F495614

General Info

Members Datasets Scaffolds Average Seq Length
1761 441 3522 136

Family's Representative Sequence

Representative Sequence 3300028563|Ga0265319_1013800|Ga0265319_10138003
Length 160
Sequence MARLTAARPGGDCGTGSGCERIGDVSIDSPNIQSLERWSFDVRRVEKPWGYELIWALTDVYCGKVLFVRAGQSLSLQFHNEKDESWLVQSGRAKLELGEAGKGVLMHEVVQAGAAFHYVPGTVHRVTAIEDTTILEVSTPHLDDVVRLEDAYGREGTSAP

Samples

Sample ID Description Type Environment
1 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
2 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
3 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
4 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
28 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
29 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
30 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
31 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
32 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
33 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
34 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
35 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
36 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
37 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
38 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
39 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
40 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
41 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
42 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
43 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
44 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
45 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
46 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
47 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
48 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
49 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
50 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
51 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
52 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
53 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
54 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
55 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
56 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
57 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
58 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
59 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
60 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
61 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
62 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
63 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
64 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
65 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
66 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
67 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
68 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
69 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
70 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
71 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
72 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
73 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
74 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
75 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
76 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
77 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
78 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
79 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
80 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
81 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
82 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
83 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
84 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
85 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
86 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
87 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
88 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
89 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
90 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
91 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
92 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
93 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
94 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
95 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
96 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
97 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
98 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
99 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
100 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
101 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
102 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
103 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
104 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
105 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
106 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
107 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
108 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
109 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
110 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
111 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
112 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
113 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
114 3300012483 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610 Metagenome Rhizosphere
115 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
116 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
117 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
118 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
119 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
120 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
121 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
122 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
123 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
124 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
125 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
126 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
127 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
128 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
129 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
130 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
131 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
132 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
133 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
134 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
135 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
136 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
137 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
192 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
195 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
196 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
197 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
198 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
199 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
200 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
201 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
202 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
203 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
204 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
205 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
206 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
207 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
208 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
209 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
210 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
211 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
212 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
213 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
214 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
215 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
216 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
217 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
218 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
219 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
220 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
221 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
222 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
223 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
224 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
225 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
226 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
227 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
228 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
229 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
230 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
231 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
232 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
233 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
234 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
235 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
236 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
237 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
238 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
239 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
240 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
241 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
242 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
243 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
244 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
245 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
246 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
247 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
248 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
249 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
250 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
251 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
252 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
253 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
254 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
255 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
256 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
257 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
258 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
259 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
260 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
261 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
262 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
263 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
264 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
265 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
266 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
267 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
268 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
269 3300042119 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218L_E14_082316_1902 Metagenome Rhizosphere
270 3300042120 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 Metagenome Rhizosphere
271 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
272 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
273 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
274 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
275 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
276 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
277 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
278 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
279 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
280 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
281 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
282 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
283 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
284 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
285 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
286 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
287 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
288 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
289 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
290 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
291 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
292 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
293 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
294 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
295 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
296 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
297 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
298 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
299 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
300 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
301 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
302 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
303 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
304 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
305 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
306 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
307 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
308 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
309 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
310 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
311 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
312 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
313 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
314 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
315 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
316 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
317 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
318 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
319 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
320 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
321 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
322 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
323 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
324 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
325 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
326 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
327 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
328 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
329 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
330 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
331 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
332 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
333 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
334 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
335 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
336 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
337 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
338 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
339 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
340 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
341 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
342 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
343 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
344 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
345 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
346 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
347 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
348 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
349 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
350 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
351 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
352 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
353 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
354 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
355 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
356 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
357 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
358 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
359 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
360 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
361 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
362 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
363 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
364 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
365 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
366 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
367 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
368 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
369 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
370 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
371 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
372 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
373 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
374 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
375 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
376 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
377 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
378 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
379 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
380 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
381 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
382 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
383 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
384 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
385 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
386 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
387 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
388 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
389 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
390 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
391 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
392 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
393 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
394 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
395 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
