F495607
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1760 | 429 | 3520 | 195 |
Family's Representative Sequence
| Representative Sequence | 3300005518|Ga0070699_100333986|Ga0070699_1003339861 |
| Length | 188 |
| Sequence | VRLFGRGERASTLDLLVVGLGNPGREHARDRHNAGWMVVDELARRHDGSFRSKFSGQLGEIRKPETYMNLSGDSLGAAARYYKAPLDSIAVVHDDVDLESGRLQVRLGGGLGGHNGLKSVKQGLGSADFLRTRVGVGRPGRGDPRPVADYVLSPFAPEDDADALVARAADAVETLARDGLEEAQRRFN |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 2 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 3 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 4 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 5 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 6 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 9 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 11 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 13 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 15 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 18 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 27 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 44 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 45 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 50 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 52 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 53 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 60 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 62 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 63 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 64 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 66 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 67 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 68 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 69 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 70 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 71 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 72 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 73 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 74 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 75 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 76 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 77 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 78 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 79 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 80 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 82 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 83 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 84 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 85 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 86 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 87 | 3300006194 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Metagenome | Rhizosphere |
| 88 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 90 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 91 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 92 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 93 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 94 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 95 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 96 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 97 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 98 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 100 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300012485 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.7.old.040610 | Metagenome | Rhizosphere |
| 115 | 3300012506 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 | Metagenome | Rhizosphere |
| 116 | 3300012512 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 | Metagenome | Rhizosphere |
| 117 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 129 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 133 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 135 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 136 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 137 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 138 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 139 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 204 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 208 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 209 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 210 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 211 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 212 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 213 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 214 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 215 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 216 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 217 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 218 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 219 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 220 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 221 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 222 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 223 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 224 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 225 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 226 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 227 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 228 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 229 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 230 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 231 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 232 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 233 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 234 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 235 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 236 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 237 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 238 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 239 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 240 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 241 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 242 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 243 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 244 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 245 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 246 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 247 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 248 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 249 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 250 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 251 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 252 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 253 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 254 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 255 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 256 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 257 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 258 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 259 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 260 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 261 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 262 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 263 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 264 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 265 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 266 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 267 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 268 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 269 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 270 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 271 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 272 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 273 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 274 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 275 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 276 | 3300042000 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 | Metagenome | Rhizosphere |
| 277 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 278 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 279 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 280 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 281 | 3300042129 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 | Metagenome | Rhizosphere |
| 282 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 283 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 284 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 285 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 286 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 287 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 288 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 289 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 290 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 291 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 292 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 293 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 294 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 295 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 296 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 297 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 298 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 299 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 300 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 301 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 361 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 362 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 363 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 364 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 365 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 366 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 367 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 368 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 369 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 370 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 371 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 372 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 373 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 374 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 375 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 376 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 377 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 378 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 379 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 380 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 381 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 382 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 383 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 384 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 385 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 386 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 387 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 388 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 389 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 390 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 391 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 392 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 393 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 394 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 395 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 396 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 397 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 398 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 399 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 400 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 401 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 402 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 403 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 404 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 405 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 406 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 407 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 408 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 409 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 410 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 411 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 412 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 413 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 414 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 415 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 416 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 417 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 418 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 419 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 420 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 421 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 422 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 423 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 424 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 425 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 426 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 427 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 428 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 429 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.49 |
| Metatranscriptomes | 0.51 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.34 |
| Nodule | 0 |
| Rhizoplane | 10.97 |
| Rhizosphere | 88.3 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 11.02 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070699_100333986 | 3300005518 | Bacteria | 1364 |
| 2 | JGI24743J22301_10010006 | 3300001991 | Bacteria | 1687 |
| 3 | JGI24743J22301_10035172 | 3300001991 | Bacteria | 995 |
| 4 | JGI24744J21845_10012680 | 3300002077 | Bacteria | 1705 |
| 5 | JGI25407J50210_10002348 | 3300003373 | Bacteria | 4444 |
| 6 | JGI25405J52794_10064353 | 3300003911 | Bacteria | 796 |
| 7 | Ga0070658_10017501 | 3300005327 | Bacteria | 5734 |
| 8 | Ga0070658_10018199 | 3300005327 | Bacteria | 5621 |
| 9 | Ga0070658_10050931 | 3300005327 | Bacteria | 3356 |
| 10 | Ga0070683_100001042 | 3300005329 | Bacteria | 20821 |
| 11 | Ga0070683_100014649 | 3300005329 | Bacteria | 6867 |
| 12 | Ga0070683_100033826 | 3300005329 | Bacteria | 4664 |
| 13 | Ga0070683_100037911 | 3300005329 | Bacteria | 4415 |
| 14 | Ga0070683_100093799 | 3300005329 | Bacteria | 2821 |
| 15 | Ga0070683_100104209 | 3300005329 | Bacteria | 2673 |
| 16 | Ga0070683_100161594 | 3300005329 | Bacteria | 2125 |
| 17 | Ga0070690_100153711 | 3300005330 | Bacteria | 1572 |
| 18 | Ga0070690_100381704 | 3300005330 | Bacteria | 1030 |
| 19 | Ga0070670_100264074 | 3300005331 | Bacteria | 1501 |
| 20 | Ga0070670_100338617 | 3300005331 | Bacteria | 1320 |
| 21 | Ga0068869_100123368 | 3300005334 | Bacteria | 1984 |
| 22 | Ga0068869_100572134 | 3300005334 | Bacteria | 952 |
| 23 | Ga0068869_100878092 | 3300005334 | Bacteria | 775 |
| 24 | Ga0070666_10100625 | 3300005335 | Unclassified | 1991 |
| 25 | Ga0070666_10162732 | 3300005335 | Bacteria | 1560 |
| 26 | Ga0070680_100019104 | 3300005336 | Bacteria | 5427 |
| 27 | Ga0070680_100067139 | 3300005336 | Bacteria | 2941 |
| 28 | Ga0070680_100106006 | 3300005336 | Bacteria | 2337 |
| 29 | Ga0070680_100147762 | 3300005336 | Bacteria | 1972 |
| 30 | Ga0070680_100158984 | 3300005336 | Unclassified | 1898 |
| 31 | Ga0070680_100161655 | 3300005336 | Unclassified | 1882 |
| 32 | Ga0070680_100192305 | 3300005336 | Bacteria | 1720 |
| 33 | Ga0070680_100466734 | 3300005336 | Unclassified | 1079 |
| 34 | Ga0070680_100497817 | 3300005336 | Unclassified | 1042 |
| 35 | Ga0070682_100002667 | 3300005337 | Bacteria | 9861 |
| 36 | Ga0070682_100009303 | 3300005337 | Bacteria | 5563 |
| 37 | Ga0070682_100011800 | 3300005337 | Bacteria | 4999 |
| 38 | Ga0070682_100270818 | 3300005337 | Bacteria | 1233 |
| 39 | Ga0068868_100006377 | 3300005338 | Bacteria | 8344 |
| 40 | Ga0068868_100051038 | 3300005338 | Bacteria | 3251 |
| 41 | Ga0068868_100053202 | 3300005338 | Bacteria | 3189 |
| 42 | Ga0068868_100111975 | 3300005338 | Bacteria | 2218 |
| 43 | Ga0068868_100140903 | 3300005338 | Unclassified | 1979 |
| 44 | Ga0068868_100295869 | 3300005338 | Bacteria | 1374 |
| 45 | Ga0068868_100505427 | 3300005338 | Bacteria | 1059 |
| 46 | Ga0070660_100010212 | 3300005339 | Bacteria | 6626 |
| 47 | Ga0070660_100052258 | 3300005339 | Bacteria | 3150 |
| 48 | Ga0070660_100175135 | 3300005339 | Bacteria | 1734 |
| 49 | Ga0070660_100615059 | 3300005339 | Bacteria | 909 |
| 50 | Ga0070689_100032245 | 3300005340 | Bacteria | 3984 |
| 51 | Ga0070689_100044528 | 3300005340 | Bacteria | 3414 |
| 52 | Ga0070689_100171740 | 3300005340 | Bacteria | 1757 |
| 53 | Ga0070689_101202902 | 3300005340 | Unclassified | 680 |
| 54 | Ga0070691_10019136 | 3300005341 | Bacteria | 3158 |
| 55 | Ga0070691_10022791 | 3300005341 | Bacteria | 2906 |
| 56 | Ga0070691_10036706 | 3300005341 | Bacteria | 2311 |
| 57 | Ga0070691_10206440 | 3300005341 | Bacteria | 1035 |
| 58 | Ga0070661_100020300 | 3300005344 | Bacteria | 4737 |
| 59 | Ga0070661_100054537 | 3300005344 | Bacteria | 2928 |
| 60 | Ga0070692_10013257 | 3300005345 | Bacteria | 3839 |
| 61 | Ga0070692_10077272 | 3300005345 | Bacteria | 1786 |
| 62 | Ga0070692_10190290 | 3300005345 | Bacteria | 1195 |
| 63 | Ga0070692_10248021 | 3300005345 | Bacteria | 1064 |
| 64 | Ga0070668_100149804 | 3300005347 | Bacteria | 1886 |
| 65 | Ga0070669_100153201 | 3300005353 | Bacteria | 1785 |
| 66 | Ga0070675_100021523 | 3300005354 | Bacteria | 5153 |
| 67 | Ga0070675_100224790 | 3300005354 | Bacteria | 1636 |
| 68 | Ga0070675_100297512 | 3300005354 | Bacteria | 1421 |
| 69 | Ga0070675_100840950 | 3300005354 | Bacteria | 840 |
| 70 | Ga0070675_101077594 | 3300005354 | Unclassified | 738 |
| 71 | Ga0070671_100295550 | 3300005355 | Bacteria | 1379 |
| 72 | Ga0070674_100019642 | 3300005356 | Bacteria | 4296 |
| 73 | Ga0070674_100020566 | 3300005356 | Bacteria | 4220 |
| 74 | Ga0070674_100089528 | 3300005356 | Unclassified | 2217 |
| 75 | Ga0070674_100375245 | 3300005356 | Bacteria | 1155 |
| 76 | Ga0070674_100723947 | 3300005356 | Bacteria | 853 |
| 77 | Ga0070673_100012276 | 3300005364 | Bacteria | 5876 |
| 78 | Ga0070673_100496010 | 3300005364 | Bacteria | 1104 |
| 79 | Ga0070673_100767032 | 3300005364 | Bacteria | 889 |
| 80 | Ga0070688_100006359 | 3300005365 | Bacteria | 6313 |
| 81 | Ga0070688_100142370 | 3300005365 | Unclassified | 1630 |
| 82 | Ga0070688_100169006 | 3300005365 | Bacteria | 1507 |
| 83 | Ga0070688_100294890 | 3300005365 | Bacteria | 1170 |
| 84 | Ga0070688_100598310 | 3300005365 | Bacteria | 844 |
| 85 | Ga0070659_100012754 | 3300005366 | Bacteria | 6238 |
| 86 | Ga0070659_100018355 | 3300005366 | Bacteria | 5280 |
| 87 | Ga0070659_100024046 | 3300005366 | Bacteria | 4668 |
| 88 | Ga0070659_100082199 | 3300005366 | Bacteria | 2573 |
| 89 | Ga0070659_100349402 | 3300005366 | Bacteria | 1240 |
| 90 | Ga0070659_100483317 | 3300005366 | Bacteria | 1054 |
| 91 | Ga0070659_100516906 | 3300005366 | Unclassified | 1019 |
| 92 | Ga0070659_100616149 | 3300005366 | Bacteria | 934 |
| 93 | Ga0070667_100242802 | 3300005367 | Bacteria | 1609 |
| 94 | Ga0070667_100344303 | 3300005367 | Bacteria | 1349 |
| 95 | Ga0070703_10001171 | 3300005406 | Bacteria | 8082 |
| 96 | Ga0070709_10068516 | 3300005434 | Bacteria | 2282 |
| 97 | Ga0070709_10459006 | 3300005434 | Bacteria | 961 |
| 98 | Ga0070709_10620233 | 3300005434 | Unclassified | 834 |
| 99 | Ga0070709_11056424 | 3300005434 | Bacteria | 648 |
| 100 | Ga0070714_100016771 | 3300005435 | Bacteria | 5923 |
| 101 | Ga0070714_100110386 | 3300005435 | Bacteria | 2435 |
| 102 | Ga0070714_100388218 | 3300005435 | Bacteria | 1317 |
| 103 | Ga0070714_100578222 | 3300005435 | Bacteria | 1077 |
| 104 | Ga0070714_100999010 | 3300005435 | Bacteria | 814 |
| 105 | Ga0070713_100009373 | 3300005436 | Bacteria | 7003 |
| 106 | Ga0070713_100192995 | 3300005436 | Bacteria | 1836 |
| 107 | Ga0070713_100501762 | 3300005436 | Bacteria | 1145 |
| 108 | Ga0070713_100509086 | 3300005436 | Unclassified | 1137 |
| 109 | Ga0070710_10020801 | 3300005437 | Bacteria | 3410 |
| 110 | Ga0070710_10032517 | 3300005437 | Bacteria | 2826 |
| 111 | Ga0070710_10144075 | 3300005437 | Unclassified | 1464 |
| 112 | Ga0070701_10001880 | 3300005438 | Bacteria | 7967 |
| 113 | Ga0070701_10041749 | 3300005438 | Bacteria | 2339 |
| 114 | Ga0070701_10050569 | 3300005438 | Bacteria | 2153 |
| 115 | Ga0070701_10120876 | 3300005438 | Bacteria | 1476 |
| 116 | Ga0070701_10124786 | 3300005438 | Bacteria | 1455 |
| 117 | Ga0070701_10265388 | 3300005438 | Bacteria | 1042 |
| 118 | Ga0070711_100038898 | 3300005439 | Bacteria | 3201 |
| 119 | Ga0070711_100047708 | 3300005439 | Bacteria | 2925 |
| 120 | Ga0070711_100109060 | 3300005439 | Bacteria | 2029 |
| 121 | Ga0070711_100321946 | 3300005439 | Bacteria | 1236 |
| 122 | Ga0070711_100343184 | 3300005439 | Bacteria | 1199 |
| 123 | Ga0070705_100010197 | 3300005440 | Bacteria | 4694 |
| 124 | Ga0070705_100043489 | 3300005440 | Bacteria | 2574 |
| 125 | Ga0070700_100028493 | 3300005441 | Bacteria | 3323 |
| 126 | Ga0070700_100175075 | 3300005441 | Bacteria | 1489 |
| 127 | Ga0070700_100423562 | 3300005441 | Bacteria | 1006 |
| 128 | Ga0070700_100596212 | 3300005441 | Bacteria | 865 |
| 129 | Ga0070700_101020529 | 3300005441 | Bacteria | 681 |
| 130 | Ga0070694_100014526 | 3300005444 | Bacteria | 4929 |
| 131 | Ga0070694_100039958 | 3300005444 | Bacteria | 3125 |
| 132 | Ga0070694_100140686 | 3300005444 | Bacteria | 1753 |
| 133 | Ga0070694_100165388 | 3300005444 | Bacteria | 1626 |
| 134 | Ga0070694_100196134 | 3300005444 | Unclassified | 1502 |
| 135 | Ga0070694_100264580 | 3300005444 | Unclassified | 1305 |
| 136 | Ga0070694_100313053 | 3300005444 | Unclassified | 1206 |
| 137 | Ga0070708_100012676 | 3300005445 | Bacteria | 6884 |
| 138 | Ga0070708_100020105 | 3300005445 | Bacteria | 5623 |
| 139 | Ga0070708_100330687 | 3300005445 | Bacteria | 1436 |
| 140 | Ga0070708_100333718 | 3300005445 | Bacteria | 1429 |
| 141 | Ga0070708_100630868 | 3300005445 | Bacteria | 1010 |
| 142 | Ga0070663_100015490 | 3300005455 | Bacteria | 4924 |
| 143 | Ga0070663_100026685 | 3300005455 | Bacteria | 3914 |
| 144 | Ga0070663_100167075 | 3300005455 | Bacteria | 1698 |
