F495568
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1750 | 424 | 3500 | 264 |
Family's Representative Sequence
| Representative Sequence | 3300049592|Ga0501076_0187137|Ga0501076_0187137_16_942 |
| Length | 308 |
| Sequence | LTKRGGSEPRYAWNDTDSGSASRTVPRVASAPDVAVDCAHVDSAERPFRIAHLSDLHCGGPYFEAALLERAISEINELRPEMVICTGDLTTFGFKHEYQMARQYLDQLDCDAFVVVPGNHDARNVGYVHFEELFGARASVLRKGGVAVVAVDSTEPDLDHGQIGRGRYAWIEEQFAAEPSVFRIFVLHHHLLPVPGTGRERNVVYDAGDAIECLLRARVHLVLSGHKHVPYAWRLENLFVVNTGTVSSLRLRGNTRPCYNVVEINGHHVSISRRHPFHGEERIIQFSTETFAYEKYTGRIEEEVTTRG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 2 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 3 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 4 | 3300001978 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 | Metagenome | Rhizosphere |
| 5 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 6 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 7 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 8 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 9 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 10 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 11 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 12 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 13 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 14 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 15 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 16 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 21 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 22 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 24 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 26 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 37 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 53 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 54 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 56 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 60 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 61 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 62 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 63 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 65 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 66 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 70 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 71 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 73 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 74 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 75 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 77 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 78 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 79 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 80 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 81 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 82 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 83 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 84 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 85 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 86 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 87 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 88 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 89 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 90 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 91 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 92 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 93 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 94 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 95 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 96 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 97 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 99 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 100 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 101 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 102 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 103 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 104 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 105 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 106 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 107 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 109 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 136 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 140 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 141 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 142 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 143 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 144 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 145 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 146 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 147 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 148 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 213 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 217 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 218 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 219 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 220 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 221 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 222 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 223 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 224 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 225 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 226 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 227 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 228 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 229 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 230 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 231 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 232 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 233 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 234 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 235 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 236 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 237 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 238 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 239 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 240 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 241 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 242 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 243 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 244 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 245 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 246 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 247 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 248 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 249 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 250 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 251 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 252 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 253 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 254 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 255 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 256 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 257 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 258 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 259 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 260 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 261 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 262 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 263 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 264 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 265 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 266 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 267 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 268 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 269 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 270 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 271 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 272 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 273 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 274 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 275 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 276 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 277 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 278 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 279 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 280 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 281 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 282 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 283 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 284 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 285 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 