396 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
397 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
398 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
399 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
400 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
401 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
402 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
403 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
404 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
405 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
406 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
407 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
408 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
409 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
410 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
411 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
412 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
413 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
414 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
415 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
416 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
417 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
418 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
419 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
420 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
421 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
422 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
423 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
424 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
425 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
426 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
427 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
428 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
429 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
430 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
431 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
432 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
433 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
434 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
435 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
436 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
437 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
438 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
439 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
440 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
441 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.98
Metatranscriptomes 1.02
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.97
Nodule 0
Rhizoplane 8.52
Rhizosphere 89.55
Stem 0
Stem Tuber 0
Unclassified 14.03

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265319_1013800 3300028563 Bacteria 3194
2 JGI24744J21845_10000960 3300002077 Bacteria 5496
3 JGI25407J50210_10001824 3300003373 Bacteria 4919
4 JGI25405J52794_10055301 3300003911 Unclassified 854
5 Ga0070658_10024594 3300005327 Bacteria 4830
6 Ga0070658_10098314 3300005327 Bacteria 2417
7 Ga0070658_10132667 3300005327 Bacteria 2076
8 Ga0070658_10288314 3300005327 Bacteria 1398
9 Ga0070658_10540868 3300005327 Unclassified 1008
10 Ga0070658_10868323 3300005327 Bacteria 784
11 Ga0070658_11094837 3300005327 Bacteria 693
12 Ga0070658_11248204 3300005327 Unclassified 646
13 Ga0070658_11400022 3300005327 Bacteria 607
14 Ga0070683_100001652 3300005329 Bacteria 17281
15 Ga0070683_100017233 3300005329 Bacteria 6381
16 Ga0070683_100060391 3300005329 Bacteria 3523
17 Ga0070683_100164114 3300005329 Bacteria 2108
18 Ga0070683_100186421 3300005329 Bacteria 1969
19 Ga0070683_100238216 3300005329 Bacteria 1730
20 Ga0070683_100296896 3300005329 Unclassified 1537
21 Ga0070683_100701841 3300005329 Bacteria 969
22 Ga0070683_101947625 3300005329 Unclassified 565
23 Ga0070683_102002313 3300005329 Bacteria 556
24 Ga0070690_100019255 3300005330 Bacteria 4138
25 Ga0070690_101352298 3300005330 Bacteria 572
26 Ga0070666_11212485 3300005335 Bacteria 562
27 Ga0070680_100008118 3300005336 Bacteria 8016
28 Ga0070680_100153672 3300005336 Bacteria 1933
29 Ga0070680_100154767 3300005336 Bacteria 1925
30 Ga0070680_100951145 3300005336 Bacteria 741
31 Ga0070680_101216723 3300005336 Bacteria 652
32 Ga0070682_100014196 3300005337 Bacteria 4600
33 Ga0070682_100155954 3300005337 Bacteria 1572
34 Ga0070682_100529155 3300005337 Bacteria 918
35 Ga0070682_100722819 3300005337 Bacteria 801
36 Ga0070682_100778455 3300005337 Bacteria 775
37 Ga0068868_100010092 3300005338 Bacteria 6822
38 Ga0068868_100027493 3300005338 Bacteria 4340
39 Ga0068868_100358715 3300005338 Unclassified 1250
40 Ga0070660_100006026 3300005339 Bacteria 8384
41 Ga0070660_100016383 3300005339 Bacteria 5379
42 Ga0070660_100035757 3300005339 Bacteria 3760
43 Ga0070660_100044741 3300005339 Bacteria 3387
44 Ga0070660_100055265 3300005339 Bacteria 3068
45 Ga0070660_100330381 3300005339 Bacteria 1253
46 Ga0070660_100533962 3300005339 Unclassified 978
47 Ga0070689_100006812 3300005340 Bacteria 7946
48 Ga0070691_10213769 3300005341 Bacteria 1019
49 Ga0070687_100282156 3300005343 Bacteria 1046
50 Ga0070687_100892703 3300005343 Bacteria 637
51 Ga0070661_100062932 3300005344 Bacteria 2724
52 Ga0070661_100217140 3300005344 Bacteria 1465
53 Ga0070661_101046311 3300005344 Bacteria 678
54 Ga0070692_10007346 3300005345 Bacteria 4850
55 Ga0070692_10674027 3300005345 Unclassified 693
56 Ga0070668_100026182 3300005347 Bacteria 4424
57 Ga0070668_100563009 3300005347 Bacteria 993
58 Ga0070669_101553195 3300005353 Bacteria 576
59 Ga0070669_101762271 3300005353 Bacteria 540
60 Ga0070675_100037741 3300005354 Bacteria 3937
61 Ga0070675_101476484 3300005354 Bacteria 627
62 Ga0070671_100015983 3300005355 Bacteria 6063
63 Ga0070671_100088093 3300005355 Bacteria 2598
64 Ga0070674_100007583 3300005356 Bacteria 6406
65 Ga0070674_100470683 3300005356 Unclassified 1041
66 Ga0070673_100148872 3300005364 Bacteria 1981
67 Ga0070673_100205245 3300005364 Bacteria 1699
68 Ga0070688_100524924 3300005365 Bacteria 896
69 Ga0070659_100033126 3300005366 Bacteria 4011
70 Ga0070659_100038472 3300005366 Bacteria 3731
71 Ga0070659_100374884 3300005366 Bacteria 1198
72 Ga0070659_100444071 3300005366 Bacteria 1099
73 Ga0070667_100179863 3300005367 Bacteria 1870
74 Ga0070667_100894857 3300005367 Bacteria 826
75 Ga0070667_101122528 3300005367 Bacteria 735
76 Ga0070703_10139602 3300005406 Bacteria 899
77 Ga0070709_10011026 3300005434 Bacteria 5022
78 Ga0070709_10026548 3300005434 Bacteria 3434
79 Ga0070709_10348405 3300005434 Unclassified 1094
80 Ga0070709_10503170 3300005434 Bacteria 921
81 Ga0070709_10972906 3300005434 Bacteria 674
82 Ga0070709_11124988 3300005434 Bacteria 629
83 Ga0070714_100028276 3300005435 Bacteria 4650
84 Ga0070714_100032738 3300005435 Bacteria 4341
85 Ga0070714_100178964 3300005435 Bacteria 1928
86 Ga0070714_100266861 3300005435 Bacteria 1586
87 Ga0070714_100388779 3300005435 Bacteria 1316
88 Ga0070714_100657281 3300005435 Bacteria 1009
89 Ga0070714_100911235 3300005435 Bacteria 854
90 Ga0070714_101135771 3300005435 Unclassified 762
91 Ga0070714_101865845 3300005435 Bacteria 587
92 Ga0070714_102220530 3300005435 Unclassified 534
93 Ga0070713_100013778 3300005436 Bacteria 5981
94 Ga0070713_100037697 3300005436 Bacteria 3909
95 Ga0070713_100115959 3300005436 Bacteria 2342
96 Ga0070713_100213048 3300005436 Bacteria 1750
97 Ga0070713_100495133 3300005436 Bacteria 1153
98 Ga0070713_100595507 3300005436 Unclassified 1050
99 Ga0070713_100954908 3300005436 Bacteria 826
100 Ga0070710_10008474 3300005437 Bacteria 5006
101 Ga0070710_10054659 3300005437 Bacteria 2253
102 Ga0070710_10201695 3300005437 Bacteria 1256
103 Ga0070710_10430744 3300005437 Bacteria 890
104 Ga0070710_10588400 3300005437 Unclassified 773
105 Ga0070710_10759654 3300005437 Bacteria 689
106 Ga0070701_10033849 3300005438 Bacteria 2556
107 Ga0070711_100001520 3300005439 Bacteria 12784
108 Ga0070711_100023649 3300005439 Bacteria 3999
109 Ga0070711_100093336 3300005439 Bacteria 2173
110 Ga0070711_100173984 3300005439 Unclassified 1643
111 Ga0070711_100355951 3300005439 Bacteria 1178
112 Ga0070711_100582484 3300005439 Unclassified 932
113 Ga0070711_101523951 3300005439 Bacteria 583
114 Ga0070705_100050250 3300005440 Bacteria 2425
115 Ga0070705_100307046 3300005440 Bacteria 1139
116 Ga0070705_100401145 3300005440 Bacteria 1015
117 Ga0070705_100441714 3300005440 Bacteria 974
118 Ga0070700_100001889 3300005441 Bacteria 10586
119 Ga0070700_100455269 3300005441 Unclassified 975
120 Ga0070694_100020934 3300005444 Bacteria 4174
121 Ga0070694_100113732 3300005444 Bacteria 1932
122 Ga0070708_100023451 3300005445 Bacteria 5248
123 Ga0070708_101330169 3300005445 Bacteria 671
124 Ga0070663_100003865 3300005455 Bacteria 8726
125 Ga0070663_100558516 3300005455 Bacteria 958
126 Ga0070678_100009983 3300005456 Bacteria 5776
127 Ga0070678_100530684 3300005456 Unclassified 1042
128 Ga0070678_100566677 3300005456 Bacteria 1010
129 Ga0070678_100741977 3300005456 Bacteria 887
130 Ga0070678_102199550 3300005456 Unclassified 523
131 Ga0070662_100622182 3300005457 Bacteria 909
132 Ga0070662_101283885 3300005457 Bacteria 630
133 Ga0070681_10021240 3300005458 Bacteria 6506
134 Ga0070681_10022909 3300005458 Bacteria 6276
135 Ga0070681_10031175 3300005458 Bacteria 5351
136 Ga0070681_10047668 3300005458 Bacteria 4284
137 Ga0070681_10050995 3300005458 Bacteria 4128
138 Ga0070681_10099226 3300005458 Bacteria 2858
139 Ga0070681_10183871 3300005458 Bacteria 2011
140 Ga0070681_10215955 3300005458 Bacteria 1834
141 Ga0070681_10281512 3300005458 Bacteria 1573
142 Ga0070681_10310396 3300005458 Bacteria 1487
143 Ga0070681_10949764 3300005458 Bacteria 779
144 Ga0068867_100002920 3300005459 Bacteria 12048
145 Ga0068867_100515956 3300005459 Bacteria 1030
146 Ga0070706_100206032 3300005467 Bacteria 1837
147 Ga0070706_100482002 3300005467 Bacteria 1154
148 Ga0070707_100002419 3300005468 Bacteria 17795
149 Ga0070707_100067070 3300005468 Bacteria 3451
150 Ga0070707_100127311 3300005468 Unclassified 2475
151 Ga0070707_100329462 3300005468 Bacteria 1483
152 Ga0070707_101262787 3300005468 Unclassified 705
153 Ga0070698_100016387 3300005471 Bacteria 7825
154 Ga0070698_100017977 3300005471 Bacteria 7445
155 Ga0070698_100197928 3300005471 Bacteria 1945
156 Ga0070698_102061150 3300005471 Unclassified 524
157 Ga0070699_100053515 3300005518 Bacteria 3493
158 Ga0070699_100062020 3300005518 Unclassified 3240
159 Ga0070699_100383779 3300005518 Bacteria 1269
160 Ga0070699_100508273 3300005518 Bacteria 1095
161 Ga0070679_100002604 3300005530 Bacteria 16412
162 Ga0070679_100072801 3300005530 Bacteria 3429
163 Ga0070679_100074082 3300005530 Bacteria 3395
164 Ga0070679_100077707 3300005530 Bacteria 3309
165 Ga0070679_100138708 3300005530 Bacteria 2412
166 Ga0070679_100161901 3300005530 Bacteria 2212
167 Ga0070679_100166241 3300005530 Bacteria 2179
168 Ga0070679_100203356 3300005530 Bacteria 1945
169 Ga0070679_100315289 3300005530 Bacteria 1513
170 Ga0070679_100429186 3300005530 Bacteria 1267
171 Ga0070679_100798995 3300005530 Bacteria 887
172 Ga0070679_101290883 3300005530 Bacteria 676
173 Ga0070679_101337935 3300005530 Unclassified 662
174 Ga0070679_101902483 3300005530 Bacteria 544
175 Ga0070684_100022931 3300005535 Bacteria 5214
176 Ga0070684_100027893 3300005535 Bacteria 4771
177 Ga0070684_100100928 3300005535 Bacteria 2578
178 Ga0070684_100101097 3300005535 Bacteria 2576
179 Ga0070684_100119575 3300005535 Bacteria 2369
180 Ga0070684_100236949 3300005535 Bacteria 1667
181 Ga0070684_100322093 3300005535 Bacteria 1420
182 Ga0070697_100221110 3300005536 Bacteria 1614
183 Ga0070697_100232065 3300005536 Bacteria 1574
184 Ga0070697_101134415 3300005536 Bacteria 696
185 Ga0068853_100044117 3300005539 Bacteria 3816
186 Ga0068853_100140662 3300005539 Bacteria 2166
187 Ga0068853_100712984 3300005539 Bacteria 957
188 Ga0068853_101255591 3300005539 Bacteria 716
189 Ga0068853_101267975 3300005539 Bacteria 712
190 Ga0068853_101356012 3300005539 Bacteria 688
191 Ga0070672_100014159 3300005543 Bacteria 5644
192 Ga0070686_100003711 3300005544 Bacteria 8393
193 Ga0070695_100000691 3300005545 Bacteria 18047
194 Ga0070695_100042188 3300005545 Bacteria 2895
195 Ga0070695_100141937 3300005545 Unclassified 1666
196 Ga0070695_100142749 3300005545 Bacteria 1662
197 Ga0070696_100020674 3300005546 Bacteria 4461
198 Ga0070696_100062600 3300005546 Bacteria 2604
199 Ga0070696_100213638 3300005546 Unclassified 1445
200 Ga0070696_101250719 3300005546 Bacteria 629
201 Ga0070693_100124306 3300005547 Bacteria 1604
202 Ga0070665_100045306 3300005548 Bacteria 4418
203 Ga0070665_100310022 3300005548 Bacteria 1582
204 Ga0070665_100338765 3300005548 Bacteria 1508
205 Ga0070704_100009470 3300005549 Bacteria 5886
206 Ga0070704_100031449 3300005549 Bacteria 3570
207 Ga0070704_100081794 3300005549 Bacteria 2380
208 Ga0070704_101862636 3300005549 Unclassified 557
209 Ga0068855_100005599 3300005563 Bacteria 15336
210 Ga0068855_100071082 3300005563 Bacteria 4047
211 Ga0068855_100076427 3300005563 Bacteria 3886
212 Ga0068855_100192962 3300005563 Bacteria 2296
213 Ga0068855_100200635 3300005563 Unclassified 2245
214 Ga0068855_100248330 3300005563 Bacteria 1985
215 Ga0068855_100254836 3300005563 Bacteria 1956
216 Ga0068855_100264783 3300005563 Bacteria 1914
217 Ga0068855_100387366 3300005563 Bacteria 1534
218 Ga0068855_100481544 3300005563 Bacteria 1351
219 Ga0068855_100606051 3300005563 Bacteria 1180
220 Ga0070664_100778101 3300005564 Bacteria 894
221 Ga0070664_100934191 3300005564 Bacteria 814
222 Ga0070664_101134218 3300005564 Bacteria 737
223 Ga0068857_100007740 3300005577 Bacteria 9255
224 Ga0068857_100043448 3300005577 Bacteria 3986
225 Ga0068857_100131252 3300005577 Bacteria 2260
226 Ga0068857_100308824 3300005577 Bacteria 1459
227 Ga0068857_100507964 3300005577 Bacteria 1132
228 Ga0068854_100657788 3300005578 Bacteria 900
229 Ga0068856_100014835 3300005614 Bacteria 7520
230 Ga0068856_100109583 3300005614 Bacteria 2757
231 Ga0068856_100217295 3300005614 Bacteria 1927
232 Ga0068856_100281439 3300005614 Bacteria 1680
233 Ga0068856_100389413 3300005614 Bacteria 1413
234 Ga0070702_100080089 3300005615 Bacteria 1953
235 Ga0070702_100107332 3300005615 Bacteria 1724
236 Ga0070702_100346172 3300005615 Bacteria 1045
237 Ga0068852_100057219 3300005616 Bacteria 3373
238 Ga0068852_100373780 3300005616 Bacteria 1397
239 Ga0068852_100655178 3300005616 Unclassified 1058
240 Ga0068859_100229612 3300005617 Bacteria 1944
241 Ga0068864_100275486 3300005618 Bacteria 1569
242 Ga0068866_10182170 3300005718 Bacteria 1242
243 Ga0068866_10430769 3300005718 Bacteria 858
244 Ga0068861_100050711 3300005719 Bacteria 3148
245 Ga0068861_100136400 3300005719 Bacteria 1997
246 Ga0068851_10805172 3300005834 Bacteria 584
247 Ga0068863_100297160 3300005841 Bacteria 1566
248 Ga0068863_101481101 3300005841 Bacteria 687
249 Ga0068860_100067587 3300005843 Bacteria 3395
250 Ga0068860_101009480 3300005843 Bacteria 850
251 Ga0068862_100954482 3300005844 Unclassified 846
252 Ga0068862_101037874 3300005844 Bacteria 812
253 Ga0081455_10003877 3300005937 Bacteria 17035
254 Ga0081455_10007079 3300005937 Bacteria 11900
255 Ga0081455_10025023 3300005937 Bacteria 5515
256 Ga0081455_10102019 3300005937 Bacteria 2302
257 Ga0081455_10124214 3300005937 Bacteria 2028
258 Ga0081455_10175429 3300005937 Bacteria 1628
259 Ga0081455_10649859 3300005937 Bacteria 679
260 Ga0081538_10000012 3300005981 Bacteria 153046
261 Ga0081538_10000078 3300005981 Bacteria 92826
262 Ga0081538_10001260 3300005981 Bacteria 26428
263 Ga0081538_10002330 3300005981 Bacteria 18723
264 Ga0081538_10042481 3300005981 Bacteria 2868
265 Ga0081540_1000116 3300005983 Bacteria 84152
266 Ga0070717_10006695 3300006028 Bacteria 8499
267 Ga0070717_10009605 3300006028 Bacteria 7279
268 Ga0070717_10027420 3300006028 Bacteria 4553
269 Ga0070717_10049312 3300006028 Bacteria 3456
270 Ga0070717_10094914 3300006028 Bacteria 2524
271 Ga0070717_10345788 3300006028 Bacteria 1329
272 Ga0070717_10403668 3300006028 Bacteria 1228
273 Ga0070717_10590095 3300006028 Unclassified 1008
274 Ga0070717_10650705 3300006028 Bacteria 957
275 Ga0070717_10712468 3300006028 Bacteria 912
276 Ga0075365_10101165 3300006038 Bacteria 1973
277 Ga0075365_10195851 3300006038 Bacteria 1415
278 Ga0075363_100381614 3300006048 Unclassified 826
279 Ga0075363_100818780 3300006048 Unclassified 567
280 Ga0075364_10001371 3300006051 Bacteria 13151
281 Ga0075364_10841640 3300006051 Bacteria 625
282 Ga0070715_10001548 3300006163 Bacteria 6735
283 Ga0070715_10009984 3300006163 Bacteria 3368
284 Ga0070716_100016873 3300006173 Bacteria 3776
285 Ga0070716_100040809 3300006173 Archaea 2583
286 Ga0070716_100073522 3300006173 Bacteria 2017
287 Ga0070712_100029829 3300006175 Bacteria 3660
288 Ga0070712_100043886 3300006175 Bacteria 3080
289 Ga0070712_100059409 3300006175 Bacteria 2693
290 Ga0070712_100061449 3300006175 Bacteria 2654
291 Ga0070712_100375737 3300006175 Unclassified 1169
292 Ga0070712_100510274 3300006175 Bacteria 1009
293 Ga0070712_100561746 3300006175 Bacteria 962
294 Ga0070712_100810849 3300006175 Bacteria 803
295 Ga0070712_101184656 3300006175 Bacteria 664
296 Ga0075362_10027773 3300006177 Bacteria 2425
297 Ga0075367_10415664 3300006178 Bacteria 851
298 Ga0075366_10184632 3300006195 Unclassified 1267
299 Ga0097621_100490334 3300006237 Bacteria 1112
300 Ga0097621_100837618 3300006237 Unclassified 854
301 Ga0097621_101468119 3300006237 Bacteria 647
302 Ga0068871_100170604 3300006358 Bacteria 1865
303 Ga0068871_101767907 3300006358 Bacteria 587
304 Ga0075428_100040344 3300006844 Bacteria 5136
305 Ga0075430_100006540 3300006846 Bacteria 9829
306 Ga0075430_100026469 3300006846 Bacteria 4934
307 Ga0075431_100013118 3300006847 Bacteria 8373
308 Ga0075431_100442740 3300006847 Bacteria 1296
309 Ga0075433_10017067 3300006852 Bacteria 6002
310 Ga0075433_10026810 3300006852 Bacteria 4883
311 Ga0075433_10121657 3300006852 Bacteria 2318
312 Ga0075433_10547873 3300006852 Unclassified 1017
313 Ga0075433_11106208 3300006852 Bacteria 689
314 Ga0075434_100032514 3300006871 Bacteria 5144
315 Ga0075434_100063037 3300006871 Bacteria 3690
316 Ga0075434_100133540 3300006871 Bacteria 2501
317 Ga0075434_100216440 3300006871 Bacteria 1936
318 Ga0075434_100786585 3300006871 Bacteria 968
319 Ga0075429_100009626 3300006880 Bacteria 8383
320 Ga0068865_100007182 3300006881 Bacteria 6840
321 Ga0068865_100290110 3300006881 Bacteria 1306
322 Ga0068865_100300021 3300006881 Bacteria 1285
323 Ga0068865_100420595 3300006881 Bacteria 1099
324 Ga0068865_100890978 3300006881 Bacteria 773
325 Ga0075436_100021159 3300006914 Bacteria 4463
326 Ga0075436_100028623 3300006914 Bacteria 3833