| 145 | Ga0070663_100276739 | 3300005455 | Bacteria | 1336 |
| 146 | Ga0070663_100619475 | 3300005455 | Bacteria | 912 |
| 147 | Ga0070678_100027358 | 3300005456 | Bacteria | 3871 |
| 148 | Ga0070678_100030925 | 3300005456 | Bacteria | 3686 |
| 149 | Ga0070678_100043829 | 3300005456 | Bacteria | 3190 |
| 150 | Ga0070678_100118294 | 3300005456 | Bacteria | 2085 |
| 151 | Ga0070678_100129772 | 3300005456 | Bacteria | 2001 |
| 152 | Ga0070678_100160733 | 3300005456 | Bacteria | 1820 |
| 153 | Ga0070678_100433178 | 3300005456 | Unclassified | 1148 |
| 154 | Ga0070662_100018956 | 3300005457 | Bacteria | 4662 |
| 155 | Ga0070662_100056258 | 3300005457 | Unclassified | 2855 |
| 156 | Ga0070662_100123105 | 3300005457 | Unclassified | 1990 |
| 157 | Ga0070662_100134448 | 3300005457 | Bacteria | 1911 |
| 158 | Ga0070662_100154025 | 3300005457 | Bacteria | 1792 |
| 159 | Ga0070662_100296099 | 3300005457 | Unclassified | 1313 |
| 160 | Ga0070662_100557926 | 3300005457 | Bacteria | 960 |
| 161 | Ga0070681_10027349 | 3300005458 | Bacteria | 5735 |
| 162 | Ga0070681_10050977 | 3300005458 | Bacteria | 4129 |
| 163 | Ga0070681_10115013 | 3300005458 | Bacteria | 2629 |
| 164 | Ga0070681_10180881 | 3300005458 | Bacteria | 2030 |
| 165 | Ga0070681_10401148 | 3300005458 | Unclassified | 1283 |
| 166 | Ga0068867_100002315 | 3300005459 | Bacteria | 13405 |
| 167 | Ga0068867_100095276 | 3300005459 | Bacteria | 2264 |
| 168 | Ga0068867_100134435 | 3300005459 | Unclassified | 1926 |
| 169 | Ga0068867_100282352 | 3300005459 | Unclassified | 1362 |
| 170 | Ga0068867_100289451 | 3300005459 | Bacteria | 1346 |
| 171 | Ga0068867_100325653 | 3300005459 | Bacteria | 1274 |
| 172 | Ga0068867_101118876 | 3300005459 | Bacteria | 720 |
| 173 | Ga0070685_10009790 | 3300005466 | Bacteria | 4969 |
| 174 | Ga0070685_10125487 | 3300005466 | Bacteria | 1598 |
| 175 | Ga0070685_10130354 | 3300005466 | Bacteria | 1572 |
| 176 | Ga0070706_100006207 | 3300005467 | Bacteria | 11304 |
| 177 | Ga0070706_100024563 | 3300005467 | Bacteria | 5549 |
| 178 | Ga0070706_100125633 | 3300005467 | Bacteria | 2392 |
| 179 | Ga0070706_100227086 | 3300005467 | Bacteria | 1743 |
| 180 | Ga0070707_100002022 | 3300005468 | Bacteria | 19410 |
| 181 | Ga0070707_100120856 | 3300005468 | Bacteria | 2543 |
| 182 | Ga0070707_100187496 | 3300005468 | Bacteria | 2016 |
| 183 | Ga0070707_100300131 | 3300005468 | Bacteria | 1561 |
| 184 | Ga0070707_100386701 | 3300005468 | Bacteria | 1359 |
| 185 | Ga0070698_100004478 | 3300005471 | Bacteria | 15359 |
| 186 | Ga0070698_100043520 | 3300005471 | Bacteria | 4603 |
| 187 | Ga0070698_100049546 | 3300005471 | Bacteria | 4286 |
| 188 | Ga0070698_100099041 | 3300005471 | Bacteria | 2889 |
| 189 | Ga0070698_100164185 | 3300005471 | Bacteria | 2164 |
| 190 | Ga0070699_100011412 | 3300005518 | Bacteria | 7671 |
| 191 | Ga0070699_100023450 | 3300005518 | Bacteria | 5316 |
| 192 | Ga0070699_100222654 | 3300005518 | Bacteria | 1681 |
| 193 | Ga0070699_100240434 | 3300005518 | Bacteria | 1616 |
| 194 | Ga0070699_100431267 | 3300005518 | Bacteria | 1194 |
| 195 | Ga0070699_101006660 | 3300005518 | Bacteria | 764 |
| 196 | Ga0070679_100019732 | 3300005530 | Bacteria | 6561 |
| 197 | Ga0070679_100050160 | 3300005530 | Bacteria | 4157 |
| 198 | Ga0070679_100054574 | 3300005530 | Bacteria | 3979 |
| 199 | Ga0070679_100073240 | 3300005530 | Bacteria | 3418 |
| 200 | Ga0070679_100078766 | 3300005530 | Bacteria | 3284 |
| 201 | Ga0070679_100131480 | 3300005530 | Bacteria | 2484 |
| 202 | Ga0070679_100150113 | 3300005530 | Bacteria | 2307 |
| 203 | Ga0070679_100167631 | 3300005530 | Bacteria | 2169 |
| 204 | Ga0070679_100255592 | 3300005530 | Bacteria | 1707 |
| 205 | Ga0070679_100369417 | 3300005530 | Bacteria | 1382 |
| 206 | Ga0070684_100000342 | 3300005535 | Bacteria | 32228 |
| 207 | Ga0070684_100009249 | 3300005535 | Bacteria | 7755 |
| 208 | Ga0070684_100015145 | 3300005535 | Bacteria | 6270 |
| 209 | Ga0070684_100017530 | 3300005535 | Bacteria | 5880 |
| 210 | Ga0070684_100039395 | 3300005535 | Bacteria | 4064 |
| 211 | Ga0070684_100081446 | 3300005535 | Bacteria | 2864 |
| 212 | Ga0070684_100083784 | 3300005535 | Bacteria | 2826 |
| 213 | Ga0070684_100093145 | 3300005535 | Bacteria | 2682 |
| 214 | Ga0070684_100257549 | 3300005535 | Bacteria | 1596 |
| 215 | Ga0070684_100294679 | 3300005535 | Bacteria | 1488 |
| 216 | Ga0070684_100448688 | 3300005535 | Bacteria | 1192 |
| 217 | Ga0070697_100065417 | 3300005536 | Unclassified | 2971 |
| 218 | Ga0070697_100230814 | 3300005536 | Bacteria | 1579 |
| 219 | Ga0070697_100305754 | 3300005536 | Unclassified | 1367 |
| 220 | Ga0068853_100007377 | 3300005539 | Bacteria | 8797 |
| 221 | Ga0068853_100650680 | 3300005539 | Bacteria | 1003 |
| 222 | Ga0070672_100180692 | 3300005543 | Bacteria | 1758 |
| 223 | Ga0070672_100180942 | 3300005543 | Bacteria | 1757 |
| 224 | Ga0070672_100237052 | 3300005543 | Bacteria | 1534 |
| 225 | Ga0070672_101122689 | 3300005543 | Bacteria | 699 |
| 226 | Ga0070686_100019311 | 3300005544 | Bacteria | 4013 |
| 227 | Ga0070686_100032890 | 3300005544 | Bacteria | 3183 |
| 228 | Ga0070686_100046897 | 3300005544 | Bacteria | 2729 |
| 229 | Ga0070686_100078211 | 3300005544 | Bacteria | 2183 |
| 230 | Ga0070686_100152514 | 3300005544 | Bacteria | 1620 |
| 231 | Ga0070686_100214841 | 3300005544 | Bacteria | 1387 |
| 232 | Ga0070686_100227249 | 3300005544 | Bacteria | 1352 |
| 233 | Ga0070686_100302843 | 3300005544 | Bacteria | 1186 |
| 234 | Ga0070695_100088184 | 3300005545 | Bacteria | 2065 |
| 235 | Ga0070695_100284694 | 3300005545 | Bacteria | 1216 |
| 236 | Ga0070696_100039680 | 3300005546 | Bacteria | 3251 |
| 237 | Ga0070696_100112185 | 3300005546 | Bacteria | 1964 |
| 238 | Ga0070696_100127897 | 3300005546 | Bacteria | 1845 |
| 239 | Ga0070696_100164253 | 3300005546 | Bacteria | 1638 |
| 240 | Ga0070696_100430723 | 3300005546 | Bacteria | 1037 |
| 241 | Ga0070696_100493859 | 3300005546 | Unclassified | 973 |
| 242 | Ga0070696_100844268 | 3300005546 | Bacteria | 756 |
| 243 | Ga0070693_100008362 | 3300005547 | Bacteria | 5097 |
| 244 | Ga0070693_100055804 | 3300005547 | Bacteria | 2277 |
| 245 | Ga0070693_100066044 | 3300005547 | Bacteria | 2116 |
| 246 | Ga0070693_100073369 | 3300005547 | Bacteria | 2021 |
| 247 | Ga0070693_100079776 | 3300005547 | Unclassified | 1948 |
| 248 | Ga0070693_100265488 | 3300005547 | Bacteria | 1144 |
| 249 | Ga0070704_100022434 | 3300005549 | Bacteria | 4108 |
| 250 | Ga0070704_100139357 | 3300005549 | Unclassified | 1891 |
| 251 | Ga0070704_100270852 | 3300005549 | Bacteria | 1403 |
| 252 | Ga0070704_100414289 | 3300005549 | Bacteria | 1153 |
| 253 | Ga0068855_100008382 | 3300005563 | Bacteria | 12498 |
| 254 | Ga0068855_100025796 | 3300005563 | Bacteria | 7028 |
| 255 | Ga0068855_100219303 | 3300005563 | Bacteria | 2134 |
| 256 | Ga0068855_100556898 | 3300005563 | Unclassified | 1240 |
| 257 | Ga0070664_100092746 | 3300005564 | Bacteria | 2615 |
| 258 | Ga0070664_100263806 | 3300005564 | Bacteria | 1550 |
| 259 | Ga0070664_100347399 | 3300005564 | Bacteria | 1348 |
| 260 | Ga0070664_100370321 | 3300005564 | Unclassified | 1306 |
| 261 | Ga0070664_100586067 | 3300005564 | Bacteria | 1033 |
| 262 | Ga0070664_100876614 | 3300005564 | Bacteria | 841 |
| 263 | Ga0068857_100013085 | 3300005577 | Bacteria | 7230 |
| 264 | Ga0068857_100020562 | 3300005577 | Bacteria | 5807 |
| 265 | Ga0068857_100057932 | 3300005577 | Bacteria | 3440 |
| 266 | Ga0068857_100106141 | 3300005577 | Bacteria | 2522 |
| 267 | Ga0068857_100202950 | 3300005577 | Bacteria | 1807 |
| 268 | Ga0068854_100022150 | 3300005578 | Bacteria | 4323 |
| 269 | Ga0068854_100213083 | 3300005578 | Bacteria | 1525 |
| 270 | Ga0068854_100394242 | 3300005578 | Bacteria | 1144 |
| 271 | Ga0068854_100516616 | 3300005578 | Bacteria | 1008 |
| 272 | Ga0068856_100005088 | 3300005614 | Bacteria | 13000 |
| 273 | Ga0068856_100040289 | 3300005614 | Bacteria | 4587 |
| 274 | Ga0068856_100072409 | 3300005614 | Bacteria | 3412 |
| 275 | Ga0068856_100102293 | 3300005614 | Bacteria | 2858 |
| 276 | Ga0068856_100121930 | 3300005614 | Bacteria | 2609 |
| 277 | Ga0068856_100164880 | 3300005614 | Bacteria | 2227 |
| 278 | Ga0068856_100228864 | 3300005614 | Bacteria | 1874 |
| 279 | Ga0068856_100423691 | 3300005614 | Bacteria | 1351 |
| 280 | Ga0068856_101024262 | 3300005614 | Bacteria | 844 |
| 281 | Ga0070702_100014762 | 3300005615 | Bacteria | 3971 |
| 282 | Ga0070702_100038923 | 3300005615 | Bacteria | 2651 |
| 283 | Ga0070702_100063194 | 3300005615 | Unclassified | 2161 |
| 284 | Ga0070702_100282603 | 3300005615 | Bacteria | 1140 |
| 285 | Ga0068852_100051251 | 3300005616 | Bacteria | 3541 |
| 286 | Ga0068852_100171861 | 3300005616 | Bacteria | 2032 |
| 287 | Ga0068852_100185938 | 3300005616 | Bacteria | 1957 |
| 288 | Ga0068852_100834025 | 3300005616 | Bacteria | 937 |
| 289 | Ga0068859_100491916 | 3300005617 | Bacteria | 1322 |
| 290 | Ga0068864_100139766 | 3300005618 | Bacteria | 2184 |
| 291 | Ga0068864_100236692 | 3300005618 | Unclassified | 1690 |
| 292 | Ga0068864_100477628 | 3300005618 | Bacteria | 1196 |
| 293 | Ga0068864_100865333 | 3300005618 | Bacteria | 891 |
| 294 | Ga0068866_10025354 | 3300005718 | Bacteria | 2786 |
| 295 | Ga0068866_10085626 | 3300005718 | Bacteria | 1704 |
| 296 | Ga0068866_10116941 | 3300005718 | Unclassified | 1496 |
| 297 | Ga0068866_10213196 | 3300005718 | Unclassified | 1161 |
| 298 | Ga0068866_10246261 | 3300005718 | Bacteria | 1091 |
| 299 | Ga0068861_100018944 | 3300005719 | Bacteria | 4909 |
| 300 | Ga0068861_100741194 | 3300005719 | Bacteria | 917 |
| 301 | Ga0068851_10086844 | 3300005834 | Bacteria | 1642 |
| 302 | Ga0068851_10173745 | 3300005834 | Bacteria | 1190 |
| 303 | Ga0068851_10227978 | 3300005834 | Unclassified | 1049 |
| 304 | Ga0068851_10562836 | 3300005834 | Bacteria | 690 |
| 305 | Ga0068870_10041843 | 3300005840 | Bacteria | 2383 |
| 306 | Ga0068870_10135662 | 3300005840 | Bacteria | 1434 |
| 307 | Ga0068863_100284147 | 3300005841 | Bacteria | 1604 |
| 308 | Ga0068858_100104693 | 3300005842 | Bacteria | 2640 |
| 309 | Ga0068858_100279512 | 3300005842 | Bacteria | 1589 |
| 310 | Ga0068860_100112623 | 3300005843 | Bacteria | 2601 |
| 311 | Ga0068862_100250283 | 3300005844 | Bacteria | 1615 |
| 312 | Ga0068862_100347600 | 3300005844 | Bacteria | 1375 |
| 313 | Ga0068862_100611005 | 3300005844 | Bacteria | 1048 |
| 314 | Ga0068862_100731564 | 3300005844 | Bacteria | 961 |
| 315 | Ga0068862_101162249 | 3300005844 | Bacteria | 769 |
| 316 | Ga0081455_10006147 | 3300005937 | Bacteria | 12959 |
| 317 | Ga0081455_10006677 | 3300005937 | Bacteria | 12330 |
| 318 | Ga0081455_10020524 | 3300005937 | Bacteria | 6217 |
| 319 | Ga0081455_10126899 | 3300005937 | Bacteria | 2000 |
| 320 | Ga0081455_10198656 | 3300005937 | Bacteria | 1503 |
| 321 | Ga0081455_10582348 | 3300005937 | Bacteria | 733 |
| 322 | Ga0081538_10000764 | 3300005981 | Bacteria | 35156 |
| 323 | Ga0081538_10014126 | 3300005981 | Bacteria | 6274 |
| 324 | Ga0081538_10018658 | 3300005981 | Bacteria | 5196 |
| 325 | Ga0081538_10034860 | 3300005981 | Bacteria | 3318 |
| 326 | Ga0081540_1008364 | 3300005983 | Bacteria | 7231 |
| 327 | Ga0081539_10000216 | 3300005985 | Bacteria | 134976 |
| 328 | Ga0081539_10103106 | 3300005985 | Unclassified | 1450 |
| 329 | Ga0070717_10156317 | 3300006028 | Bacteria | 1976 |
| 330 | Ga0070717_10292264 | 3300006028 | Bacteria | 1447 |
| 331 | Ga0075365_10135409 | 3300006038 | Bacteria | 1707 |
| 332 | Ga0075365_10282217 | 3300006038 | Bacteria | 1169 |
| 333 | Ga0075364_10001325 | 3300006051 | Bacteria | 13314 |
| 334 | Ga0075432_10000201 | 3300006058 | Bacteria | 15689 |
| 335 | Ga0075432_10013296 | 3300006058 | Bacteria | 2796 |
| 336 | Ga0075432_10040921 | 3300006058 | Bacteria | 1618 |
| 337 | Ga0075432_10047739 | 3300006058 | Bacteria | 1505 |
| 338 | Ga0070715_10117207 | 3300006163 | Bacteria | 1264 |
| 339 | Ga0070715_10141310 | 3300006163 | Bacteria | 1170 |
| 340 | Ga0070716_100078030 | 3300006173 | Bacteria | 1967 |
| 341 | Ga0070716_100394361 | 3300006173 | Unclassified | 993 |
| 342 | Ga0070712_100006400 | 3300006175 | Bacteria | 7302 |
| 343 | Ga0070712_100006610 | 3300006175 | Bacteria | 7206 |
| 344 | Ga0070712_100028051 | 3300006175 | Bacteria | 3763 |
| 345 | Ga0070712_100053477 | 3300006175 | Bacteria | 2819 |
| 346 | Ga0070712_100102684 | 3300006175 | Bacteria | 2118 |
| 347 | Ga0070712_100106362 | 3300006175 | Bacteria | 2085 |
| 348 | Ga0070712_100115383 | 3300006175 | Unclassified | 2012 |
| 349 | Ga0070712_100192106 | 3300006175 | Unclassified | 1598 |
| 350 | Ga0070712_100349392 | 3300006175 | Bacteria | 1210 |
| 351 | Ga0070712_100404309 | 3300006175 | Bacteria | 1128 |
| 352 | Ga0070712_100526557 | 3300006175 | Unclassified | 993 |
| 353 | Ga0075427_10007459 | 3300006194 | Bacteria | 1607 |
| 354 | Ga0097621_100057793 | 3300006237 | Bacteria | 3173 |
| 355 | Ga0097621_100088753 | 3300006237 | Bacteria | 2584 |
| 356 | Ga0097621_100244488 | 3300006237 | Bacteria | 1570 |
| 357 | Ga0097621_100378999 | 3300006237 | Bacteria | 1263 |
| 358 | Ga0097621_100467366 | 3300006237 | Bacteria | 1138 |
| 359 | Ga0097621_101749827 | 3300006237 | Unclassified | 592 |
| 360 | Ga0068871_100004486 | 3300006358 | Bacteria | 9719 |
| 361 | Ga0068871_100246448 | 3300006358 | Bacteria | 1555 |
| 362 | Ga0068871_100264876 | 3300006358 | Bacteria | 1500 |
| 363 | Ga0068871_100343459 | 3300006358 | Bacteria | 1319 |
| 364 | Ga0075428_100000774 | 3300006844 | Bacteria | 33307 |
| 365 | Ga0075428_100002031 | 3300006844 | Bacteria | 21804 |
| 366 | Ga0075428_100093545 | 3300006844 | Bacteria | 3277 |
| 367 | Ga0075428_101449496 | 3300006844 | Unclassified | 720 |
| 368 | Ga0075430_100027751 | 3300006846 | Bacteria | 4809 |
| 369 | Ga0075430_100102342 | 3300006846 | Bacteria | 2391 |
| 370 | Ga0075430_100563274 | 3300006846 | Bacteria | 940 |
| 371 | Ga0075430_100965442 | 3300006846 | Bacteria | 702 |
| 372 | Ga0075431_100002483 | 3300006847 | Bacteria | 17781 |
| 373 | Ga0075431_100044423 | 3300006847 | Bacteria | 4583 |
| 374 | Ga0075431_100057225 | 3300006847 | Bacteria | 4021 |
| 375 | Ga0075431_100145523 | 3300006847 | Bacteria | 2442 |
| 376 | Ga0075433_10000133 | 3300006852 | Bacteria | 38500 |
| 377 | Ga0075433_10005909 | 3300006852 | Bacteria | 9641 |
| 378 | Ga0075433_10007723 | 3300006852 | Bacteria | 8545 |
| 379 | Ga0075433_10102380 | 3300006852 | Bacteria | 2536 |
| 380 | Ga0075433_10118349 | 3300006852 | Bacteria | 2351 |
| 381 | Ga0075433_10559693 | 3300006852 | Unclassified | 1005 |
| 382 | Ga0075434_100001881 | 3300006871 | Bacteria | 18173 |
| 383 | Ga0075434_100020464 | 3300006871 | Bacteria | 6419 |
| 384 | Ga0075434_100084936 | 3300006871 | Bacteria | 3164 |
| 385 | Ga0075434_100165837 | 3300006871 | Bacteria | 2229 |
| 386 | Ga0075434_100218855 | 3300006871 | Unclassified | 1924 |
| 387 | Ga0075434_100615758 | 3300006871 | Bacteria | 1105 |
| 388 | Ga0075429_100041411 | 3300006880 | Bacteria | 4011 |
| 389 | Ga0075429_100049275 | 3300006880 | Bacteria | 3663 |
| 390 | Ga0075429_100079816 | 3300006880 | Bacteria | 2852 |
| 391 | Ga0075429_100276969 | 3300006880 | Bacteria | 1469 |
| 392 | Ga0075429_100730940 | 3300006880 | Unclassified | 867 |
| 393 | Ga0068865_100007046 | 3300006881 | Bacteria | 6901 |
| 394 | Ga0068865_100074727 | 3300006881 | Bacteria | 2414 |
| 395 | Ga0068865_100176640 | 3300006881 | Bacteria | 1641 |
| 396 | Ga0068865_100207216 | 3300006881 | Bacteria | 1526 |
| 397 | Ga0068865_100281732 | 3300006881 | Bacteria | 1323 |
| 398 | Ga0068865_100351071 | 3300006881 | Bacteria | 1195 |
| 399 | Ga0068865_100503599 | 3300006881 | Unclassified | 1010 |
| 400 | Ga0068865_101109026 | 3300006881 | Bacteria | 697 |
| 401 | Ga0075436_100001284 | 3300006914 | Bacteria | 17052 |
| 402 | Ga0075436_100003942 | 3300006914 | Bacteria | 10176 |
| 403 | Ga0075436_100004236 | 3300006914 | Bacteria | 9843 |
| 404 | Ga0075436_100057753 | 3300006914 | Bacteria | 2679 |
| 405 | Ga0075436_100323711 | 3300006914 | Unclassified | 1108 |
| 406 | Ga0097620_100491875 | 3300006931 | Bacteria | 1322 |
| 407 | Ga0075435_100014263 | 3300007076 | Bacteria | 5934 |
| 408 | Ga0075435_100019104 | 3300007076 | Bacteria | 5223 |
| 409 | Ga0075435_100037377 | 3300007076 | Bacteria | 3866 |
| 410 | Ga0075435_100076699 | 3300007076 | Unclassified | 2739 |
| 411 | Ga0075435_100173092 | 3300007076 | Bacteria | 1822 |
| 412 | Ga0075435_100277653 | 3300007076 | Bacteria | 1430 |
| 413 | Ga0075435_100281594 | 3300007076 | Bacteria | 1419 |
| 414 | Ga0075435_100292092 | 3300007076 | Bacteria | 1393 |
| 415 | Ga0075435_100464856 | 3300007076 | Unclassified | 1092 |
| 416 | Ga0075435_100487801 | 3300007076 | Bacteria | 1065 |
| 417 | Ga0105240_10022187 | 3300009093 | Bacteria | 8422 |
| 418 | Ga0105240_10114196 | 3300009093 | Bacteria | 3263 |
| 419 | Ga0105240_10142351 | 3300009093 | Bacteria | 2866 |
| 420 | Ga0105240_11303316 | 3300009093 | Bacteria | 766 |
| 421 | Ga0111539_10002272 | 3300009094 | Bacteria | 25576 |
| 422 | Ga0111539_10009515 | 3300009094 | Bacteria | 12268 |
| 423 | Ga0111539_10010606 | 3300009094 | Bacteria | 11602 |
| 424 | Ga0111539_10016586 | 3300009094 | Bacteria | 9132 |
| 425 | Ga0111539_10036464 | 3300009094 | Bacteria | 5946 |
| 426 | Ga0111539_10061251 | 3300009094 | Bacteria | 4459 |
| 427 | Ga0111539_10149634 | 3300009094 | Bacteria | 2733 |
| 428 | Ga0111539_10264359 | 3300009094 | Unclassified | 2003 |
| 429 | Ga0111539_10555615 | 3300009094 | Bacteria | 1337 |
| 430 | Ga0111539_10574942 | 3300009094 | Bacteria | 1312 |
| 431 | Ga0111539_10678807 | 3300009094 | Bacteria | 1199 |
| 432 | Ga0111539_11320136 | 3300009094 | Unclassified | 837 |
| 433 | Ga0105245_10007080 | 3300009098 | Bacteria | 9839 |
| 434 | Ga0105245_10011640 | 3300009098 | Bacteria | 7656 |
| 435 | Ga0105245_10024533 | 3300009098 | Bacteria | 5296 |
| 436 | Ga0105245_10026607 | 3300009098 | Bacteria | 5093 |
| 437 | Ga0105245_10028456 | 3300009098 | Bacteria | 4930 |
| 438 | Ga0105245_10028847 | 3300009098 | Bacteria | 4898 |
| 439 | Ga0105245_10042407 | 3300009098 | Bacteria | 4060 |
| 440 | Ga0105245_10059341 | 3300009098 | Bacteria | 3445 |
| 441 | Ga0105245_10075395 | 3300009098 | Bacteria | 3071 |
| 442 | Ga0105245_10128200 | 3300009098 | Bacteria | 2377 |
| 443 | Ga0105245_10140582 | 3300009098 | Bacteria | 2273 |
| 444 | Ga0105245_10157652 | 3300009098 | Unclassified | 2151 |
| 445 | Ga0105245_10329598 | 3300009098 | Unclassified | 1506 |
| 446 | Ga0105245_10851477 | 3300009098 | Bacteria | 952 |
| 447 | Ga0105245_10852107 | 3300009098 | Bacteria | 951 |
| 448 | Ga0105245_10996961 | 3300009098 | Unclassified | 882 |
| 449 | Ga0105247_10016445 | 3300009101 | Bacteria | 4434 |
| 450 | Ga0105247_10732856 | 3300009101 | Bacteria | 747 |
| 451 | Ga0114129_10000663 | 3300009147 | Bacteria | 43174 |
| 452 | Ga0114129_10003551 | 3300009147 | Bacteria | 21951 |
| 453 | Ga0114129_10007601 | 3300009147 | Bacteria | 15426 |
| 454 | Ga0114129_10016641 | 3300009147 | Bacteria | 10472 |
| 455 | Ga0114129_10083230 | 3300009147 | Bacteria | 4446 |
| 456 | Ga0114129_10091073 | 3300009147 | Bacteria | 4226 |
| 457 | Ga0114129_10123081 | 3300009147 | Bacteria | 3568 |
| 458 | Ga0114129_10221973 | 3300009147 | Bacteria | 2549 |
| 459 | Ga0114129_10598070 | 3300009147 | Bacteria | 1429 |
| 460 | Ga0114129_10637090 | 3300009147 | Bacteria | 1377 |
| 461 | Ga0114129_10725949 | 3300009147 | Unclassified | 1274 |
| 462 | Ga0105243_10021096 | 3300009148 | Bacteria | 4944 |
| 463 | Ga0105243_10110690 | 3300009148 | Bacteria | 2297 |
| 464 | Ga0105243_10181951 | 3300009148 | Unclassified | 1829 |
| 465 | Ga0105243_10204437 | 3300009148 | Bacteria | 1734 |
| 466 | Ga0105243_10328997 | 3300009148 | Bacteria | 1395 |
| 467 | Ga0105243_10453316 | 3300009148 | Bacteria | 1204 |
| 468 | Ga0105243_10459308 | 3300009148 | Unclassified | 1197 |
| 469 | Ga0105243_10546857 | 3300009148 | Bacteria | 1106 |
| 470 | Ga0105243_10964355 | 3300009148 | Bacteria | 853 |
| 471 | Ga0105241_10083083 | 3300009174 | Bacteria | 2512 |
| 472 | Ga0105241_10564120 | 3300009174 | Bacteria | 1024 |
| 473 | Ga0105242_10015704 | 3300009176 | Bacteria | 5883 |
| 474 | Ga0105242_10137307 | 3300009176 | Bacteria | 2118 |
| 475 | Ga0105242_10154221 | 3300009176 | Bacteria | 2005 |
| 476 | Ga0105242_10158893 | 3300009176 | Bacteria | 1977 |
| 477 | Ga0105242_10174038 | 3300009176 | Bacteria | 1894 |
| 478 | Ga0105242_10215199 | 3300009176 | Unclassified | 1714 |
| 479 | Ga0105242_10229415 | 3300009176 | Bacteria | 1663 |
| 480 | Ga0105242_10241866 | 3300009176 | Unclassified | 1623 |
| 481 | Ga0105242_10524395 | 3300009176 | Bacteria | 1131 |
| 482 | Ga0105242_10694448 | 3300009176 | Bacteria | 995 |
| 483 | Ga0105248_10109949 | 3300009177 | Bacteria | 3108 |
| 484 | Ga0105248_10113973 | 3300009177 | Unclassified | 3049 |
| 485 | Ga0105248_10147821 | 3300009177 | Bacteria | 2651 |
| 486 | Ga0105248_10284847 | 3300009177 | Bacteria | 1860 |
| 487 | Ga0105248_10414893 | 3300009177 | Bacteria | 1516 |
| 488 | Ga0105248_11082732 | 3300009177 | Bacteria | 906 |
| 489 | Ga0105237_10218584 | 3300009545 | Bacteria | 1906 |
| 490 | Ga0105238_10049251 | 3300009551 | Bacteria | 4244 |
| 491 | Ga0105238_10383819 | 3300009551 | Bacteria | 1396 |
| 492 | Ga0105238_11682101 | 3300009551 | Bacteria | 665 |
| 493 | Ga0105249_10307386 | 3300009553 | Bacteria | 1592 |
| 494 | Ga0105249_10495079 | 3300009553 | Bacteria | 1267 |
| 495 | Ga0105249_10653673 | 3300009553 | Bacteria | 1109 |
| 496 | Ga0105249_11235001 | 3300009553 | Bacteria | 818 |
| 497 | Ga0105239_10046334 | 3300010375 | Bacteria | 4764 |
| 498 | Ga0105239_10073026 | 3300010375 | Bacteria | 3772 |
| 499 | Ga0105239_10076336 | 3300010375 | Bacteria | 3685 |
| 500 | Ga0105239_10084503 | 3300010375 | Bacteria | 3496 |
| 501 | Ga0105239_10103549 | 3300010375 | Bacteria | 3150 |
| 502 | Ga0105239_10120656 | 3300010375 | Bacteria | 2911 |
| 503 | Ga0105239_10129347 | 3300010375 | Bacteria | 2807 |
| 504 | Ga0105239_10154230 | 3300010375 | Bacteria | 2564 |
| 505 | Ga0105239_10221894 | 3300010375 | Bacteria | 2120 |
| 506 | Ga0105239_10277416 | 3300010375 | Bacteria | 1886 |
| 507 | Ga0105246_10016139 | 3300011119 | Bacteria | 4726 |
| 508 | Ga0105246_10048258 | 3300011119 | Bacteria | 2910 |
| 509 | Ga0105246_10050258 | 3300011119 | Bacteria | 2859 |
| 510 | Ga0105246_10327946 | 3300011119 | Unclassified | 1246 |
| 511 | Ga0105246_10860071 | 3300011119 | Bacteria | 810 |
| 512 | Ga0157325_1007885 | 3300012485 | Bacteria | 726 |
| 513 | Ga0157324_1004659 | 3300012506 | Bacteria | 958 |
| 514 | Ga0157327_1016704 | 3300012512 | Bacteria | 779 |
| 515 | Ga0157373_10114235 | 3300013100 | Bacteria | 1898 |
| 516 | Ga0157373_10248419 | 3300013100 | Bacteria | 1258 |
| 517 | Ga0157373_10278117 | 3300013100 | Bacteria | 1186 |
| 518 | Ga0157373_10300410 | 3300013100 | Bacteria | 1139 |
