495680_0377959 | 3300047322 | Bacteria | 982 |
| 1397 | Ga0495683_0246497 | 3300047323 | Unclassified | 786 |
| 1398 | Ga0495675_0039853 | 3300047444 | Bacteria | 2993 |
| 1399 | Ga0495675_0073251 | 3300047444 | Bacteria | 2160 |
| 1400 | Ga0495675_0115991 | 3300047444 | Bacteria | 1670 |
| 1401 | Ga0495675_0217570 | 3300047444 | Bacteria | 1157 |
| 1402 | Ga0495677_0046219 | 3300047445 | Bacteria | 1598 |
| 1403 | Ga0495677_0068395 | 3300047445 | Unclassified | 1322 |
| 1404 | Ga0495684_0031706 | 3300047471 | Bacteria | 4059 |
| 1405 | Ga0495684_0037507 | 3300047471 | Bacteria | 3717 |
| 1406 | Ga0495684_0063791 | 3300047471 | Bacteria | 2800 |
| 1407 | Ga0495684_0081595 | 3300047471 | Bacteria | 2454 |
| 1408 | Ga0495684_0133068 | 3300047471 | Unclassified | 1866 |
| 1409 | Ga0495684_0207240 | 3300047471 | Bacteria | 1443 |
| 1410 | Ga0495684_0328639 | 3300047471 | Bacteria | 1091 |
| 1411 | Ga0495593_0009955 | 3300047673 | Bacteria | 5512 |
| 1412 | Ga0495593_0103529 | 3300047673 | Bacteria | 1458 |
| 1413 | Ga0495602_0033000 | 3300048088 | Bacteria | 4864 |
| 1414 | Ga0495602_0070950 | 3300048088 | Bacteria | 2977 |
| 1415 | Ga0495602_0096811 | 3300048088 | Bacteria | 2433 |
| 1416 | Ga0495602_0097344 | 3300048088 | Bacteria | 2424 |
| 1417 | Ga0495602_0192351 | 3300048088 | Bacteria | 1563 |
| 1418 | Ga0495602_0199514 | 3300048088 | Bacteria | 1528 |
| 1419 | Ga0495602_0320044 | 3300048088 | Bacteria | 1129 |
| 1420 | Ga0495602_0481544 | 3300048088 | Bacteria | 871 |
| 1421 | Ga0495602_0506773 | 3300048088 | Bacteria | 843 |
| 1422 | Ga0495602_1152168 | 3300048088 | Unclassified | 507 |
| 1423 | Ga0495614_0010456 | 3300048089 | Bacteria | 4092 |
| 1424 | Ga0495614_0107048 | 3300048089 | Unclassified | 1226 |
| 1425 | Ga0495614_0490286 | 3300048089 | Unclassified | 584 |
| 1426 | Ga0495615_0056568 | 3300048090 | Unclassified | 1024 |
| 1427 | Ga0496100_0028558 | 3300048903 | Bacteria | 3441 |
| 1428 | Ga0496100_0096316 | 3300048903 | Bacteria | 2030 |
| 1429 | Ga0496100_0240103 | 3300048903 | Bacteria | 1336 |
| 1430 | Ga0496100_0316574 | 3300048903 | Unclassified | 1171 |
| 1431 | Ga0496100_0627835 | 3300048903 | Bacteria | 836 |
| 1432 | Ga0496100_0683779 | 3300048903 | Unclassified | 800 |
| 1433 | Ga0496100_1021869 | 3300048903 | Unclassified | 651 |
| 1434 | Ga0496101_0000543 | 3300048904 | Bacteria | 23139 |
| 1435 | Ga0496101_0004442 | 3300048904 | Bacteria | 8831 |
| 1436 | Ga0496101_0020483 | 3300048904 | Bacteria | 4529 |
| 1437 | Ga0496101_0039949 | 3300048904 | Bacteria | 3340 |
| 1438 | Ga0496101_0079530 | 3300048904 | Bacteria | 2420 |
| 1439 | Ga0496101_0115586 | 3300048904 | Bacteria | 2024 |
| 1440 | Ga0496101_0149503 | 3300048904 | Bacteria | 1786 |
| 1441 | Ga0496101_0205686 | 3300048904 | Bacteria | 1523 |
| 1442 | Ga0496101_0232727 | 3300048904 | Bacteria | 1432 |
| 1443 | Ga0496101_0310674 | 3300048904 | Bacteria | 1236 |
| 1444 | Ga0496101_0377370 | 3300048904 | Unclassified | 1115 |
| 1445 | Ga0496101_0414337 | 3300048904 | Bacteria | 1062 |
| 1446 | Ga0496101_0556653 | 3300048904 | Bacteria | 907 |
| 1447 | Ga0496101_0676721 | 3300048904 | Bacteria | 815 |
| 1448 | Ga0496101_0706806 | 3300048904 | Bacteria | 796 |
| 1449 | Ga0496101_0955941 | 3300048904 | Bacteria | 674 |
| 1450 | Ga0496102_0016856 | 3300048905 | Bacteria | 6391 |
| 1451 | Ga0496102_0019934 | 3300048905 | Bacteria | 5915 |
| 1452 | Ga0496102_0020365 | 3300048905 | Bacteria | 5862 |
| 1453 | Ga0496102_0080933 | 3300048905 | Bacteria | 2993 |
| 1454 | Ga0496102_0241648 | 3300048905 | Bacteria | 1702 |
| 1455 | Ga0496102_0317047 | 3300048905 | Bacteria | 1469 |
| 1456 | Ga0496102_0564012 | 3300048905 | Bacteria | 1061 |
| 1457 | Ga0496102_0700859 | 3300048905 | Bacteria | 935 |
| 1458 | Ga0496103_0004711 | 3300048906 | Bacteria | 8249 |
| 1459 | Ga0496103_0097106 | 3300048906 | Bacteria | 1862 |
| 1460 | Ga0496103_0162048 | 3300048906 | Bacteria | 1435 |
| 1461 | Ga0496103_0257291 | 3300048906 | Unclassified | 1123 |
| 1462 | Ga0496103_0526547 | 3300048906 | Bacteria | 755 |
| 1463 | Ga0496103_0596968 | 3300048906 | Bacteria | 703 |
| 1464 | Ga0496104_0011798 | 3300048907 | Bacteria | 7842 |
| 1465 | Ga0496104_0061869 | 3300048907 | Bacteria | 3549 |
| 1466 | Ga0496104_0095674 | 3300048907 | Bacteria | 2841 |
| 1467 | Ga0496104_0104033 | 3300048907 | Bacteria | 2720 |
| 1468 | Ga0496104_0111172 | 3300048907 | Bacteria | 2627 |
| 1469 | Ga0496104_0221746 | 3300048907 | Bacteria | 1803 |
| 1470 | Ga0496104_0305767 | 3300048907 | Bacteria | 1502 |
| 1471 | Ga0496104_0462893 | 3300048907 | Bacteria | 1179 |
| 1472 | Ga0496104_0744328 | 3300048907 | Bacteria | 887 |
| 1473 | Ga0496105_0005357 | 3300048908 | Bacteria | 9725 |
| 1474 | Ga0496105_0009962 | 3300048908 | Bacteria | 7455 |
| 1475 | Ga0496105_0032243 | 3300048908 | Bacteria | 4298 |
| 1476 | Ga0496105_0041324 | 3300048908 | Bacteria | 3800 |
| 1477 | Ga0496105_0130588 | 3300048908 | Bacteria | 2071 |
| 1478 | Ga0496105_0264614 | 3300048908 | Unclassified | 1390 |
| 1479 | Ga0496105_0305435 | 3300048908 | Bacteria | 1278 |
| 1480 | Ga0496105_0632888 | 3300048908 | Bacteria | 827 |
| 1481 | Ga0496106_0013199 | 3300048909 | Bacteria | 6096 |
| 1482 | Ga0496106_0022795 | 3300048909 | Bacteria | 4651 |
| 1483 | Ga0496106_0090402 | 3300048909 | Bacteria | 2362 |
| 1484 | Ga0496106_0096091 | 3300048909 | Bacteria | 2292 |
| 1485 | Ga0496106_0318223 | 3300048909 | Bacteria | 1249 |
| 1486 | Ga0496106_0487485 | 3300048909 | Unclassified | 990 |
| 1487 | Ga0496107_0002760 | 3300048910 | Bacteria | 11559 |
| 1488 | Ga0496107_0003413 | 3300048910 | Bacteria | 10624 |
| 1489 | Ga0496107_0006653 | 3300048910 | Bacteria | 7957 |
| 1490 | Ga0496107_0021951 | 3300048910 | Bacteria | 4509 |
| 1491 | Ga0496107_0202341 | 3300048910 | Bacteria | 1476 |
| 1492 | Ga0496107_0245014 | 3300048910 | Bacteria | 1334 |
| 1493 | Ga0496107_0501895 | 3300048910 | Bacteria | 900 |
| 1494 | Ga0496108_0004928 | 3300048911 | Bacteria | 10784 |
| 1495 | Ga0496108_0015890 | 3300048911 | Bacteria | 6136 |
| 1496 | Ga0496108_0026132 | 3300048911 | Bacteria | 4815 |
| 1497 | Ga0496108_0133142 | 3300048911 | Bacteria | 2137 |
| 1498 | Ga0496108_0133478 | 3300048911 | Bacteria | 2134 |
| 1499 | Ga0496108_0143137 | 3300048911 | Unclassified | 2060 |
| 1500 | Ga0496108_0915414 | 3300048911 | Bacteria | 752 |
| 1501 | Ga0496108_0988769 | 3300048911 | Bacteria | 719 |
| 1502 | Ga0496108_1470983 | 3300048911 | Bacteria | 568 |
| 1503 | Ga0496109_0001903 | 3300048912 | Bacteria | 17330 |
| 1504 | Ga0496109_0005677 | 3300048912 | Bacteria | 10442 |
| 1505 | Ga0496109_0016587 | 3300048912 | Bacteria | 6441 |
| 1506 | Ga0496109_0017746 | 3300048912 | Bacteria | 6243 |
| 1507 | Ga0496109_0019250 | 3300048912 | Bacteria | 6015 |
| 1508 | Ga0496109_0021098 | 3300048912 | Bacteria | 5760 |
| 1509 | Ga0496109_0052346 | 3300048912 | Bacteria | 3721 |
| 1510 | Ga0496109_0170719 | 3300048912 | Bacteria | 2040 |
| 1511 | Ga0496109_0282753 | 3300048912 | Bacteria | 1563 |
| 1512 | Ga0496109_0434746 | 3300048912 | Bacteria | 1240 |
| 1513 | Ga0496109_0814742 | 3300048912 | Bacteria | 871 |
| 1514 | Ga0496110_0013638 | 3300048913 | Bacteria | 6728 |
| 1515 | Ga0496110_0016283 | 3300048913 | Bacteria | 6206 |
| 1516 | Ga0496110_0163841 | 3300048913 | Bacteria | 2016 |
| 1517 | Ga0496110_0264251 | 3300048913 | Bacteria | 1566 |
| 1518 | Ga0496110_0341057 | 3300048913 | Bacteria | 1365 |
| 1519 | Ga0496110_1133343 | 3300048913 | Bacteria | 691 |
| 1520 | Ga0496111_0034480 | 3300048914 | Bacteria | 3614 |
| 1521 | Ga0496111_0095359 | 3300048914 | Bacteria | 2183 |
| 1522 | Ga0496111_0166138 | 3300048914 | Bacteria | 1639 |
| 1523 | Ga0496111_0234273 | 3300048914 | Bacteria | 1364 |
| 1524 | Ga0496111_0365669 | 3300048914 | Bacteria | 1067 |
| 1525 | Ga0496111_0457767 | 3300048914 | Unclassified | 941 |
| 1526 | Ga0496111_0546543 | 3300048914 | Bacteria | 850 |
| 1527 | Ga0496111_0706616 | 3300048914 | Bacteria | 733 |
| 1528 | Ga0496111_0766551 | 3300048914 | Unclassified | 699 |
| 1529 | Ga0496112_0011988 | 3300048915 | Bacteria | 7948 |
| 1530 | Ga0496112_0019697 | 3300048915 | Bacteria | 6376 |
| 1531 | Ga0496112_0052475 | 3300048915 | Bacteria | 4002 |
| 1532 | Ga0496112_0052956 | 3300048915 | Bacteria | 3985 |
| 1533 | Ga0496112_0074134 | 3300048915 | Bacteria | 3365 |
| 1534 | Ga0496112_0077202 | 3300048915 | Bacteria | 3294 |
| 1535 | Ga0496112_0232347 | 3300048915 | Bacteria | 1798 |
| 1536 | Ga0496112_0422558 | 3300048915 | Bacteria | 1272 |
| 1537 | Ga0496112_0598062 | 3300048915 | Unclassified | 1035 |
| 1538 | Ga0496112_0828815 | 3300048915 | Unclassified | 849 |
| 1539 | Ga0496112_1115158 | 3300048915 | Bacteria | 707 |
| 1540 | Ga0496112_1223483 | 3300048915 | Unclassified | 668 |
| 1541 | Ga0496112_1426237 | 3300048915 | Bacteria | 607 |
| 1542 | Ga0496112_1432186 | 3300048915 | Bacteria | 605 |
| 1543 | Ga0496112_1483996 | 3300048915 | Bacteria | 592 |
| 1544 | Ga0496113_0045822 | 3300048916 | Bacteria | 3245 |
| 1545 | Ga0496113_0052705 | 3300048916 | Bacteria | 3040 |
| 1546 | Ga0496113_0059767 | 3300048916 | Bacteria | 2872 |
| 1547 | Ga0496113_0098779 | 3300048916 | Bacteria | 2260 |
| 1548 | Ga0496113_0147290 | 3300048916 | Bacteria | 1855 |
| 1549 | Ga0496113_0160344 | 3300048916 | Bacteria | 1778 |
| 1550 | Ga0496113_0169672 | 3300048916 | Bacteria | 1728 |
| 1551 | Ga0496113_0624364 | 3300048916 | Unclassified | 862 |
| 1552 | Ga0496113_0746651 | 3300048916 | Bacteria | 779 |
| 1553 | Ga0496113_1486267 | 3300048916 | Bacteria | 523 |
| 1554 | Ga0496114_0000834 | 3300048917 | Bacteria | 23084 |
| 1555 | Ga0496114_0004372 | 3300048917 | Bacteria | 10945 |
| 1556 | Ga0496114_0007807 | 3300048917 | Bacteria | 8464 |
| 1557 | Ga0496114_0013651 | 3300048917 | Bacteria | 6512 |
| 1558 | Ga0496114_0014325 | 3300048917 | Bacteria | 6362 |
| 1559 | Ga0496114_0066430 | 3300048917 | Bacteria | 3023 |
| 1560 | Ga0496114_0136620 | 3300048917 | Bacteria | 2120 |
| 1561 | Ga0496114_0138969 | 3300048917 | Bacteria | 2102 |
| 1562 | Ga0496114_0180801 | 3300048917 | Bacteria | 1842 |
| 1563 | Ga0496114_0200608 | 3300048917 | Bacteria | 1747 |
| 1564 | Ga0496114_0266443 | 3300048917 | Bacteria | 1509 |
| 1565 | Ga0496114_0467514 | 3300048917 | Unclassified | 1116 |
| 1566 | Ga0496114_0743938 | 3300048917 | Unclassified | 857 |
| 1567 | Ga0496115_0005284 | 3300048918 | Bacteria | 9390 |