327 Ga0097620_100229628 3300006931 Bacteria 1944
328 Ga0075435_100024010 3300007076 Bacteria 4725
329 Ga0075435_100061568 3300007076 Bacteria 3045
330 Ga0075435_100084943 3300007076 Bacteria 2605
331 Ga0075435_100142487 3300007076 Bacteria 2011
332 Ga0105251_10574308 3300009011 Bacteria 533
333 Ga0105244_10088778 3300009036 Bacteria 1522
334 Ga0105240_10010904 3300009093 Bacteria 12734
335 Ga0105240_10016187 3300009093 Bacteria 10106
336 Ga0105240_10033728 3300009093 Bacteria 6610
337 Ga0105240_10160432 3300009093 Bacteria 2671
338 Ga0105240_10390751 3300009093 Bacteria 1569
339 Ga0105240_10452674 3300009093 Bacteria 1436
340 Ga0105240_10508609 3300009093 Unclassified 1338
341 Ga0105240_11581991 3300009093 Unclassified 686
342 Ga0111539_10044312 3300009094 Bacteria 5330
343 Ga0111539_10191336 3300009094 Bacteria 2387
344 Ga0111539_10442030 3300009094 Bacteria 1514
345 Ga0111539_10518157 3300009094 Bacteria 1389
346 Ga0111539_10816133 3300009094 Bacteria 1085
347 Ga0111539_11243655 3300009094 Bacteria 864
348 Ga0105245_10012468 3300009098 Bacteria 7396
349 Ga0105245_10070234 3300009098 Bacteria 3177
350 Ga0105245_10119963 3300009098 Bacteria 2455
351 Ga0105245_10188190 3300009098 Bacteria 1976
352 Ga0105245_10280652 3300009098 Bacteria 1628
353 Ga0105245_11266626 3300009098 Bacteria 786
354 Ga0105245_11860478 3300009098 Bacteria 655
355 Ga0105245_12296602 3300009098 Unclassified 593
356 Ga0105245_12302965 3300009098 Bacteria 592
357 Ga0105245_13066406 3300009098 Bacteria 518
358 Ga0105247_10026522 3300009101 Bacteria 3499
359 Ga0114129_10065208 3300009147 Bacteria 5083
360 Ga0114129_10087913 3300009147 Bacteria 4309
361 Ga0114129_10172141 3300009147 Bacteria 2951
362 Ga0114129_10507177 3300009147 Bacteria 1575
363 Ga0114129_11433331 3300009147 Bacteria 851
364 Ga0114129_11667125 3300009147 Bacteria 779
365 Ga0105243_10044346 3300009148 Bacteria 3489
366 Ga0105243_10169796 3300009148 Bacteria 1888
367 Ga0105243_10343153 3300009148 Bacteria 1369
368 Ga0105243_11092827 3300009148 Bacteria 805
369 Ga0105241_10014582 3300009174 Bacteria 5756
370 Ga0105241_10082598 3300009174 Bacteria 2519
371 Ga0105241_10643072 3300009174 Bacteria 962
372 Ga0105241_10897852 3300009174 Unclassified 823
373 Ga0105241_12208815 3300009174 Bacteria 546
374 Ga0105242_10082032 3300009176 Bacteria 2698
375 Ga0105242_10085846 3300009176 Bacteria 2640
376 Ga0105242_10157190 3300009176 Unclassified 1987
377 Ga0105242_10212648 3300009176 Bacteria 1724
378 Ga0105242_10241859 3300009176 Bacteria 1623
379 Ga0105242_10368737 3300009176 Bacteria 1331
380 Ga0105242_10574160 3300009176 Bacteria 1085
381 Ga0105242_11721043 3300009176 Bacteria 664
382 Ga0105242_13274448 3300009176 Bacteria 503
383 Ga0105248_10045187 3300009177 Bacteria 4939
384 Ga0105248_10045265 3300009177 Bacteria 4935
385 Ga0105248_11488110 3300009177 Unclassified 766
386 Ga0105237_10027161 3300009545 Bacteria 5846
387 Ga0105237_10054796 3300009545 Bacteria 3995
388 Ga0105237_10089459 3300009545 Bacteria 3068
389 Ga0105237_10503301 3300009545 Bacteria 1218
390 Ga0105237_10784243 3300009545 Bacteria 960
391 Ga0105238_10066774 3300009551 Bacteria 3598
392 Ga0105238_10105267 3300009551 Bacteria 2803
393 Ga0105238_10527386 3300009551 Bacteria 1184
394 Ga0105238_12045809 3300009551 Bacteria 607
395 Ga0105249_10002311 3300009553 Bacteria 16556
396 Ga0105249_10142322 3300009553 Bacteria 2301
397 Ga0105239_10109788 3300010375 Bacteria 3057
398 Ga0105239_10146373 3300010375 Bacteria 2635
399 Ga0105239_10253720 3300010375 Bacteria 1976
400 Ga0105239_10759394 3300010375 Bacteria 1110
401 Ga0105239_10829290 3300010375 Bacteria 1060
402 Ga0105239_10890811 3300010375 Bacteria 1021
403 Ga0105239_11481799 3300010375 Bacteria 784
404 Ga0105246_10042425 3300011119 Bacteria 3081
405 Ga0105246_10154305 3300011119 Bacteria 1742
406 Ga0105246_10350141 3300011119 Bacteria 1210
407 Ga0105246_10403802 3300011119 Bacteria 1135
408 Ga0105246_10603213 3300011119 Unclassified 949
409 Ga0105246_11850611 3300011119 Bacteria 578
410 Ga0157337_1025093 3300012483 Bacteria 577
411 Ga0157373_10305154 3300013100 Bacteria 1130
412 Ga0157371_10061380 3300013102 Bacteria 2665
413 Ga0157371_10339801 3300013102 Bacteria 1092
414 Ga0157371_11504605 3300013102 Bacteria 525
415 Ga0157370_10007783 3300013104 Bacteria 11617
416 Ga0157370_10028661 3300013104 Bacteria 5475
417 Ga0157370_10070188 3300013104 Bacteria 3308
418 Ga0157370_10234264 3300013104 Bacteria 1699
419 Ga0157370_10272896 3300013104 Unclassified 1562
420 Ga0157370_10797342 3300013104 Unclassified 859
421 Ga0157370_11067564 3300013104 Unclassified 730
422 Ga0157369_10005385 3300013105 Bacteria 14901
423 Ga0157369_10067238 3300013105 Bacteria 3854
424 Ga0157369_10113649 3300013105 Bacteria 2876
425 Ga0157369_10131550 3300013105 Bacteria 2651
426 Ga0157369_10353190 3300013105 Bacteria 1527
427 Ga0157369_10368586 3300013105 Bacteria 1491
428 Ga0157369_10458950 3300013105 Bacteria 1319
429 Ga0157369_10642757 3300013105 Bacteria 1094
430 Ga0157369_10696725 3300013105 Unclassified 1046
431 Ga0157369_10814064 3300013105 Bacteria 959
432 Ga0157369_11079524 3300013105 Unclassified 821
433 Ga0157369_11122821 3300013105 Bacteria 803
434 Ga0157369_11198070 3300013105 Unclassified 775
435 Ga0157369_11469115 3300013105 Bacteria 694
436 Ga0157369_11623934 3300013105 Unclassified 657
437 Ga0157374_10113993 3300013296 Bacteria 2602
438 Ga0157374_10138765 3300013296 Bacteria 2359
439 Ga0157374_10280588 3300013296 Bacteria 1645
440 Ga0157374_10537651 3300013296 Unclassified 1176
441 Ga0157374_10759110 3300013296 Bacteria 985
442 Ga0157374_12793686 3300013296 Bacteria 516
443 Ga0157378_10021004 3300013297 Bacteria 5744
444 Ga0157378_10087210 3300013297 Bacteria 2831
445 Ga0157378_10408102 3300013297 Bacteria 1340
446 Ga0157378_10536445 3300013297 Bacteria 1174
447 Ga0163162_10004416 3300013306 Bacteria 13536
448 Ga0163162_10343122 3300013306 Bacteria 1626
449 Ga0163162_10560935 3300013306 Bacteria 1270
450 Ga0157372_10026695 3300013307 Bacteria 6286
451 Ga0157372_10149581 3300013307 Bacteria 2694
452 Ga0157372_10217095 3300013307 Bacteria 2217
453 Ga0157372_10314311 3300013307 Bacteria 1823
454 Ga0157372_10931619 3300013307 Bacteria 1007
455 Ga0157372_11104666 3300013307 Bacteria 917
456 Ga0157372_11321390 3300013307 Bacteria 832
457 Ga0157372_11843288 3300013307 Bacteria 695
458 Ga0157372_13401283 3300013307 Bacteria 506
459 Ga0157375_10192709 3300013308 Bacteria 2193
460 Ga0157375_10244167 3300013308 Bacteria 1955
461 Ga0157375_10272096 3300013308 Bacteria 1856
462 Ga0157375_10779489 3300013308 Unclassified 1106
463 Ga0163163_11323794 3300014325 Bacteria 782
464 Ga0163163_11632325 3300014325 Bacteria 706
465 Ga0163163_11692322 3300014325 Bacteria 693
466 Ga0182008_10109139 3300014497 Unclassified 1371
467 Ga0157377_10025713 3300014745 Bacteria 3142
468 Ga0157379_10693949 3300014968 Bacteria 955
469 Ga0157376_10071132 3300014969 Bacteria 2955
470 Ga0157376_10163508 3300014969 Bacteria 2020
471 Ga0157376_10191107 3300014969 Bacteria 1878
472 Ga0157376_10460680 3300014969 Bacteria 1242
473 Ga0157376_11718042 3300014969 Unclassified 663
474 Ga0182007_10317775 3300015262 Bacteria 576
475 Ga0163161_10264080 3300017792 Bacteria 1345
476 Ga0197907_10416825 3300020069 Unclassified 1236
477 Ga0197907_10716303 3300020069 Bacteria 2015
478 Ga0206356_10667790 3300020070 Bacteria 2747
479 Ga0206356_10700751 3300020070 Bacteria 839
480 Ga0206356_10788852 3300020070 Bacteria 1013
481 Ga0206356_11812622 3300020070 Bacteria 902
482 Ga0206354_10974213 3300020081 Unclassified 502
483 Ga0206353_10211289 3300020082 Bacteria 2031
484 Ga0206353_10322309 3300020082 Unclassified 1134
485 Ga0206353_10467431 3300020082 Bacteria 2054
486 Ga0206353_10600212 3300020082 Bacteria 2644
487 Ga0206353_10730077 3300020082 Bacteria 4085
488 Ga0206353_11412740 3300020082 Bacteria 4308
489 Ga0206353_11615196 3300020082 Bacteria 610
490 Ga0206353_11994009 3300020082 Bacteria 621
491 Ga0213876_10115045 3300021384 Bacteria 1428
492 Ga0224712_10170402 3300022467 Unclassified 976
493 Ga0207692_10010590 3300025898 Bacteria 3892
494 Ga0207692_10167535 3300025898 Unclassified 1271
495 Ga0207692_10229497 3300025898 Unclassified 1104
496 Ga0207692_11183417 3300025898 Bacteria 507
497 Ga0207642_10564405 3300025899 Bacteria 704
498 Ga0207647_10117127 3300025904 Bacteria 1573
499 Ga0207685_10015934 3300025905 Bacteria 2394
500 Ga0207685_10017607 3300025905 Bacteria 2315
501 Ga0207685_10019805 3300025905 Bacteria 2223
502 Ga0207699_10022148 3300025906 Bacteria 3439
503 Ga0207699_10241345 3300025906 Unclassified 1241
504 Ga0207699_10921918 3300025906 Bacteria 645
505 Ga0207699_11484705 3300025906 Bacteria 501
506 Ga0207705_10021089 3300025909 Bacteria 4647
507 Ga0207705_10048604 3300025909 Bacteria 3052
508 Ga0207705_10135407 3300025909 Unclassified 1836
509 Ga0207705_10138782 3300025909 Bacteria 1814
510 Ga0207705_10330500 3300025909 Bacteria 1172
511 Ga0207705_10395274 3300025909 Unclassified 1069
512 Ga0207705_10684079 3300025909 Bacteria 798
513 Ga0207705_11004201 3300025909 Bacteria 645
514 Ga0207705_11411075 3300025909 Bacteria 529
515 Ga0207684_10148199 3300025910 Bacteria 2018
516 Ga0207684_10489198 3300025910 Bacteria 1055
517 Ga0207684_11180863 3300025910 Bacteria 634
518 Ga0207654_10169436 3300025911 Bacteria 1417
519 Ga0207707_10006267 3300025912 Bacteria 10387
520 Ga0207707_10034982 3300025912 Bacteria 4393
521 Ga0207707_10039960 3300025912 Bacteria 4099
522 Ga0207707_10092655 3300025912 Bacteria 2640
523 Ga0207707_10313782 3300025912 Bacteria 1354
524 Ga0207707_10440447 3300025912 Bacteria 1115
525 Ga0207707_10451098 3300025912 Bacteria 1100
526 Ga0207707_11039655 3300025912 Bacteria 670
527 Ga0207695_10080725 3300025913 Bacteria 3293
528 Ga0207695_10273768 3300025913 Bacteria 1583
529 Ga0207695_11231663 3300025913 Bacteria 629
530 Ga0207671_10031468 3300025914 Bacteria 3954
531 Ga0207671_10088321 3300025914 Bacteria 2332
532 Ga0207671_10287835 3300025914 Bacteria 1297
533 Ga0207693_10000371 3300025915 Bacteria 41227
534 Ga0207693_10000990 3300025915 Bacteria 25494
535 Ga0207693_10001398 3300025915 Bacteria 21387
536 Ga0207693_10058963 3300025915 Bacteria 3007
537 Ga0207693_10121497 3300025915 Unclassified 2051
538 Ga0207693_10127706 3300025915 Bacteria 1999
539 Ga0207693_10399238 3300025915 Bacteria 1075
540 Ga0207693_10607752 3300025915 Bacteria 851
541 Ga0207693_10744333 3300025915 Unclassified 757
542 Ga0207663_10012460 3300025916 Bacteria 4599
543 Ga0207663_10038778 3300025916 Bacteria 2883
544 Ga0207663_10156398 3300025916 Bacteria 1604
545 Ga0207663_10222310 3300025916 Unclassified 1375
546 Ga0207663_10955668 3300025916 Unclassified 686
547 Ga0207663_11001241 3300025916 Bacteria 670
548 Ga0207660_10085959 3300025917 Bacteria 2321
549 Ga0207660_10097423 3300025917 Bacteria 2191
550 Ga0207660_10146812 3300025917 Bacteria 1808
551 Ga0207660_10181111 3300025917 Bacteria 1636
552 Ga0207660_10523083 3300025917 Unclassified 963
553 Ga0207660_10738588 3300025917 Bacteria 803
554 Ga0207662_10291487 3300025918 Bacteria 1082
555 Ga0207657_10000207 3300025919 Bacteria 60795
556 Ga0207657_10013395 3300025919 Bacteria 8047
557 Ga0207657_10015777 3300025919 Bacteria 7302
558 Ga0207657_10018969 3300025919 Bacteria 6546
559 Ga0207657_10021934 3300025919 Bacteria 5996
560 Ga0207657_10025349 3300025919 Bacteria 5469
561 Ga0207657_10066404 3300025919 Bacteria 3071
562 Ga0207657_10234060 3300025919 Bacteria 1468
563 Ga0207657_10332882 3300025919 Unclassified 1199
564 Ga0207657_10549748 3300025919 Bacteria 903
565 Ga0207657_10804666 3300025919 Bacteria 726
566 Ga0207657_11239371 3300025919 Bacteria 566
567 Ga0207649_10096381 3300025920 Bacteria 1949
568 Ga0207649_10260675 3300025920 Bacteria 1252
569 Ga0207649_10342542 3300025920 Bacteria 1104
570 Ga0207649_10688646 3300025920 Unclassified 792
571 Ga0207652_10021218 3300025921 Bacteria 5360
572 Ga0207652_10110214 3300025921 Bacteria 2441
573 Ga0207652_10113557 3300025921 Bacteria 2405
574 Ga0207652_10121469 3300025921 Bacteria 2324
575 Ga0207652_10125053 3300025921 Bacteria 2290
576 Ga0207652_10241419 3300025921 Bacteria 1629
577 Ga0207652_10501255 3300025921 Unclassified 1093
578 Ga0207652_10641387 3300025921 Bacteria 950
579 Ga0207652_10672200 3300025921 Bacteria 925
580 Ga0207652_10687440 3300025921 Bacteria 913
581 Ga0207652_11120811 3300025921 Bacteria 688
582 Ga0207652_11187617 3300025921 Bacteria 664
583 Ga0207652_11312725 3300025921 Bacteria 626
584 Ga0207652_11523253 3300025921 Bacteria 573
585 Ga0207646_10041496 3300025922 Bacteria 4137
586 Ga0207646_10309384 3300025922 Unclassified 1427
587 Ga0207694_10120419 3300025924 Bacteria 2095
588 Ga0207694_10290985 3300025924 Unclassified 1343
589 Ga0207694_10571791 3300025924 Bacteria 949
590 Ga0207694_11490055 3300025924 Bacteria 571
591 Ga0207659_11179850 3300025926 Unclassified 658
592 Ga0207687_10026601 3300025927 Bacteria 3875
593 Ga0207687_10081102 3300025927 Bacteria 2343
594 Ga0207687_10212967 3300025927 Bacteria 1517
595 Ga0207687_10421187 3300025927 Bacteria 1102
596 Ga0207687_10836011 3300025927 Unclassified 786
597 Ga0207700_10058843 3300025928 Bacteria 2905
598 Ga0207700_10081201 3300025928 Bacteria 2531
599 Ga0207700_10100185 3300025928 Bacteria 2308
600 Ga0207700_10298148 3300025928 Bacteria 1391
601 Ga0207700_10457358 3300025928 Unclassified 1126
602 Ga0207700_10543438 3300025928 Unclassified 1031
603 Ga0207700_11099365 3300025928 Bacteria 711
604 Ga0207664_10021231 3300025929 Bacteria 4824
605 Ga0207664_10046845 3300025929 Bacteria 3395
606 Ga0207664_10078067 3300025929 Bacteria 2685
607 Ga0207664_10148314 3300025929 Unclassified 1991
608 Ga0207664_10566979 3300025929 Unclassified 1019
609 Ga0207664_10986580 3300025929 Bacteria 755
610 Ga0207664_11146981 3300025929 Unclassified 694
611 Ga0207664_11168656 3300025929 Unclassified 687
612 Ga0207644_10048422 3300025931 Bacteria 3039
613 Ga0207644_10161976 3300025931 Bacteria 1740
614 Ga0207644_10613073 3300025931 Unclassified 904
615 Ga0207690_10239537 3300025932 Bacteria 1397
616 Ga0207690_10396115 3300025932 Unclassified 1100
617 Ga0207690_10538125 3300025932 Bacteria 948
618 Ga0207690_10984609 3300025932 Bacteria 701
619 Ga0207706_10581926 3300025933 Bacteria 962
620 Ga0207706_11325612 3300025933 Unclassified 594
621 Ga0207686_10008123 3300025934 Bacteria 5661
622 Ga0207686_10050347 3300025934 Bacteria 2590
623 Ga0207686_10148931 3300025934 Bacteria 1627
624 Ga0207686_10638204 3300025934 Unclassified 841
625 Ga0207709_10001704 3300025935 Bacteria 14807
626 Ga0207709_10068099 3300025935 Bacteria 2249
627 Ga0207670_10827760 3300025936 Bacteria 772
628 Ga0207669_10368899 3300025937 Bacteria 1115
629 Ga0207669_10502020 3300025937 Unclassified 971
630 Ga0207704_10005190 3300025938 Bacteria 5995
631 Ga0207704_10248958 3300025938 Bacteria 1333
632 Ga0207704_11141530 3300025938 Unclassified 663
633 Ga0207704_11351081 3300025938 Bacteria 610
634 Ga0207665_10000070 3300025939 Bacteria 66142
635 Ga0207665_10010513 3300025939 Bacteria 6079
636 Ga0207665_10079495 3300025939 Bacteria 2254
637 Ga0207691_10070326 3300025940 Bacteria 3160
638 Ga0207691_10198186 3300025940 Bacteria 1748
639 Ga0207711_10410625 3300025941 Bacteria 1258
640 Ga0207711_10490212 3300025941 Bacteria 1145
641 Ga0207711_10727961 3300025941 Bacteria 925
642 Ga0207711_11568913 3300025941 Unclassified 602
643 Ga0207661_10030797 3300025944 Bacteria 4136
644 Ga0207661_10032448 3300025944 Bacteria 4046
645 Ga0207661_10117707 3300025944 Bacteria 2257
646 Ga0207661_10135468 3300025944 Bacteria 2115
647 Ga0207661_10138183 3300025944 Bacteria 2095
648 Ga0207661_10246928 3300025944 Bacteria 1585
649 Ga0207661_10368125 3300025944 Bacteria 1299
650 Ga0207661_10391160 3300025944 Bacteria 1260
651 Ga0207661_10593462 3300025944 Bacteria 1016
652 Ga0207661_11282115 3300025944 Bacteria 673
653 Ga0207679_10278369 3300025945 Bacteria 1434
654 Ga0207679_10389599 3300025945 Bacteria 1223
655 Ga0207679_10580038 3300025945 Bacteria 1009
656 Ga0207667_10033445 3300025949 Bacteria 5527
657 Ga0207667_10066116 3300025949 Bacteria 3769
658 Ga0207667_10113662 3300025949 Bacteria 2791
659 Ga0207667_10173227 3300025949 Bacteria 2218
660 Ga0207667_10197387 3300025949 Bacteria 2064
661 Ga0207667_10233821 3300025949 Bacteria 1881
662 Ga0207667_10286573 3300025949 Bacteria 1683
663 Ga0207667_10322623 3300025949 Unclassified 1577
664 Ga0207667_11423086 3300025949 Bacteria 666
665 Ga0207712_10006452 3300025961 Bacteria 7395
666 Ga0207712_10277974 3300025961 Bacteria 1365
667 Ga0207668_10063831 3300025972 Bacteria 2600
668 Ga0207640_10717808 3300025981 Bacteria 859
669 Ga0207640_10897192 3300025981 Unclassified 774
670 Ga0207640_11217041 3300025981 Unclassified 670
671 Ga0207658_10002891 3300025986 Bacteria 12311
672 Ga0207658_10917277 3300025986 Bacteria 798
673 Ga0207658_11574275 3300025986 Bacteria 601
674 Ga0207677_10139189 3300026023 Bacteria 1855
675 Ga0207677_11610400 3300026023 Bacteria 601
676 Ga0207639_10325905 3300026041 Bacteria 1365
677 Ga0207639_10570039 3300026041 Bacteria 1041
678 Ga0207639_10733166 3300026041 Unclassified 918
679 Ga0207639_11877796 3300026041 Bacteria 560
680 Ga0207678_10113601 3300026067 Bacteria 2310
681 Ga0207678_10444611 3300026067 Bacteria 1126
682 Ga0207678_10622198 3300026067 Bacteria 947
683 Ga0207708_10000833 3300026075 Bacteria 23294
684 Ga0207708_10857466 3300026075 Bacteria 784
685 Ga0207708_11082143 3300026075 Unclassified 698
686 Ga0207708_11294843 3300026075 Bacteria 638
687 Ga0207708_11793532 3300026075 Bacteria 538
688 Ga0207702_10098954 3300026078 Bacteria 2570
689 Ga0207702_10277260 3300026078 Bacteria 1584
690 Ga0207702_10356568 3300026078 Bacteria 1401
691 Ga0207702_10370390 3300026078 Unclassified 1375
692 Ga0207702_10399638 3300026078 Bacteria 1325
693 Ga0207702_10487433 3300026078 Bacteria 1200
694 Ga0207702_10802490 3300026078 Unclassified 930
695 Ga0207702_10849968 3300026078 Bacteria 903
696 Ga0207702_11651225 3300026078 Unclassified 634
697 Ga0207641_10427780 3300026088 Bacteria 1276
698 Ga0207641_11068666 3300026088 Bacteria 805
699 Ga0207648_10000806 3300026089 Bacteria 35413
700 Ga0207676_10295065 3300026095 Bacteria 1478
701 Ga0207674_10003353 3300026116 Bacteria 19653
702 Ga0207674_10034494 3300026116 Bacteria 5288
703 Ga0207674_10034801 3300026116 Bacteria 5261
704 Ga0207674_10103688 3300026116 Bacteria 2823
705 Ga0207674_10335926 3300026116 Bacteria 1461
706 Ga0207674_11357543 3300026116 Unclassified 680
707 Ga0207675_100082252 3300026118 Bacteria 3020
708 Ga0207683_10007545 3300026121 Bacteria 9320
709 Ga0207683_10155522 3300026121 Bacteria 2065
710 Ga0207683_10158835 3300026121 Bacteria 2043
711 Ga0207698_10087393 3300026142 Bacteria 2539
712 Ga0207698_10126124 3300026142 Bacteria 2177
713 Ga0207698_10151040 3300026142 Bacteria 2016
714 Ga0207698_10287633 3300026142 Bacteria 1524