| 519 | Ga0157373_10537041 | 3300013100 | Bacteria | 847 |
| 520 | Ga0157371_10003563 | 3300013102 | Bacteria | 14032 |
| 521 | Ga0157371_10060914 | 3300013102 | Bacteria | 2676 |
| 522 | Ga0157371_10275444 | 3300013102 | Bacteria | 1215 |
| 523 | Ga0157371_10459776 | 3300013102 | Unclassified | 936 |
| 524 | Ga0157370_10016121 | 3300013104 | Bacteria | 7574 |
| 525 | Ga0157370_10020979 | 3300013104 | Bacteria | 6515 |
| 526 | Ga0157370_10124140 | 3300013104 | Bacteria | 2410 |
| 527 | Ga0157370_10337757 | 3300013104 | Bacteria | 1389 |
| 528 | Ga0157370_10565244 | 3300013104 | Bacteria | 1042 |
| 529 | Ga0157370_11160420 | 3300013104 | Bacteria | 697 |
| 530 | Ga0157369_10002160 | 3300013105 | Bacteria | 23694 |
| 531 | Ga0157369_10003362 | 3300013105 | Bacteria | 18994 |
| 532 | Ga0157369_10006754 | 3300013105 | Bacteria | 13243 |
| 533 | Ga0157369_10035601 | 3300013105 | Bacteria | 5457 |
| 534 | Ga0157369_10127262 | 3300013105 | Bacteria | 2700 |
| 535 | Ga0157369_10156689 | 3300013105 | Bacteria | 2405 |
| 536 | Ga0157369_10623255 | 3300013105 | Bacteria | 1113 |
| 537 | Ga0157369_10755745 | 3300013105 | Bacteria | 1000 |
| 538 | Ga0157374_10043337 | 3300013296 | Bacteria | 4157 |
| 539 | Ga0157374_10093198 | 3300013296 | Bacteria | 2875 |
| 540 | Ga0157374_10429192 | 3300013296 | Bacteria | 1321 |
| 541 | Ga0157378_10025081 | 3300013297 | Bacteria | 5253 |
| 542 | Ga0157378_10159666 | 3300013297 | Bacteria | 2107 |
| 543 | Ga0157378_10306391 | 3300013297 | Unclassified | 1539 |
| 544 | Ga0157378_10711648 | 3300013297 | Unclassified | 1024 |
| 545 | Ga0157378_10894279 | 3300013297 | Bacteria | 918 |
| 546 | Ga0163162_10119231 | 3300013306 | Unclassified | 2741 |
| 547 | Ga0163162_10313405 | 3300013306 | Bacteria | 1701 |
| 548 | Ga0163162_10495745 | 3300013306 | Bacteria | 1352 |
| 549 | Ga0163162_10781830 | 3300013306 | Bacteria | 1073 |
| 550 | Ga0163162_12326967 | 3300013306 | Unclassified | 616 |
| 551 | Ga0157372_10030229 | 3300013307 | Bacteria | 5924 |
| 552 | Ga0157372_10043097 | 3300013307 | Bacteria | 4995 |
| 553 | Ga0157372_10086950 | 3300013307 | Bacteria | 3546 |
| 554 | Ga0157372_10173725 | 3300013307 | Unclassified | 2493 |
| 555 | Ga0157372_10176750 | 3300013307 | Bacteria | 2471 |
| 556 | Ga0157372_10316070 | 3300013307 | Bacteria | 1818 |
| 557 | Ga0157372_10673858 | 3300013307 | Bacteria | 1204 |
| 558 | Ga0157372_11023478 | 3300013307 | Bacteria | 956 |
| 559 | Ga0157375_10018750 | 3300013308 | Bacteria | 6278 |
| 560 | Ga0157375_10019161 | 3300013308 | Bacteria | 6216 |
| 561 | Ga0157375_10089746 | 3300013308 | Bacteria | 3131 |
| 562 | Ga0157375_10141444 | 3300013308 | Bacteria | 2533 |
| 563 | Ga0157375_10143374 | 3300013308 | Bacteria | 2518 |
| 564 | Ga0157375_10167068 | 3300013308 | Bacteria | 2345 |
| 565 | Ga0157375_10268918 | 3300013308 | Unclassified | 1866 |
| 566 | Ga0157375_10301881 | 3300013308 | Unclassified | 1765 |
| 567 | Ga0157375_10483062 | 3300013308 | Bacteria | 1404 |
| 568 | Ga0157375_10560798 | 3300013308 | Bacteria | 1303 |
| 569 | Ga0157375_10640288 | 3300013308 | Bacteria | 1220 |
| 570 | Ga0163163_10052265 | 3300014325 | Bacteria | 4031 |
| 571 | Ga0163163_10108712 | 3300014325 | Bacteria | 2800 |
| 572 | Ga0163163_10265444 | 3300014325 | Bacteria | 1768 |
| 573 | Ga0157380_10006747 | 3300014326 | Bacteria | 8114 |
| 574 | Ga0157380_10011859 | 3300014326 | Bacteria | 6303 |
| 575 | Ga0157380_10025380 | 3300014326 | Bacteria | 4494 |
| 576 | Ga0157380_11253695 | 3300014326 | Bacteria | 787 |
| 577 | Ga0157380_12005933 | 3300014326 | Bacteria | 640 |
| 578 | Ga0182008_10007008 | 3300014497 | Bacteria | 6249 |
| 579 | Ga0182008_10077019 | 3300014497 | Bacteria | 1641 |
| 580 | Ga0182008_10256514 | 3300014497 | Bacteria | 903 |
| 581 | Ga0157377_10002487 | 3300014745 | Bacteria | 8158 |
| 582 | Ga0157377_10012588 | 3300014745 | Bacteria | 4258 |
| 583 | Ga0157377_10017171 | 3300014745 | Bacteria | 3739 |
| 584 | Ga0157377_10097193 | 3300014745 | Bacteria | 1748 |
| 585 | Ga0157377_10211253 | 3300014745 | Bacteria | 1237 |
| 586 | Ga0157379_10043254 | 3300014968 | Bacteria | 4021 |
| 587 | Ga0157379_10126575 | 3300014968 | Unclassified | 2299 |
| 588 | Ga0157379_10334167 | 3300014968 | Bacteria | 1385 |
| 589 | Ga0157376_10019379 | 3300014969 | Bacteria | 5243 |
| 590 | Ga0157376_10134939 | 3300014969 | Bacteria | 2207 |
| 591 | Ga0157376_10139764 | 3300014969 | Bacteria | 2171 |
| 592 | Ga0157376_11127829 | 3300014969 | Bacteria | 811 |
| 593 | Ga0157376_11313201 | 3300014969 | Unclassified | 754 |
| 594 | Ga0157376_11577343 | 3300014969 | Bacteria | 690 |
| 595 | Ga0182007_10004362 | 3300015262 | Bacteria | 6422 |
| 596 | Ga0163161_10006188 | 3300017792 | Bacteria | 8293 |
| 597 | Ga0163161_10189304 | 3300017792 | Bacteria | 1581 |
| 598 | Ga0163161_10640528 | 3300017792 | Bacteria | 880 |
| 599 | Ga0197907_10041679 | 3300020069 | Bacteria | 5594 |
| 600 | Ga0206356_10890542 | 3300020070 | Bacteria | 1659 |
| 601 | Ga0206356_11882679 | 3300020070 | Bacteria | 6198 |
| 602 | Ga0206354_10253245 | 3300020081 | Bacteria | 4532 |
| 603 | Ga0206354_10587909 | 3300020081 | Bacteria | 2981 |
| 604 | Ga0206353_10293431 | 3300020082 | Bacteria | 7547 |
| 605 | Ga0206353_10842030 | 3300020082 | Bacteria | 3460 |
| 606 | Ga0206353_10986072 | 3300020082 | Bacteria | 4060 |
| 607 | Ga0224712_10017277 | 3300022467 | Bacteria | 2390 |
| 608 | Ga0207656_10023877 | 3300025321 | Bacteria | 2467 |
| 609 | Ga0207656_10096929 | 3300025321 | Bacteria | 1347 |
| 610 | Ga0207656_10129649 | 3300025321 | Bacteria | 1180 |
| 611 | Ga0207656_10200309 | 3300025321 | Bacteria | 964 |
| 612 | Ga0207653_10002122 | 3300025885 | Bacteria | 6318 |
| 613 | Ga0207692_10096058 | 3300025898 | Unclassified | 1617 |
| 614 | Ga0207692_10096325 | 3300025898 | Bacteria | 1615 |
| 615 | Ga0207692_10253614 | 3300025898 | Bacteria | 1055 |
| 616 | Ga0207692_10554728 | 3300025898 | Bacteria | 734 |
| 617 | Ga0207642_10024494 | 3300025899 | Bacteria | 2427 |
| 618 | Ga0207642_10049354 | 3300025899 | Bacteria | 1892 |
| 619 | Ga0207642_10050467 | 3300025899 | Bacteria | 1877 |
| 620 | Ga0207642_10275635 | 3300025899 | Bacteria | 965 |
| 621 | Ga0207710_10018241 | 3300025900 | Bacteria | 2983 |
| 622 | Ga0207710_10040680 | 3300025900 | Bacteria | 2060 |
| 623 | Ga0207688_10005675 | 3300025901 | Bacteria | 6787 |
| 624 | Ga0207688_10021827 | 3300025901 | Bacteria | 3501 |
| 625 | Ga0207688_10023832 | 3300025901 | Bacteria | 3354 |
| 626 | Ga0207688_10040439 | 3300025901 | Bacteria | 2591 |
| 627 | Ga0207688_10063433 | 3300025901 | Unclassified | 2084 |
| 628 | Ga0207688_10122065 | 3300025901 | Bacteria | 1521 |
| 629 | Ga0207685_10025780 | 3300025905 | Bacteria | 2035 |
| 630 | Ga0207685_10035508 | 3300025905 | Unclassified | 1820 |
| 631 | Ga0207685_10045849 | 3300025905 | Unclassified | 1660 |
| 632 | Ga0207699_10057489 | 3300025906 | Unclassified | 2322 |
| 633 | Ga0207699_10082856 | 3300025906 | Bacteria | 1993 |
| 634 | Ga0207699_10162555 | 3300025906 | Bacteria | 1487 |
| 635 | Ga0207645_10031078 | 3300025907 | Bacteria | 3438 |
| 636 | Ga0207643_10004174 | 3300025908 | Bacteria | 7785 |
| 637 | Ga0207705_10014098 | 3300025909 | Bacteria | 5759 |
| 638 | Ga0207705_10022683 | 3300025909 | Bacteria | 4477 |
| 639 | Ga0207705_10052202 | 3300025909 | Bacteria | 2943 |
| 640 | Ga0207705_10066861 | 3300025909 | Bacteria | 2600 |
| 641 | Ga0207684_10196398 | 3300025910 | Bacteria | 1740 |
| 642 | Ga0207684_10787945 | 3300025910 | Bacteria | 804 |
| 643 | Ga0207654_10043072 | 3300025911 | Bacteria | 2557 |
| 644 | Ga0207654_10334482 | 3300025911 | Bacteria | 1039 |
| 645 | Ga0207707_10035823 | 3300025912 | Bacteria | 4340 |
| 646 | Ga0207707_10276018 | 3300025912 | Unclassified | 1456 |
| 647 | Ga0207707_10338397 | 3300025912 | Bacteria | 1298 |
| 648 | Ga0207695_10023618 | 3300025913 | Bacteria | 6939 |
| 649 | Ga0207695_10121774 | 3300025913 | Bacteria | 2576 |
| 650 | Ga0207695_10330496 | 3300025913 | Bacteria | 1413 |
| 651 | Ga0207695_10588406 | 3300025913 | Bacteria | 994 |
| 652 | Ga0207671_10714453 | 3300025914 | Unclassified | 797 |
| 653 | Ga0207693_10000175 | 3300025915 | Bacteria | 58611 |
| 654 | Ga0207693_10001072 | 3300025915 | Bacteria | 24515 |
| 655 | Ga0207693_10009471 | 3300025915 | Bacteria | 7934 |
| 656 | Ga0207693_10012906 | 3300025915 | Bacteria | 6742 |
| 657 | Ga0207693_10016758 | 3300025915 | Bacteria | 5852 |
| 658 | Ga0207693_10030223 | 3300025915 | Bacteria | 4277 |
| 659 | Ga0207693_10036572 | 3300025915 | Bacteria | 3870 |
| 660 | Ga0207693_10078717 | 3300025915 | Bacteria | 2580 |
| 661 | Ga0207693_10090882 | 3300025915 | Bacteria | 2393 |
| 662 | Ga0207663_10032456 | 3300025916 | Bacteria | 3100 |
| 663 | Ga0207663_10087857 | 3300025916 | Bacteria | 2054 |
| 664 | Ga0207663_10257933 | 3300025916 | Bacteria | 1286 |
| 665 | Ga0207663_10299225 | 3300025916 | Unclassified | 1201 |
| 666 | Ga0207663_10342064 | 3300025916 | Unclassified | 1130 |
| 667 | Ga0207663_10400132 | 3300025916 | Bacteria | 1050 |
| 668 | Ga0207660_10015622 | 3300025917 | Bacteria | 5014 |
| 669 | Ga0207660_10263233 | 3300025917 | Bacteria | 1364 |
| 670 | Ga0207660_10363601 | 3300025917 | Unclassified | 1161 |
| 671 | Ga0207660_10390846 | 3300025917 | Bacteria | 1119 |
| 672 | Ga0207660_10608000 | 3300025917 | Bacteria | 890 |
| 673 | Ga0207662_10011405 | 3300025918 | Bacteria | 4929 |
| 674 | Ga0207662_10121023 | 3300025918 | Bacteria | 1642 |
| 675 | Ga0207662_10347960 | 3300025918 | Unclassified | 995 |
| 676 | Ga0207657_10002558 | 3300025919 | Bacteria | 19681 |
| 677 | Ga0207657_10010921 | 3300025919 | Bacteria | 9036 |
| 678 | Ga0207657_10018459 | 3300025919 | Bacteria | 6657 |
| 679 | Ga0207657_10073781 | 3300025919 | Bacteria | 2882 |
| 680 | Ga0207657_10128935 | 3300025919 | Bacteria | 2075 |
| 681 | Ga0207657_10253886 | 3300025919 | Bacteria | 1401 |
| 682 | Ga0207649_10056776 | 3300025920 | Bacteria | 2446 |
| 683 | Ga0207649_10144312 | 3300025920 | Bacteria | 1632 |
| 684 | Ga0207649_10194759 | 3300025920 | Bacteria | 1427 |
| 685 | Ga0207652_10006237 | 3300025921 | Bacteria | 9624 |
| 686 | Ga0207652_10041641 | 3300025921 | Bacteria | 3906 |
| 687 | Ga0207652_10051672 | 3300025921 | Bacteria | 3524 |
| 688 | Ga0207652_10157338 | 3300025921 | Bacteria | 2036 |
| 689 | Ga0207652_10203299 | 3300025921 | Bacteria | 1783 |
| 690 | Ga0207652_10257332 | 3300025921 | Bacteria | 1574 |
| 691 | Ga0207652_10522337 | 3300025921 | Bacteria | 1068 |
| 692 | Ga0207646_10009655 | 3300025922 | Bacteria | 9518 |
| 693 | Ga0207681_10095560 | 3300025923 | Bacteria | 2132 |
| 694 | Ga0207681_10164526 | 3300025923 | Unclassified | 1676 |
| 695 | Ga0207681_10177730 | 3300025923 | Bacteria | 1619 |
| 696 | Ga0207694_10080014 | 3300025924 | Bacteria | 2564 |
| 697 | Ga0207694_10426934 | 3300025924 | Bacteria | 1105 |
| 698 | Ga0207694_10636978 | 3300025924 | Bacteria | 898 |
| 699 | Ga0207659_10170712 | 3300025926 | Unclassified | 1716 |
| 700 | Ga0207659_10194717 | 3300025926 | Bacteria | 1615 |
| 701 | Ga0207659_10242689 | 3300025926 | Bacteria | 1458 |
| 702 | Ga0207687_10005340 | 3300025927 | Bacteria | 8505 |
| 703 | Ga0207687_10018927 | 3300025927 | Bacteria | 4555 |
| 704 | Ga0207687_10053025 | 3300025927 | Bacteria | 2832 |
| 705 | Ga0207687_10054041 | 3300025927 | Bacteria | 2808 |
| 706 | Ga0207687_10095291 | 3300025927 | Bacteria | 2180 |
| 707 | Ga0207687_10172762 | 3300025927 | Unclassified | 1668 |
| 708 | Ga0207687_10333636 | 3300025927 | Bacteria | 1231 |
| 709 | Ga0207687_10470765 | 3300025927 | Bacteria | 1045 |
| 710 | Ga0207687_10800001 | 3300025927 | Bacteria | 804 |
| 711 | Ga0207700_10000002 | 3300025928 | Bacteria | 775978 |
| 712 | Ga0207700_10555415 | 3300025928 | Bacteria | 1019 |
| 713 | Ga0207700_10697971 | 3300025928 | Bacteria | 906 |
| 714 | Ga0207664_10077234 | 3300025929 | Bacteria | 2698 |
| 715 | Ga0207664_10260579 | 3300025929 | Bacteria | 1516 |
| 716 | Ga0207664_10685800 | 3300025929 | Unclassified | 921 |
| 717 | Ga0207664_11118578 | 3300025929 | Bacteria | 704 |
| 718 | Ga0207644_10213067 | 3300025931 | Bacteria | 1528 |
| 719 | Ga0207690_10008748 | 3300025932 | Bacteria | 6010 |
| 720 | Ga0207690_10141831 | 3300025932 | Unclassified | 1771 |
| 721 | Ga0207690_10160688 | 3300025932 | Bacteria | 1674 |
| 722 | Ga0207690_10329478 | 3300025932 | Bacteria | 1202 |
| 723 | Ga0207690_11170111 | 3300025932 | Bacteria | 642 |
| 724 | Ga0207706_10003556 | 3300025933 | Bacteria | 14883 |
| 725 | Ga0207706_10013854 | 3300025933 | Bacteria | 7314 |
| 726 | Ga0207706_10030669 | 3300025933 | Bacteria | 4795 |
| 727 | Ga0207706_10036222 | 3300025933 | Bacteria | 4384 |
| 728 | Ga0207706_10036519 | 3300025933 | Bacteria | 4365 |
| 729 | Ga0207706_10133937 | 3300025933 | Unclassified | 2180 |
| 730 | Ga0207706_10146465 | 3300025933 | Unclassified | 2077 |
| 731 | Ga0207686_10077504 | 3300025934 | Bacteria | 2158 |
| 732 | Ga0207686_10105372 | 3300025934 | Bacteria | 1891 |
| 733 | Ga0207686_10166739 | 3300025934 | Bacteria | 1549 |
| 734 | Ga0207686_10805019 | 3300025934 | Bacteria | 753 |
| 735 | Ga0207709_10166129 | 3300025935 | Bacteria | 1544 |
| 736 | Ga0207709_10169264 | 3300025935 | Bacteria | 1532 |
| 737 | Ga0207709_10508841 | 3300025935 | Unclassified | 941 |
| 738 | Ga0207709_10546424 | 3300025935 | Bacteria | 910 |
| 739 | Ga0207670_10021843 | 3300025936 | Bacteria | 3955 |
| 740 | Ga0207670_10463714 | 3300025936 | Bacteria | 1023 |
| 741 | Ga0207669_10010671 | 3300025937 | Bacteria | 4433 |
| 742 | Ga0207669_10047530 | 3300025937 | Unclassified | 2543 |
| 743 | Ga0207669_10161491 | 3300025937 | Bacteria | 1583 |
| 744 | Ga0207669_10465285 | 3300025937 | Bacteria | 1005 |
| 745 | Ga0207669_10514661 | 3300025937 | Bacteria | 960 |
| 746 | Ga0207669_10560091 | 3300025937 | Unclassified | 924 |
| 747 | Ga0207669_10736320 | 3300025937 | Bacteria | 813 |
| 748 | Ga0207704_10141778 | 3300025938 | Bacteria | 1682 |
| 749 | Ga0207704_10145716 | 3300025938 | Unclassified | 1663 |
| 750 | Ga0207704_10237308 | 3300025938 | Bacteria | 1360 |
| 751 | Ga0207704_10368862 | 3300025938 | Bacteria | 1123 |
| 752 | Ga0207704_10719747 | 3300025938 | Bacteria | 828 |
| 753 | Ga0207665_10001197 | 3300025939 | Bacteria | 17491 |
| 754 | Ga0207665_10003608 | 3300025939 | Bacteria | 10336 |
| 755 | Ga0207665_10004650 | 3300025939 | Bacteria | 9117 |
| 756 | Ga0207665_10019549 | 3300025939 | Bacteria | 4454 |
| 757 | Ga0207665_10225892 | 3300025939 | Bacteria | 1374 |
| 758 | Ga0207691_10053718 | 3300025940 | Bacteria | 3677 |
| 759 | Ga0207691_10098174 | 3300025940 | Bacteria | 2617 |
| 760 | Ga0207691_10270938 | 3300025940 | Bacteria | 1462 |
| 761 | Ga0207691_10347061 | 3300025940 | Bacteria | 1270 |
| 762 | Ga0207711_10131993 | 3300025941 | Bacteria | 2240 |
| 763 | Ga0207711_10218500 | 3300025941 | Bacteria | 1742 |
| 764 | Ga0207711_11048103 | 3300025941 | Bacteria | 756 |
| 765 | Ga0207689_10073245 | 3300025942 | Bacteria | 2814 |
| 766 | Ga0207689_10143419 | 3300025942 | Bacteria | 1968 |
| 767 | Ga0207689_10369624 | 3300025942 | Unclassified | 1193 |
| 768 | Ga0207689_11023593 | 3300025942 | Bacteria | 697 |
| 769 | Ga0207661_10000790 | 3300025944 | Bacteria | 20655 |
| 770 | Ga0207661_10002323 | 3300025944 | Bacteria | 13105 |
| 771 | Ga0207661_10010512 | 3300025944 | Bacteria | 6665 |
| 772 | Ga0207661_10062532 | 3300025944 | Bacteria | 3012 |
| 773 | Ga0207661_10080227 | 3300025944 | Bacteria | 2692 |
| 774 | Ga0207661_10126239 | 3300025944 | Unclassified | 2185 |
| 775 | Ga0207661_10134209 | 3300025944 | Bacteria | 2124 |
| 776 | Ga0207661_10256824 | 3300025944 | Bacteria | 1555 |
| 777 | Ga0207661_10292335 | 3300025944 | Bacteria | 1458 |
| 778 | Ga0207661_10387091 | 3300025944 | Bacteria | 1266 |
| 779 | Ga0207661_10474657 | 3300025944 | Bacteria | 1141 |
| 780 | Ga0207661_10515710 | 3300025944 | Bacteria | 1093 |
| 781 | Ga0207661_10582928 | 3300025944 | Bacteria | 1026 |
| 782 | Ga0207661_10589881 | 3300025944 | Bacteria | 1020 |
| 783 | Ga0207661_10622617 | 3300025944 | Bacteria | 991 |
| 784 | Ga0207661_10757286 | 3300025944 | Bacteria | 894 |
| 785 | Ga0207679_10033703 | 3300025945 | Bacteria | 3606 |
| 786 | Ga0207679_10047393 | 3300025945 | Bacteria | 3122 |
| 787 | Ga0207679_10136827 | 3300025945 | Bacteria | 1974 |
| 788 | Ga0207679_10195475 | 3300025945 | Unclassified | 1686 |
| 789 | Ga0207679_10315647 | 3300025945 | Bacteria | 1352 |
| 790 | Ga0207679_10425553 | 3300025945 | Bacteria | 1173 |
| 791 | Ga0207679_10428305 | 3300025945 | Unclassified | 1169 |
| 792 | Ga0207679_10452852 | 3300025945 | Bacteria | 1138 |
| 793 | Ga0207679_10943350 | 3300025945 | Bacteria | 790 |
| 794 | Ga0207667_10031768 | 3300025949 | Bacteria | 5696 |
| 795 | Ga0207667_10051694 | 3300025949 | Bacteria | 4330 |
| 796 | Ga0207667_10059939 | 3300025949 | Bacteria | 3984 |
| 797 | Ga0207667_10148963 | 3300025949 | Bacteria | 2409 |
| 798 | Ga0207667_10793009 | 3300025949 | Bacteria | 944 |
| 799 | Ga0207667_10855993 | 3300025949 | Bacteria | 903 |
| 800 | Ga0207667_10974821 | 3300025949 | Bacteria | 836 |
| 801 | Ga0207651_10076785 | 3300025960 | Bacteria | 2389 |
| 802 | Ga0207651_10251970 | 3300025960 | Bacteria | 1445 |
| 803 | Ga0207651_10387205 | 3300025960 | Unclassified | 1186 |
| 804 | Ga0207651_10753009 | 3300025960 | Bacteria | 861 |
| 805 | Ga0207712_10060046 | 3300025961 | Bacteria | 2694 |
| 806 | Ga0207712_10109907 | 3300025961 | Unclassified | 2066 |
| 807 | Ga0207712_10539076 | 3300025961 | Unclassified | 1002 |
| 808 | Ga0207668_10088245 | 3300025972 | Bacteria | 2271 |
| 809 | Ga0207668_10305367 | 3300025972 | Bacteria | 1315 |
| 810 | Ga0207668_10424588 | 3300025972 | Unclassified | 1129 |
| 811 | Ga0207640_10002503 | 3300025981 | Bacteria | 9845 |
| 812 | Ga0207640_10058737 | 3300025981 | Unclassified | 2535 |
| 813 | Ga0207640_10107669 | 3300025981 | Bacteria | 1969 |
| 814 | Ga0207640_10135779 | 3300025981 | Bacteria | 1785 |
| 815 | Ga0207640_11066528 | 3300025981 | Bacteria | 713 |
| 816 | Ga0207658_10259681 | 3300025986 | Bacteria | 1480 |
| 817 | Ga0207677_10139385 | 3300026023 | Unclassified | 1854 |
| 818 | Ga0207677_10222563 | 3300026023 | Bacteria | 1514 |
| 819 | Ga0207677_10249635 | 3300026023 | Bacteria | 1440 |
| 820 | Ga0207677_10256211 | 3300026023 | Bacteria | 1424 |
| 821 | Ga0207677_10484967 | 3300026023 | Bacteria | 1066 |
| 822 | Ga0207677_10735175 | 3300026023 | Unclassified | 878 |
| 823 | Ga0207677_10860483 | 3300026023 | Bacteria | 815 |
| 824 | Ga0207703_10392749 | 3300026035 | Bacteria | 1285 |
| 825 | Ga0207639_10011780 | 3300026041 | Bacteria | 6081 |
| 826 | Ga0207639_10042818 | 3300026041 | Bacteria | 3395 |
| 827 | Ga0207639_10588827 | 3300026041 | Bacteria | 1025 |
| 828 | Ga0207678_10034649 | 3300026067 | Bacteria | 4396 |
| 829 | Ga0207678_10087157 | 3300026067 | Bacteria | 2668 |
| 830 | Ga0207678_10120775 | 3300026067 | Bacteria | 2236 |
| 831 | Ga0207678_10362464 | 3300026067 | Bacteria | 1251 |
| 832 | Ga0207678_10703067 | 3300026067 | Unclassified | 890 |
| 833 | Ga0207708_10000614 | 3300026075 | Bacteria | 27403 |
| 834 | Ga0207708_10117590 | 3300026075 | Bacteria | 2069 |
| 835 | Ga0207708_10186912 | 3300026075 | Bacteria | 1647 |
| 836 | Ga0207708_10273227 | 3300026075 | Unclassified | 1367 |
| 837 | Ga0207708_10288960 | 3300026075 | Bacteria | 1330 |
| 838 | Ga0207708_10434299 | 3300026075 | Bacteria | 1091 |
| 839 | Ga0207708_10835409 | 3300026075 | Bacteria | 794 |
| 840 | Ga0207702_10049104 | 3300026078 | Bacteria | 3560 |
| 841 | Ga0207702_10113944 | 3300026078 | Bacteria | 2409 |
| 842 | Ga0207702_10136923 | 3300026078 | Bacteria | 2211 |
| 843 | Ga0207702_10141001 | 3300026078 | Bacteria | 2181 |
| 844 | Ga0207702_10168847 | 3300026078 | Bacteria | 2004 |
| 845 | Ga0207702_10172907 | 3300026078 | Bacteria | 1983 |
| 846 | Ga0207702_10176895 | 3300026078 | Bacteria | 1961 |
| 847 | Ga0207702_10200881 | 3300026078 | Bacteria | 1848 |
| 848 | Ga0207702_10356657 | 3300026078 | Unclassified | 1401 |
| 849 | Ga0207702_10449040 | 3300026078 | Bacteria | 1251 |
| 850 | Ga0207702_10558220 | 3300026078 | Bacteria | 1121 |
| 851 | Ga0207702_11220212 | 3300026078 | Bacteria | 746 |
| 852 | Ga0207702_11229844 | 3300026078 | Bacteria | 743 |
| 853 | Ga0207641_11046919 | 3300026088 | Bacteria | 814 |
| 854 | Ga0207648_10000312 | 3300026089 | Bacteria | 53245 |
| 855 | Ga0207648_10001463 | 3300026089 | Bacteria | 25973 |
| 856 | Ga0207648_10090312 | 3300026089 | Unclassified | 2676 |
| 857 | Ga0207648_10169946 | 3300026089 | Bacteria | 1927 |
| 858 | Ga0207648_10251034 | 3300026089 | Bacteria | 1577 |
| 859 | Ga0207648_10274417 | 3300026089 | Bacteria | 1507 |
| 860 | Ga0207648_10970055 | 3300026089 | Bacteria | 795 |
| 861 | Ga0207676_10489385 | 3300026095 | Bacteria | 1166 |
| 862 | Ga0207676_10491253 | 3300026095 | Bacteria | 1164 |
| 863 | Ga0207676_11017051 | 3300026095 | Bacteria | 817 |
| 864 | Ga0207674_10001702 | 3300026116 | Bacteria | 28143 |
| 865 | Ga0207674_10009621 | 3300026116 | Bacteria | 11026 |
| 866 | Ga0207674_10045075 | 3300026116 | Bacteria | 4539 |
| 867 | Ga0207674_10083130 | 3300026116 | Bacteria | 3202 |
| 868 | Ga0207674_10485558 | 3300026116 | Bacteria | 1194 |
| 869 | Ga0207675_100000145 | 3300026118 | Bacteria | 61287 |
| 870 | Ga0207675_100067391 | 3300026118 | Unclassified | 3346 |
| 871 | Ga0207675_100091809 | 3300026118 | Bacteria | 2855 |
| 872 | Ga0207675_100370464 | 3300026118 | Bacteria | 1407 |
| 873 | Ga0207675_100573288 | 3300026118 | Bacteria | 1129 |
| 874 | Ga0207675_101352257 | 3300026118 | Bacteria | 733 |
| 875 | Ga0207683_10000131 | 3300026121 | Bacteria | 61423 |
| 876 | Ga0207683_10008825 | 3300026121 | Bacteria | 8598 |
| 877 | Ga0207683_10018166 | 3300026121 | Bacteria | 5997 |
| 878 | Ga0207683_10063557 | 3300026121 | Bacteria | 3252 |
| 879 | Ga0207683_10071347 | 3300026121 | Bacteria | 3070 |
| 880 | Ga0207683_10083688 | 3300026121 | Bacteria | 2835 |
| 881 | Ga0207683_10208009 | 3300026121 | Bacteria | 1780 |
| 882 | Ga0207683_10262658 | 3300026121 | Unclassified | 1576 |
| 883 | Ga0207683_10516608 | 3300026121 | Bacteria | 1103 |
| 884 | Ga0207683_10661132 | 3300026121 | Bacteria | 968 |
| 885 | Ga0207698_10104599 | 3300026142 | Bacteria | 2356 |
| 886 | Ga0207698_10150620 | 3300026142 | Bacteria | 2018 |
| 887 | Ga0207698_10202659 | 3300026142 | Bacteria | 1778 |
| 888 | Ga0207698_10285675 | 3300026142 | Bacteria | 1528 |
| 889 | Ga0207698_10760031 | 3300026142 | Bacteria | 969 |
| 890 | Ga0209998_10021250 | 3300027717 | Bacteria | 1393 |
| 891 | Ga0207428_10000277 | 3300027907 | Bacteria | 69011 |
| 892 | Ga0207428_10003042 | 3300027907 | Bacteria | 16505 |
| 893 | Ga0207428_10015623 | 3300027907 | Bacteria | 6561 |
| 894 | Ga0207428_10016230 | 3300027907 | Bacteria | 6413 |
| 895 | Ga0207428_10046061 | 3300027907 | Bacteria | 3509 |