| 1568 | Ga0496115_0008529 | 3300048918 | Bacteria | 7583 |
| 1569 | Ga0496115_0014758 | 3300048918 | Bacteria | 5921 |
| 1570 | Ga0496115_0035679 | 3300048918 | Bacteria | 3935 |
| 1571 | Ga0496115_0047746 | 3300048918 | Bacteria | 3423 |
| 1572 | Ga0496115_0060555 | 3300048918 | Bacteria | 3051 |
| 1573 | Ga0496115_0262416 | 3300048918 | Bacteria | 1420 |
| 1574 | Ga0496115_0765807 | 3300048918 | Bacteria | 754 |
| 1575 | Ga0496117_0001293 | 3300048920 | Bacteria | 36867 |
| 1576 | Ga0496118_0003780 | 3300048921 | Bacteria | 18696 |
| 1577 | Ga0501031_0034996 | 3300049568 | Bacteria | 3276 |
| 1578 | Ga0501031_0318517 | 3300049568 | Bacteria | 1008 |
| 1579 | Ga0501032_0033341 | 3300049569 | Bacteria | 3529 |
| 1580 | Ga0501032_0103230 | 3300049569 | Bacteria | 1889 |
| 1581 | Ga0501032_0956928 | 3300049569 | Bacteria | 538 |
| 1582 | Ga0501033_0025461 | 3300049570 | Bacteria | 4458 |
| 1583 | Ga0501033_0188642 | 3300049570 | Bacteria | 1476 |
| 1584 | Ga0501034_0003733 | 3300049571 | Bacteria | 17206 |
| 1585 | Ga0501036_0004381 | 3300049572 | Bacteria | 11396 |
| 1586 | Ga0501036_0011277 | 3300049572 | Bacteria | 7395 |
| 1587 | Ga0501036_0932620 | 3300049572 | Bacteria | 712 |
| 1588 | Ga0501037_0027875 | 3300049573 | Bacteria | 4174 |
| 1589 | Ga0501037_0058673 | 3300049573 | Bacteria | 2808 |
| 1590 | Ga0501038_0110790 | 3300049574 | Bacteria | 2274 |
| 1591 | Ga0501039_0001728 | 3300049575 | Bacteria | 16100 |
| 1592 | Ga0501039_0014517 | 3300049575 | Bacteria | 6031 |
| 1593 | Ga0501039_0085454 | 3300049575 | Bacteria | 2458 |
| 1594 | Ga0501040_0007072 | 3300049576 | Bacteria | 7275 |
| 1595 | Ga0501040_0027145 | 3300049576 | Bacteria | 3853 |
| 1596 | Ga0501041_0001743 | 3300049577 | Bacteria | 12193 |
| 1597 | Ga0501041_0009330 | 3300049577 | Bacteria | 5778 |
| 1598 | Ga0501041_0409712 | 3300049577 | Unclassified | 859 |
| 1599 | Ga0501042_0007798 | 3300049578 | Bacteria | 7034 |
| 1600 | Ga0501042_0012528 | 3300049578 | Bacteria | 5747 |
| 1601 | Ga0501042_0210425 | 3300049578 | Unclassified | 1403 |
| 1602 | Ga0501043_0037215 | 3300049579 | Bacteria | 3828 |
| 1603 | Ga0501043_0075925 | 3300049579 | Bacteria | 2640 |
| 1604 | Ga0501043_0221474 | 3300049579 | Bacteria | 1464 |
| 1605 | Ga0501046_0003055 | 3300049580 | Bacteria | 15459 |
| 1606 | Ga0501046_0030403 | 3300049580 | Bacteria | 4383 |
| 1607 | Ga0501046_0369712 | 3300049580 | Unclassified | 1039 |
| 1608 | Ga0501046_0658096 | 3300049580 | Bacteria | 740 |
| 1609 | Ga0501047_0338500 | 3300049581 | Bacteria | 1342 |
| 1610 | Ga0501047_0384789 | 3300049581 | Bacteria | 1237 |
| 1611 | Ga0501047_0439677 | 3300049581 | Bacteria | 1134 |
| 1612 | Ga0501048_0003260 | 3300049582 | Bacteria | 12363 |
| 1613 | Ga0501048_0011917 | 3300049582 | Bacteria | 6483 |
| 1614 | Ga0501067_0149925 | 3300049583 | Bacteria | 1299 |
| 1615 | Ga0501067_0225539 | 3300049583 | Unclassified | 1043 |
| 1616 | Ga0501068_0057949 | 3300049584 | Bacteria | 2349 |
| 1617 | Ga0501068_0456394 | 3300049584 | Bacteria | 827 |
| 1618 | Ga0501068_0919701 | 3300049584 | Bacteria | 576 |
| 1619 | Ga0501068_1215203 | 3300049584 | Bacteria | 500 |
| 1620 | Ga0501069_0081347 | 3300049585 | Unclassified | 1824 |
| 1621 | Ga0501069_0105249 | 3300049585 | Bacteria | 1603 |
| 1622 | Ga0501069_0120595 | 3300049585 | Bacteria | 1498 |
| 1623 | Ga0501069_0134660 | 3300049585 | Bacteria | 1416 |
| 1624 | Ga0501069_0158177 | 3300049585 | Unclassified | 1304 |
| 1625 | Ga0501070_0002828 | 3300049586 | Bacteria | 15144 |
| 1626 | Ga0501070_0005455 | 3300049586 | Bacteria | 10855 |
| 1627 | Ga0501070_0029111 | 3300049586 | Bacteria | 4632 |
| 1628 | Ga0501070_0126275 | 3300049586 | Bacteria | 2114 |
| 1629 | Ga0501070_0200069 | 3300049586 | Bacteria | 1641 |
| 1630 | Ga0501070_0305449 | 3300049586 | Bacteria | 1295 |
| 1631 | Ga0501070_0434904 | 3300049586 | Bacteria | 1059 |
| 1632 | Ga0501070_0480370 | 3300049586 | Unclassified | 999 |
| 1633 | Ga0501071_0000277 | 3300049587 | Bacteria | 24366 |
| 1634 | Ga0501071_0008207 | 3300049587 | Bacteria | 6891 |
| 1635 | Ga0501071_0414863 | 3300049587 | Bacteria | 1029 |
| 1636 | Ga0501071_0789870 | 3300049587 | Unclassified | 732 |
| 1637 | Ga0501072_0004354 | 3300049588 | Bacteria | 10748 |
| 1638 | Ga0501072_0047916 | 3300049588 | Bacteria | 3365 |
| 1639 | Ga0501073_0018647 | 3300049589 | Bacteria | 5015 |
| 1640 | Ga0501073_0095788 | 3300049589 | Bacteria | 2061 |
| 1641 | Ga0501073_0498176 | 3300049589 | Bacteria | 842 |
| 1642 | Ga0501074_0020011 | 3300049590 | Bacteria | 4864 |
| 1643 | Ga0501074_0029384 | 3300049590 | Bacteria | 3981 |
| 1644 | Ga0501074_0058358 | 3300049590 | Bacteria | 2780 |
| 1645 | Ga0501074_0121443 | 3300049590 | Unclassified | 1868 |
| 1646 | Ga0501074_0138849 | 3300049590 | Bacteria | 1739 |
| 1647 | Ga0501074_0185230 | 3300049590 | Unclassified | 1485 |
| 1648 | Ga0501074_0814681 | 3300049590 | Unclassified | 658 |
| 1649 | Ga0501074_0920129 | 3300049590 | Bacteria | 615 |
| 1650 | Ga0501075_0001091 | 3300049591 | Bacteria | 17469 |
| 1651 | Ga0501075_0024275 | 3300049591 | Bacteria | 4443 |
| 1652 | Ga0501075_1366925 | 3300049591 | Bacteria | 536 |
| 1653 | Ga0501076_0000783 | 3300049592 | Bacteria | 20500 |
| 1654 | Ga0501076_0003280 | 3300049592 | Bacteria | 11336 |
| 1655 | Ga0501076_0298773 | 3300049592 | Bacteria | 1320 |
| 1656 | Ga0501077_0012704 | 3300049593 | Bacteria | 5273 |
| 1657 | Ga0501077_0014064 | 3300049593 | Bacteria | 5020 |
| 1658 | Ga0501260_055002 | 3300049689 | Bacteria | 509 |
| 1659 | Ga0501079_0001798 | 3300049741 | Bacteria | 15315 |
| 1660 | Ga0501079_0042906 | 3300049741 | Bacteria | 3491 |
| 1661 | Ga0501079_0118471 | 3300049741 | Bacteria | 2058 |
| 1662 | Ga0501079_0237828 | 3300049741 | Bacteria | 1423 |
| 1663 | Ga0501079_0626703 | 3300049741 | Bacteria | 847 |
| 1664 | Ga0501080_0013910 | 3300049742 | Bacteria | 7407 |
| 1665 | Ga0501080_0014815 | 3300049742 | Bacteria | 7181 |
| 1666 | Ga0501080_0044173 | 3300049742 | Bacteria | 4148 |
| 1667 | Ga0501080_0105808 | 3300049742 | Bacteria | 2608 |
| 1668 | Ga0501080_0142451 | 3300049742 | Bacteria | 2216 |
| 1669 | Ga0501080_0417116 | 3300049742 | Bacteria | 1206 |
| 1670 | Ga0501080_0758669 | 3300049742 | Bacteria | 853 |
| 1671 | Ga0501080_1744598 | 3300049742 | Bacteria | 524 |
| 1672 | Ga0501081_0006597 | 3300049743 | Bacteria | 7542 |
| 1673 | Ga0501081_0012176 | 3300049743 | Bacteria | 5642 |
| 1674 | Ga0501083_0009961 | 3300049744 | Bacteria | 6708 |
| 1675 | Ga0501083_0050531 | 3300049744 | Bacteria | 2798 |
| 1676 | Ga0501083_0635229 | 3300049744 | Unclassified | 694 |
| 1677 | Ga0501035_0019610 | 3300049822 | Bacteria | 6214 |
| 1678 | Ga0501035_0074026 | 3300049822 | Bacteria | 3014 |
| 1679 | Ga0501035_0242691 | 3300049822 | Bacteria | 1532 |
| 1680 | Ga0501035_0282411 | 3300049822 | Bacteria | 1403 |
| 1681 | Ga0501044_0082727 | 3300049823 | Bacteria | 3247 |
| 1682 | Ga0501044_0438339 | 3300049823 | Bacteria | 1215 |
| 1683 | Ga0501044_0919072 | 3300049823 | Bacteria | 749 |
| 1684 | Ga0501045_0004806 | 3300049824 | Bacteria | 9333 |
| 1685 | Ga0501045_0007353 | 3300049824 | Bacteria | 7657 |
| 1686 | nmdc:mga03683_207527_c1 | 3300050489 | Bacteria | 900 |
| 1687 | nmdc:mga03683_7319_c1 | 3300050489 | Bacteria | 3826 |
| 1688 | nmdc:mga00v17_14314_c1 | 3300050491 | Bacteria | 4424 |
| 1689 | nmdc:mga00v17_256446_c1 | 3300050491 | Bacteria | 1134 |
| 1690 | nmdc:mga0yw44_136119_c1 | 3300050492 | Bacteria | 1594 |
| 1691 | nmdc:mga0yw44_26552_c1 | 3300050492 | Bacteria | 3309 |
| 1692 | nmdc:mga0yw44_289946_c1 | 3300050492 | Bacteria | 1095 |
| 1693 | nmdc:mga0k408_192614_c1 | 3300050493 | Bacteria | 1216 |
| 1694 | nmdc:mga05p37_22675_c1 | 3300050507 | Bacteria | 7615 |
| 1695 | nmdc:mga05p37_370366_c2 | 3300050507 | Bacteria | 1328 |
| 1696 | nmdc:mga09592_5528_c1 | 3300050508 | Bacteria | 10285 |
| 1697 | nmdc:mga0qj67_7976_c1 | 3300050509 | Bacteria | 7829 |
| 1698 | nmdc:mga06r32_11474_c1 | 3300050510 | Bacteria | 7981 |
| 1699 | nmdc:mga06r32_871532_c1 | 3300050510 | Bacteria | 858 |
| 1700 | nmdc:mga08y16_13386_c1 | 3300050511 | Bacteria | 8630 |
| 1701 | nmdc:mga08y16_168120_c1 | 3300050511 | Bacteria | 2278 |
| 1702 | nmdc:mga08y16_442593_c1 | 3300050511 | Bacteria | 1326 |
| 1703 | nmdc:mga0n895_170673_c1 | 3300050512 | Bacteria | 2207 |
| 1704 | nmdc:mga0n895_63942_c1 | 3300050512 | Bacteria | 3639 |
| 1705 | nmdc:mga0rr50_255123_c1 | 3300050513 | Bacteria | 1457 |
| 1706 | nmdc:mga0rr50_73328_c1 | 3300050513 | Bacteria | 2617 |
| 1707 | nmdc:mga0rr50_816097_c1 | 3300050513 | Bacteria | 796 |
| 1708 | nmdc:mga08x19_752179_c1 | 3300050514 | Bacteria | 692 |
| 1709 | nmdc:mga0a205_124281_c1 | 3300050515 | Bacteria | 2169 |
| 1710 | nmdc:mga0a205_267637_c1 | 3300050515 | Bacteria | 1586 |
| 1711 | Ga0495601_0014551 | 3300053077 | Bacteria | 4741 |
| 1712 | Ga0495601_0015827 | 3300053077 | Bacteria | 4565 |
| 1713 | Ga0495601_0068997 | 3300053077 | Bacteria | 2254 |
| 1714 | Ga0495601_0092630 | 3300053077 | Bacteria | 1946 |
| 1715 | Ga0495601_0199809 | 3300053077 | Bacteria | 1306 |
| 1716 | Ga0495601_0217627 | 3300053077 | Bacteria | 1247 |
| 1717 | Ga0495601_0288321 | 3300053077 | Bacteria | 1070 |
| 1718 | Ga0495601_0304523 | 3300053077 | Unclassified | 1038 |
| 1719 | Ga0495601_0373152 | 3300053077 | Unclassified | 926 |
| 1720 | Ga0495601_0396892 | 3300053077 | Bacteria | 894 |
| 1721 | Ga0495601_0617923 | 3300053077 | Unclassified | 695 |
| 1722 | Ga0495612_0092361 | 3300053078 | Unclassified | 1283 |
| 1723 | Ga0495655_0001362 | 3300053083 | Bacteria | 3757 |
| 1724 | Ga0495595_0001437 | 3300053084 | Bacteria | 9279 |
| 1725 | Ga0495595_0099352 | 3300053084 | Bacteria | 1403 |
| 1726 | Ga0495595_0099621 | 3300053084 | Bacteria | 1401 |
| 1727 | Ga0495595_0100965 | 3300053084 | Unclassified | 1392 |
| 1728 | Ga0495619_0006989 | 3300053085 | Bacteria | 7143 |
| 1729 | Ga0495619_0009752 | 3300053085 | Bacteria | 6052 |
| 1730 | Ga0495619_0015204 | 3300053085 | Bacteria | 4865 |
| 1731 | Ga0495619_0068533 | 3300053085 | Bacteria | 2370 |
| 1732 | Ga0495619_0092706 | 3300053085 | Bacteria | 2046 |
| 1733 | Ga0495619_0100424 | 3300053085 | Archaea | 1969 |
| 1734 | Ga0495619_0107768 | 3300053085 | Unclassified | 1901 |
| 1735 | Ga0495619_0131328 | 3300053085 | Unclassified | 1721 |
| 1736 | Ga0495619_0137619 | 3300053085 | Bacteria | 1680 |
| 1737 | Ga0495619_0245552 | 3300053085 | Bacteria | 1241 |