715 Ga0207428_10003626 3300027907 Bacteria 14886
716 Ga0207428_10354867 3300027907 Bacteria 1078
717 Ga0268266_10283665 3300028379 Bacteria 1541
718 Ga0268266_10598062 3300028379 Bacteria 1059
719 Ga0268266_10736086 3300028379 Unclassified 951
720 Ga0268265_10576698 3300028380 Bacteria 1072
721 Ga0265326_10052168 3300028558 Bacteria 1158
722 Ga0265319_1003390 3300028563 Bacteria 8334
723 Ga0265319_1103063 3300028563 Bacteria 895
724 Ga0265334_10030013 3300028573 Bacteria 2177
725 Ga0265334_10100569 3300028573 Bacteria 1047
726 Ga0265334_10121742 3300028573 Bacteria 932
727 Ga0265318_10002905 3300028577 Bacteria 8906
728 Ga0265318_10026357 3300028577 Bacteria 2289
729 Ga0265318_10133877 3300028577 Bacteria 911
730 Ga0265322_10010959 3300028654 Bacteria 2630
731 Ga0265322_10014646 3300028654 Bacteria 2266
732 Ga0265322_10042958 3300028654 Bacteria 1286
733 Ga0265336_10005527 3300028666 Bacteria 4656
734 Ga0265338_10006136 3300028800 Bacteria 15425
735 Ga0265338_10009161 3300028800 Bacteria 11876
736 Ga0265338_10016938 3300028800 Bacteria 7885
737 Ga0265338_10019524 3300028800 Bacteria 7184
738 Ga0265338_10030185 3300028800 Bacteria 5349
739 Ga0265338_10070358 3300028800 Bacteria 3000
740 Ga0265338_10070593 3300028800 Bacteria 2993
741 Ga0265338_10087484 3300028800 Bacteria 2588
742 Ga0265338_10186516 3300028800 Bacteria 1576
743 Ga0265330_10017777 3300031235 Bacteria 3272
744 Ga0265330_10044163 3300031235 Bacteria 1969
745 Ga0265332_10036278 3300031238 Bacteria 2141
746 Ga0265328_10043350 3300031239 Bacteria 1655
747 Ga0265328_10307181 3300031239 Unclassified 613
748 Ga0265320_10038804 3300031240 Bacteria 2386
749 Ga0265320_10097999 3300031240 Unclassified 1352
750 Ga0265320_10279280 3300031240 Unclassified 740
751 Ga0265325_10019941 3300031241 Bacteria 3700
752 Ga0265325_10050476 3300031241 Bacteria 2142
753 Ga0265325_10106306 3300031241 Bacteria 1368
754 Ga0265329_10020911 3300031242 Bacteria 2204
755 Ga0265340_10207132 3300031247 Bacteria 881
756 Ga0265340_10295630 3300031247 Bacteria 718
757 Ga0265339_10068072 3300031249 Bacteria 1903
758 Ga0265339_10113784 3300031249 Bacteria 1397
759 Ga0265331_10099514 3300031250 Bacteria 1339
760 Ga0265331_10355698 3300031250 Unclassified 656
761 Ga0265327_10006112 3300031251 Bacteria 9751
762 Ga0265327_10021363 3300031251 Bacteria 3908
763 Ga0265327_10039337 3300031251 Bacteria 2570
764 Ga0265327_10040559 3300031251 Bacteria 2516
765 Ga0265327_10054359 3300031251 Bacteria 2073
766 Ga0265327_10213656 3300031251 Unclassified 870
767 Ga0265316_10008470 3300031344 Bacteria 9537
768 Ga0265316_10029661 3300031344 Bacteria 4493
769 Ga0265316_10049741 3300031344 Bacteria 3300
770 Ga0307408_100114748 3300031548 Bacteria 2076
771 Ga0307408_100176961 3300031548 Bacteria 1708
772 Ga0307408_100246442 3300031548 Bacteria 1471
773 Ga0265313_10004895 3300031595 Bacteria 10042
774 Ga0265313_10199018 3300031595 Bacteria 834
775 Ga0265314_10004374 3300031711 Bacteria 13142
776 Ga0265314_10131538 3300031711 Bacteria 1560
777 Ga0265314_10242230 3300031711 Bacteria 1040
778 Ga0265314_10478885 3300031711 Unclassified 658
779 Ga0265342_10030444 3300031712 Bacteria 3344
780 Ga0265342_10045478 3300031712 Bacteria 2642
781 Ga0265342_10282030 3300031712 Bacteria 879
782 Ga0307405_10257868 3300031731 Bacteria 1301
783 Ga0307405_10506553 3300031731 Bacteria 969
784 Ga0307405_11637767 3300031731 Bacteria 569
785 Ga0307413_10340511 3300031824 Bacteria 1153
786 Ga0307413_11387490 3300031824 Bacteria 617
787 Ga0307406_10103808 3300031901 Bacteria 1942
788 Ga0307406_10285552 3300031901 Bacteria 1261
789 Ga0307407_10474183 3300031903 Bacteria 913
790 Ga0307407_10619802 3300031903 Bacteria 807
791 Ga0307407_10668333 3300031903 Bacteria 780
792 Ga0307412_10303935 3300031911 Bacteria 1262
793 Ga0307409_100149342 3300031995 Bacteria 2026
794 Ga0307409_100183933 3300031995 Bacteria 1853
795 Ga0307409_100359945 3300031995 Bacteria 1376
796 Ga0307409_100395667 3300031995 Bacteria 1318
797 Ga0307409_100979340 3300031995 Bacteria 863
798 Ga0307416_100064091 3300032002 Bacteria 3013
799 Ga0307416_100130796 3300032002 Bacteria 2259
800 Ga0307416_100620890 3300032002 Bacteria 1163
801 Ga0307416_101059209 3300032002 Bacteria 915
802 Ga0307414_10394891 3300032004 Unclassified 1200
803 Ga0307411_11203901 3300032005 Bacteria 687
804 Ga0307415_100070335 3300032126 Bacteria 2457
805 Ga0307415_100133591 3300032126 Bacteria 1883
806 Ga0307415_100215392 3300032126 Bacteria 1535
807 Ga0307415_100882982 3300032126 Unclassified 823
808 Ga0316583_10018438 3300032133 Bacteria 2505
809 Ga0316583_10146969 3300032133 Bacteria 821
810 Ga0373926_0057441 3300035083 Bacteria 1413
811 Ga0373934_0287863 3300035086 Bacteria 681
812 Ga0373944_0012696 3300035089 Bacteria 2326
813 Ga0373923_0514975 3300035111 Unclassified 584
814 Ga0373936_0024078 3300035113 Bacteria 2376
815 Ga0373936_0136970 3300035113 Bacteria 1055
816 Ga0373939_0291632 3300035114 Unclassified 648
817 Ga0373945_0004024 3300035116 Bacteria 4649
818 Ga0373945_0004453 3300035116 Bacteria 4452
819 Ga0373953_0151967 3300035117 Bacteria 993
820 Ga0373953_0231221 3300035117 Bacteria 802
821 Ga0373954_0174367 3300035118 Unclassified 1054
822 Ga0373956_0136897 3300035119 Bacteria 1149
823 Ga0373943_0000450 3300035170 Bacteria 17418
824 Ga0373943_0005939 3300035170 Bacteria 5476
825 Ga0373943_0644678 3300035170 Bacteria 626
826 Ga0373946_0000587 3300035171 Bacteria 12009
827 Ga0373946_0006898 3300035171 Bacteria 4135
828 Ga0373946_0245559 3300035171 Bacteria 872
829 Ga0373955_0094356 3300035172 Unclassified 1710
830 Ga0373955_0126715 3300035172 Unclassified 1488
831 Ga0373955_0217730 3300035172 Unclassified 1140
832 Ga0373961_0228349 3300035241 Bacteria 666
833 Ga0373962_0203006 3300035242 Bacteria 672
834 Ga0373924_0035981 3300035410 Bacteria 2010
835 Ga0373924_0056500 3300035410 Bacteria 1635
836 Ga0373935_0024719 3300035692 Bacteria 3700
837 Ga0373935_0032176 3300035692 Bacteria 3258
838 Ga0373927_0077150 3300035695 Bacteria 2158
839 Ga0373933_0173003 3300035724 Unclassified 1375
840 Ga0373933_1036992 3300035724 Bacteria 540
841 Ga0373947_0004602 3300035725 Bacteria 8093
842 Ga0373947_0022617 3300035725 Bacteria 3647
843 Ga0373947_0071449 3300035725 Bacteria 2129
844 Ga0373947_0238840 3300035725 Bacteria 1199
845 Ga0373947_0417591 3300035725 Unclassified 906
846 Ga0373937_0096706 3300036401 Bacteria 2739
847 Ga0373937_0117201 3300036401 Bacteria 2481
848 Ga0373937_0932355 3300036401 Bacteria 817
849 Ga0373925_0013017 3300037068 Bacteria 6024
850 Ga0373925_0033856 3300037068 Bacteria 3764
851 Ga0373925_0149720 3300037068 Bacteria 1832
852 Ga0373925_0512518 3300037068 Unclassified 985
853 Ga0395899_0021519 3300037312 Bacteria 4891
854 Ga0395899_0042660 3300037312 Bacteria 3386
855 Ga0395899_0047824 3300037312 Bacteria 3184
856 Ga0395899_0059975 3300037312 Bacteria 2803
857 Ga0395899_0087738 3300037312 Bacteria 2257
858 Ga0395899_0101176 3300037312 Archaea 2080
859 Ga0395899_0114306 3300037312 Bacteria 1938
860 Ga0395899_0156924 3300037312 Bacteria 1610
861 Ga0395899_0196889 3300037312 Bacteria 1407
862 Ga0395899_0355591 3300037312 Bacteria 979
863 Ga0395899_0379853 3300037312 Bacteria 939
864 Ga0395899_0477512 3300037312 Bacteria 812
865 Ga0395900_0008773 3300037418 Bacteria 10389
866 Ga0395900_0009413 3300037418 Bacteria 10016
867 Ga0395900_0023438 3300037418 Bacteria 6317
868 Ga0395900_0048696 3300037418 Bacteria 4366
869 Ga0395900_0084833 3300037418 Bacteria 3255
870 Ga0395900_0089342 3300037418 Bacteria 3167
871 Ga0395900_0093981 3300037418 Bacteria 3080
872 Ga0395900_0103938 3300037418 Bacteria 2918
873 Ga0395900_0108248 3300037418 Bacteria 2855
874 Ga0395900_0157499 3300037418 Bacteria 2319
875 Ga0395900_0236980 3300037418 Bacteria 1832
876 Ga0395900_0288560 3300037418 Bacteria 1630
877 Ga0395900_0303099 3300037418 Bacteria 1583
878 Ga0395900_0349674 3300037418 Bacteria 1452
879 Ga0395900_0368692 3300037418 Bacteria 1406
880 Ga0395900_0422513 3300037418 Bacteria 1294
881 Ga0395900_0432312 3300037418 Unclassified 1275
882 Ga0395900_0505334 3300037418 Bacteria 1158
883 Ga0395900_0506483 3300037418 Bacteria 1157
884 Ga0395900_0720716 3300037418 Unclassified 930
885 Ga0395900_0869537 3300037418 Bacteria 826
886 Ga0395900_1226098 3300037418 Bacteria 665
887 Ga0395900_1330841 3300037418 Unclassified 632
888 Ga0395900_1476077 3300037418 Bacteria 592
889 Ga0395898_0002496 3300037466 Bacteria 21639
890 Ga0395898_0005097 3300037466 Bacteria 14235
891 Ga0395898_0005344 3300037466 Bacteria 13889
892 Ga0395898_0005483 3300037466 Bacteria 13708
893 Ga0395898_0015237 3300037466 Bacteria 7892
894 Ga0395898_0019651 3300037466 Bacteria 6872
895 Ga0395898_0042660 3300037466 Bacteria 4474
896 Ga0395898_0046795 3300037466 Bacteria 4248
897 Ga0395898_0050311 3300037466 Bacteria 4079
898 Ga0395898_0080644 3300037466 Bacteria 3138
899 Ga0395898_0174711 3300037466 Bacteria 2053
900 Ga0395898_0285729 3300037466 Bacteria 1574
901 Ga0395898_0298472 3300037466 Bacteria 1537
902 Ga0395898_0372696 3300037466 Bacteria 1361
903 Ga0395898_0391115 3300037466 Bacteria 1326
904 Ga0395898_0410459 3300037466 Bacteria 1291
905 Ga0395898_0451065 3300037466 Unclassified 1225
906 Ga0395898_0572026 3300037466 Bacteria 1072
907 Ga0395898_0717671 3300037466 Bacteria 941
908 Ga0395898_0971853 3300037466 Unclassified 786
909 Ga0395898_1006863 3300037466 Bacteria 769
910 Ga0395898_1549826 3300037466 Bacteria 588
911 Ga0395898_1733822 3300037466 Unclassified 547
912 Ga0395905_0002871 3300037471 Bacteria 18817
913 Ga0395905_0009104 3300037471 Bacteria 9727
914 Ga0395905_0029771 3300037471 Bacteria 5146
915 Ga0395905_0030658 3300037471 Bacteria 5065
916 Ga0395905_0059967 3300037471 Bacteria 3558
917 Ga0395905_0060087 3300037471 Bacteria 3554
918 Ga0395905_0069148 3300037471 Bacteria 3307
919 Ga0395905_0088690 3300037471 Bacteria 2899
920 Ga0395905_0135976 3300037471 Bacteria 2312
921 Ga0395905_0327047 3300037471 Bacteria 1423
922 Ga0395905_0444910 3300037471 Bacteria 1193
923 Ga0395905_0445892 3300037471 Bacteria 1192
924 Ga0395905_0649887 3300037471 Bacteria 957
925 Ga0395905_0678613 3300037471 Unclassified 933
926 Ga0436364_1080961 3300037853 Bacteria 1042
927 Ga0395901_0003588 3300038443 Bacteria 15650
928 Ga0395901_0008494 3300038443 Bacteria 10379
929 Ga0395901_0013435 3300038443 Bacteria 8323
930 Ga0395901_0019244 3300038443 Bacteria 6980
931 Ga0395901_0020919 3300038443 Bacteria 6702
932 Ga0395901_0032977 3300038443 Bacteria 5343
933 Ga0395901_0034252 3300038443 Bacteria 5244
934 Ga0395901_0035468 3300038443 Bacteria 5153
935 Ga0395901_0046421 3300038443 Bacteria 4512
936 Ga0395901_0055307 3300038443 Bacteria 4127
937 Ga0395901_0059091 3300038443 Bacteria 3989
938 Ga0395901_0059732 3300038443 Bacteria 3967
939 Ga0395901_0099670 3300038443 Bacteria 3046
940 Ga0395901_0336355 3300038443 Bacteria 1560
941 Ga0395901_0363660 3300038443 Bacteria 1491
942 Ga0395901_0422260 3300038443 Bacteria 1367
943 Ga0395901_0449930 3300038443 Bacteria 1317
944 Ga0395901_0541671 3300038443 Bacteria 1180
945 Ga0395901_0840241 3300038443 Unclassified 904
946 Ga0395901_0895174 3300038443 Unclassified 870
947 Ga0395901_1331290 3300038443 Bacteria 679
948 Ga0395901_1392265 3300038443 Unclassified 660
949 Ga0436365_0085711 3300039437 Bacteria 2892
950 Ga0436365_0701464 3300039437 Bacteria 1800
951 Ga0436365_0845903 3300039437 Bacteria 1154
952 Ga0436360_1155632 3300039438 Bacteria 2053
953 Ga0436363_0640175 3300039450 Unclassified 521
954 Ga0436363_1570462 3300039450 Bacteria 906
955 Ga0436363_1687957 3300039450 Bacteria 813
956 Ga0436363_1701756 3300039450 Bacteria 1760
957 Ga0436362_0192683 3300039453 Bacteria 1938
958 Ga0436362_1065493 3300039453 Bacteria 567
959 Ga0439461_0045621 3300041410 Unclassified 959
960 Ga0439466_0122052 3300041411 Unclassified 804
961 Ga0439465_0131463 3300041413 Bacteria 884
962 Ga0451804_0563923 3300041463 Bacteria 1130
963 Ga0451807_0290562 3300041486 Unclassified 575
964 Ga0451849_1174289 3300041505 Bacteria 804
965 Ga0451851_0413360 3300041507 Bacteria 585
966 Ga0451853_1423786 3300041512 Unclassified 569
967 Ga0451853_2826077 3300041512 Bacteria 1474
968 Ga0451853_3658391 3300041512 Bacteria 741
969 Ga0451853_3882521 3300041512 Bacteria 2326
970 Ga0439448_0036171 3300042005 Bacteria 1583
971 Ga0439432_059947 3300042006 Bacteria 1175
972 Ga0439462_0097652 3300042015 Unclassified 808
973 Ga0450915_002033 3300042119 Unclassified 1019
974 Ga0450917_005551 3300042120 Bacteria 939
975 Ga0450920_014823 3300042122 Bacteria 1479
976 Ga0450898_070467 3300042134 Unclassified 700
977 Ga0450910_023755 3300042147 Unclassified 938
978 Ga0439446_0000515 3300042156 Bacteria 7762
979 Ga0439446_0060293 3300042156 Bacteria 1146
980 Ga0439434_0086783 3300042435 Unclassified 998
981 Ga0451577_1877690 3300042876 Unclassified 525
982 Ga0466969_0028519 3300044656 Bacteria 2853
983 Ga0466969_0095008 3300044656 Bacteria 1409
984 Ga0466969_0218360 3300044656 Bacteria 867
985 Ga0466972_0522138 3300044658 Bacteria 559
986 Ga0466965_0076490 3300044683 Bacteria 1689
987 Ga0466965_0124314 3300044683 Unclassified 1334
988 Ga0466965_0154697 3300044683 Bacteria 1200
989 Ga0466965_0803528 3300044683 Bacteria 544
990 Ga0466966_0000678 3300044684 Bacteria 21592
991 Ga0466966_0003325 3300044684 Bacteria 10594
992 Ga0466966_0043646 3300044684 Bacteria 2873
993 Ga0466966_0137242 3300044684 Bacteria 1495
994 Ga0466966_0173487 3300044684 Bacteria 1310
995 Ga0466961_0002905 3300044693 Bacteria 10634
996 Ga0466961_0007370 3300044693 Bacteria 6998
997 Ga0466961_0029335 3300044693 Bacteria 3537
998 Ga0466961_0065280 3300044693 Bacteria 2313
999 Ga0466961_0070588 3300044693 Bacteria 2217
1000 Ga0466961_0075688 3300044693 Bacteria 2134
1001 Ga0466961_0096457 3300044693 Bacteria 1865
1002 Ga0466961_0159312 3300044693 Bacteria 1407
1003 Ga0466961_0538224 3300044693 Bacteria 704
1004 Ga0466963_0000661 3300044694 Bacteria 16639
1005 Ga0466963_0000792 3300044694 Bacteria 15743
1006 Ga0466963_0002009 3300044694 Bacteria 11176
1007 Ga0466963_0002017 3300044694 Bacteria 11157
1008 Ga0466963_0002252 3300044694 Bacteria 10714
1009 Ga0466963_0002500 3300044694 Bacteria 10289
1010 Ga0466963_0002999 3300044694 Bacteria 9548
1011 Ga0466963_0003520 3300044694 Bacteria 8990
1012 Ga0466963_0004663 3300044694 Bacteria 8000
1013 Ga0466963_0005080 3300044694 Bacteria 7695
1014 Ga0466963_0006726 3300044694 Bacteria 6829
1015 Ga0466963_0006855 3300044694 Bacteria 6779
1016 Ga0466963_0009150 3300044694 Bacteria 5958
1017 Ga0466963_0057815 3300044694 Bacteria 2583
1018 Ga0466963_0073487 3300044694 Bacteria 2305
1019 Ga0466963_0087868 3300044694 Bacteria 2114
1020 Ga0466963_0090601 3300044694 Unclassified 2082
1021 Ga0466963_0132045 3300044694 Bacteria 1726
1022 Ga0466963_0275348 3300044694 Bacteria 1182
1023 Ga0466963_0427892 3300044694 Bacteria 933
1024 Ga0466963_0478332 3300044694 Bacteria 879
1025 Ga0466963_1049805 3300044694 Bacteria 573
1026 Ga0466963_1092534 3300044694 Bacteria 561
1027 Ga0466964_0000335 3300044706 Bacteria 14066
1028 Ga0466964_0001343 3300044706 Bacteria 8395
1029 Ga0466964_0003667 3300044706 Bacteria 5617
1030 Ga0466964_0004919 3300044706 Bacteria 4940
1031 Ga0466964_0013694 3300044706 Bacteria 3078
1032 Ga0466964_0022018 3300044706 Bacteria 2469
1033 Ga0466964_0031620 3300044706 Bacteria 2100
1034 Ga0466964_0038061 3300044706 Unclassified 1933
1035 Ga0466964_0042842 3300044706 Bacteria 1835
1036 Ga0466964_0055679 3300044706 Bacteria 1633
1037 Ga0466964_0063175 3300044706 Bacteria 1546
1038 Ga0466964_0074447 3300044706 Unclassified 1444
1039 Ga0466964_0187771 3300044706 Unclassified 984
1040 Ga0466964_0265164 3300044706 Unclassified 852
1041 Ga0466964_0593091 3300044706 Unclassified 607
1042 Ga0466964_0730704 3300044706 Bacteria 554
1043 Ga0466971_0003596 3300044719 Bacteria 6624
1044 Ga0466971_0007633 3300044719 Bacteria 4716
1045 Ga0466971_0021486 3300044719 Bacteria 2872
1046 Ga0466971_0036982 3300044719 Bacteria 2189
1047 Ga0466971_0189687 3300044719 Unclassified 968
1048 Ga0466971_0209896 3300044719 Unclassified 921
1049 Ga0466971_0489188 3300044719 Bacteria 606
1050 Ga0466968_0002629 3300044735 Bacteria 6609
1051 Ga0466968_0004943 3300044735 Bacteria 4993
1052 Ga0466968_0078435 3300044735 Unclassified 1448
1053 Ga0466968_0123473 3300044735 Bacteria 1173
1054 Ga0466968_0146678 3300044735 Unclassified 1082
1055 Ga0466968_0217756 3300044735 Bacteria 898
1056 Ga0466968_0272199 3300044735 Unclassified 808
1057 Ga0466970_0013425 3300044765 Bacteria 4199
1058 Ga0466970_0035573 3300044765 Bacteria 2638
1059 Ga0466970_0158393 3300044765 Unclassified 1252
1060 Ga0466957_0000566 3300044842 Bacteria 18671
1061 Ga0466957_0000954 3300044842 Bacteria 14837
1062 Ga0466957_0005157 3300044842 Bacteria 7303
1063 Ga0466957_0005764 3300044842 Bacteria 6958
1064 Ga0466957_0013432 3300044842 Bacteria 4750
1065 Ga0466957_0024884 3300044842 Bacteria 3546
1066 Ga0466957_0039745 3300044842 Bacteria 2839
1067 Ga0466957_0055884 3300044842 Bacteria 2413
1068 Ga0466957_0060259 3300044842 Bacteria 2327
1069 Ga0466957_0066843 3300044842 Bacteria 2217
1070 Ga0466957_0134766 3300044842 Bacteria 1586
1071 Ga0466957_0226235 3300044842 Unclassified 1237
1072 Ga0466957_0451153 3300044842 Bacteria 886
1073 Ga0466957_0943999 3300044842 Unclassified 618
1074 Ga0466957_1089174 3300044842 Bacteria 576
1075 Ga0466957_1191833 3300044842 Unclassified 551
1076 Ga0466960_0013853 3300044901 Bacteria 3436
1077 Ga0466960_0209325 3300044901 Bacteria 1069
1078 Ga0466960_0266460 3300044901 Bacteria 956
1079 Ga0466960_0324863 3300044901 Bacteria 872
1080 Ga0466960_0400002 3300044901 Unclassified 791
1081 Ga0466959_0001247 3300045049 Bacteria 15365
1082 Ga0466959_0006694 3300045049 Bacteria 8014
1083 Ga0466959_0033953 3300045049 Bacteria 3774
1084 Ga0466959_0085996 3300045049 Bacteria 2262
1085 Ga0466959_0086370 3300045049 Bacteria 2257
1086 Ga0466959_0116728 3300045049 Bacteria 1900
1087 Ga0466959_0121324 3300045049 Bacteria 1858
1088 Ga0466959_0200703 3300045049 Bacteria 1389
1089 Ga0466959_0212575 3300045049 Bacteria 1343
1090 Ga0466959_0345420 3300045049 Bacteria 1015
1091 Ga0451576_0943868 3300045051 Bacteria 905
1092 Ga0451576_1344229 3300045051 Unclassified 744
1093 Ga0451576_1427611 3300045051 Bacteria 720
1094 Ga0466958_0000591 3300045836 Bacteria 15435
1095 Ga0466958_0000942 3300045836 Bacteria 13132
1096 Ga0466958_0004180 3300045836 Bacteria 7585
1097 Ga0466958_0006462 3300045836 Bacteria 6380
1098 Ga0466958_0012679 3300045836 Bacteria 4779
1099 Ga0466958_0030337 3300045836 Bacteria 3211
1100 Ga0466958_0057096 3300045836 Bacteria 2372
1101 Ga0466958_0058161 3300045836 Bacteria 2350
1102 Ga0466958_0066029 3300045836 Bacteria 2208
1103 Ga0466958_0069368 3300045836 Bacteria 2155
1104 Ga0466958_0154606 3300045836 Unclassified 1447
1105 Ga0466958_0201625 3300045836 Bacteria 1266
1106 Ga0466958_0217755 3300045836 Bacteria 1218