| 896 | Ga0207428_10052302 | 3300027907 | Bacteria | 3263 |
| 897 | Ga0207428_10170406 | 3300027907 | Bacteria | 1649 |
| 898 | Ga0268266_10096313 | 3300028379 | Bacteria | 2601 |
| 899 | Ga0268266_10837476 | 3300028379 | Bacteria | 889 |
| 900 | Ga0268266_10982926 | 3300028379 | Bacteria | 817 |
| 901 | Ga0268265_10094612 | 3300028380 | Bacteria | 2397 |
| 902 | Ga0268265_10394073 | 3300028380 | Bacteria | 1278 |
| 903 | Ga0268265_10729565 | 3300028380 | Unclassified | 960 |
| 904 | Ga0268264_10396007 | 3300028381 | Unclassified | 1326 |
| 905 | Ga0268264_10441464 | 3300028381 | Bacteria | 1259 |
| 906 | Ga0265319_1009788 | 3300028563 | Bacteria | 4047 |
| 907 | Ga0265319_1069717 | 3300028563 | Bacteria | 1128 |
| 908 | Ga0265334_10014340 | 3300028573 | Bacteria | 3305 |
| 909 | Ga0265318_10002132 | 3300028577 | Bacteria | 10760 |
| 910 | Ga0265318_10058364 | 3300028577 | Bacteria | 1440 |
| 911 | Ga0265318_10075539 | 3300028577 | Bacteria | 1247 |
| 912 | Ga0265318_10088624 | 3300028577 | Unclassified | 1140 |
| 913 | Ga0265322_10006748 | 3300028654 | Bacteria | 3372 |
| 914 | Ga0265336_10013425 | 3300028666 | Bacteria | 2731 |
| 915 | Ga0265338_10025789 | 3300028800 | Bacteria | 5951 |
| 916 | Ga0265338_10042085 | 3300028800 | Bacteria | 4261 |
| 917 | Ga0265338_10105491 | 3300028800 | Bacteria | 2284 |
| 918 | Ga0265330_10016111 | 3300031235 | Bacteria | 3453 |
| 919 | Ga0265320_10035728 | 3300031240 | Bacteria | 2517 |
| 920 | Ga0265320_10124055 | 3300031240 | Bacteria | 1176 |
| 921 | Ga0265320_10264719 | 3300031240 | Bacteria | 762 |
| 922 | Ga0265329_10107343 | 3300031242 | Bacteria | 891 |
| 923 | Ga0265340_10010232 | 3300031247 | Bacteria | 5021 |
| 924 | Ga0265331_10063927 | 3300031250 | Bacteria | 1733 |
| 925 | Ga0265327_10017402 | 3300031251 | Bacteria | 4512 |
| 926 | Ga0265327_10102427 | 3300031251 | Bacteria | 1379 |
| 927 | Ga0265316_10026001 | 3300031344 | Bacteria | 4876 |
| 928 | Ga0265316_10121193 | 3300031344 | Bacteria | 1975 |
| 929 | Ga0307405_10022439 | 3300031731 | Bacteria | 3569 |
| 930 | Ga0307405_10096560 | 3300031731 | Bacteria | 1971 |
| 931 | Ga0307413_10017439 | 3300031824 | Bacteria | 3739 |
| 932 | Ga0307413_10042361 | 3300031824 | Bacteria | 2675 |
| 933 | Ga0307410_10003106 | 3300031852 | Bacteria | 8238 |
| 934 | Ga0307410_10065548 | 3300031852 | Bacteria | 2499 |
| 935 | Ga0307410_10120080 | 3300031852 | Unclassified | 1916 |
| 936 | Ga0307410_10448122 | 3300031852 | Bacteria | 1052 |
| 937 | Ga0307406_10335486 | 3300031901 | Bacteria | 1175 |
| 938 | Ga0307412_10179956 | 3300031911 | Bacteria | 1589 |
| 939 | Ga0307409_100038027 | 3300031995 | Bacteria | 3555 |
| 940 | Ga0307409_100043910 | 3300031995 | Bacteria | 3361 |
| 941 | Ga0307409_100079849 | 3300031995 | Bacteria | 2638 |
| 942 | Ga0307416_100007542 | 3300032002 | Bacteria | 6933 |
| 943 | Ga0307416_100125723 | 3300032002 | Bacteria | 2296 |
| 944 | Ga0307416_100193622 | 3300032002 | Bacteria | 1921 |
| 945 | Ga0307416_100257044 | 3300032002 | Bacteria | 1704 |
| 946 | Ga0307416_100430172 | 3300032002 | Bacteria | 1367 |
| 947 | Ga0307416_101161741 | 3300032002 | Bacteria | 877 |
| 948 | Ga0307411_10049403 | 3300032005 | Bacteria | 2733 |
| 949 | Ga0307415_100003724 | 3300032126 | Bacteria | 7803 |
| 950 | Ga0307415_100025473 | 3300032126 | Bacteria | 3713 |
| 951 | Ga0307415_100060978 | 3300032126 | Bacteria | 2609 |
| 952 | Ga0307415_100135990 | 3300032126 | Bacteria | 1869 |
| 953 | Ga0307415_100453623 | 3300032126 | Bacteria | 1109 |
| 954 | Ga0373948_0002994 | 3300034817 | Bacteria | 2553 |
| 955 | Ga0373948_0003999 | 3300034817 | Bacteria | 2305 |
| 956 | Ga0373950_0002235 | 3300034818 | Bacteria | 2644 |
| 957 | Ga0373958_0018519 | 3300034819 | Bacteria | 1263 |
| 958 | Ga0373938_0085997 | 3300034957 | Bacteria | 772 |
| 959 | Ga0373926_0022755 | 3300035083 | Bacteria | 2174 |
| 960 | Ga0373929_0003555 | 3300035085 | Unclassified | 2799 |
| 961 | Ga0373929_0006108 | 3300035085 | Bacteria | 2176 |
| 962 | Ga0373929_0109906 | 3300035085 | Bacteria | 704 |
| 963 | Ga0373940_0105364 | 3300035088 | Bacteria | 860 |
| 964 | Ga0373944_0031413 | 3300035089 | Bacteria | 1598 |
| 965 | Ga0373944_0097354 | 3300035089 | Bacteria | 990 |
| 966 | Ga0373951_0034431 | 3300035091 | Bacteria | 1203 |
| 967 | Ga0373952_0006183 | 3300035092 | Bacteria | 2206 |
| 968 | Ga0373932_0114838 | 3300035112 | Bacteria | 892 |
| 969 | Ga0373932_0127902 | 3300035112 | Bacteria | 853 |
| 970 | Ga0373936_0050254 | 3300035113 | Bacteria | 1686 |
| 971 | Ga0373941_0000738 | 3300035115 | Bacteria | 6703 |
| 972 | Ga0373941_0030179 | 3300035115 | Bacteria | 1605 |
| 973 | Ga0373945_0007240 | 3300035116 | Bacteria | 3591 |
| 974 | Ga0373960_0042394 | 3300035121 | Bacteria | 1321 |
| 975 | Ga0373943_0011019 | 3300035170 | Bacteria | 4061 |
| 976 | Ga0373943_0016397 | 3300035170 | Bacteria | 3378 |
| 977 | Ga0373946_0010856 | 3300035171 | Bacteria | 3384 |
| 978 | Ga0373946_0118627 | 3300035171 | Bacteria | 1206 |
| 979 | Ga0373942_0131174 | 3300035207 | Bacteria | 791 |
| 980 | Ga0373961_0014098 | 3300035241 | Bacteria | 2026 |
| 981 | Ga0373961_0035976 | 3300035241 | Bacteria | 1408 |
| 982 | Ga0373962_0025642 | 3300035242 | Bacteria | 1584 |
| 983 | Ga0373962_0030669 | 3300035242 | Unclassified | 1472 |
| 984 | Ga0373962_0034255 | 3300035242 | Bacteria | 1406 |
| 985 | Ga0373931_0025482 | 3300035691 | Bacteria | 3004 |
| 986 | Ga0373931_0083054 | 3300035691 | Bacteria | 1772 |
| 987 | Ga0373931_0091899 | 3300035691 | Bacteria | 1692 |
| 988 | Ga0373931_0178122 | 3300035691 | Unclassified | 1257 |
| 989 | Ga0373935_0021692 | 3300035692 | Bacteria | 3934 |
| 990 | Ga0373927_0193103 | 3300035695 | Bacteria | 1336 |
| 991 | Ga0373947_0003251 | 3300035725 | Bacteria | 9637 |
| 992 | Ga0373947_0110467 | 3300035725 | Bacteria | 1737 |
| 993 | Ga0373925_0073113 | 3300037068 | Bacteria | 2594 |
| 994 | Ga0373925_0318981 | 3300037068 | Bacteria | 1257 |
| 995 | Ga0395899_0001597 | 3300037312 | Bacteria | 19014 |
| 996 | Ga0395899_0004865 | 3300037312 | Bacteria | 10465 |
| 997 | Ga0395899_0006659 | 3300037312 | Bacteria | 8952 |
| 998 | Ga0395899_0010608 | 3300037312 | Bacteria | 7059 |
| 999 | Ga0395899_0012780 | 3300037312 | Bacteria | 6432 |
| 1000 | Ga0395899_0031640 | 3300037312 | Bacteria | 3976 |
| 1001 | Ga0395899_0064530 | 3300037312 | Unclassified | 2692 |
| 1002 | Ga0395899_0113196 | 3300037312 | Unclassified | 1949 |
| 1003 | Ga0395899_0116539 | 3300037312 | Bacteria | 1916 |
| 1004 | Ga0395899_0119712 | 3300037312 | Bacteria | 1887 |
| 1005 | Ga0395899_0185662 | 3300037312 | Bacteria | 1457 |
| 1006 | Ga0395899_0234610 | 3300037312 | Bacteria | 1265 |
| 1007 | Ga0395899_0239253 | 3300037312 | Unclassified | 1250 |
| 1008 | Ga0395899_0534542 | 3300037312 | Bacteria | 756 |
| 1009 | Ga0395900_0002601 | 3300037418 | Bacteria | 19721 |
| 1010 | Ga0395900_0013793 | 3300037418 | Bacteria | 8247 |
| 1011 | Ga0395900_0014254 | 3300037418 | Bacteria | 8113 |
| 1012 | Ga0395900_0015528 | 3300037418 | Bacteria | 7762 |
| 1013 | Ga0395900_0017007 | 3300037418 | Bacteria | 7423 |
| 1014 | Ga0395900_0021897 | 3300037418 | Bacteria | 6535 |
| 1015 | Ga0395900_0023214 | 3300037418 | Bacteria | 6350 |
| 1016 | Ga0395900_0025909 | 3300037418 | Bacteria | 6003 |
| 1017 | Ga0395900_0036962 | 3300037418 | Bacteria | 5034 |
| 1018 | Ga0395900_0049987 | 3300037418 | Bacteria | 4307 |
| 1019 | Ga0395900_0055427 | 3300037418 | Bacteria | 4082 |
| 1020 | Ga0395900_0169896 | 3300037418 | Bacteria | 2220 |
| 1021 | Ga0395900_0188801 | 3300037418 | Bacteria | 2091 |
| 1022 | Ga0395900_0223963 | 3300037418 | Bacteria | 1894 |
| 1023 | Ga0395900_0326756 | 3300037418 | Unclassified | 1512 |
| 1024 | Ga0395900_0328497 | 3300037418 | Bacteria | 1508 |
| 1025 | Ga0395900_0403969 | 3300037418 | Bacteria | 1329 |
| 1026 | Ga0395900_0437265 | 3300037418 | Bacteria | 1266 |
| 1027 | Ga0395900_0701738 | 3300037418 | Bacteria | 945 |
| 1028 | Ga0395900_0727907 | 3300037418 | Bacteria | 924 |
| 1029 | Ga0395900_0920236 | 3300037418 | Bacteria | 797 |
| 1030 | Ga0395900_0925239 | 3300037418 | Bacteria | 794 |
| 1031 | Ga0395900_1012203 | 3300037418 | Bacteria | 750 |
| 1032 | Ga0395898_0008599 | 3300037466 | Bacteria | 10774 |
| 1033 | Ga0395898_0008603 | 3300037466 | Bacteria | 10771 |
| 1034 | Ga0395898_0009669 | 3300037466 | Bacteria | 10114 |
| 1035 | Ga0395898_0014477 | 3300037466 | Bacteria | 8102 |
| 1036 | Ga0395898_0015180 | 3300037466 | Bacteria | 7906 |
| 1037 | Ga0395898_0017216 | 3300037466 | Bacteria | 7381 |
| 1038 | Ga0395898_0022219 | 3300037466 | Bacteria | 6429 |
| 1039 | Ga0395898_0022984 | 3300037466 | Bacteria | 6305 |
| 1040 | Ga0395898_0028266 | 3300037466 | Bacteria | 5623 |
| 1041 | Ga0395898_0035010 | 3300037466 | Bacteria | 4997 |
| 1042 | Ga0395898_0035086 | 3300037466 | Bacteria | 4992 |
| 1043 | Ga0395898_0082324 | 3300037466 | Bacteria | 3102 |
| 1044 | Ga0395898_0101409 | 3300037466 | Bacteria | 2764 |
| 1045 | Ga0395898_0108532 | 3300037466 | Bacteria | 2661 |
| 1046 | Ga0395898_0116631 | 3300037466 | Bacteria | 2558 |
| 1047 | Ga0395898_0117823 | 3300037466 | Bacteria | 2544 |
| 1048 | Ga0395898_0187822 | 3300037466 | Unclassified | 1975 |
| 1049 | Ga0395898_0277925 | 3300037466 | Bacteria | 1597 |
| 1050 | Ga0395898_0307706 | 3300037466 | Bacteria | 1511 |
| 1051 | Ga0395898_0373145 | 3300037466 | Bacteria | 1360 |
| 1052 | Ga0395898_0554985 | 3300037466 | Bacteria | 1091 |
| 1053 | Ga0395898_0808458 | 3300037466 | Unclassified | 878 |
| 1054 | Ga0395898_0901512 | 3300037466 | Bacteria | 822 |
| 1055 | Ga0395898_1039076 | 3300037466 | Bacteria | 754 |
| 1056 | Ga0395905_0006666 | 3300037471 | Bacteria | 11576 |
| 1057 | Ga0395905_0009373 | 3300037471 | Bacteria | 9573 |
| 1058 | Ga0395905_0010981 | 3300037471 | Bacteria | 8763 |
| 1059 | Ga0395905_0011539 | 3300037471 | Bacteria | 8538 |
| 1060 | Ga0395905_0012738 | 3300037471 | Bacteria | 8088 |
| 1061 | Ga0395905_0017490 | 3300037471 | Bacteria | 6806 |
| 1062 | Ga0395905_0021210 | 3300037471 | Bacteria | 6148 |
| 1063 | Ga0395905_0024795 | 3300037471 | Bacteria | 5660 |
| 1064 | Ga0395905_0025332 | 3300037471 | Bacteria | 5593 |
| 1065 | Ga0395905_0052542 | 3300037471 | Bacteria | 3814 |
| 1066 | Ga0395905_0082243 | 3300037471 | Bacteria | 3018 |
| 1067 | Ga0395905_0097169 | 3300037471 | Bacteria | 2765 |
| 1068 | Ga0395905_0113712 | 3300037471 | Bacteria | 2543 |
| 1069 | Ga0395905_0128699 | 3300037471 | Bacteria | 2381 |
| 1070 | Ga0395905_0179346 | 3300037471 | Bacteria | 1988 |
| 1071 | Ga0395905_0236528 | 3300037471 | Bacteria | 1707 |
| 1072 | Ga0395905_0876765 | 3300037471 | Bacteria | 800 |
| 1073 | Ga0436364_0798656 | 3300037853 | Bacteria | 837 |
| 1074 | Ga0395901_0001828 | 3300038443 | Bacteria | 21979 |
| 1075 | Ga0395901_0007754 | 3300038443 | Bacteria | 10829 |
| 1076 | Ga0395901_0015104 | 3300038443 | Bacteria | 7852 |
| 1077 | Ga0395901_0015900 | 3300038443 | Bacteria | 7668 |
| 1078 | Ga0395901_0016564 | 3300038443 | Bacteria | 7510 |
| 1079 | Ga0395901_0020681 | 3300038443 | Bacteria | 6736 |
| 1080 | Ga0395901_0029551 | 3300038443 | Bacteria | 5644 |
| 1081 | Ga0395901_0029557 | 3300038443 | Bacteria | 5642 |
| 1082 | Ga0395901_0029940 | 3300038443 | Bacteria | 5607 |
| 1083 | Ga0395901_0031474 | 3300038443 | Bacteria | 5471 |
| 1084 | Ga0395901_0039987 | 3300038443 | Bacteria | 4854 |
| 1085 | Ga0395901_0050763 | 3300038443 | Bacteria | 4308 |
| 1086 | Ga0395901_0052227 | 3300038443 | Bacteria | 4248 |
| 1087 | Ga0395901_0092550 | 3300038443 | Bacteria | 3165 |
| 1088 | Ga0395901_0102978 | 3300038443 | Bacteria | 2995 |
| 1089 | Ga0395901_0123668 | 3300038443 | Bacteria | 2718 |
| 1090 | Ga0395901_0156882 | 3300038443 | Bacteria | 2390 |
| 1091 | Ga0395901_0165747 | 3300038443 | Bacteria | 2320 |
| 1092 | Ga0395901_0177683 | 3300038443 | Bacteria | 2232 |
| 1093 | Ga0395901_0193638 | 3300038443 | Bacteria | 2132 |
| 1094 | Ga0395901_0197075 | 3300038443 | Bacteria | 2111 |
| 1095 | Ga0395901_0245864 | 3300038443 | Bacteria | 1865 |
| 1096 | Ga0395901_0287129 | 3300038443 | Bacteria | 1708 |
| 1097 | Ga0395901_0313560 | 3300038443 | Bacteria | 1624 |
| 1098 | Ga0395901_0343625 | 3300038443 | Unclassified | 1541 |
| 1099 | Ga0395901_0387942 | 3300038443 | Bacteria | 1436 |
| 1100 | Ga0395901_0536901 | 3300038443 | Bacteria | 1186 |
| 1101 | Ga0395901_0589275 | 3300038443 | Unclassified | 1122 |
| 1102 | Ga0395901_0789655 | 3300038443 | Bacteria | 939 |
| 1103 | Ga0395901_0980519 | 3300038443 | Bacteria | 822 |
| 1104 | Ga0395901_1244264 | 3300038443 | Bacteria | 708 |
| 1105 | Ga0242420_030463 | 3300038996 | Bacteria | 999 |
| 1106 | Ga0436360_0455670 | 3300039438 | Bacteria | 1921 |
| 1107 | Ga0436360_0941596 | 3300039438 | Bacteria | 3206 |
| 1108 | Ga0436363_1425632 | 3300039450 | Bacteria | 724 |
| 1109 | Ga0436362_1086374 | 3300039453 | Bacteria | 1600 |
| 1110 | Ga0439439_0011931 | 3300041406 | Bacteria | 2096 |
| 1111 | Ga0439453_0018093 | 3300041408 | Bacteria | 1243 |
| 1112 | Ga0439461_0001443 | 3300041410 | Bacteria | 3671 |
| 1113 | Ga0439465_0162439 | 3300041413 | Bacteria | 802 |
| 1114 | Ga0451793_0279402 | 3300041452 | Bacteria | 1466 |
| 1115 | Ga0451802_0009325 | 3300041460 | Bacteria | 1055 |
| 1116 | Ga0451804_0779885 | 3300041463 | Bacteria | 870 |
| 1117 | Ga0451839_1336994 | 3300041496 | Bacteria | 1389 |
| 1118 | Ga0451849_0973077 | 3300041505 | Bacteria | 1339 |
| 1119 | Ga0451855_1287824 | 3300041511 | Bacteria | 1651 |
| 1120 | Ga0451853_2093963 | 3300041512 | Bacteria | 3465 |
| 1121 | Ga0451853_2918064 | 3300041512 | Bacteria | 1191 |
| 1122 | Ga0439433_0007045 | 3300041999 | Bacteria | 2428 |
| 1123 | Ga0439437_031420 | 3300042000 | Bacteria | 668 |
| 1124 | Ga0439448_0001810 | 3300042005 | Bacteria | 5656 |
| 1125 | Ga0439448_0077631 | 3300042005 | Bacteria | 1112 |
| 1126 | Ga0439451_010716 | 3300042009 | Bacteria | 1848 |
| 1127 | Ga0439454_004042 | 3300042011 | Bacteria | 1667 |
| 1128 | Ga0450920_052728 | 3300042122 | Unclassified | 817 |
| 1129 | Ga0450891_006178 | 3300042129 | Bacteria | 1104 |
| 1130 | Ga0450905_038503 | 3300042142 | Unclassified | 755 |
| 1131 | Ga0439446_0001808 | 3300042156 | Bacteria | 4994 |
| 1132 | Ga0439446_0002871 | 3300042156 | Bacteria | 4202 |
| 1133 | Ga0439446_0056712 | 3300042156 | Bacteria | 1177 |
| 1134 | Ga0450908_050710 | 3300042184 | Bacteria | 722 |
| 1135 | Ga0439434_0007259 | 3300042435 | Bacteria | 3248 |
| 1136 | Ga0439444_0092217 | 3300042437 | Bacteria | 677 |
| 1137 | Ga0439460_0083971 | 3300042461 | Bacteria | 1003 |
| 1138 | Ga0466965_0235906 | 3300044683 | Bacteria | 978 |
| 1139 | Ga0466966_0001277 | 3300044684 | Bacteria | 16126 |
| 1140 | Ga0466966_0277525 | 3300044684 | Bacteria | 1008 |
| 1141 | Ga0466966_0307505 | 3300044684 | Bacteria | 953 |
| 1142 | Ga0466966_0578242 | 3300044684 | Bacteria | 676 |
| 1143 | Ga0466966_0667269 | 3300044684 | Bacteria | 626 |
| 1144 | Ga0466961_0008611 | 3300044693 | Bacteria | 6502 |
| 1145 | Ga0466963_0001603 | 3300044694 | Bacteria | 12306 |
| 1146 | Ga0466963_0001938 | 3300044694 | Bacteria | 11341 |
| 1147 | Ga0466963_0018318 | 3300044694 | Bacteria | 4375 |
| 1148 | Ga0466963_0046134 | 3300044694 | Bacteria | 2872 |
| 1149 | Ga0466963_0061997 | 3300044694 | Bacteria | 2501 |
| 1150 | Ga0466963_0083021 | 3300044694 | Bacteria | 2173 |
| 1151 | Ga0466963_0089639 | 3300044694 | Bacteria | 2093 |
| 1152 | Ga0466963_0806581 | 3300044694 | Unclassified | 662 |
| 1153 | Ga0466964_0002529 | 3300044706 | Bacteria | 6506 |
| 1154 | Ga0466964_0224237 | 3300044706 | Bacteria | 914 |
| 1155 | Ga0466964_0305614 | 3300044706 | Bacteria | 803 |
| 1156 | Ga0466971_0087360 | 3300044719 | Bacteria | 1426 |
| 1157 | Ga0466971_0162507 | 3300044719 | Bacteria | 1046 |
| 1158 | Ga0466971_0269620 | 3300044719 | Bacteria | 813 |
| 1159 | Ga0466970_0057977 | 3300044765 | Bacteria | 2072 |
| 1160 | Ga0466970_0272427 | 3300044765 | Bacteria | 951 |
| 1161 | Ga0466957_0176811 | 3300044842 | Bacteria | 1392 |
| 1162 | Ga0466957_0232777 | 3300044842 | Unclassified | 1220 |
| 1163 | Ga0466957_0262708 | 3300044842 | Bacteria | 1151 |
| 1164 | Ga0466957_0467596 | 3300044842 | Bacteria | 871 |
| 1165 | Ga0466960_0003260 | 3300044901 | Bacteria | 6220 |
| 1166 | Ga0466960_0041567 | 3300044901 | Bacteria | 2179 |
| 1167 | Ga0466959_0002422 | 3300045049 | Bacteria | 11918 |
| 1168 | Ga0466959_0172868 | 3300045049 | Unclassified | 1515 |
| 1169 | Ga0466959_0200469 | 3300045049 | Bacteria | 1390 |
| 1170 | Ga0451576_0045359 | 3300045051 | Bacteria | 4630 |
| 1171 | Ga0451576_0348782 | 3300045051 | Bacteria | 1550 |
| 1172 | Ga0451576_0993554 | 3300045051 | Bacteria | 880 |
| 1173 | Ga0466958_0027732 | 3300045836 | Bacteria | 3352 |
| 1174 | Ga0466958_0113677 | 3300045836 | Bacteria | 1691 |
| 1175 | Ga0466958_0186463 | 3300045836 | Bacteria | 1317 |
| 1176 | Ga0466958_0247595 | 3300045836 | Bacteria | 1139 |
| 1177 | Ga0466958_0375470 | 3300045836 | Bacteria | 916 |
| 1178 | Ga0466967_0012902 | 3300045976 | Bacteria | 6424 |
| 1179 | Ga0466967_0014875 | 3300045976 | Bacteria | 6082 |
| 1180 | Ga0466967_0035200 | 3300045976 | Bacteria | 4259 |
| 1181 | Ga0466967_0055408 | 3300045976 | Bacteria | 3492 |
| 1182 | Ga0466967_0068715 | 3300045976 | Bacteria | 3164 |
| 1183 | Ga0466967_0086179 | 3300045976 | Bacteria | 2845 |
| 1184 | Ga0466967_0181845 | 3300045976 | Bacteria | 1984 |
| 1185 | Ga0466967_0273746 | 3300045976 | Bacteria | 1618 |
| 1186 | Ga0466967_0326494 | 3300045976 | Bacteria | 1481 |
| 1187 | Ga0466967_0406749 | 3300045976 | Bacteria | 1325 |
| 1188 | Ga0466967_0542910 | 3300045976 | Bacteria | 1144 |
| 1189 | Ga0466967_0849072 | 3300045976 | Bacteria | 907 |
| 1190 | Ga0495592_0125591 | 3300046454 | Bacteria | 1801 |
| 1191 | Ga0495603_0008218 | 3300046455 | Bacteria | 6308 |
| 1192 | Ga0495603_0034621 | 3300046455 | Bacteria | 3036 |
| 1193 | Ga0495603_0050587 | 3300046455 | Bacteria | 2471 |
| 1194 | Ga0495603_0212842 | 3300046455 | Bacteria | 1116 |
| 1195 | Ga0495603_0257356 | 3300046455 | Bacteria | 1005 |
| 1196 | Ga0495603_0324667 | 3300046455 | Bacteria | 883 |
| 1197 | Ga0495590_0034053 | 3300046457 | Bacteria | 1780 |
| 1198 | Ga0495629_0003431 | 3300046459 | Bacteria | 11988 |
| 1199 | Ga0495641_0001116 | 3300046461 | Bacteria | 23103 |
| 1200 | Ga0495641_0011924 | 3300046461 | Bacteria | 4904 |
| 1201 | Ga0495641_0075490 | 3300046461 | Bacteria | 1511 |
| 1202 | Ga0495651_0015831 | 3300046462 | Bacteria | 5838 |
| 1203 | Ga0495651_0436996 | 3300046462 | Bacteria | 848 |
| 1204 | Ga0495653_0107260 | 3300046463 | Bacteria | 2013 |
| 1205 | Ga0495653_0240662 | 3300046463 | Bacteria | 1206 |
| 1206 | Ga0495582_0002163 | 3300046473 | Bacteria | 10995 |
| 1207 | Ga0495582_0011173 | 3300046473 | Bacteria | 4946 |
| 1208 | Ga0495582_0025169 | 3300046473 | Bacteria | 3260 |
| 1209 | Ga0495639_0144645 | 3300046475 | Bacteria | 1144 |
| 1210 | Ga0495662_0063073 | 3300046476 | Bacteria | 1790 |
| 1211 | Ga0495662_0129556 | 3300046476 | Bacteria | 1240 |
| 1212 | Ga0495664_0314491 | 3300046477 | Bacteria | 945 |
| 1213 | Ga0495664_0327681 | 3300046477 | Bacteria | 923 |
| 1214 | Ga0495664_0385036 | 3300046477 | Unclassified | 843 |
| 1215 | Ga0495584_0113814 | 3300046491 | Unclassified | 1369 |
| 1216 | Ga0495584_0372026 | 3300046491 | Bacteria | 726 |
| 1217 | Ga0495594_0160612 | 3300046499 | Bacteria | 1277 |
| 1218 | Ga0495594_0301148 | 3300046499 | Bacteria | 913 |
| 1219 | Ga0495594_0471636 | 3300046499 | Bacteria | 713 |
| 1220 | Ga0495607_0102083 | 3300046501 | Bacteria | 1535 |
| 1221 | Ga0495607_0121295 | 3300046501 | Bacteria | 1372 |
| 1222 | Ga0495608_0060821 | 3300046511 | Bacteria | 2485 |
| 1223 | Ga0495618_0013314 | 3300046514 | Bacteria | 5006 |
| 1224 | Ga0495618_0018859 | 3300046514 | Bacteria | 4239 |
| 1225 | Ga0495618_0093653 | 3300046514 | Bacteria | 1921 |
| 1226 | Ga0495630_0027956 | 3300046517 | Bacteria | 4190 |
| 1227 | Ga0495630_0035932 | 3300046517 | Bacteria | 3703 |
| 1228 | Ga0495630_0444015 | 3300046517 | Bacteria | 994 |
| 1229 | Ga0495631_0045346 | 3300046518 | Bacteria | 1936 |
| 1230 | Ga0495637_0096068 | 3300046520 | Bacteria | 1163 |
| 1231 | Ga0495663_0083334 | 3300046525 | Unclassified | 1033 |
| 1232 | Ga0495663_0100265 | 3300046525 | Bacteria | 953 |
| 1233 | Ga0495652_0033634 | 3300046529 | Bacteria | 4473 |
| 1234 | Ga0495665_0005134 | 3300046531 | Bacteria | 7061 |
| 1235 | Ga0495640_0158942 | 3300046533 | Bacteria | 1449 |
| 1236 | Ga0495586_0078031 | 3300046535 | Bacteria | 1817 |
| 1237 | Ga0495586_0084763 | 3300046535 | Bacteria | 1745 |
| 1238 | Ga0495586_0113467 | 3300046535 | Bacteria | 1509 |
| 1239 | Ga0495587_0190816 | 3300046536 | Bacteria | 1160 |
| 1240 | Ga0495609_0146770 | 3300046538 | Bacteria | 1005 |
| 1241 | Ga0495622_0146107 | 3300046557 | Bacteria | 1072 |
| 1242 | Ga0495667_0024594 | 3300046559 | Bacteria | 4056 |
| 1243 | Ga0495667_0039070 | 3300046559 | Bacteria | 3158 |
| 1244 | Ga0495667_0371151 | 3300046559 | Bacteria | 903 |
| 1245 | Ga0495656_0131191 | 3300046615 | Bacteria | 1193 |
| 1246 | Ga0495634_0066923 | 3300046642 | Bacteria | 2377 |
| 1247 | Ga0495634_0335258 | 3300046642 | Bacteria | 908 |
| 1248 | Ga0495611_0264637 | 3300046648 | Bacteria | 796 |
| 1249 | Ga0495635_0145509 | 3300046663 | Bacteria | 1613 |
| 1250 | Ga0495588_0001802 | 3300046674 | Bacteria | 9126 |
| 1251 | Ga0495588_0021834 | 3300046674 | Bacteria | 3158 |
| 1252 | Ga0495588_0266398 | 3300046674 | Bacteria | 903 |
| 1253 | Ga0495657_0143291 | 3300046675 | Bacteria | 1488 |
| 1254 | Ga0495599_0199456 | 3300046678 | Bacteria | 1229 |
| 1255 | Ga0495623_0074218 | 3300046679 | Bacteria | 2114 |
| 1256 | Ga0495623_0260373 | 3300046679 | Bacteria | 972 |
| 1257 | Ga0495623_0593797 | 3300046679 | Bacteria | 576 |
| 1258 | Ga0495647_0027751 | 3300046681 | Bacteria | 2082 |
| 1259 | Ga0495647_0130544 | 3300046681 | Unclassified | 1064 |
| 1260 | Ga0495658_0000869 | 3300046683 | Bacteria | 16226 |
| 1261 | Ga0495658_0083975 | 3300046683 | Unclassified | 1874 |
| 1262 | Ga0495613_0012084 | 3300046689 | Bacteria | 6417 |
| 1263 | Ga0495613_0474248 | 3300046689 | Bacteria | 845 |
| 1264 | Ga0495624_0093619 | 3300046690 | Bacteria | 1852 |
| 1265 | Ga0495624_0458179 | 3300046690 | Bacteria | 764 |
| 1266 | Ga0495670_0069760 | 3300046691 | Bacteria | 1778 |
| 1267 | Ga0495671_0253716 | 3300046692 | Unclassified | 849 |
| 1268 | Ga0495589_0026497 | 3300046794 | Bacteria | 2937 |
| 1269 | Ga0495589_0042655 | 3300046794 | Bacteria | 2260 |
| 1270 | Ga0495589_0104257 | 3300046794 | Bacteria | 1371 |
| 1271 | Ga0495589_0140290 | 3300046794 | Unclassified | 1158 |
| 1272 | Ga0495589_0211949 | 3300046794 | Bacteria | 912 |
| 1273 | Ga0495600_0089247 | 3300046809 | Bacteria | 2011 |
| 1274 | Ga0495600_0318694 | 3300046809 | Bacteria | 978 |
| 1275 | Ga0495581_0000725 | 3300047315 | Bacteria | 17430 |