| 1738 | Ga0495619_0816926 | 3300053085 | Bacteria | 630 |
| 1739 | Ga0501084_0002882 | 3300054114 | Bacteria | 13909 |
| 1740 | Ga0501084_0007645 | 3300054114 | Bacteria | 8911 |
| 1741 | Ga0501084_0163645 | 3300054114 | Unclassified | 1877 |
| 1742 | Ga0501084_0408257 | 3300054114 | Bacteria | 1148 |
| 1743 | Ga0590075_114676 | 3300059424 | Bacteria | 704 |
| 1744 | Ga0590077_031419 | 3300059426 | Unclassified | 1160 |
| 1745 | Ga0587077_096519 | 3300059493 | Bacteria | 703 |
| 1746 | Ga0587115_117978 | 3300059626 | Bacteria | 508 |
| 1747 | Ga0501082_0012944 | 3300060353 | Bacteria | 7171 |
| 1748 | Ga0501082_0015327 | 3300060353 | Bacteria | 6596 |
| 1749 | Ga0501082_0471954 | 3300060353 | Unclassified | 1096 |
| 1750 | Ga0466962_0000131 | 3300061719 | Bacteria | 30686 |
| 1751 | Ga0466962_0020213 | 3300061719 | Bacteria | 3201 |
| 1752 | Ga0466962_0079384 | 3300061719 | Unclassified | 1569 |
| 1753 | Ga0466962_0081277 | 3300061719 | Unclassified | 1550 |
| 1754 | Ga0466962_0096637 | 3300061719 | Bacteria | 1416 |
| 1755 | Ga0466962_0100456 | 3300061719 | Bacteria | 1389 |
| 1756 | Ga0466962_0172679 | 3300061719 | Bacteria | 1053 |
| 1757 | Ga0466962_0448842 | 3300061719 | Bacteria | 649 |
| 1758 | Ga0530510_0007435 | 3300061734 | Bacteria | 7626 |
| 1759 | Ga0530510_0014267 | 3300061734 | Bacteria | 5602 |
| 1760 | Ga0530510_0119285 | 3300061734 | Unclassified | 1936 |
| 1761 | Ga0530510_0196228 | 3300061734 | Bacteria | 1499 |
| 1762 | Ga0265319_1013800 | |||
| 1763 | JGI24744J21845_10000960 | |||
| 1764 | JGI25407J50210_10001824 | |||
| 1765 | JGI25405J52794_10055301 | |||
| 1766 | Ga0070658_10024594 | |||
| 1767 | Ga0070658_10098314 | |||
| 1768 | Ga0070658_10132667 | |||
| 1769 | Ga0070658_10288314 | |||
| 1770 | Ga0070658_10540868 | |||
| 1771 | Ga0070658_10868323 | |||
| 1772 | Ga0070658_11094837 | |||
| 1773 | Ga0070658_11248204 | |||
| 1774 | Ga0070658_11400022 | |||
| 1775 | Ga0070683_100001652 | |||
| 1776 | Ga0070683_100017233 | |||
| 1777 | Ga0070683_100060391 | |||
| 1778 | Ga0070683_100164114 | |||
| 1779 | Ga0070683_100186421 | |||
| 1780 | Ga0070683_100238216 | |||
| 1781 | Ga0070683_100296896 | |||
| 1782 | Ga0070683_100701841 | |||
| 1783 | Ga0070683_101947625 | |||
| 1784 | Ga0070683_102002313 | |||
| 1785 | Ga0070690_100019255 | |||
| 1786 | Ga0070690_101352298 | |||
| 1787 | Ga0070666_11212485 | |||
| 1788 | Ga0070680_100008118 | |||
| 1789 | Ga0070680_100153672 | |||
| 1790 | Ga0070680_100154767 | |||
| 1791 | Ga0070680_100951145 | |||
| 1792 | Ga0070680_101216723 | |||
| 1793 | Ga0070682_100014196 | |||
| 1794 | Ga0070682_100155954 | |||
| 1795 | Ga0070682_100529155 | |||
| 1796 | Ga0070682_100722819 | |||
| 1797 | Ga0070682_100778455 | |||
| 1798 | Ga0068868_100010092 | |||
| 1799 | Ga0068868_100027493 | |||
| 1800 | Ga0068868_100358715 | |||
| 1801 | Ga0070660_100006026 | |||
| 1802 | Ga0070660_100016383 | |||
| 1803 | Ga0070660_100035757 | |||
| 1804 | Ga0070660_100044741 | |||
| 1805 | Ga0070660_100055265 | |||
| 1806 | Ga0070660_100330381 | |||
| 1807 | Ga0070660_100533962 | |||
| 1808 | Ga0070689_100006812 | |||
| 1809 | Ga0070691_10213769 | |||
| 1810 | Ga0070687_100282156 | |||
| 1811 | Ga0070687_100892703 | |||
| 1812 | Ga0070661_100062932 | |||
| 1813 | Ga0070661_100217140 | |||
| 1814 | Ga0070661_101046311 | |||
| 1815 | Ga0070692_10007346 | |||
| 1816 | Ga0070692_10674027 | |||
| 1817 | Ga0070668_100026182 | |||
| 1818 | Ga0070668_100563009 | |||
| 1819 | Ga0070669_101553195 | |||
| 1820 | Ga0070669_101762271 | |||
| 1821 | Ga0070675_100037741 | |||
| 1822 | Ga0070675_101476484 | |||
| 1823 | Ga0070671_100015983 | |||
| 1824 | Ga0070671_100088093 | |||
| 1825 | Ga0070674_100007583 | |||
| 1826 | Ga0070674_100470683 | |||
| 1827 | Ga0070673_100148872 | |||
| 1828 | Ga0070673_100205245 | |||
| 1829 | Ga0070688_100524924 | |||
| 1830 | Ga0070659_100033126 | |||
| 1831 | Ga0070659_100038472 | |||
| 1832 | Ga0070659_100374884 | |||
| 1833 | Ga0070659_100444071 | |||
| 1834 | Ga0070667_100179863 | |||
| 1835 | Ga0070667_100894857 | |||
| 1836 | Ga0070667_101122528 | |||
| 1837 | Ga0070703_10139602 | |||
| 1838 | Ga0070709_10011026 | |||
| 1839 | Ga0070709_10026548 | |||
| 1840 | Ga0070709_10348405 | |||
| 1841 | Ga0070709_10503170 | |||
| 1842 | Ga0070709_10972906 | |||
| 1843 | Ga0070709_11124988 | |||
| 1844 | Ga0070714_100028276 | |||
| 1845 | Ga0070714_100032738 | |||
| 1846 | Ga0070714_100178964 | |||
| 1847 | Ga0070714_100266861 | |||
| 1848 | Ga0070714_100388779 | |||
| 1849 | Ga0070714_100657281 | |||
| 1850 | Ga0070714_100911235 | |||
| 1851 | Ga0070714_101135771 | |||
| 1852 | Ga0070714_101865845 | |||
| 1853 | Ga0070714_102220530 | |||
| 1854 | Ga0070713_100013778 | |||
| 1855 | Ga0070713_100037697 | |||
| 1856 | Ga0070713_100115959 | |||
| 1857 | Ga0070713_100213048 | |||
| 1858 | Ga0070713_100495133 | |||
| 1859 | Ga0070713_100595507 | |||
| 1860 | Ga0070713_100954908 | |||
| 1861 | Ga0070710_10008474 | |||
| 1862 | Ga0070710_10054659 | |||
| 1863 | Ga0070710_10201695 | |||
| 1864 | Ga0070710_10430744 | |||
| 1865 | Ga0070710_10588400 | |||
| 1866 | Ga0070710_10759654 | |||
| 1867 | Ga0070701_10033849 | |||
| 1868 | Ga0070711_100001520 | |||
| 1869 | Ga0070711_100023649 | |||
| 1870 | Ga0070711_100093336 | |||
| 1871 | Ga0070711_100173984 | |||
| 1872 | Ga0070711_100355951 | |||
| 1873 | Ga0070711_100582484 | |||
| 1874 | Ga0070711_101523951 | |||
| 1875 | Ga0070705_100050250 | |||
| 1876 | Ga0070705_100307046 | |||
| 1877 | Ga0070705_100401145 | |||
| 1878 | Ga0070705_100441714 | |||
| 1879 | Ga0070700_100001889 | |||
| 1880 | Ga0070700_100455269 | |||
| 1881 | Ga0070694_100020934 | |||
| 1882 | Ga0070694_100113732 | |||
| 1883 | Ga0070708_100023451 | |||
| 1884 | Ga0070708_101330169 | |||
| 1885 | Ga0070663_100003865 | |||
| 1886 | Ga0070663_100558516 | |||
| 1887 | Ga0070678_100009983 | |||
| 1888 | Ga0070678_100530684 | |||
| 1889 | Ga0070678_100566677 | |||
| 1890 | Ga0070678_100741977 | |||
| 1891 | Ga0070678_102199550 | |||
| 1892 | Ga0070662_100622182 | |||
| 1893 | Ga0070662_101283885 | |||
| 1894 | Ga0070681_10021240 | |||
| 1895 | Ga0070681_10022909 | |||
| 1896 | Ga0070681_10031175 | |||
| 1897 | Ga0070681_10047668 | |||
| 1898 | Ga0070681_10050995 | |||
| 1899 | Ga0070681_10099226 | |||
| 1900 | Ga0070681_10183871 | |||
| 1901 | Ga0070681_10215955 | |||
| 1902 | Ga0070681_10281512 | |||
| 1903 | Ga0070681_10310396 | |||
| 1904 | Ga0070681_10949764 | |||
| 1905 | Ga0068867_100002920 | |||
| 1906 | Ga0068867_100515956 | |||
| 1907 | Ga0070706_100206032 | |||
| 1908 | Ga0070706_100482002 | |||
| 1909 | Ga0070707_100002419 | |||
| 1910 | Ga0070707_100067070 | |||
| 1911 | Ga0070707_100127311 | |||
| 1912 | Ga0070707_100329462 | |||
| 1913 | Ga0070707_101262787 | |||
| 1914 | Ga0070698_100016387 | |||
| 1915 | Ga0070698_100017977 | |||
| 1916 | Ga0070698_100197928 | |||
| 1917 | Ga0070698_102061150 | |||
| 1918 | Ga0070699_100053515 | |||
| 1919 | Ga0070699_100062020 | |||
| 1920 | Ga0070699_100383779 | |||
| 1921 | Ga0070699_100508273 | |||
| 1922 | Ga0070679_100002604 | |||
| 1923 | Ga0070679_100072801 | |||
| 1924 | Ga0070679_100074082 | |||
| 1925 | Ga0070679_100077707 | |||
| 1926 | Ga0070679_100138708 | |||
| 1927 | Ga0070679_100161901 | |||
| 1928 | Ga0070679_100166241 | |||
| 1929 | Ga0070679_100203356 | |||
| 1930 | Ga0070679_100315289 | |||
| 1931 | Ga0070679_100429186 | |||
| 1932 | Ga0070679_100798995 | |||
| 1933 | Ga0070679_101290883 | |||
| 1934 | Ga0070679_101337935 | |||
| 1935 | Ga0070679_101902483 | |||
| 1936 | Ga0070684_100022931 | |||
| 1937 | Ga0070684_100027893 | |||
| 1938 | Ga0070684_100100928 | |||
| 1939 | Ga0070684_100101097 | |||
| 1940 | Ga0070684_100119575 | |||
| 1941 | Ga0070684_100236949 | |||
| 1942 | Ga0070684_100322093 | |||
| 1943 | Ga0070697_100221110 | |||
| 1944 | Ga0070697_100232065 | |||
| 1945 | Ga0070697_101134415 | |||
| 1946 | Ga0068853_100044117 | |||
| 1947 | Ga0068853_100140662 | |||
| 1948 | Ga0068853_100712984 | |||
| 1949 | Ga0068853_101255591 | |||
| 1950 | Ga0068853_101267975 | |||
| 1951 | Ga0068853_101356012 | |||
| 1952 | Ga0070672_100014159 | |||
| 1953 | Ga0070686_100003711 | |||
| 1954 | Ga0070695_100000691 | |||
| 1955 | Ga0070695_100042188 | |||
| 1956 | Ga0070695_100141937 | |||
| 1957 | Ga0070695_100142749 | |||
| 1958 | Ga0070696_100020674 | |||
| 1959 | Ga0070696_100062600 | |||
| 1960 | Ga0070696_100213638 | |||
| 1961 | Ga0070696_101250719 | |||
| 1962 | Ga0070693_100124306 | |||
| 1963 | Ga0070665_100045306 | |||
| 1964 | Ga0070665_100310022 | |||
| 1965 | Ga0070665_100338765 | |||
| 1966 | Ga0070704_100009470 | |||
| 1967 | Ga0070704_100031449 | |||
| 1968 | Ga0070704_100081794 | |||
| 1969 | Ga0070704_101862636 | |||
| 1970 | Ga0068855_100005599 | |||
| 1971 | Ga0068855_100071082 | |||
| 1972 | Ga0068855_100076427 | |||
| 1973 | Ga0068855_100192962 | |||
| 1974 | Ga0068855_100200635 | |||
| 1975 | Ga0068855_100248330 | |||
| 1976 | Ga0068855_100254836 | |||
| 1977 | Ga0068855_100264783 | |||
| 1978 | Ga0068855_100387366 | |||
| 1979 | Ga0068855_100481544 | |||
| 1980 | Ga0068855_100606051 | |||
| 1981 | Ga0070664_100778101 | |||
| 1982 | Ga0070664_100934191 | |||
| 1983 | Ga0070664_101134218 | |||
| 1984 | Ga0068857_100007740 | |||
| 1985 | Ga0068857_100043448 | |||
| 1986 | Ga0068857_100131252 | |||
| 1987 | Ga0068857_100308824 | |||
| 1988 | Ga0068857_100507964 | |||
| 1989 | Ga0068854_100657788 | |||
| 1990 | Ga0068856_100014835 | |||
| 1991 | Ga0068856_100109583 | |||
| 1992 | Ga0068856_100217295 | |||
| 1993 | Ga0068856_100281439 | |||
| 1994 | Ga0068856_100389413 | |||
| 1995 | Ga0070702_100080089 | |||
| 1996 | Ga0070702_100107332 | |||
| 1997 | Ga0070702_100346172 | |||
| 1998 | Ga0068852_100057219 | |||
| 1999 | Ga0068852_100373780 | |||
| 2000 | Ga0068852_100655178 | |||
| 2001 | Ga0068859_100229612 | |||
| 2002 | Ga0068864_100275486 | |||
| 2003 | Ga0068866_10182170 | |||
| 2004 | Ga0068866_10430769 | |||
| 2005 | Ga0068861_100050711 | |||
| 2006 | Ga0068861_100136400 | |||
| 2007 | Ga0068851_10805172 | |||
| 2008 | Ga0068863_100297160 | |||
| 2009 | Ga0068863_101481101 | |||
| 2010 | Ga0068860_100067587 | |||
| 2011 | Ga0068860_101009480 | |||
| 2012 | Ga0068862_100954482 | |||
| 2013 | Ga0068862_101037874 | |||
| 2014 | Ga0081455_10003877 | |||
| 2015 | Ga0081455_10007079 | |||
| 2016 | Ga0081455_10025023 | |||
| 2017 | Ga0081455_10102019 | |||
| 2018 | Ga0081455_10124214 | |||