1107 Ga0466958_0257390 3300045836 Bacteria 1117
1108 Ga0466958_0276314 3300045836 Unclassified 1076
1109 Ga0466958_0289655 3300045836 Bacteria 1050
1110 Ga0466958_0507704 3300045836 Unclassified 782
1111 Ga0466958_0622245 3300045836 Bacteria 702
1112 Ga0466958_0808304 3300045836 Bacteria 611
1113 Ga0466958_0897376 3300045836 Unclassified 578
1114 Ga0466967_0000351 3300045976 Bacteria 21269
1115 Ga0466967_0002747 3300045976 Bacteria 11130
1116 Ga0466967_0003833 3300045976 Bacteria 9952
1117 Ga0466967_0005871 3300045976 Bacteria 8594
1118 Ga0466967_0007851 3300045976 Bacteria 7752
1119 Ga0466967_0008069 3300045976 Bacteria 7677
1120 Ga0466967_0011565 3300045976 Bacteria 6696
1121 Ga0466967_0013044 3300045976 Bacteria 6397
1122 Ga0466967_0014209 3300045976 Bacteria 6192
1123 Ga0466967_0015741 3300045976 Bacteria 5940
1124 Ga0466967_0023531 3300045976 Bacteria 5050
1125 Ga0466967_0033429 3300045976 Bacteria 4353
1126 Ga0466967_0037082 3300045976 Bacteria 4168
1127 Ga0466967_0041421 3300045976 Bacteria 3971
1128 Ga0466967_0055721 3300045976 Bacteria 3483
1129 Ga0466967_0076077 3300045976 Bacteria 3018
1130 Ga0466967_0076252 3300045976 Bacteria 3015
1131 Ga0466967_0076552 3300045976 Bacteria 3010
1132 Ga0466967_0085897 3300045976 Bacteria 2850
1133 Ga0466967_0093121 3300045976 Bacteria 2741
1134 Ga0466967_0101199 3300045976 Bacteria 2634
1135 Ga0466967_0105095 3300045976 Bacteria 2586
1136 Ga0466967_0116549 3300045976 Bacteria 2461
1137 Ga0466967_0131492 3300045976 Bacteria 2324
1138 Ga0466967_0141454 3300045976 Bacteria 2241
1139 Ga0466967_0143220 3300045976 Bacteria 2228
1140 Ga0466967_0157845 3300045976 Bacteria 2127
1141 Ga0466967_0162460 3300045976 Bacteria 2097
1142 Ga0466967_0206537 3300045976 Bacteria 1862
1143 Ga0466967_0253836 3300045976 Bacteria 1681
1144 Ga0466967_0254138 3300045976 Bacteria 1680
1145 Ga0466967_0261440 3300045976 Bacteria 1656
1146 Ga0466967_0264620 3300045976 Bacteria 1646
1147 Ga0466967_0346877 3300045976 Bacteria 1436
1148 Ga0466967_0605618 3300045976 Bacteria 1081
1149 Ga0466967_0619634 3300045976 Unclassified 1069
1150 Ga0466967_0889469 3300045976 Unclassified 885
1151 Ga0466967_1132674 3300045976 Unclassified 780
1152 Ga0466967_1832651 3300045976 Bacteria 604
1153 Ga0466967_1986128 3300045976 Bacteria 578
1154 Ga0466967_2160205 3300045976 Bacteria 553
1155 Ga0495592_0064166 3300046454 Bacteria 2692
1156 Ga0495592_0071193 3300046454 Bacteria 2531
1157 Ga0495592_0160618 3300046454 Bacteria 1546
1158 Ga0495592_0186727 3300046454 Bacteria 1408
1159 Ga0495603_0054756 3300046455 Bacteria 2364
1160 Ga0495603_0126672 3300046455 Bacteria 1488
1161 Ga0495603_0136523 3300046455 Bacteria 1427
1162 Ga0495591_102666 3300046458 Unclassified 708
1163 Ga0495629_0015080 3300046459 Bacteria 5554
1164 Ga0495629_0060748 3300046459 Bacteria 2641
1165 Ga0495629_0209233 3300046459 Bacteria 1347
1166 Ga0495629_0759348 3300046459 Unclassified 641
1167 Ga0495641_0001273 3300046461 Bacteria 21638
1168 Ga0495641_0017827 3300046461 Bacteria 3685
1169 Ga0495641_0024718 3300046461 Bacteria 2960
1170 Ga0495641_0024821 3300046461 Bacteria 2951
1171 Ga0495641_0088399 3300046461 Bacteria 1386
1172 Ga0495641_0095543 3300046461 Bacteria 1327
1173 Ga0495641_0125139 3300046461 Bacteria 1147
1174 Ga0495641_0257087 3300046461 Bacteria 785
1175 Ga0495641_0330853 3300046461 Unclassified 688
1176 Ga0495651_0014259 3300046462 Bacteria 6144
1177 Ga0495651_0018806 3300046462 Bacteria 5352
1178 Ga0495651_0142996 3300046462 Bacteria 1732
1179 Ga0495651_0208638 3300046462 Bacteria 1361
1180 Ga0495651_0289734 3300046462 Bacteria 1102
1181 Ga0495651_0620313 3300046462 Bacteria 680
1182 Ga0495653_0033898 3300046463 Bacteria 4042
1183 Ga0495653_0074161 3300046463 Bacteria 2536
1184 Ga0495653_0079235 3300046463 Bacteria 2433
1185 Ga0495653_0189902 3300046463 Bacteria 1402
1186 Ga0495653_0221004 3300046463 Bacteria 1273
1187 Ga0495653_0243004 3300046463 Bacteria 1198
1188 Ga0495653_0841278 3300046463 Bacteria 549
1189 Ga0495580_0287600 3300046472 Unclassified 1121
1190 Ga0495582_0000066 3300046473 Bacteria 53920
1191 Ga0495582_0030557 3300046473 Bacteria 2957
1192 Ga0495582_0069815 3300046473 Bacteria 1943
1193 Ga0495582_0085011 3300046473 Bacteria 1759
1194 Ga0495582_0110881 3300046473 Bacteria 1541
1195 Ga0495582_0139706 3300046473 Unclassified 1372
1196 Ga0495582_0329052 3300046473 Unclassified 879
1197 Ga0495582_0908106 3300046473 Bacteria 509
1198 Ga0495605_0084608 3300046474 Bacteria 1479
1199 Ga0495639_0001852 3300046475 Bacteria 9359
1200 Ga0495639_0286102 3300046475 Bacteria 820
1201 Ga0495639_0303501 3300046475 Unclassified 796
1202 Ga0495639_0305899 3300046475 Unclassified 793
1203 Ga0495662_0012277 3300046476 Bacteria 4183
1204 Ga0495662_0054097 3300046476 Bacteria 1939
1205 Ga0495662_0337123 3300046476 Bacteria 741
1206 Ga0495664_0081951 3300046477 Bacteria 1934
1207 Ga0495664_0119293 3300046477 Bacteria 1595
1208 Ga0495664_0173805 3300046477 Bacteria 1307
1209 Ga0495664_0209427 3300046477 Bacteria 1181
1210 Ga0495664_0723630 3300046477 Bacteria 587
1211 Ga0495584_0023265 3300046491 Bacteria 3142
1212 Ga0495584_0277062 3300046491 Unclassified 852
1213 Ga0495584_0322986 3300046491 Unclassified 784
1214 Ga0495585_0111918 3300046492 Bacteria 1451
1215 Ga0495585_0190734 3300046492 Bacteria 1049
1216 Ga0495594_0023442 3300046499 Bacteria 3308
1217 Ga0495594_0024618 3300046499 Bacteria 3235
1218 Ga0495594_0565863 3300046499 Bacteria 645
1219 Ga0495596_0387852 3300046500 Unclassified 544
1220 Ga0495607_0120295 3300046501 Unclassified 1380
1221 Ga0495608_0004630 3300046511 Bacteria 9825
1222 Ga0495608_0024814 3300046511 Bacteria 4096
1223 Ga0495608_0029249 3300046511 Bacteria 3739
1224 Ga0495608_0030695 3300046511 Bacteria 3637
1225 Ga0495608_0073652 3300046511 Bacteria 2227
1226 Ga0495608_0136560 3300046511 Bacteria 1567
1227 Ga0495616_0411639 3300046513 Bacteria 554
1228 Ga0495618_0016102 3300046514 Bacteria 4569
1229 Ga0495618_0030541 3300046514 Bacteria 3366
1230 Ga0495618_0123974 3300046514 Bacteria 1654
1231 Ga0495618_0678414 3300046514 Bacteria 607
1232 Ga0495618_0785582 3300046514 Bacteria 555
1233 Ga0495620_0101546 3300046515 Bacteria 1146
1234 Ga0495628_0023992 3300046516 Bacteria 4999
1235 Ga0495628_0093798 3300046516 Bacteria 2321
1236 Ga0495628_0100432 3300046516 Bacteria 2233
1237 Ga0495628_0129587 3300046516 Bacteria 1930
1238 Ga0495628_0188031 3300046516 Unclassified 1560
1239 Ga0495630_0004203 3300046517 Bacteria 10081
1240 Ga0495630_0017638 3300046517 Bacteria 5233
1241 Ga0495630_0019933 3300046517 Bacteria 4937
1242 Ga0495630_0039229 3300046517 Bacteria 3542
1243 Ga0495630_0153665 3300046517 Bacteria 1751
1244 Ga0495630_0295613 3300046517 Unclassified 1237
1245 Ga0495630_0317760 3300046517 Unclassified 1190
1246 Ga0495630_0416195 3300046517 Bacteria 1030
1247 Ga0495630_1131683 3300046517 Bacteria 593
1248 Ga0495631_0423484 3300046518 Bacteria 567
1249 Ga0495632_0215938 3300046519 Unclassified 869
1250 Ga0495644_0005854 3300046523 Bacteria 4803
1251 Ga0495644_0081365 3300046523 Bacteria 1221
1252 Ga0495644_0161187 3300046523 Bacteria 860
1253 Ga0495663_0018218 3300046525 Bacteria 1998
1254 Ga0495663_0233255 3300046525 Bacteria 650
1255 Ga0495663_0274678 3300046525 Bacteria 603
1256 Ga0495666_0015553 3300046526 Bacteria 3788
1257 Ga0495642_0025963 3300046528 Bacteria 2324
1258 Ga0495642_0210232 3300046528 Unclassified 849
1259 Ga0495652_0030319 3300046529 Bacteria 4744
1260 Ga0495652_0037661 3300046529 Bacteria 4194
1261 Ga0495652_0068143 3300046529 Bacteria 2981
1262 Ga0495652_0099102 3300046529 Bacteria 2367
1263 Ga0495652_0105101 3300046529 Bacteria 2282
1264 Ga0495652_0246943 3300046529 Bacteria 1325
1265 Ga0495665_0000252 3300046531 Bacteria 26953
1266 Ga0495665_0079447 3300046531 Unclassified 1726
1267 Ga0495640_0004199 3300046533 Bacteria 11523
1268 Ga0495640_0035408 3300046533 Bacteria 3533
1269 Ga0495640_0037865 3300046533 Bacteria 3398
1270 Ga0495640_0041162 3300046533 Bacteria 3230
1271 Ga0495640_0096912 3300046533 Unclassified 1940
1272 Ga0495640_0141064 3300046533 Bacteria 1553
1273 Ga0495640_0425162 3300046533 Bacteria 814
1274 Ga0495640_0442347 3300046533 Bacteria 795
1275 Ga0495586_0067463 3300046535 Bacteria 1951
1276 Ga0495586_0098240 3300046535 Unclassified 1623
1277 Ga0495587_0064972 3300046536 Unclassified 2131
1278 Ga0495609_0062392 3300046538 Bacteria 1646
1279 Ga0495645_0023030 3300046543 Bacteria 4508
1280 Ga0495645_0072249 3300046543 Bacteria 2486
1281 Ga0495645_0143988 3300046543 Bacteria 1660
1282 Ga0495645_0235316 3300046543 Bacteria 1225
1283 Ga0495645_0954216 3300046543 Bacteria 506
1284 Ga0495667_0038165 3300046559 Bacteria 3199
1285 Ga0495667_0060705 3300046559 Bacteria 2479
1286 Ga0495667_0064192 3300046559 Bacteria 2402
1287 Ga0495667_0073244 3300046559 Bacteria 2231
1288 Ga0495667_0093489 3300046559 Bacteria 1947
1289 Ga0495667_0101119 3300046559 Unclassified 1865
1290 Ga0495667_0116916 3300046559 Bacteria 1722
1291 Ga0495667_0228351 3300046559 Unclassified 1187
1292 Ga0495656_0002578 3300046615 Bacteria 6041
1293 Ga0495656_0046483 3300046615 Bacteria 1837
1294 Ga0495656_0056216 3300046615 Bacteria 1700
1295 Ga0495656_0057693 3300046615 Bacteria 1682
1296 Ga0495656_0076188 3300046615 Bacteria 1502
1297 Ga0495656_0630054 3300046615 Unclassified 575
1298 Ga0495668_0061246 3300046616 Bacteria 2076
1299 Ga0495634_0117304 3300046642 Bacteria 1707
1300 Ga0495634_0124792 3300046642 Bacteria 1646
1301 Ga0495611_0156954 3300046648 Bacteria 1063
1302 Ga0495635_0010487 3300046663 Bacteria 6483
1303 Ga0495635_0073551 3300046663 Bacteria 2341
1304 Ga0495635_0125878 3300046663 Bacteria 1747
1305 Ga0495635_0147042 3300046663 Bacteria 1604
1306 Ga0495635_0509116 3300046663 Bacteria 792
1307 Ga0495659_0042593 3300046664 Bacteria 1626
1308 Ga0495661_0309628 3300046665 Unclassified 788
1309 Ga0495588_0307545 3300046674 Bacteria 834
1310 Ga0495588_0561431 3300046674 Unclassified 598
1311 Ga0495657_0012211 3300046675 Bacteria 6388
1312 Ga0495657_0027103 3300046675 Bacteria 4049
1313 Ga0495657_0041419 3300046675 Bacteria 3151
1314 Ga0495657_0095513 3300046675 Bacteria 1900
1315 Ga0495657_0167394 3300046675 Unclassified 1356
1316 Ga0495657_0183623 3300046675 Bacteria 1282
1317 Ga0495657_0323357 3300046675 Bacteria 916
1318 Ga0495599_0014073 3300046678 Bacteria 4953
1319 Ga0495599_0014224 3300046678 Bacteria 4926
1320 Ga0495599_0089905 3300046678 Bacteria 1916
1321 Ga0495623_0043281 3300046679 Bacteria 2866
1322 Ga0495623_0054740 3300046679 Bacteria 2516
1323 Ga0495623_0269927 3300046679 Unclassified 950
1324 Ga0495646_0007463 3300046680 Bacteria 6950
1325 Ga0495646_0092320 3300046680 Bacteria 1746
1326 Ga0495647_0008142 3300046681 Bacteria 3523
1327 Ga0495647_0021676 3300046681 Bacteria 2315
1328 Ga0495647_0058933 3300046681 Bacteria 1510
1329 Ga0495647_0187063 3300046681 Bacteria 903
1330 Ga0495658_0001642 3300046683 Bacteria 11629
1331 Ga0495658_0022084 3300046683 Bacteria 3362
1332 Ga0495658_0034755 3300046683 Bacteria 2768
1333 Ga0495658_0053250 3300046683 Bacteria 2298
1334 Ga0495658_0173305 3300046683 Unclassified 1336
1335 Ga0495658_0415517 3300046683 Unclassified 858
1336 Ga0495613_0006002 3300046689 Bacteria 9090
1337 Ga0495613_0013886 3300046689 Bacteria 5977
1338 Ga0495613_0070553 3300046689 Bacteria 2547
1339 Ga0495613_0075604 3300046689 Bacteria 2452
1340 Ga0495613_0150056 3300046689 Bacteria 1663
1341 Ga0495613_0185108 3300046689 Unclassified 1474
1342 Ga0495613_0215310 3300046689 Bacteria 1350
1343 Ga0495613_0569643 3300046689 Unclassified 756
1344 Ga0495624_0009967 3300046690 Bacteria 6569
1345 Ga0495624_0112022 3300046690 Bacteria 1677
1346 Ga0495624_0283149 3300046690 Bacteria 1001
1347 Ga0495624_0333682 3300046690 Bacteria 912
1348 Ga0495624_0344877 3300046690 Unclassified 896
1349 Ga0495624_0426251 3300046690 Bacteria 795
1350 Ga0495624_0568532 3300046690 Unclassified 677
1351 Ga0495670_0216565 3300046691 Bacteria 1017
1352 Ga0495589_0064595 3300046794 Bacteria 1794
1353 Ga0495589_0086462 3300046794 Bacteria 1523
1354 Ga0495589_0111071 3300046794 Bacteria 1323
1355 Ga0495589_0332038 3300046794 Unclassified 702
1356 Ga0495600_0008159 3300046809 Bacteria 6428
1357 Ga0495600_0053184 3300046809 Bacteria 2644
1358 Ga0495600_0088725 3300046809 Bacteria 2017
1359 Ga0495600_0351667 3300046809 Bacteria 923
1360 Ga0495581_0005422 3300047315 Bacteria 7380
1361 Ga0495581_0006426 3300047315 Bacteria 6819
1362 Ga0495581_0011634 3300047315 Bacteria 5093
1363 Ga0495581_0203138 3300047315 Bacteria 1159
1364 Ga0495604_0010501 3300047317 Bacteria 7341
1365 Ga0495604_0022565 3300047317 Bacteria 5025
1366 Ga0495604_0188050 3300047317 Bacteria 1441
1367 Ga0495604_0190498 3300047317 Bacteria 1429
1368 Ga0495604_0540819 3300047317 Bacteria 752
1369 Ga0495604_0952056 3300047317 Unclassified 534
1370 Ga0495636_0128771 3300047318 Bacteria 1125
1371 Ga0495674_0005260 3300047319 Bacteria 12417
1372 Ga0495674_0023461 3300047319 Bacteria 5685
1373 Ga0495674_0074298 3300047319 Bacteria 2928
1374 Ga0495674_0093031 3300047319 Bacteria 2573
1375 Ga0495674_0326296 3300047319 Bacteria 1249
1376 Ga0495676_0046046 3300047321 Bacteria 3545
1377 Ga0495676_0056767 3300047321 Bacteria 3094
1378 Ga0495676_0069211 3300047321 Bacteria 2724
1379 Ga0495676_0098020 3300047321 Bacteria 2176
1380 Ga0495676_0114975 3300047321 Bacteria 1968
1381 Ga0495676_0156430 3300047321 Bacteria 1617
1382 Ga0495676_0176907 3300047321 Bacteria 1498
1383 Ga0495676_0309972 3300047321 Bacteria 1062
1384 Ga0495676_0409202 3300047321 Bacteria 899
1385 Ga0495676_0687772 3300047321 Unclassified 662
1386 Ga0495680_0004019 3300047322 Bacteria 14195
1387 Ga0495680_0007901 3300047322 Bacteria 9707
1388 Ga0495680_0012789 3300047322 Bacteria 7359
1389 Ga0495680_0031439 3300047322 Bacteria 4321
1390 Ga0495680_0033161 3300047322 Bacteria 4183
1391 Ga0495680_0048842 3300047322 Bacteria 3320
1392 Ga0495680_0121450 3300047322 Bacteria 1928
1393 Ga0495680_0158648 3300047322 Bacteria 1644
1394 Ga0495680_0256859 3300047322 Bacteria 1237
1395 Ga0495680_0281896 3300047322 Bacteria 1171
1396 Ga0495680_0377959 3300047322 Bacteria 982
1397 Ga0495683_0246497 3300047323 Unclassified 786
1398 Ga0495675_0039853 3300047444 Bacteria 2993
1399 Ga0495675_0073251 3300047444 Bacteria 2160
1400 Ga0495675_0115991 3300047444 Bacteria 1670
1401 Ga0495675_0217570 3300047444 Bacteria 1157
1402 Ga0495677_0046219 3300047445 Bacteria 1598
1403 Ga0495677_0068395 3300047445 Unclassified 1322
1404 Ga0495684_0031706 3300047471 Bacteria 4059
1405 Ga0495684_0037507 3300047471 Bacteria 3717
1406 Ga0495684_0063791 3300047471 Bacteria 2800
1407 Ga0495684_0081595 3300047471 Bacteria 2454
1408 Ga0495684_0133068 3300047471 Unclassified 1866
1409 Ga0495684_0207240 3300047471 Bacteria 1443
1410 Ga0495684_0328639 3300047471 Bacteria 1091
1411 Ga0495593_0009955 3300047673 Bacteria 5512
1412 Ga0495593_0103529 3300047673 Bacteria 1458
1413 Ga0495602_0033000 3300048088 Bacteria 4864
1414 Ga0495602_0070950 3300048088 Bacteria 2977
1415 Ga0495602_0096811 3300048088 Bacteria 2433
1416 Ga0495602_0097344 3300048088 Bacteria 2424
1417 Ga0495602_0192351 3300048088 Bacteria 1563
1418 Ga0495602_0199514 3300048088 Bacteria 1528
1419 Ga0495602_0320044 3300048088 Bacteria 1129
1420 Ga0495602_0481544 3300048088 Bacteria 871
1421 Ga0495602_0506773 3300048088 Bacteria 843
1422 Ga0495602_1152168 3300048088 Unclassified 507
1423 Ga0495614_0010456 3300048089 Bacteria 4092
1424 Ga0495614_0107048 3300048089 Unclassified 1226
1425 Ga0495614_0490286 3300048089 Unclassified 584
1426 Ga0495615_0056568 3300048090 Unclassified 1024
1427 Ga0496100_0028558 3300048903 Bacteria 3441
1428 Ga0496100_0096316 3300048903 Bacteria 2030
1429 Ga0496100_0240103 3300048903 Bacteria 1336
1430 Ga0496100_0316574 3300048903 Unclassified 1171
1431 Ga0496100_0627835 3300048903 Bacteria 836
1432 Ga0496100_0683779 3300048903 Unclassified 800
1433 Ga0496100_1021869 3300048903 Unclassified 651
1434 Ga0496101_0000543 3300048904 Bacteria 23139
1435 Ga0496101_0004442 3300048904 Bacteria 8831
1436 Ga0496101_0020483 3300048904 Bacteria 4529
1437 Ga0496101_0039949 3300048904 Bacteria 3340
1438 Ga0496101_0079530 3300048904 Bacteria 2420
1439 Ga0496101_0115586 3300048904 Bacteria 2024
1440 Ga0496101_0149503 3300048904 Bacteria 1786
1441 Ga0496101_0205686 3300048904 Bacteria 1523
1442 Ga0496101_0232727 3300048904 Bacteria 1432
1443 Ga0496101_0310674 3300048904 Bacteria 1236
1444 Ga0496101_0377370 3300048904 Unclassified 1115
1445 Ga0496101_0414337 3300048904 Bacteria 1062
1446 Ga0496101_0556653 3300048904 Bacteria 907
1447 Ga0496101_0676721 3300048904 Bacteria 815
1448 Ga0496101_0706806 3300048904 Bacteria 796
1449 Ga0496101_0955941 3300048904 Bacteria 674
1450 Ga0496102_0016856 3300048905 Bacteria 6391
1451 Ga0496102_0019934 3300048905 Bacteria 5915
1452 Ga0496102_0020365 3300048905 Bacteria 5862
1453 Ga0496102_0080933 3300048905 Bacteria 2993
1454 Ga0496102_0241648 3300048905 Bacteria 1702
1455 Ga0496102_0317047 3300048905 Bacteria 1469
1456 Ga0496102_0564012 3300048905 Bacteria 1061
1457 Ga0496102_0700859 3300048905 Bacteria 935
1458 Ga0496103_0004711 3300048906 Bacteria 8249
1459 Ga0496103_0097106 3300048906 Bacteria 1862
1460 Ga0496103_0162048 3300048906 Bacteria 1435
1461 Ga0496103_0257291 3300048906 Unclassified 1123
1462 Ga0496103_0526547 3300048906 Bacteria 755
1463 Ga0496103_0596968 3300048906 Bacteria 703
1464 Ga0496104_0011798 3300048907 Bacteria 7842
1465 Ga0496104_0061869 3300048907 Bacteria 3549
1466 Ga0496104_0095674 3300048907 Bacteria 2841
1467 Ga0496104_0104033 3300048907 Bacteria 2720
1468 Ga0496104_0111172 3300048907 Bacteria 2627
1469 Ga0496104_0221746 3300048907 Bacteria 1803
1470 Ga0496104_0305767 3300048907 Bacteria 1502
1471 Ga0496104_0462893 3300048907 Bacteria 1179
1472 Ga0496104_0744328 3300048907 Bacteria 887
1473 Ga0496105_0005357 3300048908 Bacteria 9725
1474 Ga0496105_0009962 3300048908 Bacteria 7455
1475 Ga0496105_0032243 3300048908 Bacteria 4298
1476 Ga0496105_0041324 3300048908 Bacteria 3800
1477 Ga0496105_0130588 3300048908 Bacteria 2071
1478 Ga0496105_0264614 3300048908 Unclassified 1390
1479 Ga0496105_0305435 3300048908 Bacteria 1278
1480 Ga0496105_0632888 3300048908 Bacteria 827
1481 Ga0496106_0013199 3300048909 Bacteria 6096
1482 Ga0496106_0022795 3300048909 Bacteria 4651
1483 Ga0496106_0090402 3300048909 Bacteria 2362
1484 Ga0496106_0096091 3300048909 Bacteria 2292
1485 Ga0496106_0318223 3300048909 Bacteria 1249
1486 Ga0496106_0487485 3300048909 Unclassified 990
1487 Ga0496107_0002760 3300048910 Bacteria 11559
1488 Ga0496107_0003413 3300048910 Bacteria 10624
1489 Ga0496107_0006653 3300048910 Bacteria 7957
1490 Ga0496107_0021951 3300048910 Bacteria 4509
1491 Ga0496107_0202341 3300048910 Bacteria 1476
1492 Ga0496107_0245014 3300048910 Bacteria 1334
1493 Ga0496107_0501895 3300048910 Bacteria 900
1494 Ga0496108_0004928 3300048911 Bacteria 10784