| 1276 | Ga0495581_0022828 | 3300047315 | Bacteria | 3624 |
| 1277 | Ga0495581_0198034 | 3300047315 | Bacteria | 1175 |
| 1278 | Ga0495604_0047972 | 3300047317 | Bacteria | 3324 |
| 1279 | Ga0495636_0034004 | 3300047318 | Bacteria | 2097 |
| 1280 | Ga0495674_0035968 | 3300047319 | Bacteria | 4462 |
| 1281 | Ga0495674_0860101 | 3300047319 | Bacteria | 702 |
| 1282 | Ga0495676_0001839 | 3300047321 | Bacteria | 18619 |
| 1283 | Ga0495676_0010892 | 3300047321 | Bacteria | 8221 |
| 1284 | Ga0495680_0005085 | 3300047322 | Bacteria | 12411 |
| 1285 | Ga0495680_0017152 | 3300047322 | Bacteria | 6194 |
| 1286 | Ga0495680_0121310 | 3300047322 | Bacteria | 1930 |
| 1287 | Ga0495680_0240475 | 3300047322 | Bacteria | 1286 |
| 1288 | Ga0495675_0182616 | 3300047444 | Bacteria | 1284 |
| 1289 | Ga0495677_0029114 | 3300047445 | Bacteria | 2008 |
| 1290 | Ga0495679_029615 | 3300047446 | Bacteria | 1785 |
| 1291 | Ga0495685_018718 | 3300047447 | Bacteria | 2378 |
| 1292 | Ga0495685_029609 | 3300047447 | Bacteria | 1883 |
| 1293 | Ga0495681_0134266 | 3300047470 | Bacteria | 1051 |
| 1294 | Ga0495684_0045200 | 3300047471 | Bacteria | 3370 |
| 1295 | Ga0495684_0181765 | 3300047471 | Bacteria | 1558 |
| 1296 | Ga0495684_0306496 | 3300047471 | Bacteria | 1139 |
| 1297 | Ga0495614_0012297 | 3300048089 | Bacteria | 3760 |
| 1298 | Ga0495615_0014389 | 3300048090 | Unclassified | 1672 |
| 1299 | Ga0495626_0221301 | 3300048091 | Bacteria | 769 |
| 1300 | Ga0496100_0006894 | 3300048903 | Bacteria | 6221 |
| 1301 | Ga0496100_0046873 | 3300048903 | Unclassified | 2782 |
| 1302 | Ga0496100_0053297 | 3300048903 | Bacteria | 2634 |
| 1303 | Ga0496100_0065946 | 3300048903 | Bacteria | 2401 |
| 1304 | Ga0496100_0073416 | 3300048903 | Bacteria | 2289 |
| 1305 | Ga0496100_0219766 | 3300048903 | Bacteria | 1394 |
| 1306 | Ga0496100_0526863 | 3300048903 | Bacteria | 912 |
| 1307 | Ga0496101_0000922 | 3300048904 | Bacteria | 17347 |
| 1308 | Ga0496101_0016691 | 3300048904 | Bacteria | 4968 |
| 1309 | Ga0496101_0046354 | 3300048904 | Bacteria | 3117 |
| 1310 | Ga0496101_0048429 | 3300048904 | Unclassified | 3054 |
| 1311 | Ga0496101_0087918 | 3300048904 | Bacteria | 2307 |
| 1312 | Ga0496101_0252667 | 3300048904 | Bacteria | 1374 |
| 1313 | Ga0496101_0334874 | 3300048904 | Unclassified | 1188 |
| 1314 | Ga0496101_0490533 | 3300048904 | Bacteria | 970 |
| 1315 | Ga0496101_0516917 | 3300048904 | Bacteria | 943 |
| 1316 | Ga0496101_0651947 | 3300048904 | Bacteria | 832 |
| 1317 | Ga0496102_0005265 | 3300048905 | Bacteria | 10984 |
| 1318 | Ga0496102_0086658 | 3300048905 | Bacteria | 2893 |
| 1319 | Ga0496102_0094217 | 3300048905 | Bacteria | 2774 |
| 1320 | Ga0496102_0100824 | 3300048905 | Bacteria | 2682 |
| 1321 | Ga0496102_0162426 | 3300048905 | Unclassified | 2101 |
| 1322 | Ga0496102_0215730 | 3300048905 | Bacteria | 1809 |
| 1323 | Ga0496102_0225622 | 3300048905 | Bacteria | 1766 |
| 1324 | Ga0496102_0286538 | 3300048905 | Bacteria | 1552 |
| 1325 | Ga0496102_0452355 | 3300048905 | Unclassified | 1205 |
| 1326 | Ga0496102_1236961 | 3300048905 | Bacteria | 666 |
| 1327 | Ga0496102_1782847 | 3300048905 | Bacteria | 533 |
| 1328 | Ga0496103_0003386 | 3300048906 | Bacteria | 9742 |
| 1329 | Ga0496103_0024680 | 3300048906 | Bacteria | 3628 |
| 1330 | Ga0496103_0081180 | 3300048906 | Bacteria | 2040 |
| 1331 | Ga0496103_0229331 | 3300048906 | Bacteria | 1194 |
| 1332 | Ga0496103_0310807 | 3300048906 | Bacteria | 1014 |
| 1333 | Ga0496104_0001145 | 3300048907 | Bacteria | 22699 |
| 1334 | Ga0496104_0001945 | 3300048907 | Bacteria | 17916 |
| 1335 | Ga0496104_0002282 | 3300048907 | Bacteria | 16539 |
| 1336 | Ga0496104_0006111 | 3300048907 | Bacteria | 10572 |
| 1337 | Ga0496104_0006953 | 3300048907 | Bacteria | 9976 |
| 1338 | Ga0496104_0008356 | 3300048907 | Bacteria | 9200 |
| 1339 | Ga0496104_0044622 | 3300048907 | Bacteria | 4165 |
| 1340 | Ga0496104_0117647 | 3300048907 | Bacteria | 2551 |
| 1341 | Ga0496104_0192423 | 3300048907 | Unclassified | 1952 |
| 1342 | Ga0496104_0206431 | 3300048907 | Bacteria | 1876 |
| 1343 | Ga0496104_0315864 | 3300048907 | Unclassified | 1475 |
| 1344 | Ga0496104_0335516 | 3300048907 | Bacteria | 1425 |
| 1345 | Ga0496104_0703670 | 3300048907 | Bacteria | 918 |
| 1346 | Ga0496104_1019815 | 3300048907 | Unclassified | 731 |
| 1347 | Ga0496104_1171632 | 3300048907 | Bacteria | 672 |
| 1348 | Ga0496105_0000506 | 3300048908 | Bacteria | 25663 |
| 1349 | Ga0496105_0001550 | 3300048908 | Bacteria | 16270 |
| 1350 | Ga0496105_0001566 | 3300048908 | Bacteria | 16199 |
| 1351 | Ga0496105_0003302 | 3300048908 | Bacteria | 11916 |
| 1352 | Ga0496105_0019706 | 3300048908 | Bacteria | 5442 |
| 1353 | Ga0496105_0052586 | 3300048908 | Bacteria | 3364 |
| 1354 | Ga0496105_0101079 | 3300048908 | Unclassified | 2381 |
| 1355 | Ga0496105_0102421 | 3300048908 | Bacteria | 2364 |
| 1356 | Ga0496105_0104884 | 3300048908 | Bacteria | 2334 |
| 1357 | Ga0496105_0109128 | 3300048908 | Unclassified | 2285 |
| 1358 | Ga0496105_0178655 | 3300048908 | Bacteria | 1738 |
| 1359 | Ga0496106_0175988 | 3300048909 | Bacteria | 1697 |
| 1360 | Ga0496106_0190476 | 3300048909 | Bacteria | 1630 |
| 1361 | Ga0496106_0253839 | 3300048909 | Bacteria | 1406 |
| 1362 | Ga0496106_0267711 | 3300048909 | Bacteria | 1368 |
| 1363 | Ga0496106_0298906 | 3300048909 | Unclassified | 1291 |
| 1364 | Ga0496106_0404416 | 3300048909 | Bacteria | 1097 |
| 1365 | Ga0496106_0548001 | 3300048909 | Unclassified | 928 |
| 1366 | Ga0496106_0710338 | 3300048909 | Bacteria | 801 |
| 1367 | Ga0496106_0935719 | 3300048909 | Bacteria | 683 |
| 1368 | Ga0496107_0004638 | 3300048910 | Bacteria | 9320 |
| 1369 | Ga0496107_0086376 | 3300048910 | Bacteria | 2290 |
| 1370 | Ga0496107_0103675 | 3300048910 | Bacteria | 2087 |
| 1371 | Ga0496107_0143726 | 3300048910 | Bacteria | 1763 |
| 1372 | Ga0496107_0184527 | 3300048910 | Bacteria | 1549 |
| 1373 | Ga0496107_0312634 | 3300048910 | Bacteria | 1169 |
| 1374 | Ga0496107_0328186 | 3300048910 | Bacteria | 1138 |
| 1375 | Ga0496107_0363389 | 3300048910 | Unclassified | 1077 |
| 1376 | Ga0496107_0420634 | 3300048910 | Bacteria | 993 |
| 1377 | Ga0496108_0001074 | 3300048911 | Bacteria | 21337 |
| 1378 | Ga0496108_0003450 | 3300048911 | Bacteria | 12680 |
| 1379 | Ga0496108_0027472 | 3300048911 | Bacteria | 4700 |
| 1380 | Ga0496108_0043118 | 3300048911 | Bacteria | 3768 |
| 1381 | Ga0496108_0064688 | 3300048911 | Bacteria | 3081 |
| 1382 | Ga0496108_0082631 | 3300048911 | Bacteria | 2724 |
| 1383 | Ga0496108_0106782 | 3300048911 | Bacteria | 2391 |
| 1384 | Ga0496108_0116435 | 3300048911 | Bacteria | 2289 |
| 1385 | Ga0496108_0250468 | 3300048911 | Bacteria | 1541 |
| 1386 | Ga0496108_0320304 | 3300048911 | Bacteria | 1352 |
| 1387 | Ga0496108_0345692 | 3300048911 | Bacteria | 1298 |
| 1388 | Ga0496108_0453817 | 3300048911 | Bacteria | 1120 |
| 1389 | Ga0496108_0637941 | 3300048911 | Unclassified | 926 |
| 1390 | Ga0496108_0673775 | 3300048911 | Bacteria | 898 |
| 1391 | Ga0496109_0001117 | 3300048912 | Bacteria | 22290 |
| 1392 | Ga0496109_0001504 | 3300048912 | Bacteria | 19386 |
| 1393 | Ga0496109_0003836 | 3300048912 | Bacteria | 12557 |
| 1394 | Ga0496109_0004315 | 3300048912 | Bacteria | 11874 |
| 1395 | Ga0496109_0005084 | 3300048912 | Bacteria | 10989 |
| 1396 | Ga0496109_0005974 | 3300048912 | Bacteria | 10224 |
| 1397 | Ga0496109_0014514 | 3300048912 | Bacteria | 6853 |
| 1398 | Ga0496109_0019721 | 3300048912 | Bacteria | 5949 |
| 1399 | Ga0496109_0028048 | 3300048912 | Bacteria | 5033 |
| 1400 | Ga0496109_0056454 | 3300048912 | Bacteria | 3583 |
| 1401 | Ga0496109_0108315 | 3300048912 | Bacteria | 2582 |
| 1402 | Ga0496109_0178499 | 3300048912 | Bacteria | 1994 |
| 1403 | Ga0496109_0207524 | 3300048912 | Bacteria | 1842 |
| 1404 | Ga0496109_0414639 | 3300048912 | Bacteria | 1272 |
| 1405 | Ga0496109_0452569 | 3300048912 | Bacteria | 1212 |
| 1406 | Ga0496109_0932421 | 3300048912 | Bacteria | 806 |
| 1407 | Ga0496109_1794184 | 3300048912 | Bacteria | 547 |
| 1408 | Ga0496110_0002089 | 3300048913 | Bacteria | 14889 |
| 1409 | Ga0496110_0007388 | 3300048913 | Bacteria | 8770 |
| 1410 | Ga0496110_0012212 | 3300048913 | Bacteria | 7057 |
| 1411 | Ga0496110_0015514 | 3300048913 | Bacteria | 6343 |
| 1412 | Ga0496110_0015821 | 3300048913 | Bacteria | 6289 |
| 1413 | Ga0496110_0023138 | 3300048913 | Bacteria | 5284 |
| 1414 | Ga0496110_0047459 | 3300048913 | Bacteria | 3761 |
| 1415 | Ga0496110_0049945 | 3300048913 | Bacteria | 3671 |
| 1416 | Ga0496110_0075963 | 3300048913 | Bacteria | 2986 |
| 1417 | Ga0496110_0088566 | 3300048913 | Bacteria | 2765 |
| 1418 | Ga0496110_0110925 | 3300048913 | Unclassified | 2465 |
| 1419 | Ga0496110_0125619 | 3300048913 | Bacteria | 2314 |
| 1420 | Ga0496110_0127257 | 3300048913 | Bacteria | 2299 |
| 1421 | Ga0496110_0174237 | 3300048913 | Unclassified | 1952 |
| 1422 | Ga0496110_0185035 | 3300048913 | Unclassified | 1891 |
| 1423 | Ga0496110_0250425 | 3300048913 | Unclassified | 1612 |
| 1424 | Ga0496110_0339682 | 3300048913 | Bacteria | 1368 |
| 1425 | Ga0496110_0353615 | 3300048913 | Unclassified | 1338 |
| 1426 | Ga0496110_0382113 | 3300048913 | Bacteria | 1283 |
| 1427 | Ga0496110_0936314 | 3300048913 | Bacteria | 773 |
| 1428 | Ga0496110_0971780 | 3300048913 | Bacteria | 756 |
| 1429 | Ga0496111_0000409 | 3300048914 | Bacteria | 21519 |
| 1430 | Ga0496111_0002749 | 3300048914 | Bacteria | 10698 |
| 1431 | Ga0496111_0003143 | 3300048914 | Bacteria | 10161 |
| 1432 | Ga0496111_0007452 | 3300048914 | Bacteria | 7175 |
| 1433 | Ga0496111_0008185 | 3300048914 | Bacteria | 6912 |
| 1434 | Ga0496111_0018374 | 3300048914 | Bacteria | 4844 |
| 1435 | Ga0496111_0018907 | 3300048914 | Bacteria | 4777 |
| 1436 | Ga0496111_0023678 | 3300048914 | Bacteria | 4314 |
| 1437 | Ga0496111_0027200 | 3300048914 | Bacteria | 4044 |
| 1438 | Ga0496111_0046322 | 3300048914 | Bacteria | 3131 |
| 1439 | Ga0496111_0049616 | 3300048914 | Unclassified | 3027 |
| 1440 | Ga0496111_0115382 | 3300048914 | Bacteria | 1980 |
| 1441 | Ga0496111_0121848 | 3300048914 | Unclassified | 1926 |
| 1442 | Ga0496111_0123329 | 3300048914 | Bacteria | 1914 |
| 1443 | Ga0496111_0270679 | 3300048914 | Bacteria | 1260 |
| 1444 | Ga0496111_0475853 | 3300048914 | Bacteria | 920 |
| 1445 | Ga0496112_0000219 | 3300048915 | Bacteria | 37058 |
| 1446 | Ga0496112_0003878 | 3300048915 | Bacteria | 12504 |
| 1447 | Ga0496112_0011107 | 3300048915 | Bacteria | 8207 |
| 1448 | Ga0496112_0038697 | 3300048915 | Bacteria | 4658 |
| 1449 | Ga0496112_0042811 | 3300048915 | Bacteria | 4431 |
| 1450 | Ga0496112_0049596 | 3300048915 | Bacteria | 4115 |
| 1451 | Ga0496112_0098332 | 3300048915 | Bacteria | 2896 |
| 1452 | Ga0496112_0103604 | 3300048915 | Bacteria | 2815 |
| 1453 | Ga0496112_0112444 | 3300048915 | Bacteria | 2693 |
| 1454 | Ga0496112_0231701 | 3300048915 | Bacteria | 1801 |
| 1455 | Ga0496112_0683415 | 3300048915 | Bacteria | 955 |
| 1456 | Ga0496112_0726186 | 3300048915 | Bacteria | 920 |
| 1457 | Ga0496113_0003176 | 3300048916 | Bacteria | 9784 |
| 1458 | Ga0496113_0007503 | 3300048916 | Bacteria | 7026 |
| 1459 | Ga0496113_0028481 | 3300048916 | Bacteria | 4019 |
| 1460 | Ga0496113_0030354 | 3300048916 | Bacteria | 3913 |
| 1461 | Ga0496113_0051781 | 3300048916 | Bacteria | 3064 |
| 1462 | Ga0496113_0090274 | 3300048916 | Bacteria | 2360 |
| 1463 | Ga0496113_0114285 | 3300048916 | Bacteria | 2104 |
| 1464 | Ga0496113_0273016 | 3300048916 | Bacteria | 1351 |
| 1465 | Ga0496114_0001197 | 3300048917 | Bacteria | 19622 |
| 1466 | Ga0496114_0009616 | 3300048917 | Bacteria | 7679 |
| 1467 | Ga0496114_0011616 | 3300048917 | Bacteria | 7042 |
| 1468 | Ga0496114_0020246 | 3300048917 | Bacteria | 5399 |
| 1469 | Ga0496114_0020944 | 3300048917 | Bacteria | 5311 |
| 1470 | Ga0496114_0027291 | 3300048917 | Bacteria | 4676 |
| 1471 | Ga0496114_0091729 | 3300048917 | Bacteria | 2580 |
| 1472 | Ga0496114_0193894 | 3300048917 | Unclassified | 1778 |
| 1473 | Ga0496114_0197123 | 3300048917 | Bacteria | 1763 |
| 1474 | Ga0496114_0256670 | 3300048917 | Bacteria | 1538 |
| 1475 | Ga0496114_0274091 | 3300048917 | Unclassified | 1487 |
| 1476 | Ga0496114_0308075 | 3300048917 | Unclassified | 1398 |
| 1477 | Ga0496114_0333144 | 3300048917 | Bacteria | 1342 |
| 1478 | Ga0496114_0336426 | 3300048917 | Bacteria | 1335 |
| 1479 | Ga0496114_0340949 | 3300048917 | Unclassified | 1325 |
| 1480 | Ga0496114_0350126 | 3300048917 | Bacteria | 1306 |
| 1481 | Ga0496114_0416474 | 3300048917 | Bacteria | 1190 |
| 1482 | Ga0496114_0427310 | 3300048917 | Bacteria | 1174 |
| 1483 | Ga0496115_0005498 | 3300048918 | Bacteria | 9224 |
| 1484 | Ga0496115_0005984 | 3300048918 | Bacteria | 8880 |
| 1485 | Ga0496115_0008075 | 3300048918 | Bacteria | 7773 |
| 1486 | Ga0496115_0014612 | 3300048918 | Bacteria | 5946 |
| 1487 | Ga0496115_0020694 | 3300048918 | Bacteria | 5075 |
| 1488 | Ga0496115_0047325 | 3300048918 | Bacteria | 3439 |
| 1489 | Ga0496115_0131247 | 3300048918 | Unclassified | 2065 |
| 1490 | Ga0501031_0010560 | 3300049568 | Bacteria | 6011 |
| 1491 | Ga0501031_0023210 | 3300049568 | Bacteria | 4044 |
| 1492 | Ga0501031_0564608 | 3300049568 | Bacteria | 733 |
| 1493 | Ga0501032_0040204 | 3300049569 | Bacteria | 3179 |
| 1494 | Ga0501032_0250773 | 3300049569 | Bacteria | 1149 |
| 1495 | Ga0501033_0004093 | 3300049570 | Bacteria | 11758 |
| 1496 | Ga0501033_0266844 | 3300049570 | Bacteria | 1210 |
| 1497 | Ga0501033_0396292 | 3300049570 | Unclassified | 963 |
| 1498 | Ga0501034_0027083 | 3300049571 | Bacteria | 5832 |
| 1499 | Ga0501034_0106476 | 3300049571 | Bacteria | 2797 |
| 1500 | Ga0501036_0028116 | 3300049572 | Bacteria | 4754 |
| 1501 | Ga0501036_0034638 | 3300049572 | Bacteria | 4272 |
| 1502 | Ga0501036_0088273 | 3300049572 | Bacteria | 2620 |
| 1503 | Ga0501036_0202232 | 3300049572 | Bacteria | 1670 |
| 1504 | Ga0501037_0005303 | 3300049573 | Bacteria | 9377 |
| 1505 | Ga0501037_0025710 | 3300049573 | Bacteria | 4348 |
| 1506 | Ga0501038_0005301 | 3300049574 | Bacteria | 11978 |
| 1507 | Ga0501038_0195864 | 3300049574 | Bacteria | 1624 |
| 1508 | Ga0501038_0372670 | 3300049574 | Unclassified | 1109 |
| 1509 | Ga0501038_0804281 | 3300049574 | Bacteria | 698 |
| 1510 | Ga0501039_0005779 | 3300049575 | Bacteria | 9370 |
| 1511 | Ga0501039_0026669 | 3300049575 | Bacteria | 4440 |
| 1512 | Ga0501039_0149671 | 3300049575 | Bacteria | 1834 |
| 1513 | Ga0501039_0320098 | 3300049575 | Unclassified | 1219 |
| 1514 | Ga0501039_0528921 | 3300049575 | Bacteria | 925 |
| 1515 | Ga0501040_0003212 | 3300049576 | Bacteria | 10573 |
| 1516 | Ga0501040_0065847 | 3300049576 | Bacteria | 2496 |
| 1517 | Ga0501040_0241664 | 3300049576 | Bacteria | 1287 |
| 1518 | Ga0501040_0293216 | 3300049576 | Bacteria | 1162 |
| 1519 | Ga0501040_0298256 | 3300049576 | Unclassified | 1152 |
| 1520 | Ga0501041_0011783 | 3300049577 | Bacteria | 5175 |
| 1521 | Ga0501041_0012189 | 3300049577 | Bacteria | 5091 |
| 1522 | Ga0501041_0013819 | 3300049577 | Bacteria | 4786 |
| 1523 | Ga0501041_0116738 | 3300049577 | Bacteria | 1657 |
| 1524 | Ga0501042_0016781 | 3300049578 | Bacteria | 5035 |
| 1525 | Ga0501042_0026988 | 3300049578 | Bacteria | 4036 |
| 1526 | Ga0501042_0034104 | 3300049578 | Bacteria | 3610 |
| 1527 | Ga0501042_0046904 | 3300049578 | Bacteria | 3080 |
| 1528 | Ga0501042_0108966 | 3300049578 | Bacteria | 1994 |
| 1529 | Ga0501042_0159270 | 3300049578 | Bacteria | 1628 |
| 1530 | Ga0501042_0221584 | 3300049578 | Bacteria | 1364 |
| 1531 | Ga0501043_0020192 | 3300049579 | Bacteria | 5230 |
| 1532 | Ga0501043_0039991 | 3300049579 | Bacteria | 3685 |
| 1533 | Ga0501043_0045393 | 3300049579 | Bacteria | 3456 |
| 1534 | Ga0501043_0460873 | 3300049579 | Unclassified | 954 |
| 1535 | Ga0501043_0753935 | 3300049579 | Bacteria | 707 |
| 1536 | Ga0501043_0942984 | 3300049579 | Bacteria | 617 |
| 1537 | Ga0501046_0001657 | 3300049580 | Bacteria | 21287 |
| 1538 | Ga0501046_0008491 | 3300049580 | Bacteria | 8945 |
| 1539 | Ga0501046_0019425 | 3300049580 | Bacteria | 5638 |
| 1540 | Ga0501047_0247228 | 3300049581 | Bacteria | 1633 |
| 1541 | Ga0501047_0511999 | 3300049581 | Bacteria | 1026 |
| 1542 | Ga0501048_0015422 | 3300049582 | Bacteria | 5643 |
| 1543 | Ga0501048_0030654 | 3300049582 | Bacteria | 3891 |
| 1544 | Ga0501048_0087610 | 3300049582 | Unclassified | 2196 |
| 1545 | Ga0501048_0106006 | 3300049582 | Bacteria | 1984 |
| 1546 | Ga0501048_0130521 | 3300049582 | Unclassified | 1776 |
| 1547 | Ga0501048_0309914 | 3300049582 | Bacteria | 1124 |
| 1548 | Ga0501067_0001413 | 3300049583 | Bacteria | 13017 |
| 1549 | Ga0501067_0002836 | 3300049583 | Bacteria | 9539 |
| 1550 | Ga0501067_0022931 | 3300049583 | Bacteria | 3456 |
| 1551 | Ga0501067_0067298 | 3300049583 | Bacteria | 1983 |
| 1552 | Ga0501067_0111742 | 3300049583 | Unclassified | 1519 |
| 1553 | Ga0501067_0648478 | 3300049583 | Unclassified | 593 |
| 1554 | Ga0501068_0001497 | 3300049584 | Bacteria | 12436 |
| 1555 | Ga0501068_0004650 | 3300049584 | Bacteria | 7471 |
| 1556 | Ga0501068_0020862 | 3300049584 | Bacteria | 3823 |
| 1557 | Ga0501068_0041288 | 3300049584 | Bacteria | 2772 |
| 1558 | Ga0501068_0057703 | 3300049584 | Unclassified | 2354 |
| 1559 | Ga0501068_0060039 | 3300049584 | Bacteria | 2308 |
| 1560 | Ga0501068_0207911 | 3300049584 | Unclassified | 1242 |
| 1561 | Ga0501069_0004664 | 3300049585 | Bacteria | 7084 |
| 1562 | Ga0501069_0016104 | 3300049585 | Bacteria | 4010 |
| 1563 | Ga0501069_0016471 | 3300049585 | Bacteria | 3971 |
| 1564 | Ga0501069_0069953 | 3300049585 | Bacteria | 1965 |
| 1565 | Ga0501069_0150460 | 3300049585 | Bacteria | 1337 |
| 1566 | Ga0501069_0245451 | 3300049585 | Bacteria | 1044 |
| 1567 | Ga0501069_0271800 | 3300049585 | Bacteria | 991 |
| 1568 | Ga0501069_0404115 | 3300049585 | Bacteria | 808 |
| 1569 | Ga0501070_0002518 | 3300049586 | Bacteria | 16063 |
| 1570 | Ga0501070_0013724 | 3300049586 | Bacteria | 6822 |
| 1571 | Ga0501070_0019233 | 3300049586 | Bacteria | 5729 |
| 1572 | Ga0501070_0089897 | 3300049586 | Bacteria | 2541 |
| 1573 | Ga0501070_0516894 | 3300049586 | Bacteria | 958 |
| 1574 | Ga0501070_0646876 | 3300049586 | Unclassified | 840 |
| 1575 | Ga0501070_0892045 | 3300049586 | Bacteria | 694 |
| 1576 | Ga0501071_0004216 | 3300049587 | Bacteria | 9103 |
| 1577 | Ga0501071_0007242 | 3300049587 | Bacteria | 7262 |
| 1578 | Ga0501071_0014053 | 3300049587 | Bacteria | 5471 |
| 1579 | Ga0501071_0024274 | 3300049587 | Bacteria | 4239 |
| 1580 | Ga0501071_0095280 | 3300049587 | Bacteria | 2190 |
| 1581 | Ga0501071_0373714 | 3300049587 | Bacteria | 1086 |
| 1582 | Ga0501071_0499282 | 3300049587 | Bacteria | 933 |
| 1583 | Ga0501071_0610461 | 3300049587 | Bacteria | 839 |
| 1584 | Ga0501072_0005827 | 3300049588 | Bacteria | 9387 |
| 1585 | Ga0501072_0009201 | 3300049588 | Bacteria | 7503 |
| 1586 | Ga0501072_0013077 | 3300049588 | Bacteria | 6352 |
| 1587 | Ga0501072_0024928 | 3300049588 | Bacteria | 4656 |
| 1588 | Ga0501072_0066603 | 3300049588 | Bacteria | 2841 |
| 1589 | Ga0501072_0166271 | 3300049588 | Bacteria | 1760 |
| 1590 | Ga0501072_0787437 | 3300049588 | Bacteria | 745 |
| 1591 | Ga0501073_0002371 | 3300049589 | Bacteria | 14107 |
| 1592 | Ga0501073_0004603 | 3300049589 | Bacteria | 10369 |
| 1593 | Ga0501073_0015657 | 3300049589 | Bacteria | 5499 |
| 1594 | Ga0501073_0125846 | 3300049589 | Bacteria | 1776 |
| 1595 | Ga0501073_0557057 | 3300049589 | Unclassified | 792 |
| 1596 | Ga0501074_0012304 | 3300049590 | Bacteria | 6219 |
| 1597 | Ga0501074_0017262 | 3300049590 | Bacteria | 5236 |
| 1598 | Ga0501074_0128247 | 3300049590 | Bacteria | 1815 |
| 1599 | Ga0501074_0303439 | 3300049590 | Unclassified | 1134 |
| 1600 | Ga0501074_0477033 | 3300049590 | Unclassified | 884 |
| 1601 | Ga0501075_0001488 | 3300049591 | Bacteria | 15267 |
| 1602 | Ga0501075_0003668 | 3300049591 | Bacteria | 10302 |
| 1603 | Ga0501075_0007524 | 3300049591 | Bacteria | 7554 |
| 1604 | Ga0501075_0013972 | 3300049591 | Bacteria | 5746 |
| 1605 | Ga0501075_0326847 | 3300049591 | Bacteria | 1168 |
| 1606 | Ga0501075_0399366 | 3300049591 | Bacteria | 1048 |
| 1607 | Ga0501076_0031817 | 3300049592 | Bacteria | 4116 |
| 1608 | Ga0501076_0057924 | 3300049592 | Bacteria | 3078 |
| 1609 | Ga0501076_0104873 | 3300049592 | Bacteria | 2281 |
| 1610 | Ga0501076_0131729 | 3300049592 | Bacteria | 2028 |
| 1611 | Ga0501076_0213344 | 3300049592 | Bacteria | 1578 |
| 1612 | Ga0501076_0218707 | 3300049592 | Bacteria | 1557 |
| 1613 | Ga0501076_0286756 | 3300049592 | Bacteria | 1349 |
| 1614 | Ga0501076_0323658 | 3300049592 | Bacteria | 1264 |
| 1615 | Ga0501076_0452692 | 3300049592 | Bacteria | 1057 |
| 1616 | Ga0501077_0001317 | 3300049593 | Bacteria | 14995 |
| 1617 | Ga0501077_0005968 | 3300049593 | Bacteria | 7440 |
| 1618 | Ga0501077_0012584 | 3300049593 | Bacteria | 5297 |
| 1619 | Ga0501077_0026986 | 3300049593 | Bacteria | 3646 |
| 1620 | Ga0501077_0029979 | 3300049593 | Bacteria | 3461 |
| 1621 | Ga0501077_0219528 | 3300049593 | Bacteria | 1208 |
| 1622 | Ga0501077_0306998 | 3300049593 | Unclassified | 1011 |
| 1623 | Ga0501079_0004980 | 3300049741 | Bacteria | 9846 |
| 1624 | Ga0501079_0020643 | 3300049741 | Bacteria | 5036 |
| 1625 | Ga0501079_0085671 | 3300049741 | Unclassified | 2438 |
| 1626 | Ga0501079_0244629 | 3300049741 | Bacteria | 1402 |
| 1627 | Ga0501079_0294214 | 3300049741 | Bacteria | 1270 |
| 1628 | Ga0501079_0509340 | 3300049741 | Unclassified | 946 |
| 1629 | Ga0501079_0591994 | 3300049741 | Bacteria | 873 |
| 1630 | Ga0501079_0621341 | 3300049741 | Unclassified | 850 |
| 1631 | Ga0501079_0713266 | 3300049741 | Bacteria | 789 |
| 1632 | Ga0501080_0004906 | 3300049742 | Bacteria | 11918 |
| 1633 | Ga0501080_0009108 | 3300049742 | Bacteria | 9037 |
| 1634 | Ga0501080_0041825 | 3300049742 | Bacteria | 4268 |
| 1635 | Ga0501080_0046721 | 3300049742 | Bacteria | 4030 |
| 1636 | Ga0501080_0081521 | 3300049742 | Bacteria | 3005 |
| 1637 | Ga0501080_0186580 | 3300049742 | Bacteria | 1907 |
| 1638 | Ga0501080_0278428 | 3300049742 | Bacteria | 1521 |
| 1639 | Ga0501080_0324159 | 3300049742 | Bacteria | 1394 |
| 1640 | Ga0501080_0728975 | 3300049742 | Bacteria | 873 |
| 1641 | Ga0501081_0002856 | 3300049743 | Bacteria | 10965 |
| 1642 | Ga0501081_0010627 | 3300049743 | Bacteria | 6012 |
| 1643 | Ga0501081_0011529 | 3300049743 | Bacteria | 5783 |
| 1644 | Ga0501081_0039627 | 3300049743 | Bacteria | 3225 |
| 1645 | Ga0501081_0062856 | 3300049743 | Bacteria | 2576 |
| 1646 | Ga0501081_0298923 | 3300049743 | Bacteria | 1181 |
| 1647 | Ga0501081_0712670 | 3300049743 | Bacteria | 753 |
| 1648 | Ga0501081_0793780 | 3300049743 | Bacteria | 712 |
| 1649 | Ga0501083_0002127 | 3300049744 | Bacteria | 13589 |
| 1650 | Ga0501083_0013261 | 3300049744 | Bacteria | 5762 |
| 1651 | Ga0501083_0018718 | 3300049744 | Bacteria | 4822 |
| 1652 | Ga0501083_0141943 | 3300049744 | Bacteria | 1573 |