| 2019 | Ga0081455_10175429 | |||
| 2020 | Ga0081455_10649859 | |||
| 2021 | Ga0081538_10000012 | |||
| 2022 | Ga0081538_10000078 | |||
| 2023 | Ga0081538_10001260 | |||
| 2024 | Ga0081538_10002330 | |||
| 2025 | Ga0081538_10042481 | |||
| 2026 | Ga0081540_1000116 | |||
| 2027 | Ga0070717_10006695 | |||
| 2028 | Ga0070717_10009605 | |||
| 2029 | Ga0070717_10027420 | |||
| 2030 | Ga0070717_10049312 | |||
| 2031 | Ga0070717_10094914 | |||
| 2032 | Ga0070717_10345788 | |||
| 2033 | Ga0070717_10403668 | |||
| 2034 | Ga0070717_10590095 | |||
| 2035 | Ga0070717_10650705 | |||
| 2036 | Ga0070717_10712468 | |||
| 2037 | Ga0075365_10101165 | |||
| 2038 | Ga0075365_10195851 | |||
| 2039 | Ga0075363_100381614 | |||
| 2040 | Ga0075363_100818780 | |||
| 2041 | Ga0075364_10001371 | |||
| 2042 | Ga0075364_10841640 | |||
| 2043 | Ga0070715_10001548 | |||
| 2044 | Ga0070715_10009984 | |||
| 2045 | Ga0070716_100016873 | |||
| 2046 | Ga0070716_100040809 | |||
| 2047 | Ga0070716_100073522 | |||
| 2048 | Ga0070712_100029829 | |||
| 2049 | Ga0070712_100043886 | |||
| 2050 | Ga0070712_100059409 | |||
| 2051 | Ga0070712_100061449 | |||
| 2052 | Ga0070712_100375737 | |||
| 2053 | Ga0070712_100510274 | |||
| 2054 | Ga0070712_100561746 | |||
| 2055 | Ga0070712_100810849 | |||
| 2056 | Ga0070712_101184656 | |||
| 2057 | Ga0075362_10027773 | |||
| 2058 | Ga0075367_10415664 | |||
| 2059 | Ga0075366_10184632 | |||
| 2060 | Ga0097621_100490334 | |||
| 2061 | Ga0097621_100837618 | |||
| 2062 | Ga0097621_101468119 | |||
| 2063 | Ga0068871_100170604 | |||
| 2064 | Ga0068871_101767907 | |||
| 2065 | Ga0075428_100040344 | |||
| 2066 | Ga0075430_100006540 | |||
| 2067 | Ga0075430_100026469 | |||
| 2068 | Ga0075431_100013118 | |||
| 2069 | Ga0075431_100442740 | |||
| 2070 | Ga0075433_10017067 | |||
| 2071 | Ga0075433_10026810 | |||
| 2072 | Ga0075433_10121657 | |||
| 2073 | Ga0075433_10547873 | |||
| 2074 | Ga0075433_11106208 | |||
| 2075 | Ga0075434_100032514 | |||
| 2076 | Ga0075434_100063037 | |||
| 2077 | Ga0075434_100133540 | |||
| 2078 | Ga0075434_100216440 | |||
| 2079 | Ga0075434_100786585 | |||
| 2080 | Ga0075429_100009626 | |||
| 2081 | Ga0068865_100007182 | |||
| 2082 | Ga0068865_100290110 | |||
| 2083 | Ga0068865_100300021 | |||
| 2084 | Ga0068865_100420595 | |||
| 2085 | Ga0068865_100890978 | |||
| 2086 | Ga0075436_100021159 | |||
| 2087 | Ga0075436_100028623 | |||
| 2088 | Ga0097620_100229628 | |||
| 2089 | Ga0075435_100024010 | |||
| 2090 | Ga0075435_100061568 | |||
| 2091 | Ga0075435_100084943 | |||
| 2092 | Ga0075435_100142487 | |||
| 2093 | Ga0105251_10574308 | |||
| 2094 | Ga0105244_10088778 | |||
| 2095 | Ga0105240_10010904 | |||
| 2096 | Ga0105240_10016187 | |||
| 2097 | Ga0105240_10033728 | |||
| 2098 | Ga0105240_10160432 | |||
| 2099 | Ga0105240_10390751 | |||
| 2100 | Ga0105240_10452674 | |||
| 2101 | Ga0105240_10508609 | |||
| 2102 | Ga0105240_11581991 | |||
| 2103 | Ga0111539_10044312 | |||
| 2104 | Ga0111539_10191336 | |||
| 2105 | Ga0111539_10442030 | |||
| 2106 | Ga0111539_10518157 | |||
| 2107 | Ga0111539_10816133 | |||
| 2108 | Ga0111539_11243655 | |||
| 2109 | Ga0105245_10012468 | |||
| 2110 | Ga0105245_10070234 | |||
| 2111 | Ga0105245_10119963 | |||
| 2112 | Ga0105245_10188190 | |||
| 2113 | Ga0105245_10280652 | |||
| 2114 | Ga0105245_11266626 | |||
| 2115 | Ga0105245_11860478 | |||
| 2116 | Ga0105245_12296602 | |||
| 2117 | Ga0105245_12302965 | |||
| 2118 | Ga0105245_13066406 | |||
| 2119 | Ga0105247_10026522 | |||
| 2120 | Ga0114129_10065208 | |||
| 2121 | Ga0114129_10087913 | |||
| 2122 | Ga0114129_10172141 | |||
| 2123 | Ga0114129_10507177 | |||
| 2124 | Ga0114129_11433331 | |||
| 2125 | Ga0114129_11667125 | |||
| 2126 | Ga0105243_10044346 | |||
| 2127 | Ga0105243_10169796 | |||
| 2128 | Ga0105243_10343153 | |||
| 2129 | Ga0105243_11092827 | |||
| 2130 | Ga0105241_10014582 | |||
| 2131 | Ga0105241_10082598 | |||
| 2132 | Ga0105241_10643072 | |||
| 2133 | Ga0105241_10897852 | |||
| 2134 | Ga0105241_12208815 | |||
| 2135 | Ga0105242_10082032 | |||
| 2136 | Ga0105242_10085846 | |||
| 2137 | Ga0105242_10157190 | |||
| 2138 | Ga0105242_10212648 | |||
| 2139 | Ga0105242_10241859 | |||
| 2140 | Ga0105242_10368737 | |||
| 2141 | Ga0105242_10574160 | |||
| 2142 | Ga0105242_11721043 | |||
| 2143 | Ga0105242_13274448 | |||
| 2144 | Ga0105248_10045187 | |||
| 2145 | Ga0105248_10045265 | |||
| 2146 | Ga0105248_11488110 | |||
| 2147 | Ga0105237_10027161 | |||
| 2148 | Ga0105237_10054796 | |||
| 2149 | Ga0105237_10089459 | |||
| 2150 | Ga0105237_10503301 | |||
| 2151 | Ga0105237_10784243 | |||
| 2152 | Ga0105238_10066774 | |||
| 2153 | Ga0105238_10105267 | |||
| 2154 | Ga0105238_10527386 | |||
| 2155 | Ga0105238_12045809 | |||
| 2156 | Ga0105249_10002311 | |||
| 2157 | Ga0105249_10142322 | |||
| 2158 | Ga0105239_10109788 | |||
| 2159 | Ga0105239_10146373 | |||
| 2160 | Ga0105239_10253720 | |||
| 2161 | Ga0105239_10759394 | |||
| 2162 | Ga0105239_10829290 | |||
| 2163 | Ga0105239_10890811 | |||
| 2164 | Ga0105239_11481799 | |||
| 2165 | Ga0105246_10042425 | |||
| 2166 | Ga0105246_10154305 | |||
| 2167 | Ga0105246_10350141 | |||
| 2168 | Ga0105246_10403802 | |||
| 2169 | Ga0105246_10603213 | |||
| 2170 | Ga0105246_11850611 | |||
| 2171 | Ga0157337_1025093 | |||
| 2172 | Ga0157373_10305154 | |||
| 2173 | Ga0157371_10061380 | |||
| 2174 | Ga0157371_10339801 | |||
| 2175 | Ga0157371_11504605 | |||
| 2176 | Ga0157370_10007783 | |||
| 2177 | Ga0157370_10028661 | |||
| 2178 | Ga0157370_10070188 | |||
| 2179 | Ga0157370_10234264 | |||
| 2180 | Ga0157370_10272896 | |||
| 2181 | Ga0157370_10797342 | |||
| 2182 | Ga0157370_11067564 | |||
| 2183 | Ga0157369_10005385 | |||
| 2184 | Ga0157369_10067238 | |||
| 2185 | Ga0157369_10113649 | |||
| 2186 | Ga0157369_10131550 | |||
| 2187 | Ga0157369_10353190 | |||
| 2188 | Ga0157369_10368586 | |||
| 2189 | Ga0157369_10458950 | |||
| 2190 | Ga0157369_10642757 | |||
| 2191 | Ga0157369_10696725 | |||
| 2192 | Ga0157369_10814064 | |||
| 2193 | Ga0157369_11079524 | |||
| 2194 | Ga0157369_11122821 | |||
| 2195 | Ga0157369_11198070 | |||
| 2196 | Ga0157369_11469115 | |||
| 2197 | Ga0157369_11623934 | |||
| 2198 | Ga0157374_10113993 | |||
| 2199 | Ga0157374_10138765 | |||
| 2200 | Ga0157374_10280588 | |||
| 2201 | Ga0157374_10537651 | |||
| 2202 | Ga0157374_10759110 | |||
| 2203 | Ga0157374_12793686 | |||
| 2204 | Ga0157378_10021004 | |||
| 2205 | Ga0157378_10087210 | |||
| 2206 | Ga0157378_10408102 | |||
| 2207 | Ga0157378_10536445 | |||
| 2208 | Ga0163162_10004416 | |||
| 2209 | Ga0163162_10343122 | |||
| 2210 | Ga0163162_10560935 | |||
| 2211 | Ga0157372_10026695 | |||
| 2212 | Ga0157372_10149581 | |||
| 2213 | Ga0157372_10217095 | |||
| 2214 | Ga0157372_10314311 | |||
| 2215 | Ga0157372_10931619 | |||
| 2216 | Ga0157372_11104666 | |||
| 2217 | Ga0157372_11321390 | |||
| 2218 | Ga0157372_11843288 | |||
| 2219 | Ga0157372_13401283 | |||
| 2220 | Ga0157375_10192709 | |||
| 2221 | Ga0157375_10244167 | |||
| 2222 | Ga0157375_10272096 | |||
| 2223 | Ga0157375_10779489 | |||
| 2224 | Ga0163163_11323794 | |||
| 2225 | Ga0163163_11632325 | |||
| 2226 | Ga0163163_11692322 | |||
| 2227 | Ga0182008_10109139 | |||
| 2228 | Ga0157377_10025713 | |||
| 2229 | Ga0157379_10693949 | |||
| 2230 | Ga0157376_10071132 | |||
| 2231 | Ga0157376_10163508 | |||
| 2232 | Ga0157376_10191107 | |||
| 2233 | Ga0157376_10460680 | |||
| 2234 | Ga0157376_11718042 | |||
| 2235 | Ga0182007_10317775 | |||
| 2236 | Ga0163161_10264080 | |||
| 2237 | Ga0197907_10416825 | |||
| 2238 | Ga0197907_10716303 | |||
| 2239 | Ga0206356_10667790 | |||
| 2240 | Ga0206356_10700751 | |||
| 2241 | Ga0206356_10788852 | |||
| 2242 | Ga0206356_11812622 | |||
| 2243 | Ga0206354_10974213 | |||
| 2244 | Ga0206353_10211289 | |||
| 2245 | Ga0206353_10322309 | |||
| 2246 | Ga0206353_10467431 | |||
| 2247 | Ga0206353_10600212 | |||
| 2248 | Ga0206353_10730077 | |||
| 2249 | Ga0206353_11412740 | |||
| 2250 | Ga0206353_11615196 | |||
| 2251 | Ga0206353_11994009 | |||
| 2252 | Ga0213876_10115045 | |||
| 2253 | Ga0224712_10170402 | |||
| 2254 | Ga0207692_10010590 | |||
| 2255 | Ga0207692_10167535 | |||
| 2256 | Ga0207692_10229497 | |||
| 2257 | Ga0207692_11183417 | |||
| 2258 | Ga0207642_10564405 | |||
| 2259 | Ga0207647_10117127 | |||
| 2260 | Ga0207685_10015934 | |||
| 2261 | Ga0207685_10017607 | |||
| 2262 | Ga0207685_10019805 | |||
| 2263 | Ga0207699_10022148 | |||
| 2264 | Ga0207699_10241345 | |||
| 2265 | Ga0207699_10921918 | |||
| 2266 | Ga0207699_11484705 | |||
| 2267 | Ga0207705_10021089 | |||
| 2268 | Ga0207705_10048604 | |||
| 2269 | Ga0207705_10135407 | |||
| 2270 | Ga0207705_10138782 | |||
| 2271 | Ga0207705_10330500 | |||
| 2272 | Ga0207705_10395274 | |||
| 2273 | Ga0207705_10684079 | |||
| 2274 | Ga0207705_11004201 | |||
| 2275 | Ga0207705_11411075 | |||
| 2276 | Ga0207684_10148199 | |||
| 2277 | Ga0207684_10489198 | |||
| 2278 | Ga0207684_11180863 | |||
| 2279 | Ga0207654_10169436 | |||
| 2280 | Ga0207707_10006267 | |||
| 2281 | Ga0207707_10034982 | |||
| 2282 | Ga0207707_10039960 | |||
| 2283 | Ga0207707_10092655 | |||
| 2284 | Ga0207707_10313782 | |||
| 2285 | Ga0207707_10440447 | |||
| 2286 | Ga0207707_10451098 | |||
| 2287 | Ga0207707_11039655 | |||
| 2288 | Ga0207695_10080725 | |||
| 2289 | Ga0207695_10273768 | |||
| 2290 | Ga0207695_11231663 | |||
| 2291 | Ga0207671_10031468 | |||
| 2292 | Ga0207671_10088321 | |||
| 2293 | Ga0207671_10287835 | |||
| 2294 | Ga0207693_10000371 | |||
| 2295 | Ga0207693_10000990 | |||
| 2296 | Ga0207693_10001398 | |||
| 2297 | Ga0207693_10058963 | |||
| 2298 | Ga0207693_10121497 | |||
| 2299 | Ga0207693_10127706 | |||
| 2300 | Ga0207693_10399238 | |||
| 2301 | Ga0207693_10607752 | |||
| 2302 | Ga0207693_10744333 | |||
| 2303 | Ga0207663_10012460 | |||
| 2304 | Ga0207663_10038778 | |||
| 2305 | Ga0207663_10156398 | |||
| 2306 | Ga0207663_10222310 | |||
| 2307 | Ga0207663_10955668 | |||
| 2308 | Ga0207663_11001241 | |||
| 2309 | Ga0207660_10085959 | |||
| 2310 | Ga0207660_10097423 | |||
| 2311 | Ga0207660_10146812 | |||
| 2312 | Ga0207660_10181111 | |||
| 2313 | Ga0207660_10523083 | |||
| 2314 | Ga0207660_10738588 | |||
| 2315 | Ga0207662_10291487 | |||
| 2316 | Ga0207657_10000207 | |||
| 2317 | Ga0207657_10013395 | |||
| 2318 | Ga0207657_10015777 | |||
| 2319 | Ga0207657_10018969 | |||
| 2320 | Ga0207657_10021934 | |||
| 2321 | Ga0207657_10025349 | |||
| 2322 | Ga0207657_10066404 | |||
| 2323 | Ga0207657_10234060 | |||