1495 Ga0496108_0015890 3300048911 Bacteria 6136
1496 Ga0496108_0026132 3300048911 Bacteria 4815
1497 Ga0496108_0133142 3300048911 Bacteria 2137
1498 Ga0496108_0133478 3300048911 Bacteria 2134
1499 Ga0496108_0143137 3300048911 Unclassified 2060
1500 Ga0496108_0915414 3300048911 Bacteria 752
1501 Ga0496108_0988769 3300048911 Bacteria 719
1502 Ga0496108_1470983 3300048911 Bacteria 568
1503 Ga0496109_0001903 3300048912 Bacteria 17330
1504 Ga0496109_0005677 3300048912 Bacteria 10442
1505 Ga0496109_0016587 3300048912 Bacteria 6441
1506 Ga0496109_0017746 3300048912 Bacteria 6243
1507 Ga0496109_0019250 3300048912 Bacteria 6015
1508 Ga0496109_0021098 3300048912 Bacteria 5760
1509 Ga0496109_0052346 3300048912 Bacteria 3721
1510 Ga0496109_0170719 3300048912 Bacteria 2040
1511 Ga0496109_0282753 3300048912 Bacteria 1563
1512 Ga0496109_0434746 3300048912 Bacteria 1240
1513 Ga0496109_0814742 3300048912 Bacteria 871
1514 Ga0496110_0013638 3300048913 Bacteria 6728
1515 Ga0496110_0016283 3300048913 Bacteria 6206
1516 Ga0496110_0163841 3300048913 Bacteria 2016
1517 Ga0496110_0264251 3300048913 Bacteria 1566
1518 Ga0496110_0341057 3300048913 Bacteria 1365
1519 Ga0496110_1133343 3300048913 Bacteria 691
1520 Ga0496111_0034480 3300048914 Bacteria 3614
1521 Ga0496111_0095359 3300048914 Bacteria 2183
1522 Ga0496111_0166138 3300048914 Bacteria 1639
1523 Ga0496111_0234273 3300048914 Bacteria 1364
1524 Ga0496111_0365669 3300048914 Bacteria 1067
1525 Ga0496111_0457767 3300048914 Unclassified 941
1526 Ga0496111_0546543 3300048914 Bacteria 850
1527 Ga0496111_0706616 3300048914 Bacteria 733
1528 Ga0496111_0766551 3300048914 Unclassified 699
1529 Ga0496112_0011988 3300048915 Bacteria 7948
1530 Ga0496112_0019697 3300048915 Bacteria 6376
1531 Ga0496112_0052475 3300048915 Bacteria 4002
1532 Ga0496112_0052956 3300048915 Bacteria 3985
1533 Ga0496112_0074134 3300048915 Bacteria 3365
1534 Ga0496112_0077202 3300048915 Bacteria 3294
1535 Ga0496112_0232347 3300048915 Bacteria 1798
1536 Ga0496112_0422558 3300048915 Bacteria 1272
1537 Ga0496112_0598062 3300048915 Unclassified 1035
1538 Ga0496112_0828815 3300048915 Unclassified 849
1539 Ga0496112_1115158 3300048915 Bacteria 707
1540 Ga0496112_1223483 3300048915 Unclassified 668
1541 Ga0496112_1426237 3300048915 Bacteria 607
1542 Ga0496112_1432186 3300048915 Bacteria 605
1543 Ga0496112_1483996 3300048915 Bacteria 592
1544 Ga0496113_0045822 3300048916 Bacteria 3245
1545 Ga0496113_0052705 3300048916 Bacteria 3040
1546 Ga0496113_0059767 3300048916 Bacteria 2872
1547 Ga0496113_0098779 3300048916 Bacteria 2260
1548 Ga0496113_0147290 3300048916 Bacteria 1855
1549 Ga0496113_0160344 3300048916 Bacteria 1778
1550 Ga0496113_0169672 3300048916 Bacteria 1728
1551 Ga0496113_0624364 3300048916 Unclassified 862
1552 Ga0496113_0746651 3300048916 Bacteria 779
1553 Ga0496113_1486267 3300048916 Bacteria 523
1554 Ga0496114_0000834 3300048917 Bacteria 23084
1555 Ga0496114_0004372 3300048917 Bacteria 10945
1556 Ga0496114_0007807 3300048917 Bacteria 8464
1557 Ga0496114_0013651 3300048917 Bacteria 6512
1558 Ga0496114_0014325 3300048917 Bacteria 6362
1559 Ga0496114_0066430 3300048917 Bacteria 3023
1560 Ga0496114_0136620 3300048917 Bacteria 2120
1561 Ga0496114_0138969 3300048917 Bacteria 2102
1562 Ga0496114_0180801 3300048917 Bacteria 1842
1563 Ga0496114_0200608 3300048917 Bacteria 1747
1564 Ga0496114_0266443 3300048917 Bacteria 1509
1565 Ga0496114_0467514 3300048917 Unclassified 1116
1566 Ga0496114_0743938 3300048917 Unclassified 857
1567 Ga0496115_0005284 3300048918 Bacteria 9390
1568 Ga0496115_0008529 3300048918 Bacteria 7583
1569 Ga0496115_0014758 3300048918 Bacteria 5921
1570 Ga0496115_0035679 3300048918 Bacteria 3935
1571 Ga0496115_0047746 3300048918 Bacteria 3423
1572 Ga0496115_0060555 3300048918 Bacteria 3051
1573 Ga0496115_0262416 3300048918 Bacteria 1420
1574 Ga0496115_0765807 3300048918 Bacteria 754
1575 Ga0496117_0001293 3300048920 Bacteria 36867
1576 Ga0496118_0003780 3300048921 Bacteria 18696
1577 Ga0501031_0034996 3300049568 Bacteria 3276
1578 Ga0501031_0318517 3300049568 Bacteria 1008
1579 Ga0501032_0033341 3300049569 Bacteria 3529
1580 Ga0501032_0103230 3300049569 Bacteria 1889
1581 Ga0501032_0956928 3300049569 Bacteria 538
1582 Ga0501033_0025461 3300049570 Bacteria 4458
1583 Ga0501033_0188642 3300049570 Bacteria 1476
1584 Ga0501034_0003733 3300049571 Bacteria 17206
1585 Ga0501036_0004381 3300049572 Bacteria 11396
1586 Ga0501036_0011277 3300049572 Bacteria 7395
1587 Ga0501036_0932620 3300049572 Bacteria 712
1588 Ga0501037_0027875 3300049573 Bacteria 4174
1589 Ga0501037_0058673 3300049573 Bacteria 2808
1590 Ga0501038_0110790 3300049574 Bacteria 2274
1591 Ga0501039_0001728 3300049575 Bacteria 16100
1592 Ga0501039_0014517 3300049575 Bacteria 6031
1593 Ga0501039_0085454 3300049575 Bacteria 2458
1594 Ga0501040_0007072 3300049576 Bacteria 7275
1595 Ga0501040_0027145 3300049576 Bacteria 3853
1596 Ga0501041_0001743 3300049577 Bacteria 12193
1597 Ga0501041_0009330 3300049577 Bacteria 5778
1598 Ga0501041_0409712 3300049577 Unclassified 859
1599 Ga0501042_0007798 3300049578 Bacteria 7034
1600 Ga0501042_0012528 3300049578 Bacteria 5747
1601 Ga0501042_0210425 3300049578 Unclassified 1403
1602 Ga0501043_0037215 3300049579 Bacteria 3828
1603 Ga0501043_0075925 3300049579 Bacteria 2640
1604 Ga0501043_0221474 3300049579 Bacteria 1464
1605 Ga0501046_0003055 3300049580 Bacteria 15459
1606 Ga0501046_0030403 3300049580 Bacteria 4383
1607 Ga0501046_0369712 3300049580 Unclassified 1039
1608 Ga0501046_0658096 3300049580 Bacteria 740
1609 Ga0501047_0338500 3300049581 Bacteria 1342
1610 Ga0501047_0384789 3300049581 Bacteria 1237
1611 Ga0501047_0439677 3300049581 Bacteria 1134
1612 Ga0501048_0003260 3300049582 Bacteria 12363
1613 Ga0501048_0011917 3300049582 Bacteria 6483
1614 Ga0501067_0149925 3300049583 Bacteria 1299
1615 Ga0501067_0225539 3300049583 Unclassified 1043
1616 Ga0501068_0057949 3300049584 Bacteria 2349
1617 Ga0501068_0456394 3300049584 Bacteria 827
1618 Ga0501068_0919701 3300049584 Bacteria 576
1619 Ga0501068_1215203 3300049584 Bacteria 500
1620 Ga0501069_0081347 3300049585 Unclassified 1824
1621 Ga0501069_0105249 3300049585 Bacteria 1603
1622 Ga0501069_0120595 3300049585 Bacteria 1498
1623 Ga0501069_0134660 3300049585 Bacteria 1416
1624 Ga0501069_0158177 3300049585 Unclassified 1304
1625 Ga0501070_0002828 3300049586 Bacteria 15144
1626 Ga0501070_0005455 3300049586 Bacteria 10855
1627 Ga0501070_0029111 3300049586 Bacteria 4632
1628 Ga0501070_0126275 3300049586 Bacteria 2114
1629 Ga0501070_0200069 3300049586 Bacteria 1641
1630 Ga0501070_0305449 3300049586 Bacteria 1295
1631 Ga0501070_0434904 3300049586 Bacteria 1059
1632 Ga0501070_0480370 3300049586 Unclassified 999
1633 Ga0501071_0000277 3300049587 Bacteria 24366
1634 Ga0501071_0008207 3300049587 Bacteria 6891
1635 Ga0501071_0414863 3300049587 Bacteria 1029
1636 Ga0501071_0789870 3300049587 Unclassified 732
1637 Ga0501072_0004354 3300049588 Bacteria 10748
1638 Ga0501072_0047916 3300049588 Bacteria 3365
1639 Ga0501073_0018647 3300049589 Bacteria 5015
1640 Ga0501073_0095788 3300049589 Bacteria 2061
1641 Ga0501073_0498176 3300049589 Bacteria 842
1642 Ga0501074_0020011 3300049590 Bacteria 4864
1643 Ga0501074_0029384 3300049590 Bacteria 3981
1644 Ga0501074_0058358 3300049590 Bacteria 2780
1645 Ga0501074_0121443 3300049590 Unclassified 1868
1646 Ga0501074_0138849 3300049590 Bacteria 1739
1647 Ga0501074_0185230 3300049590 Unclassified 1485
1648 Ga0501074_0814681 3300049590 Unclassified 658
1649 Ga0501074_0920129 3300049590 Bacteria 615
1650 Ga0501075_0001091 3300049591 Bacteria 17469
1651 Ga0501075_0024275 3300049591 Bacteria 4443
1652 Ga0501075_1366925 3300049591 Bacteria 536
1653 Ga0501076_0000783 3300049592 Bacteria 20500
1654 Ga0501076_0003280 3300049592 Bacteria 11336
1655 Ga0501076_0298773 3300049592 Bacteria 1320
1656 Ga0501077_0012704 3300049593 Bacteria 5273
1657 Ga0501077_0014064 3300049593 Bacteria 5020
1658 Ga0501260_055002 3300049689 Bacteria 509
1659 Ga0501079_0001798 3300049741 Bacteria 15315
1660 Ga0501079_0042906 3300049741 Bacteria 3491
1661 Ga0501079_0118471 3300049741 Bacteria 2058
1662 Ga0501079_0237828 3300049741 Bacteria 1423
1663 Ga0501079_0626703 3300049741 Bacteria 847
1664 Ga0501080_0013910 3300049742 Bacteria 7407
1665 Ga0501080_0014815 3300049742 Bacteria 7181
1666 Ga0501080_0044173 3300049742 Bacteria 4148
1667 Ga0501080_0105808 3300049742 Bacteria 2608
1668 Ga0501080_0142451 3300049742 Bacteria 2216
1669 Ga0501080_0417116 3300049742 Bacteria 1206
1670 Ga0501080_0758669 3300049742 Bacteria 853
1671 Ga0501080_1744598 3300049742 Bacteria 524
1672 Ga0501081_0006597 3300049743 Bacteria 7542
1673 Ga0501081_0012176 3300049743 Bacteria 5642
1674 Ga0501083_0009961 3300049744 Bacteria 6708
1675 Ga0501083_0050531 3300049744 Bacteria 2798
1676 Ga0501083_0635229 3300049744 Unclassified 694
1677 Ga0501035_0019610 3300049822 Bacteria 6214
1678 Ga0501035_0074026 3300049822 Bacteria 3014
1679 Ga0501035_0242691 3300049822 Bacteria 1532
1680 Ga0501035_0282411 3300049822 Bacteria 1403
1681 Ga0501044_0082727 3300049823 Bacteria 3247
1682 Ga0501044_0438339 3300049823 Bacteria 1215
1683 Ga0501044_0919072 3300049823 Bacteria 749
1684 Ga0501045_0004806 3300049824 Bacteria 9333
1685 Ga0501045_0007353 3300049824 Bacteria 7657
1686 nmdc:mga03683_207527_c1 3300050489 Bacteria 900
1687 nmdc:mga03683_7319_c1 3300050489 Bacteria 3826
1688 nmdc:mga00v17_14314_c1 3300050491 Bacteria 4424
1689 nmdc:mga00v17_256446_c1 3300050491 Bacteria 1134
1690 nmdc:mga0yw44_136119_c1 3300050492 Bacteria 1594
1691 nmdc:mga0yw44_26552_c1 3300050492 Bacteria 3309
1692 nmdc:mga0yw44_289946_c1 3300050492 Bacteria 1095
1693 nmdc:mga0k408_192614_c1 3300050493 Bacteria 1216
1694 nmdc:mga05p37_22675_c1 3300050507 Bacteria 7615
1695 nmdc:mga05p37_370366_c2 3300050507 Bacteria 1328
1696 nmdc:mga09592_5528_c1 3300050508 Bacteria 10285
1697 nmdc:mga0qj67_7976_c1 3300050509 Bacteria 7829
1698 nmdc:mga06r32_11474_c1 3300050510 Bacteria 7981
1699 nmdc:mga06r32_871532_c1 3300050510 Bacteria 858
1700 nmdc:mga08y16_13386_c1 3300050511 Bacteria 8630
1701 nmdc:mga08y16_168120_c1 3300050511 Bacteria 2278
1702 nmdc:mga08y16_442593_c1 3300050511 Bacteria 1326
1703 nmdc:mga0n895_170673_c1 3300050512 Bacteria 2207
1704 nmdc:mga0n895_63942_c1 3300050512 Bacteria 3639
1705 nmdc:mga0rr50_255123_c1 3300050513 Bacteria 1457
1706 nmdc:mga0rr50_73328_c1 3300050513 Bacteria 2617
1707 nmdc:mga0rr50_816097_c1 3300050513 Bacteria 796
1708 nmdc:mga08x19_752179_c1 3300050514 Bacteria 692
1709 nmdc:mga0a205_124281_c1 3300050515 Bacteria 2169
1710 nmdc:mga0a205_267637_c1 3300050515 Bacteria 1586
1711 Ga0495601_0014551 3300053077 Bacteria 4741
1712 Ga0495601_0015827 3300053077 Bacteria 4565
1713 Ga0495601_0068997 3300053077 Bacteria 2254
1714 Ga0495601_0092630 3300053077 Bacteria 1946
1715 Ga0495601_0199809 3300053077 Bacteria 1306
1716 Ga0495601_0217627 3300053077 Bacteria 1247
1717 Ga0495601_0288321 3300053077 Bacteria 1070
1718 Ga0495601_0304523 3300053077 Unclassified 1038
1719 Ga0495601_0373152 3300053077 Unclassified 926
1720 Ga0495601_0396892 3300053077 Bacteria 894
1721 Ga0495601_0617923 3300053077 Unclassified 695
1722 Ga0495612_0092361 3300053078 Unclassified 1283
1723 Ga0495655_0001362 3300053083 Bacteria 3757
1724 Ga0495595_0001437 3300053084 Bacteria 9279
1725 Ga0495595_0099352 3300053084 Bacteria 1403
1726 Ga0495595_0099621 3300053084 Bacteria 1401
1727 Ga0495595_0100965 3300053084 Unclassified 1392
1728 Ga0495619_0006989 3300053085 Bacteria 7143
1729 Ga0495619_0009752 3300053085 Bacteria 6052
1730 Ga0495619_0015204 3300053085 Bacteria 4865
1731 Ga0495619_0068533 3300053085 Bacteria 2370
1732 Ga0495619_0092706 3300053085 Bacteria 2046
1733 Ga0495619_0100424 3300053085 Archaea 1969
1734 Ga0495619_0107768 3300053085 Unclassified 1901
1735 Ga0495619_0131328 3300053085 Unclassified 1721
1736 Ga0495619_0137619 3300053085 Bacteria 1680
1737 Ga0495619_0245552 3300053085 Bacteria 1241
1738 Ga0495619_0816926 3300053085 Bacteria 630
1739 Ga0501084_0002882 3300054114 Bacteria 13909
1740 Ga0501084_0007645 3300054114 Bacteria 8911
1741 Ga0501084_0163645 3300054114 Unclassified 1877
1742 Ga0501084_0408257 3300054114 Bacteria 1148
1743 Ga0590075_114676 3300059424 Bacteria 704
1744 Ga0590077_031419 3300059426 Unclassified 1160
1745 Ga0587077_096519 3300059493 Bacteria 703
1746 Ga0587115_117978 3300059626 Bacteria 508
1747 Ga0501082_0012944 3300060353 Bacteria 7171
1748 Ga0501082_0015327 3300060353 Bacteria 6596
1749 Ga0501082_0471954 3300060353 Unclassified 1096
1750 Ga0466962_0000131 3300061719 Bacteria 30686
1751 Ga0466962_0020213 3300061719 Bacteria 3201
1752 Ga0466962_0079384 3300061719 Unclassified 1569
1753 Ga0466962_0081277 3300061719 Unclassified 1550
1754 Ga0466962_0096637 3300061719 Bacteria 1416
1755 Ga0466962_0100456 3300061719 Bacteria 1389
1756 Ga0466962_0172679 3300061719 Bacteria 1053
1757 Ga0466962_0448842 3300061719 Bacteria 649
1758 Ga0530510_0007435 3300061734 Bacteria 7626
1759 Ga0530510_0014267 3300061734 Bacteria 5602
1760 Ga0530510_0119285 3300061734 Unclassified 1936
1761 Ga0530510_0196228 3300061734 Bacteria 1499
1762 Ga0265319_1013800
1763 JGI24744J21845_10000960
1764 JGI25407J50210_10001824
1765 JGI25405J52794_10055301
1766 Ga0070658_10024594
1767 Ga0070658_10098314
1768 Ga0070658_10132667
1769 Ga0070658_10288314
1770 Ga0070658_10540868
1771 Ga0070658_10868323
1772 Ga0070658_11094837
1773 Ga0070658_11248204
1774 Ga0070658_11400022
1775 Ga0070683_100001652
1776 Ga0070683_100017233
1777 Ga0070683_100060391
1778 Ga0070683_100164114
1779 Ga0070683_100186421
1780 Ga0070683_100238216
1781 Ga0070683_100296896
1782 Ga0070683_100701841
1783 Ga0070683_101947625
1784 Ga0070683_102002313
1785 Ga0070690_100019255
1786 Ga0070690_101352298
1787 Ga0070666_11212485
1788 Ga0070680_100008118
1789 Ga0070680_100153672
1790 Ga0070680_100154767
1791 Ga0070680_100951145
1792 Ga0070680_101216723
1793 Ga0070682_100014196
1794 Ga0070682_100155954
1795 Ga0070682_100529155
1796 Ga0070682_100722819
1797 Ga0070682_100778455
1798 Ga0068868_100010092
1799 Ga0068868_100027493
1800 Ga0068868_100358715
1801 Ga0070660_100006026
1802 Ga0070660_100016383
1803 Ga0070660_100035757
1804 Ga0070660_100044741
1805 Ga0070660_100055265
1806 Ga0070660_100330381
1807 Ga0070660_100533962
1808 Ga0070689_100006812
1809 Ga0070691_10213769
1810 Ga0070687_100282156
1811 Ga0070687_100892703
1812 Ga0070661_100062932
1813 Ga0070661_100217140
1814 Ga0070661_101046311
1815 Ga0070692_10007346
1816 Ga0070692_10674027
1817 Ga0070668_100026182
1818 Ga0070668_100563009
1819 Ga0070669_101553195
1820 Ga0070669_101762271
1821 Ga0070675_100037741
1822 Ga0070675_101476484
1823 Ga0070671_100015983
1824 Ga0070671_100088093
1825 Ga0070674_100007583
1826 Ga0070674_100470683
1827 Ga0070673_100148872
1828 Ga0070673_100205245
1829 Ga0070688_100524924
1830 Ga0070659_100033126
1831 Ga0070659_100038472
1832 Ga0070659_100374884
1833 Ga0070659_100444071
1834 Ga0070667_100179863
1835 Ga0070667_100894857
1836 Ga0070667_101122528
1837 Ga0070703_10139602
1838 Ga0070709_10011026
1839 Ga0070709_10026548
1840 Ga0070709_10348405
1841 Ga0070709_10503170
1842 Ga0070709_10972906
1843 Ga0070709_11124988
1844 Ga0070714_100028276
1845 Ga0070714_100032738
1846 Ga0070714_100178964
1847 Ga0070714_100266861
1848 Ga0070714_100388779
1849 Ga0070714_100657281
1850 Ga0070714_100911235
1851 Ga0070714_101135771
1852 Ga0070714_101865845
1853 Ga0070714_102220530
1854 Ga0070713_100013778
1855 Ga0070713_100037697
1856 Ga0070713_100115959
1857 Ga0070713_100213048
1858 Ga0070713_100495133
1859 Ga0070713_100595507
1860 Ga0070713_100954908
1861 Ga0070710_10008474
1862 Ga0070710_10054659
1863 Ga0070710_10201695
1864 Ga0070710_10430744
1865 Ga0070710_10588400
1866 Ga0070710_10759654
1867 Ga0070701_10033849
1868 Ga0070711_100001520
1869 Ga0070711_100023649
1870 Ga0070711_100093336
1871 Ga0070711_100173984
1872 Ga0070711_100355951
1873 Ga0070711_100582484
1874 Ga0070711_101523951
1875 Ga0070705_100050250
1876 Ga0070705_100307046
1877 Ga0070705_100401145
1878 Ga0070705_100441714
1879 Ga0070700_100001889
1880 Ga0070700_100455269
1881 Ga0070694_100020934
1882 Ga0070694_100113732
1883 Ga0070708_100023451
1884 Ga0070708_101330169
1885 Ga0070663_100003865
1886 Ga0070663_100558516
1887 Ga0070678_100009983
1888 Ga0070678_100530684
1889 Ga0070678_100566677
1890 Ga0070678_100741977
1891 Ga0070678_102199550
1892 Ga0070662_100622182
1893 Ga0070662_101283885
1894 Ga0070681_10021240
1895 Ga0070681_10022909
1896 Ga0070681_10031175
1897 Ga0070681_10047668
1898 Ga0070681_10050995
1899 Ga0070681_10099226
1900 Ga0070681_10183871
1901 Ga0070681_10215955
1902 Ga0070681_10281512
1903 Ga0070681_10310396
1904 Ga0070681_10949764
1905 Ga0068867_100002920
1906 Ga0068867_100515956
1907 Ga0070706_100206032
1908 Ga0070706_100482002
1909 Ga0070707_100002419
1910 Ga0070707_100067070
1911 Ga0070707_100127311
1912 Ga0070707_100329462
1913 Ga0070707_101262787
1914 Ga0070698_100016387
1915 Ga0070698_100017977
1916 Ga0070698_100197928
1917 Ga0070698_102061150
1918 Ga0070699_100053515
1919 Ga0070699_100062020
1920 Ga0070699_100383779
1921 Ga0070699_100508273
1922 Ga0070679_100002604
1923 Ga0070679_100072801
1924 Ga0070679_100074082
1925 Ga0070679_100077707
1926 Ga0070679_100138708
1927 Ga0070679_100161901
1928 Ga0070679_100166241
1929 Ga0070679_100203356
1930 Ga0070679_100315289
1931 Ga0070679_100429186
1932 Ga0070679_100798995
1933 Ga0070679_101290883
1934 Ga0070679_101337935
1935 Ga0070679_101902483
1936 Ga0070684_100022931
1937 Ga0070684_100027893
1938 Ga0070684_100100928
1939 Ga0070684_100101097
1940 Ga0070684_100119575
1941 Ga0070684_100236949
1942 Ga0070684_100322093
1943 Ga0070697_100221110
1944 Ga0070697_100232065
1945 Ga0070697_101134415
1946 Ga0068853_100044117
1947 Ga0068853_100140662
1948 Ga0068853_100712984
1949 Ga0068853_101255591
1950 Ga0068853_101267975
1951 Ga0068853_101356012
1952 Ga0070672_100014159
1953 Ga0070686_100003711
1954 Ga0070695_100000691
1955 Ga0070695_100042188
1956 Ga0070695_100141937
1957 Ga0070695_100142749
1958 Ga0070696_100020674
1959 Ga0070696_100062600
1960 Ga0070696_100213638
1961 Ga0070696_101250719
1962 Ga0070693_100124306
1963 Ga0070665_100045306
1964 Ga0070665_100310022
1965 Ga0070665_100338765
1966 Ga0070704_100009470
1967 Ga0070704_100031449
1968 Ga0070704_100081794
1969 Ga0070704_101862636
1970 Ga0068855_100005599
1971 Ga0068855_100071082
1972 Ga0068855_100076427
1973 Ga0068855_100192962
1974 Ga0068855_100200635
1975 Ga0068855_100248330
1976 Ga0068855_100254836
1977 Ga0068855_100264783
1978 Ga0068855_100387366
1979 Ga0068855_100481544
1980 Ga0068855_100606051
1981 Ga0070664_100778101
1982 Ga0070664_100934191
1983 Ga0070664_101134218
1984 Ga0068857_100007740
1985 Ga0068857_100043448
1986 Ga0068857_100131252
1987 Ga0068857_100308824
1988 Ga0068857_100507964
1989 Ga0068854_100657788
1990 Ga0068856_100014835