| 1653 | Ga0501083_0145833 | 3300049744 | Bacteria | 1550 |
| 1654 | Ga0501083_0956119 | 3300049744 | Bacteria | 557 |
| 1655 | Ga0501035_0019349 | 3300049822 | Bacteria | 6263 |
| 1656 | Ga0501044_0008260 | 3300049823 | Bacteria | 11415 |
| 1657 | Ga0501044_0427141 | 3300049823 | Bacteria | 1235 |
| 1658 | Ga0501045_0012604 | 3300049824 | Bacteria | 5953 |
| 1659 | Ga0501045_0017900 | 3300049824 | Bacteria | 5031 |
| 1660 | Ga0501045_0026718 | 3300049824 | Bacteria | 4154 |
| 1661 | Ga0501045_0075686 | 3300049824 | Bacteria | 2479 |
| 1662 | Ga0501045_0151236 | 3300049824 | Bacteria | 1727 |
| 1663 | Ga0501045_0170299 | 3300049824 | Bacteria | 1622 |
| 1664 | Ga0501045_0339060 | 3300049824 | Bacteria | 1119 |
| 1665 | Ga0501045_0638361 | 3300049824 | Bacteria | 787 |
| 1666 | nmdc:mga0yw44_242653_c1 | 3300050492 | Bacteria | 1198 |
| 1667 | nmdc:mga0yw44_529172_c1 | 3300050492 | Bacteria | 800 |
| 1668 | nmdc:mga04h51_58263_c1 | 3300050495 | Bacteria | 1316 |
| 1669 | nmdc:mga05p37_11057_c1 | 3300050507 | Bacteria | 10723 |
| 1670 | nmdc:mga05p37_140165_c1 | 3300050507 | Bacteria | 2963 |
| 1671 | nmdc:mga05p37_1406_c1 | 3300050507 | Bacteria | 27982 |
| 1672 | nmdc:mga05p37_141812_c1 | 3300050507 | Bacteria | 2944 |
| 1673 | nmdc:mga05p37_34623_c1 | 3300050507 | Bacteria | 6187 |
| 1674 | nmdc:mga05p37_586618_c1 | 3300050507 | Unclassified | 1261 |
| 1675 | nmdc:mga05p37_6125_c1 | 3300050507 | Bacteria | 14170 |
| 1676 | nmdc:mga05p37_71668_c1 | 3300050507 | Bacteria | 4263 |
| 1677 | nmdc:mga09592_31718_c1 | 3300050508 | Bacteria | 4404 |
| 1678 | nmdc:mga09592_474302_c1 | 3300050508 | Bacteria | 1078 |
| 1679 | nmdc:mga09592_49204_c1 | 3300050508 | Bacteria | 3554 |
| 1680 | nmdc:mga09592_806947_c1 | 3300050508 | Unclassified | 793 |
| 1681 | nmdc:mga09592_8887_c1 | 3300050508 | Bacteria | 8169 |
| 1682 | nmdc:mga0qj67_20591_c1 | 3300050509 | Bacteria | 5053 |
| 1683 | nmdc:mga0qj67_286774_c1 | 3300050509 | Bacteria | 1334 |
| 1684 | nmdc:mga0qj67_9604_c1 | 3300050509 | Bacteria | 7211 |
| 1685 | nmdc:mga06r32_131069_c1 | 3300050510 | Bacteria | 2479 |
| 1686 | nmdc:mga06r32_15111_c1 | 3300050510 | Bacteria | 7010 |
| 1687 | nmdc:mga06r32_375190_c1 | 3300050510 | Bacteria | 1405 |
| 1688 | nmdc:mga06r32_445028_c1 | 3300050510 | Bacteria | 1276 |
| 1689 | nmdc:mga06r32_91144_c1 | 3300050510 | Bacteria | 2979 |
| 1690 | nmdc:mga08y16_115013_c1 | 3300050511 | Bacteria | 2801 |
| 1691 | nmdc:mga08y16_14526_c1 | 3300050511 | Bacteria | 8285 |
| 1692 | nmdc:mga08y16_17249_c1 | 3300050511 | Bacteria | 7600 |
| 1693 | nmdc:mga08y16_24056_c1 | 3300050511 | Bacteria | 6432 |
| 1694 | nmdc:mga08y16_265562_c1 | 3300050511 | Bacteria | 1772 |
| 1695 | nmdc:mga08y16_287111_c1 | 3300050511 | Bacteria | 1696 |
| 1696 | nmdc:mga08y16_500553_c1 | 3300050511 | Bacteria | 1234 |
| 1697 | nmdc:mga08y16_71934_c1 | 3300050511 | Bacteria | 3604 |
| 1698 | nmdc:mga08y16_9514_c1 | 3300050511 | Bacteria | 10197 |
| 1699 | nmdc:mga0n895_1087_c1 | 3300050512 | Bacteria | 19875 |
| 1700 | nmdc:mga0n895_157890_c1 | 3300050512 | Bacteria | 2299 |
| 1701 | nmdc:mga0n895_300366_c1 | 3300050512 | Bacteria | 1627 |
| 1702 | nmdc:mga0n895_34268_c1 | 3300050512 | Bacteria | 4886 |
| 1703 | nmdc:mga0n895_593483_c1 | 3300050512 | Unclassified | 1110 |
| 1704 | nmdc:mga0n895_687748_c1 | 3300050512 | Bacteria | 1020 |
| 1705 | nmdc:mga0n895_983906_c1 | 3300050512 | Bacteria | 826 |
| 1706 | nmdc:mga0rr50_1112_c1 | 3300050513 | Bacteria | 14601 |
| 1707 | nmdc:mga0rr50_117735_c1 | 3300050513 | Unclassified | 2110 |
| 1708 | nmdc:mga0rr50_231623_c1 | 3300050513 | Bacteria | 1529 |
| 1709 | nmdc:mga0rr50_426135_c1 | 3300050513 | Bacteria | 1123 |
| 1710 | nmdc:mga0rr50_746_c1 | 3300050513 | Bacteria | 17524 |
| 1711 | nmdc:mga0rr50_83364_c1 | 3300050513 | Bacteria | 2472 |
| 1712 | nmdc:mga08x19_18960_c1 | 3300050514 | Bacteria | 4218 |
| 1713 | nmdc:mga08x19_39385_c1 | 3300050514 | Bacteria | 3004 |
| 1714 | nmdc:mga08x19_54514_c1 | 3300050514 | Unclassified | 2574 |
| 1715 | nmdc:mga08x19_80734_c1 | 3300050514 | Bacteria | 2135 |
| 1716 | nmdc:mga0a205_110447_c1 | 3300050515 | Bacteria | 2648 |
| 1717 | nmdc:mga0a205_13662_c1 | 3300050515 | Bacteria | 7566 |
| 1718 | nmdc:mga0a205_152852_c1 | 3300050515 | Bacteria | 2207 |
| 1719 | nmdc:mga0a205_25610_c1 | 3300050515 | Bacteria | 5621 |
| 1720 | nmdc:mga0a205_330047_c1 | 3300050515 | Bacteria | 1395 |
| 1721 | nmdc:mga0a205_399321_c1 | 3300050515 | Bacteria | 1238 |
| 1722 | nmdc:mga0a205_637_c1 | 3300050515 | Bacteria | 27863 |
| 1723 | Ga0495601_0042428 | 3300053077 | Bacteria | 2854 |
| 1724 | Ga0495612_0230640 | 3300053078 | Bacteria | 821 |
| 1725 | Ga0495612_0272101 | 3300053078 | Bacteria | 756 |
| 1726 | Ga0495655_0166703 | 3300053083 | Bacteria | 703 |
| 1727 | Ga0495595_0003489 | 3300053084 | Bacteria | 6247 |
| 1728 | Ga0495619_0007560 | 3300053085 | Bacteria | 6879 |
| 1729 | Ga0495619_0018176 | 3300053085 | Bacteria | 4459 |
| 1730 | Ga0495619_0073118 | 3300053085 | Bacteria | 2297 |
| 1731 | Ga0495619_0177982 | 3300053085 | Unclassified | 1471 |
| 1732 | Ga0501084_0002387 | 3300054114 | Bacteria | 15112 |
| 1733 | Ga0501084_0003760 | 3300054114 | Bacteria | 12338 |
| 1734 | Ga0501084_0010194 | 3300054114 | Bacteria | 7770 |
| 1735 | Ga0501084_0058812 | 3300054114 | Bacteria | 3217 |
| 1736 | Ga0501084_0078245 | 3300054114 | Bacteria | 2772 |
| 1737 | Ga0501084_0088611 | 3300054114 | Bacteria | 2598 |
| 1738 | Ga0501084_0129819 | 3300054114 | Bacteria | 2121 |
| 1739 | Ga0501084_0213715 | 3300054114 | Bacteria | 1627 |
| 1740 | Ga0501084_0314690 | 3300054114 | Unclassified | 1322 |
| 1741 | Ga0501084_0414401 | 3300054114 | Bacteria | 1139 |
| 1742 | Ga0590075_022938 | 3300059424 | Bacteria | 1564 |
| 1743 | Ga0501082_0083902 | 3300060353 | Bacteria | 2748 |
| 1744 | Ga0501082_0086088 | 3300060353 | Bacteria | 2710 |
| 1745 | Ga0501082_0313764 | 3300060353 | Bacteria | 1365 |
| 1746 | Ga0501082_0424949 | 3300060353 | Unclassified | 1160 |
| 1747 | Ga0501082_0460848 | 3300060353 | Bacteria | 1111 |
| 1748 | Ga0501082_0841050 | 3300060353 | Unclassified | 803 |
| 1749 | Ga0501082_1221175 | 3300060353 | Bacteria | 657 |
| 1750 | Ga0466962_0070104 | 3300061719 | Bacteria | 1674 |
| 1751 | Ga0466962_0314690 | 3300061719 | Bacteria | 776 |
| 1752 | Ga0530510_0023878 | 3300061734 | Bacteria | 4360 |
| 1753 | Ga0530510_0038675 | 3300061734 | Bacteria | 3444 |
| 1754 | Ga0530510_0068495 | 3300061734 | Bacteria | 2575 |
| 1755 | Ga0530510_0075021 | 3300061734 | Bacteria | 2456 |
| 1756 | Ga0530510_0076699 | 3300061734 | Bacteria | 2429 |
| 1757 | Ga0530510_0118841 | 3300061734 | Bacteria | 1939 |
| 1758 | Ga0530510_0130468 | 3300061734 | Bacteria | 1849 |
| 1759 | Ga0530510_0445773 | 3300061734 | Unclassified | 978 |
| 1760 | Ga0530510_0795071 | 3300061734 | Bacteria | 722 |
| 1761 | Ga0070699_100333986 | |||
| 1762 | JGI24743J22301_10010006 | |||
| 1763 | JGI24743J22301_10035172 | |||
| 1764 | JGI24744J21845_10012680 | |||
| 1765 | JGI25407J50210_10002348 | |||
| 1766 | JGI25405J52794_10064353 | |||
| 1767 | Ga0070658_10017501 | |||
| 1768 | Ga0070658_10018199 | |||
| 1769 | Ga0070658_10050931 | |||
| 1770 | Ga0070683_100001042 | |||
| 1771 | Ga0070683_100014649 | |||
| 1772 | Ga0070683_100033826 | |||
| 1773 | Ga0070683_100037911 | |||
| 1774 | Ga0070683_100093799 | |||
| 1775 | Ga0070683_100104209 | |||
| 1776 | Ga0070683_100161594 | |||
| 1777 | Ga0070690_100153711 | |||
| 1778 | Ga0070690_100381704 | |||
| 1779 | Ga0070670_100264074 | |||
| 1780 | Ga0070670_100338617 | |||
| 1781 | Ga0068869_100123368 | |||
| 1782 | Ga0068869_100572134 | |||
| 1783 | Ga0068869_100878092 | |||
| 1784 | Ga0070666_10100625 | |||
| 1785 | Ga0070666_10162732 | |||
| 1786 | Ga0070680_100019104 | |||
| 1787 | Ga0070680_100067139 | |||
| 1788 | Ga0070680_100106006 | |||
| 1789 | Ga0070680_100147762 | |||
| 1790 | Ga0070680_100158984 | |||
| 1791 | Ga0070680_100161655 | |||
| 1792 | Ga0070680_100192305 | |||
| 1793 | Ga0070680_100466734 | |||
| 1794 | Ga0070680_100497817 | |||
| 1795 | Ga0070682_100002667 | |||
| 1796 | Ga0070682_100009303 | |||
| 1797 | Ga0070682_100011800 | |||
| 1798 | Ga0070682_100270818 | |||
| 1799 | Ga0068868_100006377 | |||
| 1800 | Ga0068868_100051038 | |||
| 1801 | Ga0068868_100053202 | |||
| 1802 | Ga0068868_100111975 | |||
| 1803 | Ga0068868_100140903 | |||
| 1804 | Ga0068868_100295869 | |||
| 1805 | Ga0068868_100505427 | |||
| 1806 | Ga0070660_100010212 | |||
| 1807 | Ga0070660_100052258 | |||
| 1808 | Ga0070660_100175135 | |||
| 1809 | Ga0070660_100615059 | |||
| 1810 | Ga0070689_100032245 | |||
| 1811 | Ga0070689_100044528 | |||
| 1812 | Ga0070689_100171740 | |||
| 1813 | Ga0070689_101202902 | |||
| 1814 | Ga0070691_10019136 | |||
| 1815 | Ga0070691_10022791 | |||
| 1816 | Ga0070691_10036706 | |||
| 1817 | Ga0070691_10206440 | |||
| 1818 | Ga0070661_100020300 | |||
| 1819 | Ga0070661_100054537 | |||
| 1820 | Ga0070692_10013257 | |||
| 1821 | Ga0070692_10077272 | |||
| 1822 | Ga0070692_10190290 | |||
| 1823 | Ga0070692_10248021 | |||
| 1824 | Ga0070668_100149804 | |||
| 1825 | Ga0070669_100153201 | |||
| 1826 | Ga0070675_100021523 | |||
| 1827 | Ga0070675_100224790 | |||
| 1828 | Ga0070675_100297512 | |||
| 1829 | Ga0070675_100840950 | |||
| 1830 | Ga0070675_101077594 | |||
| 1831 | Ga0070671_100295550 | |||
| 1832 | Ga0070674_100019642 | |||
| 1833 | Ga0070674_100020566 | |||
| 1834 | Ga0070674_100089528 | |||
| 1835 | Ga0070674_100375245 | |||
| 1836 | Ga0070674_100723947 | |||
| 1837 | Ga0070673_100012276 | |||
| 1838 | Ga0070673_100496010 | |||
| 1839 | Ga0070673_100767032 | |||
| 1840 | Ga0070688_100006359 | |||
| 1841 | Ga0070688_100142370 | |||
| 1842 | Ga0070688_100169006 | |||
| 1843 | Ga0070688_100294890 | |||
| 1844 | Ga0070688_100598310 | |||
| 1845 | Ga0070659_100012754 | |||
| 1846 | Ga0070659_100018355 | |||
| 1847 | Ga0070659_100024046 | |||
| 1848 | Ga0070659_100082199 | |||
| 1849 | Ga0070659_100349402 | |||
| 1850 | Ga0070659_100483317 | |||
| 1851 | Ga0070659_100516906 | |||
| 1852 | Ga0070659_100616149 | |||
| 1853 | Ga0070667_100242802 | |||
| 1854 | Ga0070667_100344303 | |||
| 1855 | Ga0070703_10001171 | |||
| 1856 | Ga0070709_10068516 | |||
| 1857 | Ga0070709_10459006 | |||
| 1858 | Ga0070709_10620233 | |||
| 1859 | Ga0070709_11056424 | |||
| 1860 | Ga0070714_100016771 | |||
| 1861 | Ga0070714_100110386 | |||
| 1862 | Ga0070714_100388218 | |||
| 1863 | Ga0070714_100578222 | |||
| 1864 | Ga0070714_100999010 | |||
| 1865 | Ga0070713_100009373 | |||
| 1866 | Ga0070713_100192995 | |||
| 1867 | Ga0070713_100501762 | |||
| 1868 | Ga0070713_100509086 | |||
| 1869 | Ga0070710_10020801 | |||
| 1870 | Ga0070710_10032517 | |||
| 1871 | Ga0070710_10144075 | |||
| 1872 | Ga0070701_10001880 | |||
| 1873 | Ga0070701_10041749 | |||
| 1874 | Ga0070701_10050569 | |||
| 1875 | Ga0070701_10120876 | |||
| 1876 | Ga0070701_10124786 | |||
| 1877 | Ga0070701_10265388 | |||
| 1878 | Ga0070711_100038898 | |||
| 1879 | Ga0070711_100047708 | |||
| 1880 | Ga0070711_100109060 | |||
| 1881 | Ga0070711_100321946 | |||
| 1882 | Ga0070711_100343184 | |||
| 1883 | Ga0070705_100010197 | |||
| 1884 | Ga0070705_100043489 | |||
| 1885 | Ga0070700_100028493 | |||
| 1886 | Ga0070700_100175075 | |||
| 1887 | Ga0070700_100423562 | |||
| 1888 | Ga0070700_100596212 | |||
| 1889 | Ga0070700_101020529 | |||
| 1890 | Ga0070694_100014526 | |||
| 1891 | Ga0070694_100039958 | |||
| 1892 | Ga0070694_100140686 | |||
| 1893 | Ga0070694_100165388 | |||
| 1894 | Ga0070694_100196134 | |||
| 1895 | Ga0070694_100264580 | |||
| 1896 | Ga0070694_100313053 | |||
| 1897 | Ga0070708_100012676 | |||
| 1898 | Ga0070708_100020105 | |||
| 1899 | Ga0070708_100330687 | |||
| 1900 | Ga0070708_100333718 | |||
| 1901 | Ga0070708_100630868 | |||
| 1902 | Ga0070663_100015490 | |||
| 1903 | Ga0070663_100026685 | |||
| 1904 | Ga0070663_100167075 | |||
| 1905 | Ga0070663_100276739 | |||
| 1906 | Ga0070663_100619475 | |||
| 1907 | Ga0070678_100027358 | |||
| 1908 | Ga0070678_100030925 | |||
| 1909 | Ga0070678_100043829 | |||
| 1910 | Ga0070678_100118294 | |||
| 1911 | Ga0070678_100129772 | |||
| 1912 | Ga0070678_100160733 | |||
| 1913 | Ga0070678_100433178 | |||
| 1914 | Ga0070662_100018956 | |||
| 1915 | Ga0070662_100056258 | |||
| 1916 | Ga0070662_100123105 | |||
| 1917 | Ga0070662_100134448 | |||
| 1918 | Ga0070662_100154025 | |||
| 1919 | Ga0070662_100296099 | |||
| 1920 | Ga0070662_100557926 | |||
| 1921 | Ga0070681_10027349 | |||
| 1922 | Ga0070681_10050977 | |||
| 1923 | Ga0070681_10115013 | |||
| 1924 | Ga0070681_10180881 | |||
| 1925 | Ga0070681_10401148 | |||
| 1926 | Ga0068867_100002315 | |||
| 1927 | Ga0068867_100095276 | |||
| 1928 | Ga0068867_100134435 | |||
| 1929 | Ga0068867_100282352 | |||
| 1930 | Ga0068867_100289451 | |||
| 1931 | Ga0068867_100325653 | |||
| 1932 | Ga0068867_101118876 | |||
| 1933 | Ga0070685_10009790 | |||
| 1934 | Ga0070685_10125487 | |||
| 1935 | Ga0070685_10130354 | |||
| 1936 | Ga0070706_100006207 | |||
| 1937 | Ga0070706_100024563 | |||
| 1938 | Ga0070706_100125633 | |||
| 1939 | Ga0070706_100227086 | |||
| 1940 | Ga0070707_100002022 | |||
| 1941 | Ga0070707_100120856 | |||
| 1942 | Ga0070707_100187496 | |||
| 1943 | Ga0070707_100300131 | |||
| 1944 | Ga0070707_100386701 | |||
| 1945 | Ga0070698_100004478 | |||
| 1946 | Ga0070698_100043520 | |||
| 1947 | Ga0070698_100049546 | |||
| 1948 | Ga0070698_100099041 | |||
| 1949 | Ga0070698_100164185 | |||
| 1950 | Ga0070699_100011412 | |||
| 1951 | Ga0070699_100023450 | |||
| 1952 | Ga0070699_100222654 | |||
| 1953 | Ga0070699_100240434 | |||
| 1954 | Ga0070699_100431267 | |||
| 1955 | Ga0070699_101006660 | |||
| 1956 | Ga0070679_100019732 | |||
| 1957 | Ga0070679_100050160 | |||
| 1958 | Ga0070679_100054574 | |||
| 1959 | Ga0070679_100073240 | |||
| 1960 | Ga0070679_100078766 | |||
| 1961 | Ga0070679_100131480 | |||
| 1962 | Ga0070679_100150113 | |||
| 1963 | Ga0070679_100167631 | |||
| 1964 | Ga0070679_100255592 | |||
| 1965 | Ga0070679_100369417 | |||
| 1966 | Ga0070684_100000342 | |||
| 1967 | Ga0070684_100009249 | |||
| 1968 | Ga0070684_100015145 | |||
| 1969 | Ga0070684_100017530 | |||
| 1970 | Ga0070684_100039395 | |||
| 1971 | Ga0070684_100081446 | |||
| 1972 | Ga0070684_100083784 | |||
| 1973 | Ga0070684_100093145 | |||
| 1974 | Ga0070684_100257549 | |||
| 1975 | Ga0070684_100294679 | |||
| 1976 | Ga0070684_100448688 | |||
| 1977 | Ga0070697_100065417 | |||
| 1978 | Ga0070697_100230814 | |||
| 1979 | Ga0070697_100305754 | |||
| 1980 | Ga0068853_100007377 | |||
| 1981 | Ga0068853_100650680 | |||
| 1982 | Ga0070672_100180692 | |||
| 1983 | Ga0070672_100180942 | |||
| 1984 | Ga0070672_100237052 | |||
| 1985 | Ga0070672_101122689 | |||
| 1986 | Ga0070686_100019311 | |||
| 1987 | Ga0070686_100032890 | |||
| 1988 | Ga0070686_100046897 | |||
| 1989 | Ga0070686_100078211 | |||
| 1990 | Ga0070686_100152514 | |||
| 1991 | Ga0070686_100214841 | |||
| 1992 | Ga0070686_100227249 | |||
| 1993 | Ga0070686_100302843 | |||
| 1994 | Ga0070695_100088184 | |||
| 1995 | Ga0070695_100284694 | |||
| 1996 | Ga0070696_100039680 | |||
| 1997 | Ga0070696_100112185 | |||
| 1998 | Ga0070696_100127897 | |||
| 1999 | Ga0070696_100164253 | |||
| 2000 | Ga0070696_100430723 | |||
| 2001 | Ga0070696_100493859 | |||
| 2002 | Ga0070696_100844268 | |||
| 2003 | Ga0070693_100008362 | |||
| 2004 | Ga0070693_100055804 | |||
| 2005 | Ga0070693_100066044 | |||
| 2006 | Ga0070693_100073369 | |||
| 2007 | Ga0070693_100079776 | |||
| 2008 | Ga0070693_100265488 | |||
| 2009 | Ga0070704_100022434 | |||
| 2010 | Ga0070704_100139357 | |||
| 2011 | Ga0070704_100270852 | |||
| 2012 | Ga0070704_100414289 | |||
| 2013 | Ga0068855_100008382 | |||
| 2014 | Ga0068855_100025796 | |||
| 2015 | Ga0068855_100219303 | |||
| 2016 | Ga0068855_100556898 | |||
| 2017 | Ga0070664_100092746 | |||
| 2018 | Ga0070664_100263806 | |||
| 2019 | Ga0070664_100347399 | |||
| 2020 | Ga0070664_100370321 | |||
| 2021 | Ga0070664_100586067 | |||
| 2022 | Ga0070664_100876614 | |||
| 2023 | Ga0068857_100013085 | |||
| 2024 | Ga0068857_100020562 | |||
| 2025 | Ga0068857_100057932 | |||
| 2026 | Ga0068857_100106141 | |||
| 2027 | Ga0068857_100202950 | |||
| 2028 | Ga0068854_100022150 | |||
| 2029 | Ga0068854_100213083 | |||
| 2030 | Ga0068854_100394242 | |||
| 2031 | Ga0068854_100516616 | |||
| 2032 | Ga0068856_100005088 | |||
| 2033 | Ga0068856_100040289 | |||
| 2034 | Ga0068856_100072409 | |||
| 2035 | Ga0068856_100102293 | |||
| 2036 | Ga0068856_100121930 | |||
| 2037 | Ga0068856_100164880 | |||
| 2038 | Ga0068856_100228864 | |||
| 2039 | Ga0068856_100423691 | |||
| 2040 | Ga0068856_101024262 | |||
| 2041 | Ga0070702_100014762 | |||
| 2042 | Ga0070702_100038923 | |||
| 2043 | Ga0070702_100063194 | |||
| 2044 | Ga0070702_100282603 | |||
| 2045 | Ga0068852_100051251 | |||
| 2046 | Ga0068852_100171861 | |||
| 2047 | Ga0068852_100185938 | |||
| 2048 | Ga0068852_100834025 | |||
| 2049 | Ga0068859_100491916 | |||
| 2050 | Ga0068864_100139766 | |||
| 2051 | Ga0068864_100236692 | |||
| 2052 | Ga0068864_100477628 | |||
| 2053 | Ga0068864_100865333 | |||
| 2054 | Ga0068866_10025354 | |||
| 2055 | Ga0068866_10085626 | |||
| 2056 | Ga0068866_10116941 | |||
| 2057 | Ga0068866_10213196 | |||
| 2058 | Ga0068866_10246261 | |||
| 2059 | Ga0068861_100018944 | |||
| 2060 | Ga0068861_100741194 | |||
| 2061 | Ga0068851_10086844 | |||
| 2062 | Ga0068851_10173745 | |||
| 2063 | Ga0068851_10227978 | |||
| 2064 | Ga0068851_10562836 | |||
| 2065 | Ga0068870_10041843 | |||
| 2066 | Ga0068870_10135662 | |||
| 2067 | Ga0068863_100284147 | |||
| 2068 | Ga0068858_100104693 | |||
| 2069 | Ga0068858_100279512 | |||
| 2070 | Ga0068860_100112623 | |||
| 2071 | Ga0068862_100250283 | |||
| 2072 | Ga0068862_100347600 | |||
| 2073 | Ga0068862_100611005 | |||
| 2074 | Ga0068862_100731564 | |||
| 2075 | Ga0068862_101162249 | |||
| 2076 | Ga0081455_10006147 | |||
| 2077 | Ga0081455_10006677 | |||
| 2078 | Ga0081455_10020524 | |||
| 2079 | Ga0081455_10126899 | |||
| 2080 | Ga0081455_10198656 | |||
| 2081 | Ga0081455_10582348 | |||
| 2082 | Ga0081538_10000764 | |||
| 2083 | Ga0081538_10014126 | |||
| 2084 | Ga0081538_10018658 | |||
| 2085 | Ga0081538_10034860 | |||
| 2086 | Ga0081540_1008364 | |||
| 2087 | Ga0081539_10000216 | |||
| 2088 | Ga0081539_10103106 | |||
| 2089 | Ga0070717_10156317 | |||
| 2090 | Ga0070717_10292264 | |||
| 2091 | Ga0075365_10135409 | |||
| 2092 | Ga0075365_10282217 | |||
| 2093 | Ga0075364_10001325 | |||
| 2094 | Ga0075432_10000201 | |||
| 2095 | Ga0075432_10013296 | |||
| 2096 | Ga0075432_10040921 | |||
| 2097 | Ga0075432_10047739 | |||
| 2098 | Ga0070715_10117207 | |||
| 2099 | Ga0070715_10141310 | |||
| 2100 | Ga0070716_100078030 | |||
| 2101 | Ga0070716_100394361 | |||
| 2102 | Ga0070712_100006400 | |||
| 2103 | Ga0070712_100006610 | |||
| 2104 | Ga0070712_100028051 | |||
| 2105 | Ga0070712_100053477 | |||
| 2106 | Ga0070712_100102684 | |||
| 2107 | Ga0070712_100106362 | |||
| 2108 | Ga0070712_100115383 | |||
| 2109 | Ga0070712_100192106 | |||
| 2110 | Ga0070712_100349392 | |||
| 2111 | Ga0070712_100404309 | |||
| 2112 | Ga0070712_100526557 | |||
| 2113 | Ga0075427_10007459 | |||
| 2114 | Ga0097621_100057793 | |||
| 2115 | Ga0097621_100088753 | |||
| 2116 | Ga0097621_100244488 | |||
| 2117 | Ga0097621_100378999 | |||
| 2118 | Ga0097621_100467366 | |||
| 2119 | Ga0097621_101749827 | |||
| 2120 | Ga0068871_100004486 | |||
| 2121 | Ga0068871_100246448 | |||
| 2122 | Ga0068871_100264876 | |||
| 2123 | Ga0068871_100343459 | |||
| 2124 | Ga0075428_100000774 | |||
| 2125 | Ga0075428_100002031 | |||
| 2126 | Ga0075428_100093545 | |||
| 2127 | Ga0075428_101449496 | |||
| 2128 | Ga0075430_100027751 | |||
| 2129 | Ga0075430_100102342 | |||
| 2130 | Ga0075430_100563274 | |||
| 2131 | Ga0075430_100965442 | |||
| 2132 | Ga0075431_100002483 | |||
| 2133 | Ga0075431_100044423 | |||
| 2134 | Ga0075431_100057225 | |||
| 2135 | Ga0075431_100145523 | |||
| 2136 | Ga0075433_10000133 | |||
| 2137 | Ga0075433_10005909 | |||
| 2138 | Ga0075433_10007723 | |||
| 2139 | Ga0075433_10102380 | |||
| 2140 | Ga0075433_10118349 | |||
| 2141 | Ga0075433_10559693 | |||
| 2142 | Ga0075434_100001881 | |||
| 2143 | Ga0075434_100020464 | |||
| 2144 | Ga0075434_100084936 | |||
| 2145 | Ga0075434_100165837 | |||
| 2146 | Ga0075434_100218855 | |||
| 2147 | Ga0075434_100615758 | |||
| 2148 | Ga0075429_100041411 | |||
| 2149 | Ga0075429_100049275 | |||
| 2150 | Ga0075429_100079816 | |||
| 2151 | Ga0075429_100276969 | |||
| 2152 | Ga0075429_100730940 | |||
| 2153 | Ga0068865_100007046 | |||
| 2154 | Ga0068865_100074727 | |||
| 2155 | Ga0068865_100176640 | |||
| 2156 | Ga0068865_100207216 | |||
| 2157 | Ga0068865_100281732 | |||
| 2158 | Ga0068865_100351071 | |||
| 2159 | Ga0068865_100503599 | |||
| 2160 | Ga0068865_101109026 | |||
| 2161 | Ga0075436_100001284 | |||
| 2162 | Ga0075436_100003942 | |||
| 2163 | Ga0075436_100004236 | |||
| 2164 | Ga0075436_100057753 | |||
| 2165 | Ga0075436_100323711 | |||
| 2166 | Ga0097620_100491875 | |||
| 2167 | Ga0075435_100014263 | |||
| 2168 | Ga0075435_100019104 | |||
| 2169 | Ga0075435_100037377 | |||
| 2170 | Ga0075435_100076699 | |||
| 2171 | Ga0075435_100173092 | |||
| 2172 | Ga0075435_100277653 | |||
| 2173 | Ga0075435_100281594 | |||
| 2174 | Ga0075435_100292092 | |||
| 2175 | Ga0075435_100464856 | |||
| 2176 | Ga0075435_100487801 | |||
| 2177 | Ga0105240_10022187 | |||
| 2178 | Ga0105240_10114196 | |||
| 2179 | Ga0105240_10142351 | |||
| 2180 | Ga0105240_11303316 | |||
| 2181 | Ga0111539_10002272 | |||
| 2182 | Ga0111539_10009515 | |||
| 2183 | Ga0111539_10010606 | |||
| 2184 | Ga0111539_10016586 | |||
| 2185 | Ga0111539_10036464 | |||
| 2186 | Ga0111539_10061251 | |||
| 2187 | Ga0111539_10149634 | |||
| 2188 | Ga0111539_10264359 | |||
| 2189 | Ga0111539_10555615 | |||
| 2190 | Ga0111539_10574942 | |||
| 2191 | Ga0111539_10678807 | |||
| 2192 | Ga0111539_11320136 | |||
| 2193 | Ga0105245_10007080 | |||
| 2194 | Ga0105245_10011640 | |||
| 2195 | Ga0105245_10024533 | |||
| 2196 | Ga0105245_10026607 | |||
| 2197 | Ga0105245_10028456 | |||
| 2198 | Ga0105245_10028847 | |||
| 2199 | Ga0105245_10042407 | |||
| 2200 | Ga0105245_10059341 | |||
| 2201 | Ga0105245_10075395 | |||
| 2202 | Ga0105245_10128200 | |||
| 2203 | Ga0105245_10140582 | |||
| 2204 | Ga0105245_10157652 | |||
| 2205 | Ga0105245_10329598 | |||
| 2206 | Ga0105245_10851477 | |||
| 2207 | Ga0105245_10852107 | |||
| 2208 | Ga0105245_10996961 | |||
| 2209 | Ga0105247_10016445 | |||
| 2210 | Ga0105247_10732856 | |||
| 2211 | Ga0114129_10000663 | |||
| 2212 | Ga0114129_10003551 | |||
| 2213 | Ga0114129_10007601 | |||
| 2214 | Ga0114129_10016641 | |||
| 2215 | Ga0114129_10083230 | |||
| 2216 | Ga0114129_10091073 | |||
| 2217 | Ga0114129_10123081 | |||
| 2218 | Ga0114129_10221973 | |||
| 2219 | Ga0114129_10598070 | |||
| 2220 | Ga0114129_10637090 | |||
| 2221 | Ga0114129_10725949 | |||