| 2324 | Ga0207657_10332882 | |||
| 2325 | Ga0207657_10549748 | |||
| 2326 | Ga0207657_10804666 | |||
| 2327 | Ga0207657_11239371 | |||
| 2328 | Ga0207649_10096381 | |||
| 2329 | Ga0207649_10260675 | |||
| 2330 | Ga0207649_10342542 | |||
| 2331 | Ga0207649_10688646 | |||
| 2332 | Ga0207652_10021218 | |||
| 2333 | Ga0207652_10110214 | |||
| 2334 | Ga0207652_10113557 | |||
| 2335 | Ga0207652_10121469 | |||
| 2336 | Ga0207652_10125053 | |||
| 2337 | Ga0207652_10241419 | |||
| 2338 | Ga0207652_10501255 | |||
| 2339 | Ga0207652_10641387 | |||
| 2340 | Ga0207652_10672200 | |||
| 2341 | Ga0207652_10687440 | |||
| 2342 | Ga0207652_11120811 | |||
| 2343 | Ga0207652_11187617 | |||
| 2344 | Ga0207652_11312725 | |||
| 2345 | Ga0207652_11523253 | |||
| 2346 | Ga0207646_10041496 | |||
| 2347 | Ga0207646_10309384 | |||
| 2348 | Ga0207694_10120419 | |||
| 2349 | Ga0207694_10290985 | |||
| 2350 | Ga0207694_10571791 | |||
| 2351 | Ga0207694_11490055 | |||
| 2352 | Ga0207659_11179850 | |||
| 2353 | Ga0207687_10026601 | |||
| 2354 | Ga0207687_10081102 | |||
| 2355 | Ga0207687_10212967 | |||
| 2356 | Ga0207687_10421187 | |||
| 2357 | Ga0207687_10836011 | |||
| 2358 | Ga0207700_10058843 | |||
| 2359 | Ga0207700_10081201 | |||
| 2360 | Ga0207700_10100185 | |||
| 2361 | Ga0207700_10298148 | |||
| 2362 | Ga0207700_10457358 | |||
| 2363 | Ga0207700_10543438 | |||
| 2364 | Ga0207700_11099365 | |||
| 2365 | Ga0207664_10021231 | |||
| 2366 | Ga0207664_10046845 | |||
| 2367 | Ga0207664_10078067 | |||
| 2368 | Ga0207664_10148314 | |||
| 2369 | Ga0207664_10566979 | |||
| 2370 | Ga0207664_10986580 | |||
| 2371 | Ga0207664_11146981 | |||
| 2372 | Ga0207664_11168656 | |||
| 2373 | Ga0207644_10048422 | |||
| 2374 | Ga0207644_10161976 | |||
| 2375 | Ga0207644_10613073 | |||
| 2376 | Ga0207690_10239537 | |||
| 2377 | Ga0207690_10396115 | |||
| 2378 | Ga0207690_10538125 | |||
| 2379 | Ga0207690_10984609 | |||
| 2380 | Ga0207706_10581926 | |||
| 2381 | Ga0207706_11325612 | |||
| 2382 | Ga0207686_10008123 | |||
| 2383 | Ga0207686_10050347 | |||
| 2384 | Ga0207686_10148931 | |||
| 2385 | Ga0207686_10638204 | |||
| 2386 | Ga0207709_10001704 | |||
| 2387 | Ga0207709_10068099 | |||
| 2388 | Ga0207670_10827760 | |||
| 2389 | Ga0207669_10368899 | |||
| 2390 | Ga0207669_10502020 | |||
| 2391 | Ga0207704_10005190 | |||
| 2392 | Ga0207704_10248958 | |||
| 2393 | Ga0207704_11141530 | |||
| 2394 | Ga0207704_11351081 | |||
| 2395 | Ga0207665_10000070 | |||
| 2396 | Ga0207665_10010513 | |||
| 2397 | Ga0207665_10079495 | |||
| 2398 | Ga0207691_10070326 | |||
| 2399 | Ga0207691_10198186 | |||
| 2400 | Ga0207711_10410625 | |||
| 2401 | Ga0207711_10490212 | |||
| 2402 | Ga0207711_10727961 | |||
| 2403 | Ga0207711_11568913 | |||
| 2404 | Ga0207661_10030797 | |||
| 2405 | Ga0207661_10032448 | |||
| 2406 | Ga0207661_10117707 | |||
| 2407 | Ga0207661_10135468 | |||
| 2408 | Ga0207661_10138183 | |||
| 2409 | Ga0207661_10246928 | |||
| 2410 | Ga0207661_10368125 | |||
| 2411 | Ga0207661_10391160 | |||
| 2412 | Ga0207661_10593462 | |||
| 2413 | Ga0207661_11282115 | |||
| 2414 | Ga0207679_10278369 | |||
| 2415 | Ga0207679_10389599 | |||
| 2416 | Ga0207679_10580038 | |||
| 2417 | Ga0207667_10033445 | |||
| 2418 | Ga0207667_10066116 | |||
| 2419 | Ga0207667_10113662 | |||
| 2420 | Ga0207667_10173227 | |||
| 2421 | Ga0207667_10197387 | |||
| 2422 | Ga0207667_10233821 | |||
| 2423 | Ga0207667_10286573 | |||
| 2424 | Ga0207667_10322623 | |||
| 2425 | Ga0207667_11423086 | |||
| 2426 | Ga0207712_10006452 | |||
| 2427 | Ga0207712_10277974 | |||
| 2428 | Ga0207668_10063831 | |||
| 2429 | Ga0207640_10717808 | |||
| 2430 | Ga0207640_10897192 | |||
| 2431 | Ga0207640_11217041 | |||
| 2432 | Ga0207658_10002891 | |||
| 2433 | Ga0207658_10917277 | |||
| 2434 | Ga0207658_11574275 | |||
| 2435 | Ga0207677_10139189 | |||
| 2436 | Ga0207677_11610400 | |||
| 2437 | Ga0207639_10325905 | |||
| 2438 | Ga0207639_10570039 | |||
| 2439 | Ga0207639_10733166 | |||
| 2440 | Ga0207639_11877796 | |||
| 2441 | Ga0207678_10113601 | |||
| 2442 | Ga0207678_10444611 | |||
| 2443 | Ga0207678_10622198 | |||
| 2444 | Ga0207708_10000833 | |||
| 2445 | Ga0207708_10857466 | |||
| 2446 | Ga0207708_11082143 | |||
| 2447 | Ga0207708_11294843 | |||
| 2448 | Ga0207708_11793532 | |||
| 2449 | Ga0207702_10098954 | |||
| 2450 | Ga0207702_10277260 | |||
| 2451 | Ga0207702_10356568 | |||
| 2452 | Ga0207702_10370390 | |||
| 2453 | Ga0207702_10399638 | |||
| 2454 | Ga0207702_10487433 | |||
| 2455 | Ga0207702_10802490 | |||
| 2456 | Ga0207702_10849968 | |||
| 2457 | Ga0207702_11651225 | |||
| 2458 | Ga0207641_10427780 | |||
| 2459 | Ga0207641_11068666 | |||
| 2460 | Ga0207648_10000806 | |||
| 2461 | Ga0207676_10295065 | |||
| 2462 | Ga0207674_10003353 | |||
| 2463 | Ga0207674_10034494 | |||
| 2464 | Ga0207674_10034801 | |||
| 2465 | Ga0207674_10103688 | |||
| 2466 | Ga0207674_10335926 | |||
| 2467 | Ga0207674_11357543 | |||
| 2468 | Ga0207675_100082252 | |||
| 2469 | Ga0207683_10007545 | |||
| 2470 | Ga0207683_10155522 | |||
| 2471 | Ga0207683_10158835 | |||
| 2472 | Ga0207698_10087393 | |||
| 2473 | Ga0207698_10126124 | |||
| 2474 | Ga0207698_10151040 | |||
| 2475 | Ga0207698_10287633 | |||
| 2476 | Ga0207428_10003626 | |||
| 2477 | Ga0207428_10354867 | |||
| 2478 | Ga0268266_10283665 | |||
| 2479 | Ga0268266_10598062 | |||
| 2480 | Ga0268266_10736086 | |||
| 2481 | Ga0268265_10576698 | |||
| 2482 | Ga0265326_10052168 | |||
| 2483 | Ga0265319_1003390 | |||
| 2484 | Ga0265319_1103063 | |||
| 2485 | Ga0265334_10030013 | |||
| 2486 | Ga0265334_10100569 | |||
| 2487 | Ga0265334_10121742 | |||
| 2488 | Ga0265318_10002905 | |||
| 2489 | Ga0265318_10026357 | |||
| 2490 | Ga0265318_10133877 | |||
| 2491 | Ga0265322_10010959 | |||
| 2492 | Ga0265322_10014646 | |||
| 2493 | Ga0265322_10042958 | |||
| 2494 | Ga0265336_10005527 | |||
| 2495 | Ga0265338_10006136 | |||
| 2496 | Ga0265338_10009161 | |||
| 2497 | Ga0265338_10016938 | |||
| 2498 | Ga0265338_10019524 | |||
| 2499 | Ga0265338_10030185 | |||
| 2500 | Ga0265338_10070358 | |||
| 2501 | Ga0265338_10070593 | |||
| 2502 | Ga0265338_10087484 | |||
| 2503 | Ga0265338_10186516 | |||
| 2504 | Ga0265330_10017777 | |||
| 2505 | Ga0265330_10044163 | |||
| 2506 | Ga0265332_10036278 | |||
| 2507 | Ga0265328_10043350 | |||
| 2508 | Ga0265328_10307181 | |||
| 2509 | Ga0265320_10038804 | |||
| 2510 | Ga0265320_10097999 | |||
| 2511 | Ga0265320_10279280 | |||
| 2512 | Ga0265325_10019941 | |||
| 2513 | Ga0265325_10050476 | |||
| 2514 | Ga0265325_10106306 | |||
| 2515 | Ga0265329_10020911 | |||
| 2516 | Ga0265340_10207132 | |||
| 2517 | Ga0265340_10295630 | |||
| 2518 | Ga0265339_10068072 | |||
| 2519 | Ga0265339_10113784 | |||
| 2520 | Ga0265331_10099514 | |||
| 2521 | Ga0265331_10355698 | |||
| 2522 | Ga0265327_10006112 | |||
| 2523 | Ga0265327_10021363 | |||
| 2524 | Ga0265327_10039337 | |||
| 2525 | Ga0265327_10040559 | |||
| 2526 | Ga0265327_10054359 | |||
| 2527 | Ga0265327_10213656 | |||
| 2528 | Ga0265316_10008470 | |||
| 2529 | Ga0265316_10029661 | |||
| 2530 | Ga0265316_10049741 | |||
| 2531 | Ga0307408_100114748 | |||
| 2532 | Ga0307408_100176961 | |||
| 2533 | Ga0307408_100246442 | |||
| 2534 | Ga0265313_10004895 | |||
| 2535 | Ga0265313_10199018 | |||
| 2536 | Ga0265314_10004374 | |||
| 2537 | Ga0265314_10131538 | |||
| 2538 | Ga0265314_10242230 | |||
| 2539 | Ga0265314_10478885 | |||
| 2540 | Ga0265342_10030444 | |||
| 2541 | Ga0265342_10045478 | |||
| 2542 | Ga0265342_10282030 | |||
| 2543 | Ga0307405_10257868 | |||
| 2544 | Ga0307405_10506553 | |||
| 2545 | Ga0307405_11637767 | |||
| 2546 | Ga0307413_10340511 | |||
| 2547 | Ga0307413_11387490 | |||
| 2548 | Ga0307406_10103808 | |||
| 2549 | Ga0307406_10285552 | |||
| 2550 | Ga0307407_10474183 | |||
| 2551 | Ga0307407_10619802 | |||
| 2552 | Ga0307407_10668333 | |||
| 2553 | Ga0307412_10303935 | |||
| 2554 | Ga0307409_100149342 | |||
| 2555 | Ga0307409_100183933 | |||
| 2556 | Ga0307409_100359945 | |||
| 2557 | Ga0307409_100395667 | |||
| 2558 | Ga0307409_100979340 | |||
| 2559 | Ga0307416_100064091 | |||
| 2560 | Ga0307416_100130796 | |||
| 2561 | Ga0307416_100620890 | |||
| 2562 | Ga0307416_101059209 | |||
| 2563 | Ga0307414_10394891 | |||
| 2564 | Ga0307411_11203901 | |||
| 2565 | Ga0307415_100070335 | |||
| 2566 | Ga0307415_100133591 | |||
| 2567 | Ga0307415_100215392 | |||
| 2568 | Ga0307415_100882982 | |||
| 2569 | Ga0316583_10018438 | |||
| 2570 | Ga0316583_10146969 | |||
| 2571 | Ga0373926_0057441 | |||
| 2572 | Ga0373934_0287863 | |||
| 2573 | Ga0373944_0012696 | |||
| 2574 | Ga0373923_0514975 | |||
| 2575 | Ga0373936_0024078 | |||
| 2576 | Ga0373936_0136970 | |||
| 2577 | Ga0373939_0291632 | |||
| 2578 | Ga0373945_0004024 | |||
| 2579 | Ga0373945_0004453 | |||
| 2580 | Ga0373953_0151967 | |||
| 2581 | Ga0373953_0231221 | |||
| 2582 | Ga0373954_0174367 | |||
| 2583 | Ga0373956_0136897 | |||
| 2584 | Ga0373943_0000450 | |||
| 2585 | Ga0373943_0005939 | |||
| 2586 | Ga0373943_0644678 | |||
| 2587 | Ga0373946_0000587 | |||
| 2588 | Ga0373946_0006898 | |||
| 2589 | Ga0373946_0245559 | |||
| 2590 | Ga0373955_0094356 | |||
| 2591 | Ga0373955_0126715 | |||
| 2592 | Ga0373955_0217730 | |||
| 2593 | Ga0373961_0228349 | |||
| 2594 | Ga0373962_0203006 | |||
| 2595 | Ga0373924_0035981 | |||
| 2596 | Ga0373924_0056500 | |||
| 2597 | Ga0373935_0024719 | |||
| 2598 | Ga0373935_0032176 | |||
| 2599 | Ga0373927_0077150 | |||
| 2600 | Ga0373933_0173003 | |||
| 2601 | Ga0373933_1036992 | |||
| 2602 | Ga0373947_0004602 | |||
| 2603 | Ga0373947_0022617 | |||
| 2604 | Ga0373947_0071449 | |||
| 2605 | Ga0373947_0238840 | |||
| 2606 | Ga0373947_0417591 | |||
| 2607 | Ga0373937_0096706 | |||
| 2608 | Ga0373937_0117201 | |||
| 2609 | Ga0373937_0932355 | |||
| 2610 | Ga0373925_0013017 | |||
| 2611 | Ga0373925_0033856 | |||
| 2612 | Ga0373925_0149720 | |||
| 2613 | Ga0373925_0512518 | |||
| 2614 | Ga0395899_0021519 | |||
| 2615 | Ga0395899_0042660 | |||
| 2616 | Ga0395899_0047824 | |||
| 2617 | Ga0395899_0059975 | |||
| 2618 | Ga0395899_0087738 | |||
| 2619 | Ga0395899_0101176 | |||
| 2620 | Ga0395899_0114306 | |||
| 2621 | Ga0395899_0156924 | |||
| 2622 | Ga0395899_0196889 | |||
| 2623 | Ga0395899_0355591 | |||
| 2624 | Ga0395899_0379853 | |||
| 2625 | Ga0395899_0477512 | |||
| 2626 | Ga0395900_0008773 | |||
| 2627 | Ga0395900_0009413 | |||
| 2628 | Ga0395900_0023438 | |||
| 2629 | Ga0395900_0048696 | |||
| 2630 | Ga0395900_0084833 | |||