1991 Ga0068856_100109583
1992 Ga0068856_100217295
1993 Ga0068856_100281439
1994 Ga0068856_100389413
1995 Ga0070702_100080089
1996 Ga0070702_100107332
1997 Ga0070702_100346172
1998 Ga0068852_100057219
1999 Ga0068852_100373780
2000 Ga0068852_100655178
2001 Ga0068859_100229612
2002 Ga0068864_100275486
2003 Ga0068866_10182170
2004 Ga0068866_10430769
2005 Ga0068861_100050711
2006 Ga0068861_100136400
2007 Ga0068851_10805172
2008 Ga0068863_100297160
2009 Ga0068863_101481101
2010 Ga0068860_100067587
2011 Ga0068860_101009480
2012 Ga0068862_100954482
2013 Ga0068862_101037874
2014 Ga0081455_10003877
2015 Ga0081455_10007079
2016 Ga0081455_10025023
2017 Ga0081455_10102019
2018 Ga0081455_10124214
2019 Ga0081455_10175429
2020 Ga0081455_10649859
2021 Ga0081538_10000012
2022 Ga0081538_10000078
2023 Ga0081538_10001260
2024 Ga0081538_10002330
2025 Ga0081538_10042481
2026 Ga0081540_1000116
2027 Ga0070717_10006695
2028 Ga0070717_10009605
2029 Ga0070717_10027420
2030 Ga0070717_10049312
2031 Ga0070717_10094914
2032 Ga0070717_10345788
2033 Ga0070717_10403668
2034 Ga0070717_10590095
2035 Ga0070717_10650705
2036 Ga0070717_10712468
2037 Ga0075365_10101165
2038 Ga0075365_10195851
2039 Ga0075363_100381614
2040 Ga0075363_100818780
2041 Ga0075364_10001371
2042 Ga0075364_10841640
2043 Ga0070715_10001548
2044 Ga0070715_10009984
2045 Ga0070716_100016873
2046 Ga0070716_100040809
2047 Ga0070716_100073522
2048 Ga0070712_100029829
2049 Ga0070712_100043886
2050 Ga0070712_100059409
2051 Ga0070712_100061449
2052 Ga0070712_100375737
2053 Ga0070712_100510274
2054 Ga0070712_100561746
2055 Ga0070712_100810849
2056 Ga0070712_101184656
2057 Ga0075362_10027773
2058 Ga0075367_10415664
2059 Ga0075366_10184632
2060 Ga0097621_100490334
2061 Ga0097621_100837618
2062 Ga0097621_101468119
2063 Ga0068871_100170604
2064 Ga0068871_101767907
2065 Ga0075428_100040344
2066 Ga0075430_100006540
2067 Ga0075430_100026469
2068 Ga0075431_100013118
2069 Ga0075431_100442740
2070 Ga0075433_10017067
2071 Ga0075433_10026810
2072 Ga0075433_10121657
2073 Ga0075433_10547873
2074 Ga0075433_11106208
2075 Ga0075434_100032514
2076 Ga0075434_100063037
2077 Ga0075434_100133540
2078 Ga0075434_100216440
2079 Ga0075434_100786585
2080 Ga0075429_100009626
2081 Ga0068865_100007182
2082 Ga0068865_100290110
2083 Ga0068865_100300021
2084 Ga0068865_100420595
2085 Ga0068865_100890978
2086 Ga0075436_100021159
2087 Ga0075436_100028623
2088 Ga0097620_100229628
2089 Ga0075435_100024010
2090 Ga0075435_100061568
2091 Ga0075435_100084943
2092 Ga0075435_100142487
2093 Ga0105251_10574308
2094 Ga0105244_10088778
2095 Ga0105240_10010904
2096 Ga0105240_10016187
2097 Ga0105240_10033728
2098 Ga0105240_10160432
2099 Ga0105240_10390751
2100 Ga0105240_10452674
2101 Ga0105240_10508609
2102 Ga0105240_11581991
2103 Ga0111539_10044312
2104 Ga0111539_10191336
2105 Ga0111539_10442030
2106 Ga0111539_10518157
2107 Ga0111539_10816133
2108 Ga0111539_11243655
2109 Ga0105245_10012468
2110 Ga0105245_10070234
2111 Ga0105245_10119963
2112 Ga0105245_10188190
2113 Ga0105245_10280652
2114 Ga0105245_11266626
2115 Ga0105245_11860478
2116 Ga0105245_12296602
2117 Ga0105245_12302965
2118 Ga0105245_13066406
2119 Ga0105247_10026522
2120 Ga0114129_10065208
2121 Ga0114129_10087913
2122 Ga0114129_10172141
2123 Ga0114129_10507177
2124 Ga0114129_11433331
2125 Ga0114129_11667125
2126 Ga0105243_10044346
2127 Ga0105243_10169796
2128 Ga0105243_10343153
2129 Ga0105243_11092827
2130 Ga0105241_10014582
2131 Ga0105241_10082598
2132 Ga0105241_10643072
2133 Ga0105241_10897852
2134 Ga0105241_12208815
2135 Ga0105242_10082032
2136 Ga0105242_10085846
2137 Ga0105242_10157190
2138 Ga0105242_10212648
2139 Ga0105242_10241859
2140 Ga0105242_10368737
2141 Ga0105242_10574160
2142 Ga0105242_11721043
2143 Ga0105242_13274448
2144 Ga0105248_10045187
2145 Ga0105248_10045265
2146 Ga0105248_11488110
2147 Ga0105237_10027161
2148 Ga0105237_10054796
2149 Ga0105237_10089459
2150 Ga0105237_10503301
2151 Ga0105237_10784243
2152 Ga0105238_10066774
2153 Ga0105238_10105267
2154 Ga0105238_10527386
2155 Ga0105238_12045809
2156 Ga0105249_10002311
2157 Ga0105249_10142322
2158 Ga0105239_10109788
2159 Ga0105239_10146373
2160 Ga0105239_10253720
2161 Ga0105239_10759394
2162 Ga0105239_10829290
2163 Ga0105239_10890811
2164 Ga0105239_11481799
2165 Ga0105246_10042425
2166 Ga0105246_10154305
2167 Ga0105246_10350141
2168 Ga0105246_10403802
2169 Ga0105246_10603213
2170 Ga0105246_11850611
2171 Ga0157337_1025093
2172 Ga0157373_10305154
2173 Ga0157371_10061380
2174 Ga0157371_10339801
2175 Ga0157371_11504605
2176 Ga0157370_10007783
2177 Ga0157370_10028661
2178 Ga0157370_10070188
2179 Ga0157370_10234264
2180 Ga0157370_10272896
2181 Ga0157370_10797342
2182 Ga0157370_11067564
2183 Ga0157369_10005385
2184 Ga0157369_10067238
2185 Ga0157369_10113649
2186 Ga0157369_10131550
2187 Ga0157369_10353190
2188 Ga0157369_10368586
2189 Ga0157369_10458950
2190 Ga0157369_10642757
2191 Ga0157369_10696725
2192 Ga0157369_10814064
2193 Ga0157369_11079524
2194 Ga0157369_11122821
2195 Ga0157369_11198070
2196 Ga0157369_11469115
2197 Ga0157369_11623934
2198 Ga0157374_10113993
2199 Ga0157374_10138765
2200 Ga0157374_10280588
2201 Ga0157374_10537651
2202 Ga0157374_10759110
2203 Ga0157374_12793686
2204 Ga0157378_10021004
2205 Ga0157378_10087210
2206 Ga0157378_10408102
2207 Ga0157378_10536445
2208 Ga0163162_10004416
2209 Ga0163162_10343122
2210 Ga0163162_10560935
2211 Ga0157372_10026695
2212 Ga0157372_10149581
2213 Ga0157372_10217095
2214 Ga0157372_10314311
2215 Ga0157372_10931619
2216 Ga0157372_11104666
2217 Ga0157372_11321390
2218 Ga0157372_11843288
2219 Ga0157372_13401283
2220 Ga0157375_10192709
2221 Ga0157375_10244167
2222 Ga0157375_10272096
2223 Ga0157375_10779489
2224 Ga0163163_11323794
2225 Ga0163163_11632325
2226 Ga0163163_11692322
2227 Ga0182008_10109139
2228 Ga0157377_10025713
2229 Ga0157379_10693949
2230 Ga0157376_10071132
2231 Ga0157376_10163508
2232 Ga0157376_10191107
2233 Ga0157376_10460680
2234 Ga0157376_11718042
2235 Ga0182007_10317775
2236 Ga0163161_10264080
2237 Ga0197907_10416825
2238 Ga0197907_10716303
2239 Ga0206356_10667790
2240 Ga0206356_10700751
2241 Ga0206356_10788852
2242 Ga0206356_11812622
2243 Ga0206354_10974213
2244 Ga0206353_10211289
2245 Ga0206353_10322309
2246 Ga0206353_10467431
2247 Ga0206353_10600212
2248 Ga0206353_10730077
2249 Ga0206353_11412740
2250 Ga0206353_11615196
2251 Ga0206353_11994009
2252 Ga0213876_10115045
2253 Ga0224712_10170402
2254 Ga0207692_10010590
2255 Ga0207692_10167535
2256 Ga0207692_10229497
2257 Ga0207692_11183417
2258 Ga0207642_10564405
2259 Ga0207647_10117127
2260 Ga0207685_10015934
2261 Ga0207685_10017607
2262 Ga0207685_10019805
2263 Ga0207699_10022148
2264 Ga0207699_10241345
2265 Ga0207699_10921918
2266 Ga0207699_11484705
2267 Ga0207705_10021089
2268 Ga0207705_10048604
2269 Ga0207705_10135407
2270 Ga0207705_10138782
2271 Ga0207705_10330500
2272 Ga0207705_10395274
2273 Ga0207705_10684079
2274 Ga0207705_11004201
2275 Ga0207705_11411075
2276 Ga0207684_10148199
2277 Ga0207684_10489198
2278 Ga0207684_11180863
2279 Ga0207654_10169436
2280 Ga0207707_10006267
2281 Ga0207707_10034982
2282 Ga0207707_10039960
2283 Ga0207707_10092655
2284 Ga0207707_10313782
2285 Ga0207707_10440447
2286 Ga0207707_10451098
2287 Ga0207707_11039655
2288 Ga0207695_10080725
2289 Ga0207695_10273768
2290 Ga0207695_11231663
2291 Ga0207671_10031468
2292 Ga0207671_10088321
2293 Ga0207671_10287835
2294 Ga0207693_10000371
2295 Ga0207693_10000990
2296 Ga0207693_10001398
2297 Ga0207693_10058963
2298 Ga0207693_10121497
2299 Ga0207693_10127706
2300 Ga0207693_10399238
2301 Ga0207693_10607752
2302 Ga0207693_10744333
2303 Ga0207663_10012460
2304 Ga0207663_10038778
2305 Ga0207663_10156398
2306 Ga0207663_10222310
2307 Ga0207663_10955668
2308 Ga0207663_11001241
2309 Ga0207660_10085959
2310 Ga0207660_10097423
2311 Ga0207660_10146812
2312 Ga0207660_10181111
2313 Ga0207660_10523083
2314 Ga0207660_10738588
2315 Ga0207662_10291487
2316 Ga0207657_10000207
2317 Ga0207657_10013395
2318 Ga0207657_10015777
2319 Ga0207657_10018969
2320 Ga0207657_10021934
2321 Ga0207657_10025349
2322 Ga0207657_10066404
2323 Ga0207657_10234060
2324 Ga0207657_10332882
2325 Ga0207657_10549748
2326 Ga0207657_10804666
2327 Ga0207657_11239371
2328 Ga0207649_10096381
2329 Ga0207649_10260675
2330 Ga0207649_10342542
2331 Ga0207649_10688646
2332 Ga0207652_10021218
2333 Ga0207652_10110214
2334 Ga0207652_10113557
2335 Ga0207652_10121469
2336 Ga0207652_10125053
2337 Ga0207652_10241419
2338 Ga0207652_10501255
2339 Ga0207652_10641387
2340 Ga0207652_10672200
2341 Ga0207652_10687440
2342 Ga0207652_11120811
2343 Ga0207652_11187617
2344 Ga0207652_11312725
2345 Ga0207652_11523253
2346 Ga0207646_10041496
2347 Ga0207646_10309384
2348 Ga0207694_10120419
2349 Ga0207694_10290985
2350 Ga0207694_10571791
2351 Ga0207694_11490055
2352 Ga0207659_11179850
2353 Ga0207687_10026601
2354 Ga0207687_10081102
2355 Ga0207687_10212967
2356 Ga0207687_10421187
2357 Ga0207687_10836011
2358 Ga0207700_10058843
2359 Ga0207700_10081201
2360 Ga0207700_10100185
2361 Ga0207700_10298148
2362 Ga0207700_10457358
2363 Ga0207700_10543438
2364 Ga0207700_11099365
2365 Ga0207664_10021231
2366 Ga0207664_10046845
2367 Ga0207664_10078067
2368 Ga0207664_10148314
2369 Ga0207664_10566979
2370 Ga0207664_10986580
2371 Ga0207664_11146981
2372 Ga0207664_11168656
2373 Ga0207644_10048422
2374 Ga0207644_10161976
2375 Ga0207644_10613073
2376 Ga0207690_10239537
2377 Ga0207690_10396115
2378 Ga0207690_10538125
2379 Ga0207690_10984609
2380 Ga0207706_10581926
2381 Ga0207706_11325612
2382 Ga0207686_10008123
2383 Ga0207686_10050347
2384 Ga0207686_10148931
2385 Ga0207686_10638204
2386 Ga0207709_10001704
2387 Ga0207709_10068099
2388 Ga0207670_10827760
2389 Ga0207669_10368899
2390 Ga0207669_10502020
2391 Ga0207704_10005190
2392 Ga0207704_10248958
2393 Ga0207704_11141530
2394 Ga0207704_11351081
2395 Ga0207665_10000070
2396 Ga0207665_10010513
2397 Ga0207665_10079495
2398 Ga0207691_10070326
2399 Ga0207691_10198186
2400 Ga0207711_10410625
2401 Ga0207711_10490212
2402 Ga0207711_10727961
2403 Ga0207711_11568913
2404 Ga0207661_10030797
2405 Ga0207661_10032448
2406 Ga0207661_10117707
2407 Ga0207661_10135468
2408 Ga0207661_10138183
2409 Ga0207661_10246928
2410 Ga0207661_10368125
2411 Ga0207661_10391160
2412 Ga0207661_10593462
2413 Ga0207661_11282115
2414 Ga0207679_10278369
2415 Ga0207679_10389599
2416 Ga0207679_10580038
2417 Ga0207667_10033445
2418 Ga0207667_10066116
2419 Ga0207667_10113662
2420 Ga0207667_10173227
2421 Ga0207667_10197387
2422 Ga0207667_10233821
2423 Ga0207667_10286573
2424 Ga0207667_10322623
2425 Ga0207667_11423086
2426 Ga0207712_10006452
2427 Ga0207712_10277974
2428 Ga0207668_10063831
2429 Ga0207640_10717808
2430 Ga0207640_10897192
2431 Ga0207640_11217041
2432 Ga0207658_10002891
2433 Ga0207658_10917277
2434 Ga0207658_11574275
2435 Ga0207677_10139189
2436 Ga0207677_11610400
2437 Ga0207639_10325905
2438 Ga0207639_10570039
2439 Ga0207639_10733166
2440 Ga0207639_11877796
2441 Ga0207678_10113601
2442 Ga0207678_10444611
2443 Ga0207678_10622198
2444 Ga0207708_10000833
2445 Ga0207708_10857466
2446 Ga0207708_11082143
2447 Ga0207708_11294843
2448 Ga0207708_11793532
2449 Ga0207702_10098954
2450 Ga0207702_10277260
2451 Ga0207702_10356568
2452 Ga0207702_10370390
2453 Ga0207702_10399638
2454 Ga0207702_10487433
2455 Ga0207702_10802490
2456 Ga0207702_10849968
2457 Ga0207702_11651225
2458 Ga0207641_10427780
2459 Ga0207641_11068666
2460 Ga0207648_10000806
2461 Ga0207676_10295065
2462 Ga0207674_10003353
2463 Ga0207674_10034494
2464 Ga0207674_10034801
2465 Ga0207674_10103688
2466 Ga0207674_10335926
2467 Ga0207674_11357543
2468 Ga0207675_100082252
2469 Ga0207683_10007545
2470 Ga0207683_10155522
2471 Ga0207683_10158835
2472 Ga0207698_10087393
2473 Ga0207698_10126124
2474 Ga0207698_10151040
2475 Ga0207698_10287633
2476 Ga0207428_10003626
2477 Ga0207428_10354867
2478 Ga0268266_10283665
2479 Ga0268266_10598062
2480 Ga0268266_10736086
2481 Ga0268265_10576698
2482 Ga0265326_10052168
2483 Ga0265319_1003390
2484 Ga0265319_1103063
2485 Ga0265334_10030013
2486 Ga0265334_10100569
2487 Ga0265334_10121742
2488 Ga0265318_10002905
2489 Ga0265318_10026357
2490 Ga0265318_10133877
2491 Ga0265322_10010959
2492 Ga0265322_10014646
2493 Ga0265322_10042958
2494 Ga0265336_10005527
2495 Ga0265338_10006136
2496 Ga0265338_10009161
2497 Ga0265338_10016938
2498 Ga0265338_10019524
2499 Ga0265338_10030185
2500 Ga0265338_10070358
2501 Ga0265338_10070593
2502 Ga0265338_10087484
2503 Ga0265338_10186516
2504 Ga0265330_10017777
2505 Ga0265330_10044163
2506 Ga0265332_10036278
2507 Ga0265328_10043350
2508 Ga0265328_10307181
2509 Ga0265320_10038804
2510 Ga0265320_10097999
2511 Ga0265320_10279280
2512 Ga0265325_10019941
2513 Ga0265325_10050476
2514 Ga0265325_10106306
2515 Ga0265329_10020911
2516 Ga0265340_10207132
2517 Ga0265340_10295630
2518 Ga0265339_10068072
2519 Ga0265339_10113784
2520 Ga0265331_10099514
2521 Ga0265331_10355698
2522 Ga0265327_10006112
2523 Ga0265327_10021363
2524 Ga0265327_10039337
2525 Ga0265327_10040559
2526 Ga0265327_10054359
2527 Ga0265327_10213656
2528 Ga0265316_10008470
2529 Ga0265316_10029661
2530 Ga0265316_10049741
2531 Ga0307408_100114748
2532 Ga0307408_100176961
2533 Ga0307408_100246442
2534 Ga0265313_10004895
2535 Ga0265313_10199018
2536 Ga0265314_10004374
2537 Ga0265314_10131538
2538 Ga0265314_10242230
2539 Ga0265314_10478885
2540 Ga0265342_10030444
2541 Ga0265342_10045478
2542 Ga0265342_10282030
2543 Ga0307405_10257868
2544 Ga0307405_10506553
2545 Ga0307405_11637767
2546 Ga0307413_10340511
2547 Ga0307413_11387490
2548 Ga0307406_10103808
2549 Ga0307406_10285552
2550 Ga0307407_10474183
2551 Ga0307407_10619802
2552 Ga0307407_10668333
2553 Ga0307412_10303935
2554 Ga0307409_100149342
2555 Ga0307409_100183933
2556 Ga0307409_100359945
2557 Ga0307409_100395667
2558 Ga0307409_100979340
2559 Ga0307416_100064091
2560 Ga0307416_100130796
2561 Ga0307416_100620890
2562 Ga0307416_101059209
2563 Ga0307414_10394891
2564 Ga0307411_11203901
2565 Ga0307415_100070335
2566 Ga0307415_100133591
2567 Ga0307415_100215392
2568 Ga0307415_100882982
2569 Ga0316583_10018438
2570 Ga0316583_10146969
2571 Ga0373926_0057441
2572 Ga0373934_0287863
2573 Ga0373944_0012696
2574 Ga0373923_0514975
2575 Ga0373936_0024078
2576 Ga0373936_0136970
2577 Ga0373939_0291632
2578 Ga0373945_0004024
2579 Ga0373945_0004453
2580 Ga0373953_0151967
2581 Ga0373953_0231221
2582 Ga0373954_0174367
2583 Ga0373956_0136897
2584 Ga0373943_0000450
2585 Ga0373943_0005939
2586 Ga0373943_0644678
2587 Ga0373946_0000587
2588 Ga0373946_0006898
2589 Ga0373946_0245559
2590 Ga0373955_0094356
2591 Ga0373955_0126715
2592 Ga0373955_0217730
2593 Ga0373961_0228349
2594 Ga0373962_0203006
2595 Ga0373924_0035981
2596 Ga0373924_0056500
2597 Ga0373935_0024719
2598 Ga0373935_0032176
2599 Ga0373927_0077150
2600 Ga0373933_0173003
2601 Ga0373933_1036992
2602 Ga0373947_0004602
2603 Ga0373947_0022617
2604 Ga0373947_0071449
2605 Ga0373947_0238840
2606 Ga0373947_0417591
2607 Ga0373937_0096706
2608 Ga0373937_0117201
2609 Ga0373937_0932355
2610 Ga0373925_0013017
2611 Ga0373925_0033856
2612 Ga0373925_0149720
2613 Ga0373925_0512518
2614 Ga0395899_0021519
2615 Ga0395899_0042660
2616 Ga0395899_0047824
2617 Ga0395899_0059975
2618 Ga0395899_0087738
2619 Ga0395899_0101176
2620 Ga0395899_0114306
2621 Ga0395899_0156924
2622 Ga0395899_0196889
2623 Ga0395899_0355591
2624 Ga0395899_0379853
2625 Ga0395899_0477512
2626 Ga0395900_0008773
2627 Ga0395900_0009413
2628 Ga0395900_0023438
2629 Ga0395900_0048696
2630 Ga0395900_0084833
2631 Ga0395900_0089342
2632 Ga0395900_0093981
2633 Ga0395900_0103938
2634 Ga0395900_0108248
2635 Ga0395900_0157499
2636 Ga0395900_0236980
2637 Ga0395900_0288560
2638 Ga0395900_0303099
2639 Ga0395900_0349674
2640 Ga0395900_0368692
2641 Ga0395900_0422513
2642 Ga0395900_0432312
2643 Ga0395900_0505334
2644 Ga0395900_0506483
2645 Ga0395900_0720716
2646 Ga0395900_0869537
2647 Ga0395900_1226098
2648 Ga0395900_1330841
2649 Ga0395900_1476077
2650 Ga0395898_0002496
2651 Ga0395898_0005097
2652 Ga0395898_0005344
2653 Ga0395898_0005483
2654 Ga0395898_0015237
2655 Ga0395898_0019651
2656 Ga0395898_0042660
2657 Ga0395898_0046795
2658 Ga0395898_0050311
2659 Ga0395898_0080644
2660 Ga0395898_0174711
2661 Ga0395898_0285729
2662 Ga0395898_0298472
2663 Ga0395898_0372696
2664 Ga0395898_0391115
2665 Ga0395898_0410459
2666 Ga0395898_0451065
2667 Ga0395898_0572026
2668 Ga0395898_0717671
2669 Ga0395898_0971853
2670 Ga0395898_1006863
2671 Ga0395898_1549826
2672 Ga0395898_1733822
2673 Ga0395905_0002871
2674 Ga0395905_0009104
2675 Ga0395905_0029771
2676 Ga0395905_0030658
2677 Ga0395905_0059967
2678 Ga0395905_0060087
2679 Ga0395905_0069148
2680 Ga0395905_0088690
2681 Ga0395905_0135976
2682 Ga0395905_0327047
2683 Ga0395905_0444910
2684 Ga0395905_0445892
2685 Ga0395905_0649887
2686 Ga0395905_0678613
2687 Ga0436364_1080961
2688 Ga0395901_0003588
2689 Ga0395901_0008494
2690 Ga0395901_0013435
2691 Ga0395901_0019244
2692 Ga0395901_0020919
2693 Ga0395901_0032977
2694 Ga0395901_0034252
2695 Ga0395901_0035468
2696 Ga0395901_0046421
2697 Ga0395901_0055307
2698 Ga0395901_0059091
2699 Ga0395901_0059732
2700 Ga0395901_0099670
2701 Ga0395901_0336355
2702 Ga0395901_0363660
2703 Ga0395901_0422260
2704 Ga0395901_0449930
2705 Ga0395901_0541671
2706 Ga0395901_0840241
2707 Ga0395901_0895174
2708 Ga0395901_1331290
2709 Ga0395901_1392265
2710 Ga0436365_0085711
2711 Ga0436365_0701464
2712 Ga0436365_0845903
2713 Ga0436360_1155632
2714 Ga0436363_0640175
2715 Ga0436363_1570462
2716 Ga0436363_1687957
2717 Ga0436363_1701756
2718 Ga0436362_0192683
2719 Ga0436362_1065493
2720 Ga0439461_0045621
2721 Ga0439466_0122052
2722 Ga0439465_0131463
2723 Ga0451804_0563923
2724 Ga0451807_0290562
2725 Ga0451849_1174289
2726 Ga0451851_0413360
2727 Ga0451853_1423786
2728 Ga0451853_2826077
2729 Ga0451853_3658391
2730 Ga0451853_3882521
2731 Ga0439448_0036171
2732 Ga0439432_059947
2733 Ga0439462_0097652
2734 Ga0450915_002033
2735 Ga0450917_005551
2736 Ga0450920_014823
2737 Ga0450898_070467
2738 Ga0450910_023755
2739 Ga0439446_0000515
2740 Ga0439446_0060293
2741 Ga0439434_0086783
2742 Ga0451577_1877690
2743 Ga0466969_0028519
2744 Ga0466969_0095008
2745 Ga0466969_0218360
2746 Ga0466972_0522138
2747 Ga0466965_0076490
2748 Ga0466965_0124314
2749 Ga0466965_0154697
2750 Ga0466965_0803528
2751 Ga0466966_0000678
2752 Ga0466966_0003325
2753 Ga0466966_0043646
2754 Ga0466966_0137242
2755 Ga0466966_0173487
2756 Ga0466961_0002905
2757 Ga0466961_0007370
2758 Ga0466961_0029335
2759 Ga0466961_0065280
2760 Ga0466961_0070588
2761 Ga0466961_0075688
2762 Ga0466961_0096457
2763 Ga0466961_0159312
2764 Ga0466961_0538224
2765 Ga0466963_0000661
2766 Ga0466963_0000792
2767 Ga0466963_0002009
2768 Ga0466963_0002017
2769 Ga0466963_0002252
2770 Ga0466963_0002500
2771 Ga0466963_0002999
2772 Ga0466963_0003520
2773 Ga0466963_0004663
2774 Ga0466963_0005080
2775 Ga0466963_0006726
2776 Ga0466963_0006855
2777 Ga0466963_0009150
2778 Ga0466963_0057815
2779 Ga0466963_0073487