| 2222 | Ga0105243_10021096 | |||
| 2223 | Ga0105243_10110690 | |||
| 2224 | Ga0105243_10181951 | |||
| 2225 | Ga0105243_10204437 | |||
| 2226 | Ga0105243_10328997 | |||
| 2227 | Ga0105243_10453316 | |||
| 2228 | Ga0105243_10459308 | |||
| 2229 | Ga0105243_10546857 | |||
| 2230 | Ga0105243_10964355 | |||
| 2231 | Ga0105241_10083083 | |||
| 2232 | Ga0105241_10564120 | |||
| 2233 | Ga0105242_10015704 | |||
| 2234 | Ga0105242_10137307 | |||
| 2235 | Ga0105242_10154221 | |||
| 2236 | Ga0105242_10158893 | |||
| 2237 | Ga0105242_10174038 | |||
| 2238 | Ga0105242_10215199 | |||
| 2239 | Ga0105242_10229415 | |||
| 2240 | Ga0105242_10241866 | |||
| 2241 | Ga0105242_10524395 | |||
| 2242 | Ga0105242_10694448 | |||
| 2243 | Ga0105248_10109949 | |||
| 2244 | Ga0105248_10113973 | |||
| 2245 | Ga0105248_10147821 | |||
| 2246 | Ga0105248_10284847 | |||
| 2247 | Ga0105248_10414893 | |||
| 2248 | Ga0105248_11082732 | |||
| 2249 | Ga0105237_10218584 | |||
| 2250 | Ga0105238_10049251 | |||
| 2251 | Ga0105238_10383819 | |||
| 2252 | Ga0105238_11682101 | |||
| 2253 | Ga0105249_10307386 | |||
| 2254 | Ga0105249_10495079 | |||
| 2255 | Ga0105249_10653673 | |||
| 2256 | Ga0105249_11235001 | |||
| 2257 | Ga0105239_10046334 | |||
| 2258 | Ga0105239_10073026 | |||
| 2259 | Ga0105239_10076336 | |||
| 2260 | Ga0105239_10084503 | |||
| 2261 | Ga0105239_10103549 | |||
| 2262 | Ga0105239_10120656 | |||
| 2263 | Ga0105239_10129347 | |||
| 2264 | Ga0105239_10154230 | |||
| 2265 | Ga0105239_10221894 | |||
| 2266 | Ga0105239_10277416 | |||
| 2267 | Ga0105246_10016139 | |||
| 2268 | Ga0105246_10048258 | |||
| 2269 | Ga0105246_10050258 | |||
| 2270 | Ga0105246_10327946 | |||
| 2271 | Ga0105246_10860071 | |||
| 2272 | Ga0157325_1007885 | |||
| 2273 | Ga0157324_1004659 | |||
| 2274 | Ga0157327_1016704 | |||
| 2275 | Ga0157373_10114235 | |||
| 2276 | Ga0157373_10248419 | |||
| 2277 | Ga0157373_10278117 | |||
| 2278 | Ga0157373_10300410 | |||
| 2279 | Ga0157373_10537041 | |||
| 2280 | Ga0157371_10003563 | |||
| 2281 | Ga0157371_10060914 | |||
| 2282 | Ga0157371_10275444 | |||
| 2283 | Ga0157371_10459776 | |||
| 2284 | Ga0157370_10016121 | |||
| 2285 | Ga0157370_10020979 | |||
| 2286 | Ga0157370_10124140 | |||
| 2287 | Ga0157370_10337757 | |||
| 2288 | Ga0157370_10565244 | |||
| 2289 | Ga0157370_11160420 | |||
| 2290 | Ga0157369_10002160 | |||
| 2291 | Ga0157369_10003362 | |||
| 2292 | Ga0157369_10006754 | |||
| 2293 | Ga0157369_10035601 | |||
| 2294 | Ga0157369_10127262 | |||
| 2295 | Ga0157369_10156689 | |||
| 2296 | Ga0157369_10623255 | |||
| 2297 | Ga0157369_10755745 | |||
| 2298 | Ga0157374_10043337 | |||
| 2299 | Ga0157374_10093198 | |||
| 2300 | Ga0157374_10429192 | |||
| 2301 | Ga0157378_10025081 | |||
| 2302 | Ga0157378_10159666 | |||
| 2303 | Ga0157378_10306391 | |||
| 2304 | Ga0157378_10711648 | |||
| 2305 | Ga0157378_10894279 | |||
| 2306 | Ga0163162_10119231 | |||
| 2307 | Ga0163162_10313405 | |||
| 2308 | Ga0163162_10495745 | |||
| 2309 | Ga0163162_10781830 | |||
| 2310 | Ga0163162_12326967 | |||
| 2311 | Ga0157372_10030229 | |||
| 2312 | Ga0157372_10043097 | |||
| 2313 | Ga0157372_10086950 | |||
| 2314 | Ga0157372_10173725 | |||
| 2315 | Ga0157372_10176750 | |||
| 2316 | Ga0157372_10316070 | |||
| 2317 | Ga0157372_10673858 | |||
| 2318 | Ga0157372_11023478 | |||
| 2319 | Ga0157375_10018750 | |||
| 2320 | Ga0157375_10019161 | |||
| 2321 | Ga0157375_10089746 | |||
| 2322 | Ga0157375_10141444 | |||
| 2323 | Ga0157375_10143374 | |||
| 2324 | Ga0157375_10167068 | |||
| 2325 | Ga0157375_10268918 | |||
| 2326 | Ga0157375_10301881 | |||
| 2327 | Ga0157375_10483062 | |||
| 2328 | Ga0157375_10560798 | |||
| 2329 | Ga0157375_10640288 | |||
| 2330 | Ga0163163_10052265 | |||
| 2331 | Ga0163163_10108712 | |||
| 2332 | Ga0163163_10265444 | |||
| 2333 | Ga0157380_10006747 | |||
| 2334 | Ga0157380_10011859 | |||
| 2335 | Ga0157380_10025380 | |||
| 2336 | Ga0157380_11253695 | |||
| 2337 | Ga0157380_12005933 | |||
| 2338 | Ga0182008_10007008 | |||
| 2339 | Ga0182008_10077019 | |||
| 2340 | Ga0182008_10256514 | |||
| 2341 | Ga0157377_10002487 | |||
| 2342 | Ga0157377_10012588 | |||
| 2343 | Ga0157377_10017171 | |||
| 2344 | Ga0157377_10097193 | |||
| 2345 | Ga0157377_10211253 | |||
| 2346 | Ga0157379_10043254 | |||
| 2347 | Ga0157379_10126575 | |||
| 2348 | Ga0157379_10334167 | |||
| 2349 | Ga0157376_10019379 | |||
| 2350 | Ga0157376_10134939 | |||
| 2351 | Ga0157376_10139764 | |||
| 2352 | Ga0157376_11127829 | |||
| 2353 | Ga0157376_11313201 | |||
| 2354 | Ga0157376_11577343 | |||
| 2355 | Ga0182007_10004362 | |||
| 2356 | Ga0163161_10006188 | |||
| 2357 | Ga0163161_10189304 | |||
| 2358 | Ga0163161_10640528 | |||
| 2359 | Ga0197907_10041679 | |||
| 2360 | Ga0206356_10890542 | |||
| 2361 | Ga0206356_11882679 | |||
| 2362 | Ga0206354_10253245 | |||
| 2363 | Ga0206354_10587909 | |||
| 2364 | Ga0206353_10293431 | |||
| 2365 | Ga0206353_10842030 | |||
| 2366 | Ga0206353_10986072 | |||
| 2367 | Ga0224712_10017277 | |||
| 2368 | Ga0207656_10023877 | |||
| 2369 | Ga0207656_10096929 | |||
| 2370 | Ga0207656_10129649 | |||
| 2371 | Ga0207656_10200309 | |||
| 2372 | Ga0207653_10002122 | |||
| 2373 | Ga0207692_10096058 | |||
| 2374 | Ga0207692_10096325 | |||
| 2375 | Ga0207692_10253614 | |||
| 2376 | Ga0207692_10554728 | |||
| 2377 | Ga0207642_10024494 | |||
| 2378 | Ga0207642_10049354 | |||
| 2379 | Ga0207642_10050467 | |||
| 2380 | Ga0207642_10275635 | |||
| 2381 | Ga0207710_10018241 | |||
| 2382 | Ga0207710_10040680 | |||
| 2383 | Ga0207688_10005675 | |||
| 2384 | Ga0207688_10021827 | |||
| 2385 | Ga0207688_10023832 | |||
| 2386 | Ga0207688_10040439 | |||
| 2387 | Ga0207688_10063433 | |||
| 2388 | Ga0207688_10122065 | |||
| 2389 | Ga0207685_10025780 | |||
| 2390 | Ga0207685_10035508 | |||
| 2391 | Ga0207685_10045849 | |||
| 2392 | Ga0207699_10057489 | |||
| 2393 | Ga0207699_10082856 | |||
| 2394 | Ga0207699_10162555 | |||
| 2395 | Ga0207645_10031078 | |||
| 2396 | Ga0207643_10004174 | |||
| 2397 | Ga0207705_10014098 | |||
| 2398 | Ga0207705_10022683 | |||
| 2399 | Ga0207705_10052202 | |||
| 2400 | Ga0207705_10066861 | |||
| 2401 | Ga0207684_10196398 | |||
| 2402 | Ga0207684_10787945 | |||
| 2403 | Ga0207654_10043072 | |||
| 2404 | Ga0207654_10334482 | |||
| 2405 | Ga0207707_10035823 | |||
| 2406 | Ga0207707_10276018 | |||
| 2407 | Ga0207707_10338397 | |||
| 2408 | Ga0207695_10023618 | |||
| 2409 | Ga0207695_10121774 | |||
| 2410 | Ga0207695_10330496 | |||
| 2411 | Ga0207695_10588406 | |||
| 2412 | Ga0207671_10714453 | |||
| 2413 | Ga0207693_10000175 | |||
| 2414 | Ga0207693_10001072 | |||
| 2415 | Ga0207693_10009471 | |||
| 2416 | Ga0207693_10012906 | |||
| 2417 | Ga0207693_10016758 | |||
| 2418 | Ga0207693_10030223 | |||
| 2419 | Ga0207693_10036572 | |||
| 2420 | Ga0207693_10078717 | |||
| 2421 | Ga0207693_10090882 | |||
| 2422 | Ga0207663_10032456 | |||
| 2423 | Ga0207663_10087857 | |||
| 2424 | Ga0207663_10257933 | |||
| 2425 | Ga0207663_10299225 | |||
| 2426 | Ga0207663_10342064 | |||
| 2427 | Ga0207663_10400132 | |||
| 2428 | Ga0207660_10015622 | |||
| 2429 | Ga0207660_10263233 | |||
| 2430 | Ga0207660_10363601 | |||
| 2431 | Ga0207660_10390846 | |||
| 2432 | Ga0207660_10608000 | |||
| 2433 | Ga0207662_10011405 | |||
| 2434 | Ga0207662_10121023 | |||
| 2435 | Ga0207662_10347960 | |||
| 2436 | Ga0207657_10002558 | |||
| 2437 | Ga0207657_10010921 | |||
| 2438 | Ga0207657_10018459 | |||
| 2439 | Ga0207657_10073781 | |||
| 2440 | Ga0207657_10128935 | |||
| 2441 | Ga0207657_10253886 | |||
| 2442 | Ga0207649_10056776 | |||
| 2443 | Ga0207649_10144312 | |||
| 2444 | Ga0207649_10194759 | |||
| 2445 | Ga0207652_10006237 | |||
| 2446 | Ga0207652_10041641 | |||
| 2447 | Ga0207652_10051672 | |||
| 2448 | Ga0207652_10157338 | |||
| 2449 | Ga0207652_10203299 | |||
| 2450 | Ga0207652_10257332 | |||
| 2451 | Ga0207652_10522337 | |||
| 2452 | Ga0207646_10009655 | |||
| 2453 | Ga0207681_10095560 | |||
| 2454 | Ga0207681_10164526 | |||
| 2455 | Ga0207681_10177730 | |||
| 2456 | Ga0207694_10080014 | |||
| 2457 | Ga0207694_10426934 | |||
| 2458 | Ga0207694_10636978 | |||
| 2459 | Ga0207659_10170712 | |||
| 2460 | Ga0207659_10194717 | |||
| 2461 | Ga0207659_10242689 | |||
| 2462 | Ga0207687_10005340 | |||
| 2463 | Ga0207687_10018927 | |||
| 2464 | Ga0207687_10053025 | |||
| 2465 | Ga0207687_10054041 | |||
| 2466 | Ga0207687_10095291 | |||
| 2467 | Ga0207687_10172762 | |||
| 2468 | Ga0207687_10333636 | |||
| 2469 | Ga0207687_10470765 | |||
| 2470 | Ga0207687_10800001 | |||
| 2471 | Ga0207700_10000002 | |||
| 2472 | Ga0207700_10555415 | |||
| 2473 | Ga0207700_10697971 | |||
| 2474 | Ga0207664_10077234 | |||
| 2475 | Ga0207664_10260579 | |||
| 2476 | Ga0207664_10685800 | |||
| 2477 | Ga0207664_11118578 | |||
| 2478 | Ga0207644_10213067 | |||
| 2479 | Ga0207690_10008748 | |||
| 2480 | Ga0207690_10141831 | |||
| 2481 | Ga0207690_10160688 | |||
| 2482 | Ga0207690_10329478 | |||
| 2483 | Ga0207690_11170111 | |||
| 2484 | Ga0207706_10003556 | |||
| 2485 | Ga0207706_10013854 | |||
| 2486 | Ga0207706_10030669 | |||
| 2487 | Ga0207706_10036222 | |||
| 2488 | Ga0207706_10036519 | |||
| 2489 | Ga0207706_10133937 | |||
| 2490 | Ga0207706_10146465 | |||
| 2491 | Ga0207686_10077504 | |||
| 2492 | Ga0207686_10105372 | |||
| 2493 | Ga0207686_10166739 | |||
| 2494 | Ga0207686_10805019 | |||
| 2495 | Ga0207709_10166129 | |||
| 2496 | Ga0207709_10169264 | |||
| 2497 | Ga0207709_10508841 | |||
| 2498 | Ga0207709_10546424 | |||
| 2499 | Ga0207670_10021843 | |||
| 2500 | Ga0207670_10463714 | |||
| 2501 | Ga0207669_10010671 | |||
| 2502 | Ga0207669_10047530 | |||
| 2503 | Ga0207669_10161491 | |||
| 2504 | Ga0207669_10465285 | |||
| 2505 | Ga0207669_10514661 | |||
| 2506 | Ga0207669_10560091 | |||
| 2507 | Ga0207669_10736320 | |||
| 2508 | Ga0207704_10141778 | |||
| 2509 | Ga0207704_10145716 | |||
| 2510 | Ga0207704_10237308 | |||
| 2511 | Ga0207704_10368862 | |||
| 2512 | Ga0207704_10719747 | |||
| 2513 | Ga0207665_10001197 | |||
| 2514 | Ga0207665_10003608 | |||
| 2515 | Ga0207665_10004650 | |||
| 2516 | Ga0207665_10019549 | |||
| 2517 | Ga0207665_10225892 | |||
| 2518 | Ga0207691_10053718 | |||
| 2519 | Ga0207691_10098174 | |||
| 2520 | Ga0207691_10270938 | |||
| 2521 | Ga0207691_10347061 | |||
| 2522 | Ga0207711_10131993 | |||
| 2523 | Ga0207711_10218500 | |||
| 2524 | Ga0207711_11048103 | |||
| 2525 | Ga0207689_10073245 | |||
| 2526 | Ga0207689_10143419 | |||
| 2527 | Ga0207689_10369624 | |||
| 2528 | Ga0207689_11023593 | |||
| 2529 | Ga0207661_10000790 | |||
| 2530 | Ga0207661_10002323 | |||
| 2531 | Ga0207661_10010512 | |||
| 2532 | Ga0207661_10062532 | |||
| 2533 | Ga0207661_10080227 | |||
| 2534 | Ga0207661_10126239 | |||
| 2535 | Ga0207661_10134209 | |||
| 2536 | Ga0207661_10256824 | |||
| 2537 | Ga0207661_10292335 | |||
| 2538 | Ga0207661_10387091 | |||
| 2539 | Ga0207661_10474657 | |||
| 2540 | Ga0207661_10515710 | |||
| 2541 | Ga0207661_10582928 | |||
| 2542 | Ga0207661_10589881 | |||
| 2543 | Ga0207661_10622617 | |||
| 2544 | Ga0207661_10757286 | |||
| 2545 | Ga0207679_10033703 | |||
| 2546 | Ga0207679_10047393 | |||
| 2547 | Ga0207679_10136827 | |||
| 2548 | Ga0207679_10195475 | |||
| 2549 | Ga0207679_10315647 | |||
| 2550 | Ga0207679_10425553 | |||
| 2551 | Ga0207679_10428305 | |||
| 2552 | Ga0207679_10452852 | |||
| 2553 | Ga0207679_10943350 | |||
| 2554 | Ga0207667_10031768 | |||
| 2555 | Ga0207667_10051694 | |||
| 2556 | Ga0207667_10059939 | |||
| 2557 | Ga0207667_10148963 | |||
| 2558 | Ga0207667_10793009 | |||
| 2559 | Ga0207667_10855993 | |||
| 2560 | Ga0207667_10974821 | |||
| 2561 | Ga0207651_10076785 | |||
| 2562 | Ga0207651_10251970 | |||
| 2563 | Ga0207651_10387205 | |||
| 2564 | Ga0207651_10753009 | |||
| 2565 | Ga0207712_10060046 | |||
| 2566 | Ga0207712_10109907 | |||
| 2567 | Ga0207712_10539076 | |||
| 2568 | Ga0207668_10088245 | |||
| 2569 | Ga0207668_10305367 | |||
| 2570 | Ga0207668_10424588 | |||
| 2571 | Ga0207640_10002503 | |||
| 2572 | Ga0207640_10058737 | |||
| 2573 | Ga0207640_10107669 | |||
| 2574 | Ga0207640_10135779 | |||
| 2575 | Ga0207640_11066528 | |||
| 2576 | Ga0207658_10259681 | |||
| 2577 | Ga0207677_10139385 | |||
| 2578 | Ga0207677_10222563 | |||
| 2579 | Ga0207677_10249635 | |||
| 2580 | Ga0207677_10256211 | |||
| 2581 | Ga0207677_10484967 | |||
| 2582 | Ga0207677_10735175 | |||
| 2583 | Ga0207677_10860483 | |||
| 2584 | Ga0207703_10392749 | |||
| 2585 | Ga0207639_10011780 | |||
| 2586 | Ga0207639_10042818 | |||
| 2587 | Ga0207639_10588827 | |||
| 2588 | Ga0207678_10034649 | |||
| 2589 | Ga0207678_10087157 | |||
| 2590 | Ga0207678_10120775 | |||
| 2591 | Ga0207678_10362464 | |||
| 2592 | Ga0207678_10703067 | |||
| 2593 | Ga0207708_10000614 | |||
| 2594 | Ga0207708_10117590 | |||
| 2595 | Ga0207708_10186912 | |||
| 2596 | Ga0207708_10273227 | |||
| 2597 | Ga0207708_10288960 | |||
| 2598 | Ga0207708_10434299 | |||
| 2599 | Ga0207708_10835409 | |||
| 2600 | Ga0207702_10049104 | |||
| 2601 | Ga0207702_10113944 | |||
| 2602 | Ga0207702_10136923 | |||
| 2603 | Ga0207702_10141001 | |||
| 2604 | Ga0207702_10168847 | |||
| 2605 | Ga0207702_10172907 | |||
| 2606 | Ga0207702_10176895 | |||
| 2607 | Ga0207702_10200881 | |||
| 2608 | Ga0207702_10356657 | |||
| 2609 | Ga0207702_10449040 | |||
| 2610 | Ga0207702_10558220 | |||
| 2611 | Ga0207702_11220212 | |||
| 2612 | Ga0207702_11229844 | |||
| 2613 | Ga0207641_11046919 | |||
| 2614 | Ga0207648_10000312 | |||
| 2615 | Ga0207648_10001463 | |||
| 2616 | Ga0207648_10090312 | |||
| 2617 | Ga0207648_10169946 | |||
| 2618 | Ga0207648_10251034 | |||
| 2619 | Ga0207648_10274417 | |||
| 2620 | Ga0207648_10970055 | |||
| 2621 | Ga0207676_10489385 | |||
| 2622 | Ga0207676_10491253 | |||
| 2623 | Ga0207676_11017051 | |||
| 2624 | Ga0207674_10001702 | |||
| 2625 | Ga0207674_10009621 | |||
| 2626 | Ga0207674_10045075 | |||
| 2627 | Ga0207674_10083130 | |||
| 2628 | Ga0207674_10485558 | |||
| 2629 | Ga0207675_100000145 | |||
| 2630 | Ga0207675_100067391 | |||
| 2631 | Ga0207675_100091809 | |||
| 2632 | Ga0207675_100370464 | |||
| 2633 | Ga0207675_100573288 | |||
| 2634 | Ga0207675_101352257 | |||
| 2635 | Ga0207683_10000131 | |||
| 2636 | Ga0207683_10008825 | |||
| 2637 | Ga0207683_10018166 | |||
| 2638 | Ga0207683_10063557 | |||
| 2639 | Ga0207683_10071347 | |||
| 2640 | Ga0207683_10083688 | |||
| 2641 | Ga0207683_10208009 | |||
| 2642 | Ga0207683_10262658 | |||
| 2643 | Ga0207683_10516608 | |||
| 2644 | Ga0207683_10661132 | |||
| 2645 | Ga0207698_10104599 | |||
| 2646 | Ga0207698_10150620 | |||
| 2647 | Ga0207698_10202659 | |||
| 2648 | Ga0207698_10285675 | |||
| 2649 | Ga0207698_10760031 | |||
| 2650 | Ga0209998_10021250 | |||
| 2651 | Ga0207428_10000277 | |||
| 2652 | Ga0207428_10003042 | |||
| 2653 | Ga0207428_10015623 | |||
| 2654 | Ga0207428_10016230 | |||
| 2655 | Ga0207428_10046061 | |||
| 2656 | Ga0207428_10052302 | |||
| 2657 | Ga0207428_10170406 | |||
| 2658 | Ga0268266_10096313 | |||
| 2659 | Ga0268266_10837476 | |||
| 2660 | Ga0268266_10982926 | |||
| 2661 | Ga0268265_10094612 | |||
| 2662 | Ga0268265_10394073 | |||
| 2663 | Ga0268265_10729565 | |||
| 2664 | Ga0268264_10396007 | |||
| 2665 | Ga0268264_10441464 | |||
| 2666 | Ga0265319_1009788 | |||
| 2667 | Ga0265319_1069717 | |||
| 2668 | Ga0265334_10014340 | |||
| 2669 | Ga0265318_10002132 | |||
| 2670 | Ga0265318_10058364 | |||
| 2671 | Ga0265318_10075539 | |||
| 2672 | Ga0265318_10088624 | |||
| 2673 | Ga0265322_10006748 | |||
| 2674 | Ga0265336_10013425 | |||
| 2675 | Ga0265338_10025789 | |||
| 2676 | Ga0265338_10042085 | |||
| 2677 | Ga0265338_10105491 | |||
| 2678 | Ga0265330_10016111 | |||
| 2679 | Ga0265320_10035728 | |||
| 2680 | Ga0265320_10124055 | |||
| 2681 | Ga0265320_10264719 | |||
| 2682 | Ga0265329_10107343 | |||
| 2683 | Ga0265340_10010232 | |||
| 2684 | Ga0265331_10063927 | |||
| 2685 | Ga0265327_10017402 | |||
| 2686 | Ga0265327_10102427 | |||
| 2687 | Ga0265316_10026001 | |||
| 2688 | Ga0265316_10121193 | |||
| 2689 | Ga0307405_10022439 | |||
| 2690 | Ga0307405_10096560 | |||
| 2691 | Ga0307413_10017439 | |||
| 2692 | Ga0307413_10042361 | |||
| 2693 | Ga0307410_10003106 | |||
| 2694 | Ga0307410_10065548 | |||
| 2695 | Ga0307410_10120080 | |||
| 2696 | Ga0307410_10448122 | |||
| 2697 | Ga0307406_10335486 | |||
| 2698 | Ga0307412_10179956 | |||
| 2699 | Ga0307409_100038027 | |||
| 2700 | Ga0307409_100043910 | |||
| 2701 | Ga0307409_100079849 | |||
| 2702 | Ga0307416_100007542 | |||
| 2703 | Ga0307416_100125723 | |||
| 2704 | Ga0307416_100193622 | |||
| 2705 | Ga0307416_100257044 | |||
| 2706 | Ga0307416_100430172 | |||
| 2707 | Ga0307416_101161741 | |||
| 2708 | Ga0307411_10049403 | |||
| 2709 | Ga0307415_100003724 | |||
| 2710 | Ga0307415_100025473 | |||
| 2711 | Ga0307415_100060978 | |||
| 2712 | Ga0307415_100135990 | |||
| 2713 | Ga0307415_100453623 | |||
| 2714 | Ga0373948_0002994 | |||
| 2715 | Ga0373948_0003999 | |||
| 2716 | Ga0373950_0002235 | |||
| 2717 | Ga0373958_0018519 | |||
| 2718 | Ga0373938_0085997 | |||
| 2719 | Ga0373926_0022755 | |||
| 2720 | Ga0373929_0003555 | |||
| 2721 | Ga0373929_0006108 | |||
| 2722 | Ga0373929_0109906 | |||
| 2723 | Ga0373940_0105364 | |||
| 2724 | Ga0373944_0031413 | |||
| 2725 | Ga0373944_0097354 | |||
| 2726 | Ga0373951_0034431 | |||
| 2727 | Ga0373952_0006183 | |||
| 2728 | Ga0373932_0114838 | |||
| 2729 | Ga0373932_0127902 | |||
| 2730 | Ga0373936_0050254 | |||
| 2731 | Ga0373941_0000738 | |||
| 2732 | Ga0373941_0030179 | |||
| 2733 | Ga0373945_0007240 | |||
| 2734 | Ga0373960_0042394 | |||
| 2735 | Ga0373943_0011019 | |||
| 2736 | Ga0373943_0016397 | |||
| 2737 | Ga0373946_0010856 | |||
| 2738 | Ga0373946_0118627 | |||
| 2739 | Ga0373942_0131174 | |||
| 2740 | Ga0373961_0014098 | |||
| 2741 | Ga0373961_0035976 | |||
| 2742 | Ga0373962_0025642 | |||
| 2743 | Ga0373962_0030669 | |||
| 2744 | Ga0373962_0034255 | |||
| 2745 | Ga0373931_0025482 | |||
| 2746 | Ga0373931_0083054 | |||
| 2747 | Ga0373931_0091899 | |||
| 2748 | Ga0373931_0178122 | |||
| 2749 | Ga0373935_0021692 | |||
| 2750 | Ga0373927_0193103 | |||
| 2751 | Ga0373947_0003251 | |||
| 2752 | Ga0373947_0110467 | |||
| 2753 | Ga0373925_0073113 | |||
| 2754 | Ga0373925_0318981 | |||
| 2755 | Ga0395899_0001597 | |||
| 2756 | Ga0395899_0004865 | |||
| 2757 | Ga0395899_0006659 | |||
| 2758 | Ga0395899_0010608 | |||
| 2759 | Ga0395899_0012780 | |||
| 2760 | Ga0395899_0031640 | |||
| 2761 | Ga0395899_0064530 | |||
| 2762 | Ga0395899_0113196 | |||
| 2763 | Ga0395899_0116539 | |||
| 2764 | Ga0395899_0119712 | |||
| 2765 | Ga0395899_0185662 | |||
| 2766 | Ga0395899_0234610 | |||
| 2767 | Ga0395899_0239253 | |||
| 2768 | Ga0395899_0534542 | |||
| 2769 | Ga0395900_0002601 | |||
| 2770 | Ga0395900_0013793 | |||
| 2771 | Ga0395900_0014254 | |||
| 2772 | Ga0395900_0015528 | |||
| 2773 | Ga0395900_0017007 | |||
| 2774 | Ga0395900_0021897 | |||
| 2775 | Ga0395900_0023214 | |||
| 2776 | Ga0395900_0025909 | |||
| 2777 | Ga0395900_0036962 | |||
| 2778 | Ga0395900_0049987 | |||
| 2779 | Ga0395900_0055427 | |||
| 2780 | Ga0395900_0169896 | |||
| 2781 | Ga0395900_0188801 | |||
| 2782 | Ga0395900_0223963 | |||
| 2783 | Ga0395900_0326756 | |||
| 2784 | Ga0395900_0328497 | |||
| 2785 | Ga0395900_0403969 | |||
| 2786 | Ga0395900_0437265 | |||
| 2787 | Ga0395900_0701738 | |||
| 2788 | Ga0395900_0727907 | |||
| 2789 | Ga0395900_0920236 | |||
| 2790 | Ga0395900_0925239 | |||
| 2791 | Ga0395900_1012203 | |||
| 2792 | Ga0395898_0008599 | |||
| 2793 | Ga0395898_0008603 | |||
| 2794 | Ga0395898_0009669 | |||
| 2795 | Ga0395898_0014477 | |||
| 2796 | Ga0395898_0015180 | |||
| 2797 | Ga0395898_0017216 | |||
| 2798 | Ga0395898_0022219 | |||
| 2799 | Ga0395898_0022984 | |||
| 2800 | Ga0395898_0028266 | |||
| 2801 | Ga0395898_0035010 | |||
| 2802 | Ga0395898_0035086 | |||
| 2803 | Ga0395898_0082324 | |||
| 2804 | Ga0395898_0101409 | |||
| 2805 | Ga0395898_0108532 | |||
| 2806 | Ga0395898_0116631 | |||
| 2807 | Ga0395898_0117823 | |||
| 2808 | Ga0395898_0187822 | |||
| 2809 | Ga0395898_0277925 | |||
| 2810 | Ga0395898_0307706 | |||
| 2811 | Ga0395898_0373145 | |||
| 2812 | Ga0395898_0554985 | |||
| 2813 | Ga0395898_0808458 | |||
| 2814 | Ga0395898_0901512 | |||
| 2815 | Ga0395898_1039076 | |||
| 2816 | Ga0395905_0006666 | |||
| 2817 | Ga0395905_0009373 | |||
| 2818 | Ga0395905_0010981 | |||
| 2819 | Ga0395905_0011539 | |||
| 2820 | Ga0395905_0012738 | |||
| 2821 | Ga0395905_0017490 | |||
| 2822 | Ga0395905_0021210 | |||
| 2823 | Ga0395905_0024795 | |||
| 2824 | Ga0395905_0025332 | |||
| 2825 | Ga0395905_0052542 | |||
| 2826 | Ga0395905_0082243 | |||
| 2827 | Ga0395905_0097169 | |||
| 2828 | Ga0395905_0113712 | |||
| 2829 | Ga0395905_0128699 | |||
| 2830 | Ga0395905_0179346 | |||
| 2831 | Ga0395905_0236528 | |||
| 2832 | Ga0395905_0876765 | |||
| 2833 | Ga0436364_0798656 | |||
| 2834 | Ga0395901_0001828 | |||
| 2835 | Ga0395901_0007754 | |||
| 2836 | Ga0395901_0015104 | |||
| 2837 | Ga0395901_0015900 | |||
| 2838 | Ga0395901_0016564 | |||
| 2839 | Ga0395901_0020681 | |||
| 2840 | Ga0395901_0029551 | |||
| 2841 | Ga0395901_0029557 | |||
| 2842 | Ga0395901_0029940 | |||
| 2843 | Ga0395901_0031474 | |||
| 2844 | Ga0395901_0039987 | |||
| 2845 | Ga0395901_0050763 | |||
| 2846 | Ga0395901_0052227 | |||
| 2847 | Ga0395901_0092550 | |||
| 2848 | Ga0395901_0102978 | |||
| 2849 | Ga0395901_0123668 | |||
| 2850 | Ga0395901_0156882 | |||
| 2851 | Ga0395901_0165747 | |||
| 2852 | Ga0395901_0177683 | |||
| 2853 | Ga0395901_0193638 | |||
| 2854 | Ga0395901_0197075 | |||
| 2855 | Ga0395901_0245864 | |||
| 2856 | Ga0395901_0287129 | |||
| 2857 | Ga0395901_0313560 | |||
| 2858 | Ga0395901_0343625 | |||
| 2859 | Ga0395901_0387942 | |||
| 2860 | Ga0395901_0536901 | |||
| 2861 | Ga0395901_0589275 | |||
| 2862 | Ga0395901_0789655 | |||
| 2863 | Ga0395901_0980519 | |||
| 2864 | Ga0395901_1244264 | |||
| 2865 | Ga0242420_030463 | |||
| 2866 | Ga0436360_0455670 | |||
| 2867 | Ga0436360_0941596 | |||
| 2868 | Ga0436363_1425632 | |||
| 2869 | Ga0436362_1086374 | |||
| 2870 | Ga0439439_0011931 | |||
| 2871 | Ga0439453_0018093 | |||
| 2872 | Ga0439461_0001443 | |||
| 2873 | Ga0439465_0162439 | |||
| 2874 | Ga0451793_0279402 | |||
| 2875 | Ga0451802_0009325 | |||
| 2876 | Ga0451804_0779885 | |||
| 2877 | Ga0451839_1336994 | |||
| 2878 | Ga0451849_0973077 | |||
| 2879 | Ga0451855_1287824 | |||
| 2880 | Ga0451853_2093963 | |||
| 2881 | Ga0451853_2918064 | |||
| 2882 | Ga0439433_0007045 | |||
| 2883 | Ga0439437_031420 | |||
| 2884 | Ga0439448_0001810 | |||
| 2885 | Ga0439448_0077631 | |||
| 2886 | Ga0439451_010716 | |||
| 2887 | Ga0439454_004042 | |||
| 2888 | Ga0450920_052728 | |||
| 2889 | Ga0450891_006178 | |||
| 2890 | Ga0450905_038503 | |||
| 2891 | Ga0439446_0001808 | |||
| 2892 | Ga0439446_0002871 | |||
| 2893 | Ga0439446_0056712 | |||
| 2894 | Ga0450908_050710 | |||
| 2895 | Ga0439434_0007259 | |||
| 2896 | Ga0439444_0092217 | |||
| 2897 | Ga0439460_0083971 | |||