| 2631 | Ga0395900_0089342 | |||
| 2632 | Ga0395900_0093981 | |||
| 2633 | Ga0395900_0103938 | |||
| 2634 | Ga0395900_0108248 | |||
| 2635 | Ga0395900_0157499 | |||
| 2636 | Ga0395900_0236980 | |||
| 2637 | Ga0395900_0288560 | |||
| 2638 | Ga0395900_0303099 | |||
| 2639 | Ga0395900_0349674 | |||
| 2640 | Ga0395900_0368692 | |||
| 2641 | Ga0395900_0422513 | |||
| 2642 | Ga0395900_0432312 | |||
| 2643 | Ga0395900_0505334 | |||
| 2644 | Ga0395900_0506483 | |||
| 2645 | Ga0395900_0720716 | |||
| 2646 | Ga0395900_0869537 | |||
| 2647 | Ga0395900_1226098 | |||
| 2648 | Ga0395900_1330841 | |||
| 2649 | Ga0395900_1476077 | |||
| 2650 | Ga0395898_0002496 | |||
| 2651 | Ga0395898_0005097 | |||
| 2652 | Ga0395898_0005344 | |||
| 2653 | Ga0395898_0005483 | |||
| 2654 | Ga0395898_0015237 | |||
| 2655 | Ga0395898_0019651 | |||
| 2656 | Ga0395898_0042660 | |||
| 2657 | Ga0395898_0046795 | |||
| 2658 | Ga0395898_0050311 | |||
| 2659 | Ga0395898_0080644 | |||
| 2660 | Ga0395898_0174711 | |||
| 2661 | Ga0395898_0285729 | |||
| 2662 | Ga0395898_0298472 | |||
| 2663 | Ga0395898_0372696 | |||
| 2664 | Ga0395898_0391115 | |||
| 2665 | Ga0395898_0410459 | |||
| 2666 | Ga0395898_0451065 | |||
| 2667 | Ga0395898_0572026 | |||
| 2668 | Ga0395898_0717671 | |||
| 2669 | Ga0395898_0971853 | |||
| 2670 | Ga0395898_1006863 | |||
| 2671 | Ga0395898_1549826 | |||
| 2672 | Ga0395898_1733822 | |||
| 2673 | Ga0395905_0002871 | |||
| 2674 | Ga0395905_0009104 | |||
| 2675 | Ga0395905_0029771 | |||
| 2676 | Ga0395905_0030658 | |||
| 2677 | Ga0395905_0059967 | |||
| 2678 | Ga0395905_0060087 | |||
| 2679 | Ga0395905_0069148 | |||
| 2680 | Ga0395905_0088690 | |||
| 2681 | Ga0395905_0135976 | |||
| 2682 | Ga0395905_0327047 | |||
| 2683 | Ga0395905_0444910 | |||
| 2684 | Ga0395905_0445892 | |||
| 2685 | Ga0395905_0649887 | |||
| 2686 | Ga0395905_0678613 | |||
| 2687 | Ga0436364_1080961 | |||
| 2688 | Ga0395901_0003588 | |||
| 2689 | Ga0395901_0008494 | |||
| 2690 | Ga0395901_0013435 | |||
| 2691 | Ga0395901_0019244 | |||
| 2692 | Ga0395901_0020919 | |||
| 2693 | Ga0395901_0032977 | |||
| 2694 | Ga0395901_0034252 | |||
| 2695 | Ga0395901_0035468 | |||
| 2696 | Ga0395901_0046421 | |||
| 2697 | Ga0395901_0055307 | |||
| 2698 | Ga0395901_0059091 | |||
| 2699 | Ga0395901_0059732 | |||
| 2700 | Ga0395901_0099670 | |||
| 2701 | Ga0395901_0336355 | |||
| 2702 | Ga0395901_0363660 | |||
| 2703 | Ga0395901_0422260 | |||
| 2704 | Ga0395901_0449930 | |||
| 2705 | Ga0395901_0541671 | |||
| 2706 | Ga0395901_0840241 | |||
| 2707 | Ga0395901_0895174 | |||
| 2708 | Ga0395901_1331290 | |||
| 2709 | Ga0395901_1392265 | |||
| 2710 | Ga0436365_0085711 | |||
| 2711 | Ga0436365_0701464 | |||
| 2712 | Ga0436365_0845903 | |||
| 2713 | Ga0436360_1155632 | |||
| 2714 | Ga0436363_0640175 | |||
| 2715 | Ga0436363_1570462 | |||
| 2716 | Ga0436363_1687957 | |||
| 2717 | Ga0436363_1701756 | |||
| 2718 | Ga0436362_0192683 | |||
| 2719 | Ga0436362_1065493 | |||
| 2720 | Ga0439461_0045621 | |||
| 2721 | Ga0439466_0122052 | |||
| 2722 | Ga0439465_0131463 | |||
| 2723 | Ga0451804_0563923 | |||
| 2724 | Ga0451807_0290562 | |||
| 2725 | Ga0451849_1174289 | |||
| 2726 | Ga0451851_0413360 | |||
| 2727 | Ga0451853_1423786 | |||
| 2728 | Ga0451853_2826077 | |||
| 2729 | Ga0451853_3658391 | |||
| 2730 | Ga0451853_3882521 | |||
| 2731 | Ga0439448_0036171 | |||
| 2732 | Ga0439432_059947 | |||
| 2733 | Ga0439462_0097652 | |||
| 2734 | Ga0450915_002033 | |||
| 2735 | Ga0450917_005551 | |||
| 2736 | Ga0450920_014823 | |||
| 2737 | Ga0450898_070467 | |||
| 2738 | Ga0450910_023755 | |||
| 2739 | Ga0439446_0000515 | |||
| 2740 | Ga0439446_0060293 | |||
| 2741 | Ga0439434_0086783 | |||
| 2742 | Ga0451577_1877690 | |||
| 2743 | Ga0466969_0028519 | |||
| 2744 | Ga0466969_0095008 | |||
| 2745 | Ga0466969_0218360 | |||
| 2746 | Ga0466972_0522138 | |||
| 2747 | Ga0466965_0076490 | |||
| 2748 | Ga0466965_0124314 | |||
| 2749 | Ga0466965_0154697 | |||
| 2750 | Ga0466965_0803528 | |||
| 2751 | Ga0466966_0000678 | |||
| 2752 | Ga0466966_0003325 | |||
| 2753 | Ga0466966_0043646 | |||
| 2754 | Ga0466966_0137242 | |||
| 2755 | Ga0466966_0173487 | |||
| 2756 | Ga0466961_0002905 | |||
| 2757 | Ga0466961_0007370 | |||
| 2758 | Ga0466961_0029335 | |||
| 2759 | Ga0466961_0065280 | |||
| 2760 | Ga0466961_0070588 | |||
| 2761 | Ga0466961_0075688 | |||
| 2762 | Ga0466961_0096457 | |||
| 2763 | Ga0466961_0159312 | |||
| 2764 | Ga0466961_0538224 | |||
| 2765 | Ga0466963_0000661 | |||
| 2766 | Ga0466963_0000792 | |||
| 2767 | Ga0466963_0002009 | |||
| 2768 | Ga0466963_0002017 | |||
| 2769 | Ga0466963_0002252 | |||
| 2770 | Ga0466963_0002500 | |||
| 2771 | Ga0466963_0002999 | |||
| 2772 | Ga0466963_0003520 | |||
| 2773 | Ga0466963_0004663 | |||
| 2774 | Ga0466963_0005080 | |||
| 2775 | Ga0466963_0006726 | |||
| 2776 | Ga0466963_0006855 | |||
| 2777 | Ga0466963_0009150 | |||
| 2778 | Ga0466963_0057815 | |||
| 2779 | Ga0466963_0073487 | |||
| 2780 | Ga0466963_0087868 | |||
| 2781 | Ga0466963_0090601 | |||
| 2782 | Ga0466963_0132045 | |||
| 2783 | Ga0466963_0275348 | |||
| 2784 | Ga0466963_0427892 | |||
| 2785 | Ga0466963_0478332 | |||
| 2786 | Ga0466963_1049805 | |||
| 2787 | Ga0466963_1092534 | |||
| 2788 | Ga0466964_0000335 | |||
| 2789 | Ga0466964_0001343 | |||
| 2790 | Ga0466964_0003667 | |||
| 2791 | Ga0466964_0004919 | |||
| 2792 | Ga0466964_0013694 | |||
| 2793 | Ga0466964_0022018 | |||
| 2794 | Ga0466964_0031620 | |||
| 2795 | Ga0466964_0038061 | |||
| 2796 | Ga0466964_0042842 | |||
| 2797 | Ga0466964_0055679 | |||
| 2798 | Ga0466964_0063175 | |||
| 2799 | Ga0466964_0074447 | |||
| 2800 | Ga0466964_0187771 | |||
| 2801 | Ga0466964_0265164 | |||
| 2802 | Ga0466964_0593091 | |||
| 2803 | Ga0466964_0730704 | |||
| 2804 | Ga0466971_0003596 | |||
| 2805 | Ga0466971_0007633 | |||
| 2806 | Ga0466971_0021486 | |||
| 2807 | Ga0466971_0036982 | |||
| 2808 | Ga0466971_0189687 | |||
| 2809 | Ga0466971_0209896 | |||
| 2810 | Ga0466971_0489188 | |||
| 2811 | Ga0466968_0002629 | |||
| 2812 | Ga0466968_0004943 | |||
| 2813 | Ga0466968_0078435 | |||
| 2814 | Ga0466968_0123473 | |||
| 2815 | Ga0466968_0146678 | |||
| 2816 | Ga0466968_0217756 | |||
| 2817 | Ga0466968_0272199 | |||
| 2818 | Ga0466970_0013425 | |||
| 2819 | Ga0466970_0035573 | |||
| 2820 | Ga0466970_0158393 | |||
| 2821 | Ga0466957_0000566 | |||
| 2822 | Ga0466957_0000954 | |||
| 2823 | Ga0466957_0005157 | |||
| 2824 | Ga0466957_0005764 | |||
| 2825 | Ga0466957_0013432 | |||
| 2826 | Ga0466957_0024884 | |||
| 2827 | Ga0466957_0039745 | |||
| 2828 | Ga0466957_0055884 | |||
| 2829 | Ga0466957_0060259 | |||
| 2830 | Ga0466957_0066843 | |||
| 2831 | Ga0466957_0134766 | |||
| 2832 | Ga0466957_0226235 | |||
| 2833 | Ga0466957_0451153 | |||
| 2834 | Ga0466957_0943999 | |||
| 2835 | Ga0466957_1089174 | |||
| 2836 | Ga0466957_1191833 | |||
| 2837 | Ga0466960_0013853 | |||
| 2838 | Ga0466960_0209325 | |||
| 2839 | Ga0466960_0266460 | |||
| 2840 | Ga0466960_0324863 | |||
| 2841 | Ga0466960_0400002 | |||
| 2842 | Ga0466959_0001247 | |||
| 2843 | Ga0466959_0006694 | |||
| 2844 | Ga0466959_0033953 | |||
| 2845 | Ga0466959_0085996 | |||
| 2846 | Ga0466959_0086370 | |||
| 2847 | Ga0466959_0116728 | |||
| 2848 | Ga0466959_0121324 | |||
| 2849 | Ga0466959_0200703 | |||
| 2850 | Ga0466959_0212575 | |||
| 2851 | Ga0466959_0345420 | |||
| 2852 | Ga0451576_0943868 | |||
| 2853 | Ga0451576_1344229 | |||
| 2854 | Ga0451576_1427611 | |||
| 2855 | Ga0466958_0000591 | |||
| 2856 | Ga0466958_0000942 | |||
| 2857 | Ga0466958_0004180 | |||
| 2858 | Ga0466958_0006462 | |||
| 2859 | Ga0466958_0012679 | |||
| 2860 | Ga0466958_0030337 | |||
| 2861 | Ga0466958_0057096 | |||
| 2862 | Ga0466958_0058161 | |||
| 2863 | Ga0466958_0066029 | |||
| 2864 | Ga0466958_0069368 | |||
| 2865 | Ga0466958_0154606 | |||
| 2866 | Ga0466958_0201625 | |||
| 2867 | Ga0466958_0217755 | |||
| 2868 | Ga0466958_0257390 | |||
| 2869 | Ga0466958_0276314 | |||
| 2870 | Ga0466958_0289655 | |||
| 2871 | Ga0466958_0507704 | |||
| 2872 | Ga0466958_0622245 | |||
| 2873 | Ga0466958_0808304 | |||
| 2874 | Ga0466958_0897376 | |||
| 2875 | Ga0466967_0000351 | |||
| 2876 | Ga0466967_0002747 | |||
| 2877 | Ga0466967_0003833 | |||
| 2878 | Ga0466967_0005871 | |||
| 2879 | Ga0466967_0007851 | |||
| 2880 | Ga0466967_0008069 | |||
| 2881 | Ga0466967_0011565 | |||
| 2882 | Ga0466967_0013044 | |||
| 2883 | Ga0466967_0014209 | |||
| 2884 | Ga0466967_0015741 | |||
| 2885 | Ga0466967_0023531 | |||
| 2886 | Ga0466967_0033429 | |||
| 2887 | Ga0466967_0037082 | |||
| 2888 | Ga0466967_0041421 | |||
| 2889 | Ga0466967_0055721 | |||
| 2890 | Ga0466967_0076077 | |||
| 2891 | Ga0466967_0076252 | |||
| 2892 | Ga0466967_0076552 | |||
| 2893 | Ga0466967_0085897 | |||
| 2894 | Ga0466967_0093121 | |||
| 2895 | Ga0466967_0101199 | |||
| 2896 | Ga0466967_0105095 | |||
| 2897 | Ga0466967_0116549 | |||
| 2898 | Ga0466967_0131492 | |||
| 2899 | Ga0466967_0141454 | |||
| 2900 | Ga0466967_0143220 | |||
| 2901 | Ga0466967_0157845 | |||
| 2902 | Ga0466967_0162460 | |||
| 2903 | Ga0466967_0206537 | |||
| 2904 | Ga0466967_0253836 | |||
| 2905 | Ga0466967_0254138 | |||
| 2906 | Ga0466967_0261440 | |||
| 2907 | Ga0466967_0264620 | |||
| 2908 | Ga0466967_0346877 | |||
| 2909 | Ga0466967_0605618 | |||
| 2910 | Ga0466967_0619634 | |||
| 2911 | Ga0466967_0889469 | |||
| 2912 | Ga0466967_1132674 | |||
| 2913 | Ga0466967_1832651 | |||
| 2914 | Ga0466967_1986128 | |||
| 2915 | Ga0466967_2160205 | |||
| 2916 | Ga0495592_0064166 | |||
| 2917 | Ga0495592_0071193 | |||
| 2918 | Ga0495592_0160618 | |||
| 2919 | Ga0495592_0186727 | |||
| 2920 | Ga0495603_0054756 | |||
| 2921 | Ga0495603_0126672 | |||
| 2922 | Ga0495603_0136523 | |||
| 2923 | Ga0495591_102666 | |||
| 2924 | Ga0495629_0015080 | |||
| 2925 | Ga0495629_0060748 | |||
| 2926 | Ga0495629_0209233 | |||
| 2927 | Ga0495629_0759348 | |||
| 2928 | Ga0495641_0001273 | |||
| 2929 | Ga0495641_0017827 | |||
| 2930 | Ga0495641_0024718 | |||
| 2931 | Ga0495641_0024821 | |||
| 2932 | Ga0495641_0088399 | |||
| 2933 | Ga0495641_0095543 | |||
| 2934 | Ga0495641_0125139 | |||
| 2935 | Ga0495641_0257087 | |||
| 2936 | Ga0495641_0330853 | |||
| 2937 | Ga0495651_0014259 | |||
| 2938 | Ga0495651_0018806 | |||
| 2939 | Ga0495651_0142996 | |||
| 2940 | Ga0495651_0208638 | |||
| 2941 | Ga0495651_0289734 | |||
| 2942 | Ga0495651_0620313 | |||
| 2943 | Ga0495653_0033898 | |||
| 2944 | Ga0495653_0074161 | |||
| 2945 | Ga0495653_0079235 | |||