2780 Ga0466963_0087868
2781 Ga0466963_0090601
2782 Ga0466963_0132045
2783 Ga0466963_0275348
2784 Ga0466963_0427892
2785 Ga0466963_0478332
2786 Ga0466963_1049805
2787 Ga0466963_1092534
2788 Ga0466964_0000335
2789 Ga0466964_0001343
2790 Ga0466964_0003667
2791 Ga0466964_0004919
2792 Ga0466964_0013694
2793 Ga0466964_0022018
2794 Ga0466964_0031620
2795 Ga0466964_0038061
2796 Ga0466964_0042842
2797 Ga0466964_0055679
2798 Ga0466964_0063175
2799 Ga0466964_0074447
2800 Ga0466964_0187771
2801 Ga0466964_0265164
2802 Ga0466964_0593091
2803 Ga0466964_0730704
2804 Ga0466971_0003596
2805 Ga0466971_0007633
2806 Ga0466971_0021486
2807 Ga0466971_0036982
2808 Ga0466971_0189687
2809 Ga0466971_0209896
2810 Ga0466971_0489188
2811 Ga0466968_0002629
2812 Ga0466968_0004943
2813 Ga0466968_0078435
2814 Ga0466968_0123473
2815 Ga0466968_0146678
2816 Ga0466968_0217756
2817 Ga0466968_0272199
2818 Ga0466970_0013425
2819 Ga0466970_0035573
2820 Ga0466970_0158393
2821 Ga0466957_0000566
2822 Ga0466957_0000954
2823 Ga0466957_0005157
2824 Ga0466957_0005764
2825 Ga0466957_0013432
2826 Ga0466957_0024884
2827 Ga0466957_0039745
2828 Ga0466957_0055884
2829 Ga0466957_0060259
2830 Ga0466957_0066843
2831 Ga0466957_0134766
2832 Ga0466957_0226235
2833 Ga0466957_0451153
2834 Ga0466957_0943999
2835 Ga0466957_1089174
2836 Ga0466957_1191833
2837 Ga0466960_0013853
2838 Ga0466960_0209325
2839 Ga0466960_0266460
2840 Ga0466960_0324863
2841 Ga0466960_0400002
2842 Ga0466959_0001247
2843 Ga0466959_0006694
2844 Ga0466959_0033953
2845 Ga0466959_0085996
2846 Ga0466959_0086370
2847 Ga0466959_0116728
2848 Ga0466959_0121324
2849 Ga0466959_0200703
2850 Ga0466959_0212575
2851 Ga0466959_0345420
2852 Ga0451576_0943868
2853 Ga0451576_1344229
2854 Ga0451576_1427611
2855 Ga0466958_0000591
2856 Ga0466958_0000942
2857 Ga0466958_0004180
2858 Ga0466958_0006462
2859 Ga0466958_0012679
2860 Ga0466958_0030337
2861 Ga0466958_0057096
2862 Ga0466958_0058161
2863 Ga0466958_0066029
2864 Ga0466958_0069368
2865 Ga0466958_0154606
2866 Ga0466958_0201625
2867 Ga0466958_0217755
2868 Ga0466958_0257390
2869 Ga0466958_0276314
2870 Ga0466958_0289655
2871 Ga0466958_0507704
2872 Ga0466958_0622245
2873 Ga0466958_0808304
2874 Ga0466958_0897376
2875 Ga0466967_0000351
2876 Ga0466967_0002747
2877 Ga0466967_0003833
2878 Ga0466967_0005871
2879 Ga0466967_0007851
2880 Ga0466967_0008069
2881 Ga0466967_0011565
2882 Ga0466967_0013044
2883 Ga0466967_0014209
2884 Ga0466967_0015741
2885 Ga0466967_0023531
2886 Ga0466967_0033429
2887 Ga0466967_0037082
2888 Ga0466967_0041421
2889 Ga0466967_0055721
2890 Ga0466967_0076077
2891 Ga0466967_0076252
2892 Ga0466967_0076552
2893 Ga0466967_0085897
2894 Ga0466967_0093121
2895 Ga0466967_0101199
2896 Ga0466967_0105095
2897 Ga0466967_0116549
2898 Ga0466967_0131492
2899 Ga0466967_0141454
2900 Ga0466967_0143220
2901 Ga0466967_0157845
2902 Ga0466967_0162460
2903 Ga0466967_0206537
2904 Ga0466967_0253836
2905 Ga0466967_0254138
2906 Ga0466967_0261440
2907 Ga0466967_0264620
2908 Ga0466967_0346877
2909 Ga0466967_0605618
2910 Ga0466967_0619634
2911 Ga0466967_0889469
2912 Ga0466967_1132674
2913 Ga0466967_1832651
2914 Ga0466967_1986128
2915 Ga0466967_2160205
2916 Ga0495592_0064166
2917 Ga0495592_0071193
2918 Ga0495592_0160618
2919 Ga0495592_0186727
2920 Ga0495603_0054756
2921 Ga0495603_0126672
2922 Ga0495603_0136523
2923 Ga0495591_102666
2924 Ga0495629_0015080
2925 Ga0495629_0060748
2926 Ga0495629_0209233
2927 Ga0495629_0759348
2928 Ga0495641_0001273
2929 Ga0495641_0017827
2930 Ga0495641_0024718
2931 Ga0495641_0024821
2932 Ga0495641_0088399
2933 Ga0495641_0095543
2934 Ga0495641_0125139
2935 Ga0495641_0257087
2936 Ga0495641_0330853
2937 Ga0495651_0014259
2938 Ga0495651_0018806
2939 Ga0495651_0142996
2940 Ga0495651_0208638
2941 Ga0495651_0289734
2942 Ga0495651_0620313
2943 Ga0495653_0033898
2944 Ga0495653_0074161
2945 Ga0495653_0079235
2946 Ga0495653_0189902
2947 Ga0495653_0221004
2948 Ga0495653_0243004
2949 Ga0495653_0841278
2950 Ga0495580_0287600
2951 Ga0495582_0000066
2952 Ga0495582_0030557
2953 Ga0495582_0069815
2954 Ga0495582_0085011
2955 Ga0495582_0110881
2956 Ga0495582_0139706
2957 Ga0495582_0329052
2958 Ga0495582_0908106
2959 Ga0495605_0084608
2960 Ga0495639_0001852
2961 Ga0495639_0286102
2962 Ga0495639_0303501
2963 Ga0495639_0305899
2964 Ga0495662_0012277
2965 Ga0495662_0054097
2966 Ga0495662_0337123
2967 Ga0495664_0081951
2968 Ga0495664_0119293
2969 Ga0495664_0173805
2970 Ga0495664_0209427
2971 Ga0495664_0723630
2972 Ga0495584_0023265
2973 Ga0495584_0277062
2974 Ga0495584_0322986
2975 Ga0495585_0111918
2976 Ga0495585_0190734
2977 Ga0495594_0023442
2978 Ga0495594_0024618
2979 Ga0495594_0565863
2980 Ga0495596_0387852
2981 Ga0495607_0120295
2982 Ga0495608_0004630
2983 Ga0495608_0024814
2984 Ga0495608_0029249
2985 Ga0495608_0030695
2986 Ga0495608_0073652
2987 Ga0495608_0136560
2988 Ga0495616_0411639
2989 Ga0495618_0016102
2990 Ga0495618_0030541
2991 Ga0495618_0123974
2992 Ga0495618_0678414
2993 Ga0495618_0785582
2994 Ga0495620_0101546
2995 Ga0495628_0023992
2996 Ga0495628_0093798
2997 Ga0495628_0100432
2998 Ga0495628_0129587
2999 Ga0495628_0188031
3000 Ga0495630_0004203
3001 Ga0495630_0017638
3002 Ga0495630_0019933
3003 Ga0495630_0039229
3004 Ga0495630_0153665
3005 Ga0495630_0295613
3006 Ga0495630_0317760
3007 Ga0495630_0416195
3008 Ga0495630_1131683
3009 Ga0495631_0423484
3010 Ga0495632_0215938
3011 Ga0495644_0005854
3012 Ga0495644_0081365
3013 Ga0495644_0161187
3014 Ga0495663_0018218
3015 Ga0495663_0233255
3016 Ga0495663_0274678
3017 Ga0495666_0015553
3018 Ga0495642_0025963
3019 Ga0495642_0210232
3020 Ga0495652_0030319
3021 Ga0495652_0037661
3022 Ga0495652_0068143
3023 Ga0495652_0099102
3024 Ga0495652_0105101
3025 Ga0495652_0246943
3026 Ga0495665_0000252
3027 Ga0495665_0079447
3028 Ga0495640_0004199
3029 Ga0495640_0035408
3030 Ga0495640_0037865
3031 Ga0495640_0041162
3032 Ga0495640_0096912
3033 Ga0495640_0141064
3034 Ga0495640_0425162
3035 Ga0495640_0442347
3036 Ga0495586_0067463
3037 Ga0495586_0098240
3038 Ga0495587_0064972
3039 Ga0495609_0062392
3040 Ga0495645_0023030
3041 Ga0495645_0072249
3042 Ga0495645_0143988
3043 Ga0495645_0235316
3044 Ga0495645_0954216
3045 Ga0495667_0038165
3046 Ga0495667_0060705
3047 Ga0495667_0064192
3048 Ga0495667_0073244
3049 Ga0495667_0093489
3050 Ga0495667_0101119
3051 Ga0495667_0116916
3052 Ga0495667_0228351
3053 Ga0495656_0002578
3054 Ga0495656_0046483
3055 Ga0495656_0056216
3056 Ga0495656_0057693
3057 Ga0495656_0076188
3058 Ga0495656_0630054
3059 Ga0495668_0061246
3060 Ga0495634_0117304
3061 Ga0495634_0124792
3062 Ga0495611_0156954
3063 Ga0495635_0010487
3064 Ga0495635_0073551
3065 Ga0495635_0125878
3066 Ga0495635_0147042
3067 Ga0495635_0509116
3068 Ga0495659_0042593
3069 Ga0495661_0309628
3070 Ga0495588_0307545
3071 Ga0495588_0561431
3072 Ga0495657_0012211
3073 Ga0495657_0027103
3074 Ga0495657_0041419
3075 Ga0495657_0095513
3076 Ga0495657_0167394
3077 Ga0495657_0183623
3078 Ga0495657_0323357
3079 Ga0495599_0014073
3080 Ga0495599_0014224
3081 Ga0495599_0089905
3082 Ga0495623_0043281
3083 Ga0495623_0054740
3084 Ga0495623_0269927
3085 Ga0495646_0007463
3086 Ga0495646_0092320
3087 Ga0495647_0008142
3088 Ga0495647_0021676
3089 Ga0495647_0058933
3090 Ga0495647_0187063
3091 Ga0495658_0001642
3092 Ga0495658_0022084
3093 Ga0495658_0034755
3094 Ga0495658_0053250
3095 Ga0495658_0173305
3096 Ga0495658_0415517
3097 Ga0495613_0006002
3098 Ga0495613_0013886
3099 Ga0495613_0070553
3100 Ga0495613_0075604
3101 Ga0495613_0150056
3102 Ga0495613_0185108
3103 Ga0495613_0215310
3104 Ga0495613_0569643
3105 Ga0495624_0009967
3106 Ga0495624_0112022
3107 Ga0495624_0283149
3108 Ga0495624_0333682
3109 Ga0495624_0344877
3110 Ga0495624_0426251
3111 Ga0495624_0568532
3112 Ga0495670_0216565
3113 Ga0495589_0064595
3114 Ga0495589_0086462
3115 Ga0495589_0111071
3116 Ga0495589_0332038
3117 Ga0495600_0008159
3118 Ga0495600_0053184
3119 Ga0495600_0088725
3120 Ga0495600_0351667
3121 Ga0495581_0005422
3122 Ga0495581_0006426
3123 Ga0495581_0011634
3124 Ga0495581_0203138
3125 Ga0495604_0010501
3126 Ga0495604_0022565
3127 Ga0495604_0188050
3128 Ga0495604_0190498
3129 Ga0495604_0540819
3130 Ga0495604_0952056
3131 Ga0495636_0128771
3132 Ga0495674_0005260
3133 Ga0495674_0023461
3134 Ga0495674_0074298
3135 Ga0495674_0093031
3136 Ga0495674_0326296
3137 Ga0495676_0046046
3138 Ga0495676_0056767
3139 Ga0495676_0069211
3140 Ga0495676_0098020
3141 Ga0495676_0114975
3142 Ga0495676_0156430
3143 Ga0495676_0176907
3144 Ga0495676_0309972
3145 Ga0495676_0409202
3146 Ga0495676_0687772
3147 Ga0495680_0004019
3148 Ga0495680_0007901
3149 Ga0495680_0012789
3150 Ga0495680_0031439
3151 Ga0495680_0033161
3152 Ga0495680_0048842
3153 Ga0495680_0121450
3154 Ga0495680_0158648
3155 Ga0495680_0256859
3156 Ga0495680_0281896
3157 Ga0495680_0377959
3158 Ga0495683_0246497
3159 Ga0495675_0039853
3160 Ga0495675_0073251
3161 Ga0495675_0115991
3162 Ga0495675_0217570
3163 Ga0495677_0046219
3164 Ga0495677_0068395
3165 Ga0495684_0031706
3166 Ga0495684_0037507
3167 Ga0495684_0063791
3168 Ga0495684_0081595
3169 Ga0495684_0133068
3170 Ga0495684_0207240
3171 Ga0495684_0328639
3172 Ga0495593_0009955
3173 Ga0495593_0103529
3174 Ga0495602_0033000
3175 Ga0495602_0070950
3176 Ga0495602_0096811
3177 Ga0495602_0097344
3178 Ga0495602_0192351
3179 Ga0495602_0199514
3180 Ga0495602_0320044
3181 Ga0495602_0481544
3182 Ga0495602_0506773
3183 Ga0495602_1152168
3184 Ga0495614_0010456
3185 Ga0495614_0107048
3186 Ga0495614_0490286
3187 Ga0495615_0056568
3188 Ga0496100_0028558
3189 Ga0496100_0096316
3190 Ga0496100_0240103
3191 Ga0496100_0316574
3192 Ga0496100_0627835
3193 Ga0496100_0683779
3194 Ga0496100_1021869
3195 Ga0496101_0000543
3196 Ga0496101_0004442
3197 Ga0496101_0020483
3198 Ga0496101_0039949
3199 Ga0496101_0079530
3200 Ga0496101_0115586
3201 Ga0496101_0149503
3202 Ga0496101_0205686
3203 Ga0496101_0232727
3204 Ga0496101_0310674
3205 Ga0496101_0377370
3206 Ga0496101_0414337
3207 Ga0496101_0556653
3208 Ga0496101_0676721
3209 Ga0496101_0706806
3210 Ga0496101_0955941
3211 Ga0496102_0016856
3212 Ga0496102_0019934
3213 Ga0496102_0020365
3214 Ga0496102_0080933
3215 Ga0496102_0241648
3216 Ga0496102_0317047
3217 Ga0496102_0564012
3218 Ga0496102_0700859
3219 Ga0496103_0004711
3220 Ga0496103_0097106
3221 Ga0496103_0162048
3222 Ga0496103_0257291
3223 Ga0496103_0526547
3224 Ga0496103_0596968
3225 Ga0496104_0011798
3226 Ga0496104_0061869
3227 Ga0496104_0095674
3228 Ga0496104_0104033
3229 Ga0496104_0111172
3230 Ga0496104_0221746
3231 Ga0496104_0305767
3232 Ga0496104_0462893
3233 Ga0496104_0744328
3234 Ga0496105_0005357
3235 Ga0496105_0009962
3236 Ga0496105_0032243
3237 Ga0496105_0041324
3238 Ga0496105_0130588
3239 Ga0496105_0264614
3240 Ga0496105_0305435
3241 Ga0496105_0632888
3242 Ga0496106_0013199
3243 Ga0496106_0022795
3244 Ga0496106_0090402
3245 Ga0496106_0096091
3246 Ga0496106_0318223
3247 Ga0496106_0487485
3248 Ga0496107_0002760
3249 Ga0496107_0003413
3250 Ga0496107_0006653
3251 Ga0496107_0021951
3252 Ga0496107_0202341
3253 Ga0496107_0245014
3254 Ga0496107_0501895
3255 Ga0496108_0004928
3256 Ga0496108_0015890
3257 Ga0496108_0026132
3258 Ga0496108_0133142
3259 Ga0496108_0133478
3260 Ga0496108_0143137
3261 Ga0496108_0915414
3262 Ga0496108_0988769
3263 Ga0496108_1470983
3264 Ga0496109_0001903
3265 Ga0496109_0005677
3266 Ga0496109_0016587
3267 Ga0496109_0017746
3268 Ga0496109_0019250
3269 Ga0496109_0021098
3270 Ga0496109_0052346
3271 Ga0496109_0170719
3272 Ga0496109_0282753
3273 Ga0496109_0434746
3274 Ga0496109_0814742
3275 Ga0496110_0013638
3276 Ga0496110_0016283
3277 Ga0496110_0163841
3278 Ga0496110_0264251
3279 Ga0496110_0341057
3280 Ga0496110_1133343
3281 Ga0496111_0034480
3282 Ga0496111_0095359
3283 Ga0496111_0166138
3284 Ga0496111_0234273
3285 Ga0496111_0365669
3286 Ga0496111_0457767
3287 Ga0496111_0546543
3288 Ga0496111_0706616
3289 Ga0496111_0766551
3290 Ga0496112_0011988
3291 Ga0496112_0019697
3292 Ga0496112_0052475
3293 Ga0496112_0052956
3294 Ga0496112_0074134
3295 Ga0496112_0077202
3296 Ga0496112_0232347
3297 Ga0496112_0422558
3298 Ga0496112_0598062
3299 Ga0496112_0828815
3300 Ga0496112_1115158
3301 Ga0496112_1223483
3302 Ga0496112_1426237
3303 Ga0496112_1432186
3304 Ga0496112_1483996
3305 Ga0496113_0045822
3306 Ga0496113_0052705
3307 Ga0496113_0059767
3308 Ga0496113_0098779
3309 Ga0496113_0147290
3310 Ga0496113_0160344
3311 Ga0496113_0169672
3312 Ga0496113_0624364
3313 Ga0496113_0746651
3314 Ga0496113_1486267
3315 Ga0496114_0000834
3316 Ga0496114_0004372
3317 Ga0496114_0007807
3318 Ga0496114_0013651
3319 Ga0496114_0014325
3320 Ga0496114_0066430
3321 Ga0496114_0136620
3322 Ga0496114_0138969
3323 Ga0496114_0180801
3324 Ga0496114_0200608
3325 Ga0496114_0266443
3326 Ga0496114_0467514
3327 Ga0496114_0743938
3328 Ga0496115_0005284
3329 Ga0496115_0008529
3330 Ga0496115_0014758
3331 Ga0496115_0035679
3332 Ga0496115_0047746
3333 Ga0496115_0060555
3334 Ga0496115_0262416
3335 Ga0496115_0765807
3336 Ga0496117_0001293
3337 Ga0496118_0003780
3338 Ga0501031_0034996
3339 Ga0501031_0318517
3340 Ga0501032_0033341
3341 Ga0501032_0103230
3342 Ga0501032_0956928
3343 Ga0501033_0025461
3344 Ga0501033_0188642
3345 Ga0501034_0003733
3346 Ga0501036_0004381
3347 Ga0501036_0011277
3348 Ga0501036_0932620
3349 Ga0501037_0027875
3350 Ga0501037_0058673
3351 Ga0501038_0110790
3352 Ga0501039_0001728
3353 Ga0501039_0014517
3354 Ga0501039_0085454
3355 Ga0501040_0007072
3356 Ga0501040_0027145
3357 Ga0501041_0001743
3358 Ga0501041_0009330
3359 Ga0501041_0409712
3360 Ga0501042_0007798
3361 Ga0501042_0012528
3362 Ga0501042_0210425
3363 Ga0501043_0037215
3364 Ga0501043_0075925
3365 Ga0501043_0221474
3366 Ga0501046_0003055
3367 Ga0501046_0030403
3368 Ga0501046_0369712
3369 Ga0501046_0658096
3370 Ga0501047_0338500
3371 Ga0501047_0384789
3372 Ga0501047_0439677
3373 Ga0501048_0003260
3374 Ga0501048_0011917
3375 Ga0501067_0149925
3376 Ga0501067_0225539
3377 Ga0501068_0057949
3378 Ga0501068_0456394
3379 Ga0501068_0919701
3380 Ga0501068_1215203
3381 Ga0501069_0081347
3382 Ga0501069_0105249
3383 Ga0501069_0120595
3384 Ga0501069_0134660
3385 Ga0501069_0158177
3386 Ga0501070_0002828
3387 Ga0501070_0005455
3388 Ga0501070_0029111
3389 Ga0501070_0126275
3390 Ga0501070_0200069
3391 Ga0501070_0305449
3392 Ga0501070_0434904
3393 Ga0501070_0480370
3394 Ga0501071_0000277
3395 Ga0501071_0008207
3396 Ga0501071_0414863
3397 Ga0501071_0789870
3398 Ga0501072_0004354
3399 Ga0501072_0047916
3400 Ga0501073_0018647
3401 Ga0501073_0095788
3402 Ga0501073_0498176
3403 Ga0501074_0020011
3404 Ga0501074_0029384
3405 Ga0501074_0058358
3406 Ga0501074_0121443
3407 Ga0501074_0138849
3408 Ga0501074_0185230
3409 Ga0501074_0814681
3410 Ga0501074_0920129
3411 Ga0501075_0001091
3412 Ga0501075_0024275
3413 Ga0501075_1366925
3414 Ga0501076_0000783
3415 Ga0501076_0003280
3416 Ga0501076_0298773
3417 Ga0501077_0012704
3418 Ga0501077_0014064
3419 Ga0501260_055002
3420 Ga0501079_0001798
3421 Ga0501079_0042906
3422 Ga0501079_0118471
3423 Ga0501079_0237828
3424 Ga0501079_0626703
3425 Ga0501080_0013910
3426 Ga0501080_0014815
3427 Ga0501080_0044173
3428 Ga0501080_0105808
3429 Ga0501080_0142451
3430 Ga0501080_0417116
3431 Ga0501080_0758669
3432 Ga0501080_1744598
3433 Ga0501081_0006597
3434 Ga0501081_0012176
3435 Ga0501083_0009961
3436 Ga0501083_0050531
3437 Ga0501083_0635229
3438 Ga0501035_0019610
3439 Ga0501035_0074026
3440 Ga0501035_0242691
3441 Ga0501035_0282411
3442 Ga0501044_0082727
3443 Ga0501044_0438339
3444 Ga0501044_0919072
3445 Ga0501045_0004806
3446 Ga0501045_0007353
3447 nmdc:mga03683_207527_c1
3448 nmdc:mga03683_7319_c1
3449 nmdc:mga00v17_14314_c1
3450 nmdc:mga00v17_256446_c1
3451 nmdc:mga0yw44_136119_c1
3452 nmdc:mga0yw44_26552_c1
3453 nmdc:mga0yw44_289946_c1
3454 nmdc:mga0k408_192614_c1
3455 nmdc:mga05p37_22675_c1
3456 nmdc:mga05p37_370366_c2
3457 nmdc:mga09592_5528_c1
3458 nmdc:mga0qj67_7976_c1
3459 nmdc:mga06r32_11474_c1
3460 nmdc:mga06r32_871532_c1
3461 nmdc:mga08y16_13386_c1
3462 nmdc:mga08y16_168120_c1
3463 nmdc:mga08y16_442593_c1
3464 nmdc:mga0n895_170673_c1
3465 nmdc:mga0n895_63942_c1
3466 nmdc:mga0rr50_255123_c1
3467 nmdc:mga0rr50_73328_c1
3468 nmdc:mga0rr50_816097_c1
3469 nmdc:mga08x19_752179_c1
3470 nmdc:mga0a205_124281_c1
3471 nmdc:mga0a205_267637_c1
3472 Ga0495601_0014551
3473 Ga0495601_0015827
3474 Ga0495601_0068997
3475 Ga0495601_0092630
3476 Ga0495601_0199809
3477 Ga0495601_0217627
3478 Ga0495601_0288321
3479 Ga0495601_0304523
3480 Ga0495601_0373152
3481 Ga0495601_0396892
3482 Ga0495601_0617923
3483 Ga0495612_0092361
3484 Ga0495655_0001362
3485 Ga0495595_0001437
3486 Ga0495595_0099352
3487 Ga0495595_0099621
3488 Ga0495595_0100965
3489 Ga0495619_0006989
3490 Ga0495619_0009752
3491 Ga0495619_0015204
3492 Ga0495619_0068533
3493 Ga0495619_0092706
3494 Ga0495619_0100424
3495 Ga0495619_0107768
3496 Ga0495619_0131328
3497 Ga0495619_0137619
3498 Ga0495619_0245552
3499 Ga0495619_0816926
3500 Ga0501084_0002882
3501 Ga0501084_0007645
3502 Ga0501084_0163645
3503 Ga0501084_0408257
3504 Ga0590075_114676
3505 Ga0590077_031419
3506 Ga0587077_096519
3507 Ga0587115_117978
3508 Ga0501082_0012944
3509 Ga0501082_0015327
3510 Ga0501082_0471954
3511 Ga0466962_0000131
3512 Ga0466962_0020213
3513 Ga0466962_0079384
3514 Ga0466962_0081277
3515 Ga0466962_0096637
3516 Ga0466962_0100456
3517 Ga0466962_0172679
3518 Ga0466962_0448842
3519 Ga0530510_0007435
3520 Ga0530510_0014267
3521 Ga0530510_0119285
3522 Ga0530510_0196228

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01050

MannoseP_isomer

Mannose-6-phosphate isomerase C-terminal

36

150

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
7chj-assembly1.cif.gz_A crystal structure of pco4 0.9163 28 116
6sbp-assembly1.cif.gz_A plant cysteine oxidase pco5 from arabidopsis thaliana 0.9085 28 116
7chi-assembly1.cif.gz_A crystal structure of pco5 0.9046 28 116
6s7e-assembly1.cif.gz_A plant cysteine oxidase pco4 from arabidopsis thaliana (using peg 3350 and naf as precipitants) 0.904 28 116
6s0p-assembly1.cif.gz_A plant cysteine oxidase pco4 from arabidopsis thaliana 0.9001 28 123
ID Description Score Start End Superfamily
3rnsA01 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8946 34 116 2.60.120.10
af_P02858_394_558_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8891 36 115 2.60.120.10
af_A0A0R0GMV1_360_489_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8835 36 115 2.60.120.10
af_P17410_9_96_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.879 37 114 2.60.120.10
5fpxA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8713 19 116 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A7V8XFD1-F1-model_v4 Cupin 0.9855 5 136 GO:0005976
GO:0016779
AF-A0A318S3Q0-F1-model_v4 Mannose-6-phosphate isomerase-like protein (Cupin superfamily) 0.9838 14 132 GO:0016853
AF-A0A7W1R1K1-F1-model_v4 Cupin 0.9834 38 136 GO:0005976
GO:0016779
AF-A0A2M8F5G2-F1-model_v4 Cupin 0.9797 14 129 GO:0005976
GO:0016779
AF-A0A1Q7RFH7-F1-model_v4 Cupin 0.9767 16 130 GO:0005976
GO:0016779

Map