| 2898 | Ga0466965_0235906 | |||
| 2899 | Ga0466966_0001277 | |||
| 2900 | Ga0466966_0277525 | |||
| 2901 | Ga0466966_0307505 | |||
| 2902 | Ga0466966_0578242 | |||
| 2903 | Ga0466966_0667269 | |||
| 2904 | Ga0466961_0008611 | |||
| 2905 | Ga0466963_0001603 | |||
| 2906 | Ga0466963_0001938 | |||
| 2907 | Ga0466963_0018318 | |||
| 2908 | Ga0466963_0046134 | |||
| 2909 | Ga0466963_0061997 | |||
| 2910 | Ga0466963_0083021 | |||
| 2911 | Ga0466963_0089639 | |||
| 2912 | Ga0466963_0806581 | |||
| 2913 | Ga0466964_0002529 | |||
| 2914 | Ga0466964_0224237 | |||
| 2915 | Ga0466964_0305614 | |||
| 2916 | Ga0466971_0087360 | |||
| 2917 | Ga0466971_0162507 | |||
| 2918 | Ga0466971_0269620 | |||
| 2919 | Ga0466970_0057977 | |||
| 2920 | Ga0466970_0272427 | |||
| 2921 | Ga0466957_0176811 | |||
| 2922 | Ga0466957_0232777 | |||
| 2923 | Ga0466957_0262708 | |||
| 2924 | Ga0466957_0467596 | |||
| 2925 | Ga0466960_0003260 | |||
| 2926 | Ga0466960_0041567 | |||
| 2927 | Ga0466959_0002422 | |||
| 2928 | Ga0466959_0172868 | |||
| 2929 | Ga0466959_0200469 | |||
| 2930 | Ga0451576_0045359 | |||
| 2931 | Ga0451576_0348782 | |||
| 2932 | Ga0451576_0993554 | |||
| 2933 | Ga0466958_0027732 | |||
| 2934 | Ga0466958_0113677 | |||
| 2935 | Ga0466958_0186463 | |||
| 2936 | Ga0466958_0247595 | |||
| 2937 | Ga0466958_0375470 | |||
| 2938 | Ga0466967_0012902 | |||
| 2939 | Ga0466967_0014875 | |||
| 2940 | Ga0466967_0035200 | |||
| 2941 | Ga0466967_0055408 | |||
| 2942 | Ga0466967_0068715 | |||
| 2943 | Ga0466967_0086179 | |||
| 2944 | Ga0466967_0181845 | |||
| 2945 | Ga0466967_0273746 | |||
| 2946 | Ga0466967_0326494 | |||
| 2947 | Ga0466967_0406749 | |||
| 2948 | Ga0466967_0542910 | |||
| 2949 | Ga0466967_0849072 | |||
| 2950 | Ga0495592_0125591 | |||
| 2951 | Ga0495603_0008218 | |||
| 2952 | Ga0495603_0034621 | |||
| 2953 | Ga0495603_0050587 | |||
| 2954 | Ga0495603_0212842 | |||
| 2955 | Ga0495603_0257356 | |||
| 2956 | Ga0495603_0324667 | |||
| 2957 | Ga0495590_0034053 | |||
| 2958 | Ga0495629_0003431 | |||
| 2959 | Ga0495641_0001116 | |||
| 2960 | Ga0495641_0011924 | |||
| 2961 | Ga0495641_0075490 | |||
| 2962 | Ga0495651_0015831 | |||
| 2963 | Ga0495651_0436996 | |||
| 2964 | Ga0495653_0107260 | |||
| 2965 | Ga0495653_0240662 | |||
| 2966 | Ga0495582_0002163 | |||
| 2967 | Ga0495582_0011173 | |||
| 2968 | Ga0495582_0025169 | |||
| 2969 | Ga0495639_0144645 | |||
| 2970 | Ga0495662_0063073 | |||
| 2971 | Ga0495662_0129556 | |||
| 2972 | Ga0495664_0314491 | |||
| 2973 | Ga0495664_0327681 | |||
| 2974 | Ga0495664_0385036 | |||
| 2975 | Ga0495584_0113814 | |||
| 2976 | Ga0495584_0372026 | |||
| 2977 | Ga0495594_0160612 | |||
| 2978 | Ga0495594_0301148 | |||
| 2979 | Ga0495594_0471636 | |||
| 2980 | Ga0495607_0102083 | |||
| 2981 | Ga0495607_0121295 | |||
| 2982 | Ga0495608_0060821 | |||
| 2983 | Ga0495618_0013314 | |||
| 2984 | Ga0495618_0018859 | |||
| 2985 | Ga0495618_0093653 | |||
| 2986 | Ga0495630_0027956 | |||
| 2987 | Ga0495630_0035932 | |||
| 2988 | Ga0495630_0444015 | |||
| 2989 | Ga0495631_0045346 | |||
| 2990 | Ga0495637_0096068 | |||
| 2991 | Ga0495663_0083334 | |||
| 2992 | Ga0495663_0100265 | |||
| 2993 | Ga0495652_0033634 | |||
| 2994 | Ga0495665_0005134 | |||
| 2995 | Ga0495640_0158942 | |||
| 2996 | Ga0495586_0078031 | |||
| 2997 | Ga0495586_0084763 | |||
| 2998 | Ga0495586_0113467 | |||
| 2999 | Ga0495587_0190816 | |||
| 3000 | Ga0495609_0146770 | |||
| 3001 | Ga0495622_0146107 | |||
| 3002 | Ga0495667_0024594 | |||
| 3003 | Ga0495667_0039070 | |||
| 3004 | Ga0495667_0371151 | |||
| 3005 | Ga0495656_0131191 | |||
| 3006 | Ga0495634_0066923 | |||
| 3007 | Ga0495634_0335258 | |||
| 3008 | Ga0495611_0264637 | |||
| 3009 | Ga0495635_0145509 | |||
| 3010 | Ga0495588_0001802 | |||
| 3011 | Ga0495588_0021834 | |||
| 3012 | Ga0495588_0266398 | |||
| 3013 | Ga0495657_0143291 | |||
| 3014 | Ga0495599_0199456 | |||
| 3015 | Ga0495623_0074218 | |||
| 3016 | Ga0495623_0260373 | |||
| 3017 | Ga0495623_0593797 | |||
| 3018 | Ga0495647_0027751 | |||
| 3019 | Ga0495647_0130544 | |||
| 3020 | Ga0495658_0000869 | |||
| 3021 | Ga0495658_0083975 | |||
| 3022 | Ga0495613_0012084 | |||
| 3023 | Ga0495613_0474248 | |||
| 3024 | Ga0495624_0093619 | |||
| 3025 | Ga0495624_0458179 | |||
| 3026 | Ga0495670_0069760 | |||
| 3027 | Ga0495671_0253716 | |||
| 3028 | Ga0495589_0026497 | |||
| 3029 | Ga0495589_0042655 | |||
| 3030 | Ga0495589_0104257 | |||
| 3031 | Ga0495589_0140290 | |||
| 3032 | Ga0495589_0211949 | |||
| 3033 | Ga0495600_0089247 | |||
| 3034 | Ga0495600_0318694 | |||
| 3035 | Ga0495581_0000725 | |||
| 3036 | Ga0495581_0022828 | |||
| 3037 | Ga0495581_0198034 | |||
| 3038 | Ga0495604_0047972 | |||
| 3039 | Ga0495636_0034004 | |||
| 3040 | Ga0495674_0035968 | |||
| 3041 | Ga0495674_0860101 | |||
| 3042 | Ga0495676_0001839 | |||
| 3043 | Ga0495676_0010892 | |||
| 3044 | Ga0495680_0005085 | |||
| 3045 | Ga0495680_0017152 | |||
| 3046 | Ga0495680_0121310 | |||
| 3047 | Ga0495680_0240475 | |||
| 3048 | Ga0495675_0182616 | |||
| 3049 | Ga0495677_0029114 | |||
| 3050 | Ga0495679_029615 | |||
| 3051 | Ga0495685_018718 | |||
| 3052 | Ga0495685_029609 | |||
| 3053 | Ga0495681_0134266 | |||
| 3054 | Ga0495684_0045200 | |||
| 3055 | Ga0495684_0181765 | |||
| 3056 | Ga0495684_0306496 | |||
| 3057 | Ga0495614_0012297 | |||
| 3058 | Ga0495615_0014389 | |||
| 3059 | Ga0495626_0221301 | |||
| 3060 | Ga0496100_0006894 | |||
| 3061 | Ga0496100_0046873 | |||
| 3062 | Ga0496100_0053297 | |||
| 3063 | Ga0496100_0065946 | |||
| 3064 | Ga0496100_0073416 | |||
| 3065 | Ga0496100_0219766 | |||
| 3066 | Ga0496100_0526863 | |||
| 3067 | Ga0496101_0000922 | |||
| 3068 | Ga0496101_0016691 | |||
| 3069 | Ga0496101_0046354 | |||
| 3070 | Ga0496101_0048429 | |||
| 3071 | Ga0496101_0087918 | |||
| 3072 | Ga0496101_0252667 | |||
| 3073 | Ga0496101_0334874 | |||
| 3074 | Ga0496101_0490533 | |||
| 3075 | Ga0496101_0516917 | |||
| 3076 | Ga0496101_0651947 | |||
| 3077 | Ga0496102_0005265 | |||
| 3078 | Ga0496102_0086658 | |||
| 3079 | Ga0496102_0094217 | |||
| 3080 | Ga0496102_0100824 | |||
| 3081 | Ga0496102_0162426 | |||
| 3082 | Ga0496102_0215730 | |||
| 3083 | Ga0496102_0225622 | |||
| 3084 | Ga0496102_0286538 | |||
| 3085 | Ga0496102_0452355 | |||
| 3086 | Ga0496102_1236961 | |||
| 3087 | Ga0496102_1782847 | |||
| 3088 | Ga0496103_0003386 | |||
| 3089 | Ga0496103_0024680 | |||
| 3090 | Ga0496103_0081180 | |||
| 3091 | Ga0496103_0229331 | |||
| 3092 | Ga0496103_0310807 | |||
| 3093 | Ga0496104_0001145 | |||
| 3094 | Ga0496104_0001945 | |||
| 3095 | Ga0496104_0002282 | |||
| 3096 | Ga0496104_0006111 | |||
| 3097 | Ga0496104_0006953 | |||
| 3098 | Ga0496104_0008356 | |||
| 3099 | Ga0496104_0044622 | |||
| 3100 | Ga0496104_0117647 | |||
| 3101 | Ga0496104_0192423 | |||
| 3102 | Ga0496104_0206431 | |||
| 3103 | Ga0496104_0315864 | |||
| 3104 | Ga0496104_0335516 | |||
| 3105 | Ga0496104_0703670 | |||
| 3106 | Ga0496104_1019815 | |||
| 3107 | Ga0496104_1171632 | |||
| 3108 | Ga0496105_0000506 | |||
| 3109 | Ga0496105_0001550 | |||
| 3110 | Ga0496105_0001566 | |||
| 3111 | Ga0496105_0003302 | |||
| 3112 | Ga0496105_0019706 | |||
| 3113 | Ga0496105_0052586 | |||
| 3114 | Ga0496105_0101079 | |||
| 3115 | Ga0496105_0102421 | |||
| 3116 | Ga0496105_0104884 | |||
| 3117 | Ga0496105_0109128 | |||
| 3118 | Ga0496105_0178655 | |||
| 3119 | Ga0496106_0175988 | |||
| 3120 | Ga0496106_0190476 | |||
| 3121 | Ga0496106_0253839 | |||
| 3122 | Ga0496106_0267711 | |||
| 3123 | Ga0496106_0298906 | |||
| 3124 | Ga0496106_0404416 | |||
| 3125 | Ga0496106_0548001 | |||
| 3126 | Ga0496106_0710338 | |||
| 3127 | Ga0496106_0935719 | |||
| 3128 | Ga0496107_0004638 | |||
| 3129 | Ga0496107_0086376 | |||
| 3130 | Ga0496107_0103675 | |||
| 3131 | Ga0496107_0143726 | |||
| 3132 | Ga0496107_0184527 | |||
| 3133 | Ga0496107_0312634 | |||
| 3134 | Ga0496107_0328186 | |||
| 3135 | Ga0496107_0363389 | |||
| 3136 | Ga0496107_0420634 | |||
| 3137 | Ga0496108_0001074 | |||
| 3138 | Ga0496108_0003450 | |||
| 3139 | Ga0496108_0027472 | |||
| 3140 | Ga0496108_0043118 | |||
| 3141 | Ga0496108_0064688 | |||
| 3142 | Ga0496108_0082631 | |||
| 3143 | Ga0496108_0106782 | |||
| 3144 | Ga0496108_0116435 | |||
| 3145 | Ga0496108_0250468 | |||
| 3146 | Ga0496108_0320304 | |||
| 3147 | Ga0496108_0345692 | |||
| 3148 | Ga0496108_0453817 | |||
| 3149 | Ga0496108_0637941 | |||
| 3150 | Ga0496108_0673775 | |||
| 3151 | Ga0496109_0001117 | |||
| 3152 | Ga0496109_0001504 | |||
| 3153 | Ga0496109_0003836 | |||
| 3154 | Ga0496109_0004315 | |||
| 3155 | Ga0496109_0005084 | |||
| 3156 | Ga0496109_0005974 | |||
| 3157 | Ga0496109_0014514 | |||
| 3158 | Ga0496109_0019721 | |||
| 3159 | Ga0496109_0028048 | |||
| 3160 | Ga0496109_0056454 | |||
| 3161 | Ga0496109_0108315 | |||
| 3162 | Ga0496109_0178499 | |||
| 3163 | Ga0496109_0207524 | |||
| 3164 | Ga0496109_0414639 | |||
| 3165 | Ga0496109_0452569 | |||
| 3166 | Ga0496109_0932421 | |||
| 3167 | Ga0496109_1794184 | |||
| 3168 | Ga0496110_0002089 | |||
| 3169 | Ga0496110_0007388 | |||
| 3170 | Ga0496110_0012212 | |||
| 3171 | Ga0496110_0015514 | |||
| 3172 | Ga0496110_0015821 | |||
| 3173 | Ga0496110_0023138 | |||
| 3174 | Ga0496110_0047459 | |||
| 3175 | Ga0496110_0049945 | |||
| 3176 | Ga0496110_0075963 | |||
| 3177 | Ga0496110_0088566 | |||
| 3178 | Ga0496110_0110925 | |||
| 3179 | Ga0496110_0125619 | |||
| 3180 | Ga0496110_0127257 | |||
| 3181 | Ga0496110_0174237 | |||
| 3182 | Ga0496110_0185035 | |||
| 3183 | Ga0496110_0250425 | |||
| 3184 | Ga0496110_0339682 | |||
| 3185 | Ga0496110_0353615 | |||
| 3186 | Ga0496110_0382113 | |||
| 3187 | Ga0496110_0936314 | |||
| 3188 | Ga0496110_0971780 | |||
| 3189 | Ga0496111_0000409 | |||
| 3190 | Ga0496111_0002749 | |||
| 3191 | Ga0496111_0003143 | |||
| 3192 | Ga0496111_0007452 | |||
| 3193 | Ga0496111_0008185 | |||
| 3194 | Ga0496111_0018374 | |||
| 3195 | Ga0496111_0018907 | |||
| 3196 | Ga0496111_0023678 | |||
| 3197 | Ga0496111_0027200 | |||
| 3198 | Ga0496111_0046322 | |||
| 3199 | Ga0496111_0049616 | |||
| 3200 | Ga0496111_0115382 | |||
| 3201 | Ga0496111_0121848 | |||
| 3202 | Ga0496111_0123329 | |||
| 3203 | Ga0496111_0270679 | |||
| 3204 | Ga0496111_0475853 | |||
| 3205 | Ga0496112_0000219 | |||
| 3206 | Ga0496112_0003878 | |||
| 3207 | Ga0496112_0011107 | |||
| 3208 | Ga0496112_0038697 | |||
| 3209 | Ga0496112_0042811 | |||
| 3210 | Ga0496112_0049596 | |||
| 3211 | Ga0496112_0098332 | |||
| 3212 | Ga0496112_0103604 | |||
| 3213 | Ga0496112_0112444 | |||
| 3214 | Ga0496112_0231701 | |||
| 3215 | Ga0496112_0683415 | |||
| 3216 | Ga0496112_0726186 | |||
| 3217 | Ga0496113_0003176 | |||
| 3218 | Ga0496113_0007503 | |||
| 3219 | Ga0496113_0028481 | |||
| 3220 | Ga0496113_0030354 | |||
| 3221 | Ga0496113_0051781 | |||
| 3222 | Ga0496113_0090274 | |||
| 3223 | Ga0496113_0114285 | |||
| 3224 | Ga0496113_0273016 | |||
| 3225 | Ga0496114_0001197 | |||
| 3226 | Ga0496114_0009616 | |||
| 3227 | Ga0496114_0011616 | |||
| 3228 | Ga0496114_0020246 | |||
| 3229 | Ga0496114_0020944 | |||
| 3230 | Ga0496114_0027291 | |||
| 3231 | Ga0496114_0091729 | |||
| 3232 | Ga0496114_0193894 | |||
| 3233 | Ga0496114_0197123 | |||
| 3234 | Ga0496114_0256670 | |||
| 3235 | Ga0496114_0274091 | |||
| 3236 | Ga0496114_0308075 | |||
| 3237 | Ga0496114_0333144 | |||
| 3238 | Ga0496114_0336426 | |||
| 3239 | Ga0496114_0340949 | |||
| 3240 | Ga0496114_0350126 | |||
| 3241 | Ga0496114_0416474 | |||
| 3242 | Ga0496114_0427310 | |||
| 3243 | Ga0496115_0005498 | |||
| 3244 | Ga0496115_0005984 | |||
| 3245 | Ga0496115_0008075 | |||
| 3246 | Ga0496115_0014612 | |||
| 3247 | Ga0496115_0020694 | |||
| 3248 | Ga0496115_0047325 | |||
| 3249 | Ga0496115_0131247 | |||
| 3250 | Ga0501031_0010560 | |||
| 3251 | Ga0501031_0023210 | |||
| 3252 | Ga0501031_0564608 | |||
| 3253 | Ga0501032_0040204 | |||
| 3254 | Ga0501032_0250773 | |||
| 3255 | Ga0501033_0004093 | |||
| 3256 | Ga0501033_0266844 | |||
| 3257 | Ga0501033_0396292 | |||
| 3258 | Ga0501034_0027083 | |||
| 3259 | Ga0501034_0106476 | |||
| 3260 | Ga0501036_0028116 | |||
| 3261 | Ga0501036_0034638 | |||
| 3262 | Ga0501036_0088273 | |||
| 3263 | Ga0501036_0202232 | |||
| 3264 | Ga0501037_0005303 | |||
| 3265 | Ga0501037_0025710 | |||
| 3266 | Ga0501038_0005301 | |||
| 3267 | Ga0501038_0195864 | |||
| 3268 | Ga0501038_0372670 | |||
| 3269 | Ga0501038_0804281 | |||
| 3270 | Ga0501039_0005779 | |||
| 3271 | Ga0501039_0026669 | |||
| 3272 | Ga0501039_0149671 | |||
| 3273 | Ga0501039_0320098 | |||
| 3274 | Ga0501039_0528921 | |||
| 3275 | Ga0501040_0003212 | |||
| 3276 | Ga0501040_0065847 | |||
| 3277 | Ga0501040_0241664 | |||
| 3278 | Ga0501040_0293216 | |||
| 3279 | Ga0501040_0298256 | |||
| 3280 | Ga0501041_0011783 | |||
| 3281 | Ga0501041_0012189 | |||
| 3282 | Ga0501041_0013819 | |||
| 3283 | Ga0501041_0116738 | |||
| 3284 | Ga0501042_0016781 | |||
| 3285 | Ga0501042_0026988 | |||
| 3286 | Ga0501042_0034104 | |||
| 3287 | Ga0501042_0046904 | |||
| 3288 | Ga0501042_0108966 | |||
| 3289 | Ga0501042_0159270 | |||
| 3290 | Ga0501042_0221584 | |||
| 3291 | Ga0501043_0020192 | |||
| 3292 | Ga0501043_0039991 | |||
| 3293 | Ga0501043_0045393 | |||
| 3294 | Ga0501043_0460873 | |||
| 3295 | Ga0501043_0753935 | |||
| 3296 | Ga0501043_0942984 | |||
| 3297 | Ga0501046_0001657 | |||
| 3298 | Ga0501046_0008491 | |||
| 3299 | Ga0501046_0019425 | |||
| 3300 | Ga0501047_0247228 | |||
| 3301 | Ga0501047_0511999 | |||
| 3302 | Ga0501048_0015422 | |||
| 3303 | Ga0501048_0030654 | |||
| 3304 | Ga0501048_0087610 | |||
| 3305 | Ga0501048_0106006 | |||
| 3306 | Ga0501048_0130521 | |||
| 3307 | Ga0501048_0309914 | |||
| 3308 | Ga0501067_0001413 | |||
| 3309 | Ga0501067_0002836 | |||
| 3310 | Ga0501067_0022931 | |||
| 3311 | Ga0501067_0067298 | |||
| 3312 | Ga0501067_0111742 | |||
| 3313 | Ga0501067_0648478 | |||
| 3314 | Ga0501068_0001497 | |||
| 3315 | Ga0501068_0004650 | |||
| 3316 | Ga0501068_0020862 | |||
| 3317 | Ga0501068_0041288 | |||
| 3318 | Ga0501068_0057703 | |||
| 3319 | Ga0501068_0060039 | |||
| 3320 | Ga0501068_0207911 | |||
| 3321 | Ga0501069_0004664 | |||
| 3322 | Ga0501069_0016104 | |||
| 3323 | Ga0501069_0016471 | |||
| 3324 | Ga0501069_0069953 | |||
| 3325 | Ga0501069_0150460 | |||
| 3326 | Ga0501069_0245451 | |||
| 3327 | Ga0501069_0271800 | |||
| 3328 | Ga0501069_0404115 | |||
| 3329 | Ga0501070_0002518 | |||
| 3330 | Ga0501070_0013724 | |||
| 3331 | Ga0501070_0019233 | |||
| 3332 | Ga0501070_0089897 | |||
| 3333 | Ga0501070_0516894 | |||
| 3334 | Ga0501070_0646876 | |||
| 3335 | Ga0501070_0892045 | |||
| 3336 | Ga0501071_0004216 | |||
| 3337 | Ga0501071_0007242 | |||
| 3338 | Ga0501071_0014053 | |||
| 3339 | Ga0501071_0024274 | |||
| 3340 | Ga0501071_0095280 | |||
| 3341 | Ga0501071_0373714 | |||
| 3342 | Ga0501071_0499282 | |||
| 3343 | Ga0501071_0610461 | |||
| 3344 | Ga0501072_0005827 | |||
| 3345 | Ga0501072_0009201 | |||
| 3346 | Ga0501072_0013077 | |||
| 3347 | Ga0501072_0024928 | |||
| 3348 | Ga0501072_0066603 | |||
| 3349 | Ga0501072_0166271 | |||
| 3350 | Ga0501072_0787437 | |||
| 3351 | Ga0501073_0002371 | |||
| 3352 | Ga0501073_0004603 | |||
| 3353 | Ga0501073_0015657 | |||
| 3354 | Ga0501073_0125846 | |||
| 3355 | Ga0501073_0557057 | |||
| 3356 | Ga0501074_0012304 | |||
| 3357 | Ga0501074_0017262 | |||
| 3358 | Ga0501074_0128247 | |||
| 3359 | Ga0501074_0303439 | |||
| 3360 | Ga0501074_0477033 | |||
| 3361 | Ga0501075_0001488 | |||
| 3362 | Ga0501075_0003668 | |||
| 3363 | Ga0501075_0007524 | |||
| 3364 | Ga0501075_0013972 | |||
| 3365 | Ga0501075_0326847 | |||
| 3366 | Ga0501075_0399366 | |||
| 3367 | Ga0501076_0031817 | |||
| 3368 | Ga0501076_0057924 | |||
| 3369 | Ga0501076_0104873 | |||
| 3370 | Ga0501076_0131729 | |||
| 3371 | Ga0501076_0213344 | |||
| 3372 | Ga0501076_0218707 | |||
| 3373 | Ga0501076_0286756 | |||
| 3374 | Ga0501076_0323658 | |||
| 3375 | Ga0501076_0452692 | |||
| 3376 | Ga0501077_0001317 | |||
| 3377 | Ga0501077_0005968 | |||
| 3378 | Ga0501077_0012584 | |||
| 3379 | Ga0501077_0026986 | |||
| 3380 | Ga0501077_0029979 | |||
| 3381 | Ga0501077_0219528 | |||
| 3382 | Ga0501077_0306998 | |||
| 3383 | Ga0501079_0004980 | |||
| 3384 | Ga0501079_0020643 | |||
| 3385 | Ga0501079_0085671 | |||
| 3386 | Ga0501079_0244629 | |||
| 3387 | Ga0501079_0294214 | |||
| 3388 | Ga0501079_0509340 | |||
| 3389 | Ga0501079_0591994 | |||
| 3390 | Ga0501079_0621341 | |||
| 3391 | Ga0501079_0713266 | |||
| 3392 | Ga0501080_0004906 | |||
| 3393 | Ga0501080_0009108 | |||
| 3394 | Ga0501080_0041825 | |||
| 3395 | Ga0501080_0046721 | |||
| 3396 | Ga0501080_0081521 | |||
| 3397 | Ga0501080_0186580 | |||
| 3398 | Ga0501080_0278428 | |||
| 3399 | Ga0501080_0324159 | |||
| 3400 | Ga0501080_0728975 | |||
| 3401 | Ga0501081_0002856 | |||
| 3402 | Ga0501081_0010627 | |||
| 3403 | Ga0501081_0011529 | |||
| 3404 | Ga0501081_0039627 | |||
| 3405 | Ga0501081_0062856 | |||
| 3406 | Ga0501081_0298923 | |||
| 3407 | Ga0501081_0712670 | |||
| 3408 | Ga0501081_0793780 | |||
| 3409 | Ga0501083_0002127 | |||
| 3410 | Ga0501083_0013261 | |||
| 3411 | Ga0501083_0018718 | |||
| 3412 | Ga0501083_0141943 | |||
| 3413 | Ga0501083_0145833 | |||
| 3414 | Ga0501083_0956119 | |||
| 3415 | Ga0501035_0019349 | |||
| 3416 | Ga0501044_0008260 | |||
| 3417 | Ga0501044_0427141 | |||
| 3418 | Ga0501045_0012604 | |||
| 3419 | Ga0501045_0017900 | |||
| 3420 | Ga0501045_0026718 | |||
| 3421 | Ga0501045_0075686 | |||
| 3422 | Ga0501045_0151236 | |||
| 3423 | Ga0501045_0170299 | |||
| 3424 | Ga0501045_0339060 | |||
| 3425 | Ga0501045_0638361 | |||
| 3426 | nmdc:mga0yw44_242653_c1 | |||
| 3427 | nmdc:mga0yw44_529172_c1 | |||
| 3428 | nmdc:mga04h51_58263_c1 | |||
| 3429 | nmdc:mga05p37_11057_c1 | |||
| 3430 | nmdc:mga05p37_140165_c1 | |||
| 3431 | nmdc:mga05p37_1406_c1 | |||
| 3432 | nmdc:mga05p37_141812_c1 | |||
| 3433 | nmdc:mga05p37_34623_c1 | |||
| 3434 | nmdc:mga05p37_586618_c1 | |||
| 3435 | nmdc:mga05p37_6125_c1 | |||
| 3436 | nmdc:mga05p37_71668_c1 | |||
| 3437 | nmdc:mga09592_31718_c1 | |||
| 3438 | nmdc:mga09592_474302_c1 | |||
| 3439 | nmdc:mga09592_49204_c1 | |||
| 3440 | nmdc:mga09592_806947_c1 | |||
| 3441 | nmdc:mga09592_8887_c1 | |||
| 3442 | nmdc:mga0qj67_20591_c1 | |||
| 3443 | nmdc:mga0qj67_286774_c1 | |||
| 3444 | nmdc:mga0qj67_9604_c1 | |||
| 3445 | nmdc:mga06r32_131069_c1 | |||
| 3446 | nmdc:mga06r32_15111_c1 | |||
| 3447 | nmdc:mga06r32_375190_c1 | |||
| 3448 | nmdc:mga06r32_445028_c1 | |||
| 3449 | nmdc:mga06r32_91144_c1 | |||
| 3450 | nmdc:mga08y16_115013_c1 | |||
| 3451 | nmdc:mga08y16_14526_c1 | |||
| 3452 | nmdc:mga08y16_17249_c1 | |||
| 3453 | nmdc:mga08y16_24056_c1 | |||
| 3454 | nmdc:mga08y16_265562_c1 | |||
| 3455 | nmdc:mga08y16_287111_c1 | |||
| 3456 | nmdc:mga08y16_500553_c1 | |||
| 3457 | nmdc:mga08y16_71934_c1 | |||
| 3458 | nmdc:mga08y16_9514_c1 | |||
| 3459 | nmdc:mga0n895_1087_c1 | |||
| 3460 | nmdc:mga0n895_157890_c1 | |||
| 3461 | nmdc:mga0n895_300366_c1 | |||
| 3462 | nmdc:mga0n895_34268_c1 | |||
| 3463 | nmdc:mga0n895_593483_c1 | |||
| 3464 | nmdc:mga0n895_687748_c1 | |||
| 3465 | nmdc:mga0n895_983906_c1 | |||
| 3466 | nmdc:mga0rr50_1112_c1 | |||
| 3467 | nmdc:mga0rr50_117735_c1 | |||
| 3468 | nmdc:mga0rr50_231623_c1 | |||
| 3469 | nmdc:mga0rr50_426135_c1 | |||
| 3470 | nmdc:mga0rr50_746_c1 | |||
| 3471 | nmdc:mga0rr50_83364_c1 | |||
| 3472 | nmdc:mga08x19_18960_c1 | |||
| 3473 | nmdc:mga08x19_39385_c1 | |||
| 3474 | nmdc:mga08x19_54514_c1 | |||
| 3475 | nmdc:mga08x19_80734_c1 | |||
| 3476 | nmdc:mga0a205_110447_c1 | |||
| 3477 | nmdc:mga0a205_13662_c1 | |||
| 3478 | nmdc:mga0a205_152852_c1 | |||
| 3479 | nmdc:mga0a205_25610_c1 | |||
| 3480 | nmdc:mga0a205_330047_c1 | |||
| 3481 | nmdc:mga0a205_399321_c1 | |||
| 3482 | nmdc:mga0a205_637_c1 | |||
| 3483 | Ga0495601_0042428 | |||
| 3484 | Ga0495612_0230640 | |||
| 3485 | Ga0495612_0272101 | |||
| 3486 | Ga0495655_0166703 | |||
| 3487 | Ga0495595_0003489 | |||
| 3488 | Ga0495619_0007560 | |||
| 3489 | Ga0495619_0018176 | |||
| 3490 | Ga0495619_0073118 | |||
| 3491 | Ga0495619_0177982 | |||
| 3492 | Ga0501084_0002387 | |||
| 3493 | Ga0501084_0003760 | |||
| 3494 | Ga0501084_0010194 | |||
| 3495 | Ga0501084_0058812 | |||
| 3496 | Ga0501084_0078245 | |||
| 3497 | Ga0501084_0088611 | |||
| 3498 | Ga0501084_0129819 | |||
| 3499 | Ga0501084_0213715 | |||
| 3500 | Ga0501084_0314690 | |||
| 3501 | Ga0501084_0414401 | |||
| 3502 | Ga0590075_022938 | |||
| 3503 | Ga0501082_0083902 | |||
| 3504 | Ga0501082_0086088 | |||
| 3505 | Ga0501082_0313764 | |||
| 3506 | Ga0501082_0424949 | |||
| 3507 | Ga0501082_0460848 | |||
| 3508 | Ga0501082_0841050 | |||
| 3509 | Ga0501082_1221175 | |||
| 3510 | Ga0466962_0070104 | |||
| 3511 | Ga0466962_0314690 | |||
| 3512 | Ga0530510_0023878 | |||
| 3513 | Ga0530510_0038675 | |||
| 3514 | Ga0530510_0068495 | |||
| 3515 | Ga0530510_0075021 | |||
| 3516 | Ga0530510_0076699 | |||
| 3517 | Ga0530510_0118841 | |||
| 3518 | Ga0530510_0130468 | |||
| 3519 | Ga0530510_0445773 | |||
| 3520 | Ga0530510_0795071 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2z2j-assembly1.cif.gz_A | crystal structure of peptidyl-trna hydrolase from mycobacterium tuberculosis | 0.9523 | 3 | 176 |
| 7wt6-assembly1.cif.gz_A | crystal structure of full-length peptidyl-trna hydrolase from mycobacterium tuberculosis | 0.94 | 1 | 184 |
| 4yly-assembly1.cif.gz_A | crystal structure of peptidyl-trna hydrolase from a gram-positive bacterium, staphylococcus aureus at 2.25 angstrom resolution | 0.9392 | 3 | 185 |
| 5zk0-assembly1.cif.gz_A | crystal structure of peptidyl-trna hydrolase mutant -m71a from vibrio cholerae | 0.9375 | 4 | 184 |
| 4zxp-assembly3.cif.gz_A | crystal structure of peptidyl- trna hydrolase from vibrio cholerae | 0.9366 | 3 | 184 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4ylyA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Peptidyl-tRNA hydrolase | 0.9392 | 3 | 185 | 3.40.50.1470 |
| af_Q10LI6_46_183_3.40.50.1470 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Peptidyl-tRNA hydrolase | 0.9271 | 3 | 132 | 3.40.50.1470 |
| 5ektA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Peptidyl-tRNA hydrolase | 0.9266 | 3 | 184 | 3.40.50.1470 |
| 4ylyA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Peptidyl-tRNA hydrolase | 0.9246 | 3 | 185 | 3.40.50.1470 |
| 5zx8A00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Peptidyl-tRNA hydrolase | 0.922 | 1 | 185 | 3.40.50.1470 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A538GP38-F1-model_v4 | peptidyl-tRNA hydrolase (EC 3.1.1.29) | 0.9972 | 3 | 136 |
GO:0004045
|
| AF-A0A091USK0-F1-model_v4 | peptidyl-tRNA hydrolase (EC 3.1.1.29) | 0.9853 | 48 | 136 |
GO:0004045
|
| AF-A0A1G0EEC0-F1-model_v4 | peptidyl-tRNA hydrolase (EC 3.1.1.29) | 0.9842 | 3 | 131 |
GO:0004045
|
| AF-A0A538GP38-F1-model_v4 | peptidyl-tRNA hydrolase (EC 3.1.1.29) | 0.9826 | 3 | 136 |
GO:0004045
|
| AF-A0A0F9F6Q4-F1-model_v4 | peptidyl-tRNA hydrolase (EC 3.1.1.29) | 0.9787 | 3 | 136 |
GO:0004045
|