| 2946 | Ga0495653_0189902 | |||
| 2947 | Ga0495653_0221004 | |||
| 2948 | Ga0495653_0243004 | |||
| 2949 | Ga0495653_0841278 | |||
| 2950 | Ga0495580_0287600 | |||
| 2951 | Ga0495582_0000066 | |||
| 2952 | Ga0495582_0030557 | |||
| 2953 | Ga0495582_0069815 | |||
| 2954 | Ga0495582_0085011 | |||
| 2955 | Ga0495582_0110881 | |||
| 2956 | Ga0495582_0139706 | |||
| 2957 | Ga0495582_0329052 | |||
| 2958 | Ga0495582_0908106 | |||
| 2959 | Ga0495605_0084608 | |||
| 2960 | Ga0495639_0001852 | |||
| 2961 | Ga0495639_0286102 | |||
| 2962 | Ga0495639_0303501 | |||
| 2963 | Ga0495639_0305899 | |||
| 2964 | Ga0495662_0012277 | |||
| 2965 | Ga0495662_0054097 | |||
| 2966 | Ga0495662_0337123 | |||
| 2967 | Ga0495664_0081951 | |||
| 2968 | Ga0495664_0119293 | |||
| 2969 | Ga0495664_0173805 | |||
| 2970 | Ga0495664_0209427 | |||
| 2971 | Ga0495664_0723630 | |||
| 2972 | Ga0495584_0023265 | |||
| 2973 | Ga0495584_0277062 | |||
| 2974 | Ga0495584_0322986 | |||
| 2975 | Ga0495585_0111918 | |||
| 2976 | Ga0495585_0190734 | |||
| 2977 | Ga0495594_0023442 | |||
| 2978 | Ga0495594_0024618 | |||
| 2979 | Ga0495594_0565863 | |||
| 2980 | Ga0495596_0387852 | |||
| 2981 | Ga0495607_0120295 | |||
| 2982 | Ga0495608_0004630 | |||
| 2983 | Ga0495608_0024814 | |||
| 2984 | Ga0495608_0029249 | |||
| 2985 | Ga0495608_0030695 | |||
| 2986 | Ga0495608_0073652 | |||
| 2987 | Ga0495608_0136560 | |||
| 2988 | Ga0495616_0411639 | |||
| 2989 | Ga0495618_0016102 | |||
| 2990 | Ga0495618_0030541 | |||
| 2991 | Ga0495618_0123974 | |||
| 2992 | Ga0495618_0678414 | |||
| 2993 | Ga0495618_0785582 | |||
| 2994 | Ga0495620_0101546 | |||
| 2995 | Ga0495628_0023992 | |||
| 2996 | Ga0495628_0093798 | |||
| 2997 | Ga0495628_0100432 | |||
| 2998 | Ga0495628_0129587 | |||
| 2999 | Ga0495628_0188031 | |||
| 3000 | Ga0495630_0004203 | |||
| 3001 | Ga0495630_0017638 | |||
| 3002 | Ga0495630_0019933 | |||
| 3003 | Ga0495630_0039229 | |||
| 3004 | Ga0495630_0153665 | |||
| 3005 | Ga0495630_0295613 | |||
| 3006 | Ga0495630_0317760 | |||
| 3007 | Ga0495630_0416195 | |||
| 3008 | Ga0495630_1131683 | |||
| 3009 | Ga0495631_0423484 | |||
| 3010 | Ga0495632_0215938 | |||
| 3011 | Ga0495644_0005854 | |||
| 3012 | Ga0495644_0081365 | |||
| 3013 | Ga0495644_0161187 | |||
| 3014 | Ga0495663_0018218 | |||
| 3015 | Ga0495663_0233255 | |||
| 3016 | Ga0495663_0274678 | |||
| 3017 | Ga0495666_0015553 | |||
| 3018 | Ga0495642_0025963 | |||
| 3019 | Ga0495642_0210232 | |||
| 3020 | Ga0495652_0030319 | |||
| 3021 | Ga0495652_0037661 | |||
| 3022 | Ga0495652_0068143 | |||
| 3023 | Ga0495652_0099102 | |||
| 3024 | Ga0495652_0105101 | |||
| 3025 | Ga0495652_0246943 | |||
| 3026 | Ga0495665_0000252 | |||
| 3027 | Ga0495665_0079447 | |||
| 3028 | Ga0495640_0004199 | |||
| 3029 | Ga0495640_0035408 | |||
| 3030 | Ga0495640_0037865 | |||
| 3031 | Ga0495640_0041162 | |||
| 3032 | Ga0495640_0096912 | |||
| 3033 | Ga0495640_0141064 | |||
| 3034 | Ga0495640_0425162 | |||
| 3035 | Ga0495640_0442347 | |||
| 3036 | Ga0495586_0067463 | |||
| 3037 | Ga0495586_0098240 | |||
| 3038 | Ga0495587_0064972 | |||
| 3039 | Ga0495609_0062392 | |||
| 3040 | Ga0495645_0023030 | |||
| 3041 | Ga0495645_0072249 | |||
| 3042 | Ga0495645_0143988 | |||
| 3043 | Ga0495645_0235316 | |||
| 3044 | Ga0495645_0954216 | |||
| 3045 | Ga0495667_0038165 | |||
| 3046 | Ga0495667_0060705 | |||
| 3047 | Ga0495667_0064192 | |||
| 3048 | Ga0495667_0073244 | |||
| 3049 | Ga0495667_0093489 | |||
| 3050 | Ga0495667_0101119 | |||
| 3051 | Ga0495667_0116916 | |||
| 3052 | Ga0495667_0228351 | |||
| 3053 | Ga0495656_0002578 | |||
| 3054 | Ga0495656_0046483 | |||
| 3055 | Ga0495656_0056216 | |||
| 3056 | Ga0495656_0057693 | |||
| 3057 | Ga0495656_0076188 | |||
| 3058 | Ga0495656_0630054 | |||
| 3059 | Ga0495668_0061246 | |||
| 3060 | Ga0495634_0117304 | |||
| 3061 | Ga0495634_0124792 | |||
| 3062 | Ga0495611_0156954 | |||
| 3063 | Ga0495635_0010487 | |||
| 3064 | Ga0495635_0073551 | |||
| 3065 | Ga0495635_0125878 | |||
| 3066 | Ga0495635_0147042 | |||
| 3067 | Ga0495635_0509116 | |||
| 3068 | Ga0495659_0042593 | |||
| 3069 | Ga0495661_0309628 | |||
| 3070 | Ga0495588_0307545 | |||
| 3071 | Ga0495588_0561431 | |||
| 3072 | Ga0495657_0012211 | |||
| 3073 | Ga0495657_0027103 | |||
| 3074 | Ga0495657_0041419 | |||
| 3075 | Ga0495657_0095513 | |||
| 3076 | Ga0495657_0167394 | |||
| 3077 | Ga0495657_0183623 | |||
| 3078 | Ga0495657_0323357 | |||
| 3079 | Ga0495599_0014073 | |||
| 3080 | Ga0495599_0014224 | |||
| 3081 | Ga0495599_0089905 | |||
| 3082 | Ga0495623_0043281 | |||
| 3083 | Ga0495623_0054740 | |||
| 3084 | Ga0495623_0269927 | |||
| 3085 | Ga0495646_0007463 | |||
| 3086 | Ga0495646_0092320 | |||
| 3087 | Ga0495647_0008142 | |||
| 3088 | Ga0495647_0021676 | |||
| 3089 | Ga0495647_0058933 | |||
| 3090 | Ga0495647_0187063 | |||
| 3091 | Ga0495658_0001642 | |||
| 3092 | Ga0495658_0022084 | |||
| 3093 | Ga0495658_0034755 | |||
| 3094 | Ga0495658_0053250 | |||
| 3095 | Ga0495658_0173305 | |||
| 3096 | Ga0495658_0415517 | |||
| 3097 | Ga0495613_0006002 | |||
| 3098 | Ga0495613_0013886 | |||
| 3099 | Ga0495613_0070553 | |||
| 3100 | Ga0495613_0075604 | |||
| 3101 | Ga0495613_0150056 | |||
| 3102 | Ga0495613_0185108 | |||
| 3103 | Ga0495613_0215310 | |||
| 3104 | Ga0495613_0569643 | |||
| 3105 | Ga0495624_0009967 | |||
| 3106 | Ga0495624_0112022 | |||
| 3107 | Ga0495624_0283149 | |||
| 3108 | Ga0495624_0333682 | |||
| 3109 | Ga0495624_0344877 | |||
| 3110 | Ga0495624_0426251 | |||
| 3111 | Ga0495624_0568532 | |||
| 3112 | Ga0495670_0216565 | |||
| 3113 | Ga0495589_0064595 | |||
| 3114 | Ga0495589_0086462 | |||
| 3115 | Ga0495589_0111071 | |||
| 3116 | Ga0495589_0332038 | |||
| 3117 | Ga0495600_0008159 | |||
| 3118 | Ga0495600_0053184 | |||
| 3119 | Ga0495600_0088725 | |||
| 3120 | Ga0495600_0351667 | |||
| 3121 | Ga0495581_0005422 | |||
| 3122 | Ga0495581_0006426 | |||
| 3123 | Ga0495581_0011634 | |||
| 3124 | Ga0495581_0203138 | |||
| 3125 | Ga0495604_0010501 | |||
| 3126 | Ga0495604_0022565 | |||
| 3127 | Ga0495604_0188050 | |||
| 3128 | Ga0495604_0190498 | |||
| 3129 | Ga0495604_0540819 | |||
| 3130 | Ga0495604_0952056 | |||
| 3131 | Ga0495636_0128771 | |||
| 3132 | Ga0495674_0005260 | |||
| 3133 | Ga0495674_0023461 | |||
| 3134 | Ga0495674_0074298 | |||
| 3135 | Ga0495674_0093031 | |||
| 3136 | Ga0495674_0326296 | |||
| 3137 | Ga0495676_0046046 | |||
| 3138 | Ga0495676_0056767 | |||
| 3139 | Ga0495676_0069211 | |||
| 3140 | Ga0495676_0098020 | |||
| 3141 | Ga0495676_0114975 | |||
| 3142 | Ga0495676_0156430 | |||
| 3143 | Ga0495676_0176907 | |||
| 3144 | Ga0495676_0309972 | |||
| 3145 | Ga0495676_0409202 | |||
| 3146 | Ga0495676_0687772 | |||
| 3147 | Ga0495680_0004019 | |||
| 3148 | Ga0495680_0007901 | |||
| 3149 | Ga0495680_0012789 | |||
| 3150 | Ga0495680_0031439 | |||
| 3151 | Ga0495680_0033161 | |||
| 3152 | Ga0495680_0048842 | |||
| 3153 | Ga0495680_0121450 | |||
| 3154 | Ga0495680_0158648 | |||
| 3155 | Ga0495680_0256859 | |||
| 3156 | Ga0495680_0281896 | |||
| 3157 | Ga0495680_0377959 | |||
| 3158 | Ga0495683_0246497 | |||
| 3159 | Ga0495675_0039853 | |||
| 3160 | Ga0495675_0073251 | |||
| 3161 | Ga0495675_0115991 | |||
| 3162 | Ga0495675_0217570 | |||
| 3163 | Ga0495677_0046219 | |||
| 3164 | Ga0495677_0068395 | |||
| 3165 | Ga0495684_0031706 | |||
| 3166 | Ga0495684_0037507 | |||
| 3167 | Ga0495684_0063791 | |||
| 3168 | Ga0495684_0081595 | |||
| 3169 | Ga0495684_0133068 | |||
| 3170 | Ga0495684_0207240 | |||
| 3171 | Ga0495684_0328639 | |||
| 3172 | Ga0495593_0009955 | |||
| 3173 | Ga0495593_0103529 | |||
| 3174 | Ga0495602_0033000 | |||
| 3175 | Ga0495602_0070950 | |||
| 3176 | Ga0495602_0096811 | |||
| 3177 | Ga0495602_0097344 | |||
| 3178 | Ga0495602_0192351 | |||
| 3179 | Ga0495602_0199514 | |||
| 3180 | Ga0495602_0320044 | |||
| 3181 | Ga0495602_0481544 | |||
| 3182 | Ga0495602_0506773 | |||
| 3183 | Ga0495602_1152168 | |||
| 3184 | Ga0495614_0010456 | |||
| 3185 | Ga0495614_0107048 | |||
| 3186 | Ga0495614_0490286 | |||
| 3187 | Ga0495615_0056568 | |||
| 3188 | Ga0496100_0028558 | |||
| 3189 | Ga0496100_0096316 | |||
| 3190 | Ga0496100_0240103 | |||
| 3191 | Ga0496100_0316574 | |||
| 3192 | Ga0496100_0627835 | |||
| 3193 | Ga0496100_0683779 | |||
| 3194 | Ga0496100_1021869 | |||
| 3195 | Ga0496101_0000543 | |||
| 3196 | Ga0496101_0004442 | |||
| 3197 | Ga0496101_0020483 | |||
| 3198 | Ga0496101_0039949 | |||
| 3199 | Ga0496101_0079530 | |||
| 3200 | Ga0496101_0115586 | |||
| 3201 | Ga0496101_0149503 | |||
| 3202 | Ga0496101_0205686 | |||
| 3203 | Ga0496101_0232727 | |||
| 3204 | Ga0496101_0310674 | |||
| 3205 | Ga0496101_0377370 | |||
| 3206 | Ga0496101_0414337 | |||
| 3207 | Ga0496101_0556653 | |||
| 3208 | Ga0496101_0676721 | |||
| 3209 | Ga0496101_0706806 | |||
| 3210 | Ga0496101_0955941 | |||
| 3211 | Ga0496102_0016856 | |||
| 3212 | Ga0496102_0019934 | |||
| 3213 | Ga0496102_0020365 | |||
| 3214 | Ga0496102_0080933 | |||
| 3215 | Ga0496102_0241648 | |||
| 3216 | Ga0496102_0317047 | |||
| 3217 | Ga0496102_0564012 | |||
| 3218 | Ga0496102_0700859 | |||
| 3219 | Ga0496103_0004711 | |||
| 3220 | Ga0496103_0097106 | |||
| 3221 | Ga0496103_0162048 | |||
| 3222 | Ga0496103_0257291 | |||
| 3223 | Ga0496103_0526547 | |||
| 3224 | Ga0496103_0596968 | |||
| 3225 | Ga0496104_0011798 | |||
| 3226 | Ga0496104_0061869 | |||
| 3227 | Ga0496104_0095674 | |||
| 3228 | Ga0496104_0104033 | |||
| 3229 | Ga0496104_0111172 | |||
| 3230 | Ga0496104_0221746 | |||
| 3231 | Ga0496104_0305767 | |||
| 3232 | Ga0496104_0462893 | |||
| 3233 | Ga0496104_0744328 | |||
| 3234 | Ga0496105_0005357 | |||
| 3235 | Ga0496105_0009962 | |||
| 3236 | Ga0496105_0032243 | |||
| 3237 | Ga0496105_0041324 | |||
| 3238 | Ga0496105_0130588 | |||
| 3239 | Ga0496105_0264614 | |||
| 3240 | Ga0496105_0305435 | |||
| 3241 | Ga0496105_0632888 | |||
| 3242 | Ga0496106_0013199 | |||
| 3243 | Ga0496106_0022795 | |||
| 3244 | Ga0496106_0090402 | |||
| 3245 | Ga0496106_0096091 | |||
| 3246 | Ga0496106_0318223 | |||
| 3247 | Ga0496106_0487485 | |||
| 3248 | Ga0496107_0002760 | |||
| 3249 | Ga0496107_0003413 | |||
| 3250 | Ga0496107_0006653 | |||
| 3251 | Ga0496107_0021951 | |||
| 3252 | Ga0496107_0202341 | |||
| 3253 | Ga0496107_0245014 | |||
| 3254 | Ga0496107_0501895 | |||
| 3255 | Ga0496108_0004928 | |||
| 3256 | Ga0496108_0015890 | |||
| 3257 | Ga0496108_0026132 | |||
| 3258 | Ga0496108_0133142 | |||
| 3259 | Ga0496108_0133478 | |||
| 3260 | Ga0496108_0143137 | |||
| 3261 | Ga0496108_0915414 | |||
| 3262 | Ga0496108_0988769 | |||
| 3263 | Ga0496108_1470983 | |||
| 3264 | Ga0496109_0001903 | |||
| 3265 | Ga0496109_0005677 | |||
| 3266 | Ga0496109_0016587 | |||
| 3267 | Ga0496109_0017746 | |||
| 3268 | Ga0496109_0019250 | |||
| 3269 | Ga0496109_0021098 | |||
| 3270 | Ga0496109_0052346 | |||
| 3271 | Ga0496109_0170719 | |||
| 3272 | Ga0496109_0282753 | |||
| 3273 | Ga0496109_0434746 | |||
| 3274 | Ga0496109_0814742 | |||
| 3275 | Ga0496110_0013638 | |||
| 3276 | Ga0496110_0016283 | |||
| 3277 | Ga0496110_0163841 | |||
| 3278 | Ga0496110_0264251 | |||
| 3279 | Ga0496110_0341057 | |||
| 3280 | Ga0496110_1133343 | |||
| 3281 | Ga0496111_0034480 | |||
| 3282 | Ga0496111_0095359 | |||
| 3283 | Ga0496111_0166138 | |||
| 3284 | Ga0496111_0234273 | |||
| 3285 | Ga0496111_0365669 | |||
| 3286 | Ga0496111_0457767 | |||
| 3287 | Ga0496111_0546543 | |||
| 3288 | Ga0496111_0706616 | |||
| 3289 | Ga0496111_0766551 | |||
| 3290 | Ga0496112_0011988 | |||
| 3291 | Ga0496112_0019697 | |||
| 3292 | Ga0496112_0052475 | |||
| 3293 | Ga0496112_0052956 | |||
| 3294 | Ga0496112_0074134 | |||
| 3295 | Ga0496112_0077202 | |||
| 3296 | Ga0496112_0232347 | |||
| 3297 | Ga0496112_0422558 | |||
| 3298 | Ga0496112_0598062 | |||
| 3299 | Ga0496112_0828815 | |||
| 3300 | Ga0496112_1115158 | |||
| 3301 | Ga0496112_1223483 | |||
| 3302 | Ga0496112_1426237 | |||
| 3303 | Ga0496112_1432186 | |||
| 3304 | Ga0496112_1483996 | |||
| 3305 | Ga0496113_0045822 | |||
| 3306 | Ga0496113_0052705 | |||
| 3307 | Ga0496113_0059767 | |||
| 3308 | Ga0496113_0098779 | |||
| 3309 | Ga0496113_0147290 | |||
| 3310 | Ga0496113_0160344 | |||
| 3311 | Ga0496113_0169672 | |||
| 3312 | Ga0496113_0624364 | |||
| 3313 | Ga0496113_0746651 | |||
| 3314 | Ga0496113_1486267 | |||
| 3315 | Ga0496114_0000834 | |||
| 3316 | Ga0496114_0004372 | |||
| 3317 | Ga0496114_0007807 | |||
| 3318 | Ga0496114_0013651 | |||
| 3319 | Ga0496114_0014325 | |||
| 3320 | Ga0496114_0066430 | |||
| 3321 | Ga0496114_0136620 | |||
| 3322 | Ga0496114_0138969 | |||
| 3323 | Ga0496114_0180801 | |||
| 3324 | Ga0496114_0200608 | |||
| 3325 | Ga0496114_0266443 | |||
| 3326 | Ga0496114_0467514 | |||
| 3327 | Ga0496114_0743938 | |||
| 3328 | Ga0496115_0005284 | |||
| 3329 | Ga0496115_0008529 | |||
| 3330 | Ga0496115_0014758 | |||
| 3331 | Ga0496115_0035679 | |||
| 3332 | Ga0496115_0047746 | |||
| 3333 | Ga0496115_0060555 | |||
| 3334 | Ga0496115_0262416 | |||
| 3335 | Ga0496115_0765807 | |||
| 3336 | Ga0496117_0001293 | |||
| 3337 | Ga0496118_0003780 | |||
| 3338 | Ga0501031_0034996 | |||
| 3339 | Ga0501031_0318517 | |||
| 3340 | Ga0501032_0033341 | |||
| 3341 | Ga0501032_0103230 | |||
| 3342 | Ga0501032_0956928 | |||
| 3343 | Ga0501033_0025461 | |||
| 3344 | Ga0501033_0188642 | |||
| 3345 | Ga0501034_0003733 | |||
| 3346 | Ga0501036_0004381 | |||
| 3347 | Ga0501036_0011277 | |||
| 3348 | Ga0501036_0932620 | |||
| 3349 | Ga0501037_0027875 | |||
| 3350 | Ga0501037_0058673 | |||
| 3351 | Ga0501038_0110790 | |||
| 3352 | Ga0501039_0001728 | |||
| 3353 | Ga0501039_0014517 | |||
| 3354 | Ga0501039_0085454 | |||
| 3355 | Ga0501040_0007072 | |||
| 3356 | Ga0501040_0027145 | |||
| 3357 | Ga0501041_0001743 | |||
| 3358 | Ga0501041_0009330 | |||
| 3359 | Ga0501041_0409712 | |||
| 3360 | Ga0501042_0007798 | |||
| 3361 | Ga0501042_0012528 | |||
| 3362 | Ga0501042_0210425 | |||
| 3363 | Ga0501043_0037215 | |||
| 3364 | Ga0501043_0075925 | |||
| 3365 | Ga0501043_0221474 | |||
| 3366 | Ga0501046_0003055 | |||
| 3367 | Ga0501046_0030403 | |||
| 3368 | Ga0501046_0369712 | |||
| 3369 | Ga0501046_0658096 | |||
| 3370 | Ga0501047_0338500 | |||
| 3371 | Ga0501047_0384789 | |||
| 3372 | Ga0501047_0439677 | |||
| 3373 | Ga0501048_0003260 | |||
| 3374 | Ga0501048_0011917 | |||
| 3375 | Ga0501067_0149925 | |||
| 3376 | Ga0501067_0225539 | |||
| 3377 | Ga0501068_0057949 | |||
| 3378 | Ga0501068_0456394 | |||
| 3379 | Ga0501068_0919701 | |||
| 3380 | Ga0501068_1215203 | |||
| 3381 | Ga0501069_0081347 | |||
| 3382 | Ga0501069_0105249 | |||
| 3383 | Ga0501069_0120595 | |||
| 3384 | Ga0501069_0134660 | |||
| 3385 | Ga0501069_0158177 | |||
| 3386 | Ga0501070_0002828 | |||
| 3387 | Ga0501070_0005455 | |||
| 3388 | Ga0501070_0029111 | |||
| 3389 | Ga0501070_0126275 | |||
| 3390 | Ga0501070_0200069 | |||
| 3391 | Ga0501070_0305449 | |||
| 3392 | Ga0501070_0434904 | |||
| 3393 | Ga0501070_0480370 | |||
| 3394 | Ga0501071_0000277 | |||
| 3395 | Ga0501071_0008207 | |||
| 3396 | Ga0501071_0414863 | |||
| 3397 | Ga0501071_0789870 | |||
| 3398 | Ga0501072_0004354 | |||
| 3399 | Ga0501072_0047916 | |||
| 3400 | Ga0501073_0018647 | |||
| 3401 | Ga0501073_0095788 | |||
| 3402 | Ga0501073_0498176 | |||
| 3403 | Ga0501074_0020011 | |||
| 3404 | Ga0501074_0029384 | |||
| 3405 | Ga0501074_0058358 | |||
| 3406 | Ga0501074_0121443 | |||
| 3407 | Ga0501074_0138849 | |||
| 3408 | Ga0501074_0185230 | |||
| 3409 | Ga0501074_0814681 | |||
| 3410 | Ga0501074_0920129 | |||
| 3411 | Ga0501075_0001091 | |||
| 3412 | Ga0501075_0024275 | |||
| 3413 | Ga0501075_1366925 | |||
| 3414 | Ga0501076_0000783 | |||
| 3415 | Ga0501076_0003280 | |||
| 3416 | Ga0501076_0298773 | |||
| 3417 | Ga0501077_0012704 | |||
| 3418 | Ga0501077_0014064 | |||
| 3419 | Ga0501260_055002 | |||
| 3420 | Ga0501079_0001798 | |||
| 3421 | Ga0501079_0042906 | |||
| 3422 | Ga0501079_0118471 | |||
| 3423 | Ga0501079_0237828 | |||
| 3424 | Ga0501079_0626703 | |||
| 3425 | Ga0501080_0013910 | |||
| 3426 | Ga0501080_0014815 | |||
| 3427 | Ga0501080_0044173 | |||
| 3428 | Ga0501080_0105808 | |||
| 3429 | Ga0501080_0142451 | |||
| 3430 | Ga0501080_0417116 | |||
| 3431 | Ga0501080_0758669 | |||
| 3432 | Ga0501080_1744598 | |||
| 3433 | Ga0501081_0006597 | |||
| 3434 | Ga0501081_0012176 | |||
| 3435 | Ga0501083_0009961 | |||
| 3436 | Ga0501083_0050531 | |||
| 3437 | Ga0501083_0635229 | |||
| 3438 | Ga0501035_0019610 | |||
| 3439 | Ga0501035_0074026 | |||
| 3440 | Ga0501035_0242691 | |||
| 3441 | Ga0501035_0282411 | |||
| 3442 | Ga0501044_0082727 | |||
| 3443 | Ga0501044_0438339 | |||
| 3444 | Ga0501044_0919072 | |||
| 3445 | Ga0501045_0004806 | |||
| 3446 | Ga0501045_0007353 | |||
| 3447 | nmdc:mga03683_207527_c1 | |||
| 3448 | nmdc:mga03683_7319_c1 | |||
| 3449 | nmdc:mga00v17_14314_c1 | |||
| 3450 | nmdc:mga00v17_256446_c1 | |||
| 3451 | nmdc:mga0yw44_136119_c1 | |||
| 3452 | nmdc:mga0yw44_26552_c1 | |||
| 3453 | nmdc:mga0yw44_289946_c1 | |||
| 3454 | nmdc:mga0k408_192614_c1 | |||
| 3455 | nmdc:mga05p37_22675_c1 | |||
| 3456 | nmdc:mga05p37_370366_c2 | |||
| 3457 | nmdc:mga09592_5528_c1 | |||
| 3458 | nmdc:mga0qj67_7976_c1 | |||
| 3459 | nmdc:mga06r32_11474_c1 | |||
| 3460 | nmdc:mga06r32_871532_c1 | |||
| 3461 | nmdc:mga08y16_13386_c1 | |||
| 3462 | nmdc:mga08y16_168120_c1 | |||
| 3463 | nmdc:mga08y16_442593_c1 | |||
| 3464 | nmdc:mga0n895_170673_c1 | |||
| 3465 | nmdc:mga0n895_63942_c1 | |||
| 3466 | nmdc:mga0rr50_255123_c1 | |||
| 3467 | nmdc:mga0rr50_73328_c1 | |||
| 3468 | nmdc:mga0rr50_816097_c1 | |||
| 3469 | nmdc:mga08x19_752179_c1 | |||
| 3470 | nmdc:mga0a205_124281_c1 | |||
| 3471 | nmdc:mga0a205_267637_c1 | |||
| 3472 | Ga0495601_0014551 | |||
| 3473 | Ga0495601_0015827 | |||
| 3474 | Ga0495601_0068997 | |||
| 3475 | Ga0495601_0092630 | |||
| 3476 | Ga0495601_0199809 | |||
| 3477 | Ga0495601_0217627 | |||
| 3478 | Ga0495601_0288321 | |||
| 3479 | Ga0495601_0304523 | |||
| 3480 | Ga0495601_0373152 | |||
| 3481 | Ga0495601_0396892 | |||
| 3482 | Ga0495601_0617923 | |||
| 3483 | Ga0495612_0092361 | |||
| 3484 | Ga0495655_0001362 | |||
| 3485 | Ga0495595_0001437 | |||
| 3486 | Ga0495595_0099352 | |||
| 3487 | Ga0495595_0099621 | |||
| 3488 | Ga0495595_0100965 | |||
| 3489 | Ga0495619_0006989 | |||
| 3490 | Ga0495619_0009752 | |||
| 3491 | Ga0495619_0015204 | |||
| 3492 | Ga0495619_0068533 | |||
| 3493 | Ga0495619_0092706 | |||
| 3494 | Ga0495619_0100424 | |||
| 3495 | Ga0495619_0107768 | |||
| 3496 | Ga0495619_0131328 | |||
| 3497 | Ga0495619_0137619 | |||
| 3498 | Ga0495619_0245552 | |||
| 3499 | Ga0495619_0816926 | |||
| 3500 | Ga0501084_0002882 | |||
| 3501 | Ga0501084_0007645 | |||
| 3502 | Ga0501084_0163645 | |||
| 3503 | Ga0501084_0408257 | |||
| 3504 | Ga0590075_114676 | |||
| 3505 | Ga0590077_031419 | |||
| 3506 | Ga0587077_096519 | |||
| 3507 | Ga0587115_117978 | |||
| 3508 | Ga0501082_0012944 | |||
| 3509 | Ga0501082_0015327 | |||
| 3510 | Ga0501082_0471954 | |||
| 3511 | Ga0466962_0000131 | |||
| 3512 | Ga0466962_0020213 | |||
| 3513 | Ga0466962_0079384 | |||
| 3514 | Ga0466962_0081277 | |||
| 3515 | Ga0466962_0096637 | |||
| 3516 | Ga0466962_0100456 | |||
| 3517 | Ga0466962_0172679 | |||
| 3518 | Ga0466962_0448842 | |||
| 3519 | Ga0530510_0007435 | |||
| 3520 | Ga0530510_0014267 | |||
| 3521 | Ga0530510_0119285 | |||
| 3522 | Ga0530510_0196228 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7chj-assembly1.cif.gz_A | crystal structure of pco4 | 0.9163 | 28 | 116 |
| 6sbp-assembly1.cif.gz_A | plant cysteine oxidase pco5 from arabidopsis thaliana | 0.9085 | 28 | 116 |
| 7chi-assembly1.cif.gz_A | crystal structure of pco5 | 0.9046 | 28 | 116 |
| 6s7e-assembly1.cif.gz_A | plant cysteine oxidase pco4 from arabidopsis thaliana (using peg 3350 and naf as precipitants) | 0.904 | 28 | 116 |
| 6s0p-assembly1.cif.gz_A | plant cysteine oxidase pco4 from arabidopsis thaliana | 0.9001 | 28 | 123 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3rnsA01 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.8946 | 34 | 116 | 2.60.120.10 |
| af_P02858_394_558_2.60.120.10 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.8891 | 36 | 115 | 2.60.120.10 |
| af_A0A0R0GMV1_360_489_2.60.120.10 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.8835 | 36 | 115 | 2.60.120.10 |
| af_P17410_9_96_2.60.120.10 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.879 | 37 | 114 | 2.60.120.10 |
| 5fpxA00 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.8713 | 19 | 116 | 2.60.120.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7V8XFD1-F1-model_v4 | Cupin | 0.9855 | 5 | 136 |
GO:0005976
GO:0016779 |
| AF-A0A318S3Q0-F1-model_v4 | Mannose-6-phosphate isomerase-like protein (Cupin superfamily) | 0.9838 | 14 | 132 |
GO:0016853
|
| AF-A0A7W1R1K1-F1-model_v4 | Cupin | 0.9834 | 38 | 136 |
GO:0005976
GO:0016779 |
| AF-A0A2M8F5G2-F1-model_v4 | Cupin | 0.9797 | 14 | 129 |
GO:0005976
GO:0016779 |
| AF-A0A1Q7RFH7-F1-model_v4 | Cupin | 0.9767 | 16 | 130 |
GO:0005976
GO:0016779 |