286 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 287 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 288 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 289 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 290 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 291 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 292 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 293 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 294 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 295 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 296 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 297 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 298 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 299 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 354 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 355 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 356 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 357 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 358 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 359 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 360 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 361 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 362 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 363 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 364 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 365 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 366 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 367 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 368 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 369 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 370 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 371 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 372 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 373 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 374 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 375 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 376 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 377 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 378 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 379 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 380 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 381 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 382 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 383 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 384 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 385 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 386 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 387 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 388 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 389 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 390 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 391 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 392 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 393 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 394 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 395 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 396 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 397 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 398 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 399 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 400 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 401 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 402 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 403 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 404 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 405 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 406 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 407 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 408 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 409 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 410 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 411 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 412 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 413 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 414 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 415 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 416 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 417 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 418 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 419 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 420 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 421 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 422 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 423 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 424 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.86 |
| Metatranscriptomes | 1.14 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.51 |
| Nodule | 0 |
| Rhizoplane | 10.23 |
| Rhizosphere | 88.86 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 14.8 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0501076_0187137 | 3300049592 | Bacteria | 1689 |
| 2 | JGI24752J21851_1021037 | 3300001976 | Archaea | 851 |
| 3 | JGI24746J21847_1008797 | 3300001977 | Unclassified | 1519 |
| 4 | JGI24747J21853_1005673 | 3300001978 | Bacteria | 1160 |
| 5 | JGI24739J22299_10023322 | 3300001989 | Unclassified | 2189 |
| 6 | JGI24743J22301_10002240 | 3300001991 | Bacteria | 2872 |
| 7 | JGI24743J22301_10002607 | 3300001991 | Bacteria | 2748 |
| 8 | JGI24743J22301_10003655 | 3300001991 | Bacteria | 2451 |
| 9 | JGI24745J21846_1004648 | 3300002073 | Bacteria | 1476 |
| 10 | JGI24738J21930_10004033 | 3300002075 | Bacteria | 3639 |
| 11 | JGI24738J21930_10014493 | 3300002075 | Bacteria | 1690 |
| 12 | JGI24749J21850_1025441 | 3300002076 | Archaea | 843 |
| 13 | JGI24744J21845_10010971 | 3300002077 | Bacteria | 1855 |
| 14 | JGI24033J26618_1002043 | 3300002155 | Bacteria | 2031 |
| 15 | JGI24742J22300_10006233 | 3300002244 | Bacteria | 1968 |
| 16 | JGI25406J46586_10019731 | 3300003203 | Unclassified | 2739 |
| 17 | JGI25407J50210_10008378 | 3300003373 | Bacteria | 2605 |
| 18 | JGI25407J50210_10009726 | 3300003373 | Unclassified | 2441 |
| 19 | JGI25407J50210_10014112 | 3300003373 | Bacteria | 2058 |
| 20 | Ga0058862_12831764 | 3300004803 | Bacteria | 1400 |
| 21 | Ga0070658_10015054 | 3300005327 | Bacteria | 6190 |
| 22 | Ga0070658_10109397 | 3300005327 | Bacteria | 2288 |
| 23 | Ga0070658_10120539 | 3300005327 | Bacteria | 2179 |
| 24 | Ga0070658_10300504 | 3300005327 | Bacteria | 1369 |
| 25 | Ga0070658_10546937 | 3300005327 | Bacteria | 1002 |
| 26 | Ga0070683_100005201 | 3300005329 | Bacteria | 10833 |
| 27 | Ga0070683_100062646 | 3300005329 | Bacteria | 3458 |
| 28 | Ga0070683_100104634 | 3300005329 | Bacteria | 2667 |
| 29 | Ga0070683_100108866 | 3300005329 | Bacteria | 2613 |
| 30 | Ga0070683_100111274 | 3300005329 | Bacteria | 2583 |
| 31 | Ga0070683_100117347 | 3300005329 | Bacteria | 2513 |
| 32 | Ga0070683_100128256 | 3300005329 | Bacteria | 2399 |
| 33 | Ga0070683_100196314 | 3300005329 | Bacteria | 1916 |
| 34 | Ga0070683_100249141 | 3300005329 | Bacteria | 1689 |
| 35 | Ga0070683_100426171 | 3300005329 | Bacteria | 1266 |
| 36 | Ga0070683_100443193 | 3300005329 | Unclassified | 1239 |
| 37 | Ga0070683_100445597 | 3300005329 | Bacteria | 1235 |
| 38 | Ga0070670_100005716 | 3300005331 | Bacteria | 10509 |
| 39 | Ga0070670_100030695 | 3300005331 | Unclassified | 4628 |
| 40 | Ga0070670_100183745 | 3300005331 | Bacteria | 1815 |
| 41 | Ga0070677_10134271 | 3300005333 | Bacteria | 1134 |
| 42 | Ga0068869_100108886 | 3300005334 | Bacteria | 2105 |
| 43 | Ga0068869_100115911 | 3300005334 | Bacteria | 2043 |
| 44 | Ga0070680_100008148 | 3300005336 | Bacteria | 8007 |
| 45 | Ga0070680_100047408 | 3300005336 | Bacteria | 3498 |
| 46 | Ga0070680_100071038 | 3300005336 | Bacteria | 2860 |
| 47 | Ga0070680_100095265 | 3300005336 | Bacteria | 2467 |
| 48 | Ga0070680_100174114 | 3300005336 | Bacteria | 1811 |
| 49 | Ga0070680_100257630 | 3300005336 | Bacteria | 1475 |
| 50 | Ga0070682_100002738 | 3300005337 | Bacteria | 9767 |
| 51 | Ga0070682_100031525 | 3300005337 | Bacteria | 3206 |
| 52 | Ga0070682_100100688 | 3300005337 | Bacteria | 1907 |
| 53 | Ga0070682_100271625 | 3300005337 | Bacteria | 1232 |
| 54 | Ga0068868_100004372 | 3300005338 | Bacteria | 9903 |
| 55 | Ga0068868_100170304 | 3300005338 | Unclassified | 1802 |
| 56 | Ga0070660_100003874 | 3300005339 | Bacteria | 10334 |
| 57 | Ga0070660_100004655 | 3300005339 | Bacteria | 9496 |
| 58 | Ga0070660_100007596 | 3300005339 | Bacteria | 7557 |
| 59 | Ga0070660_100008326 | 3300005339 | Bacteria | 7249 |
| 60 | Ga0070660_100038835 | 3300005339 | Bacteria | 3616 |
| 61 | Ga0070660_100264926 | 3300005339 | Unclassified | 1404 |
| 62 | Ga0070689_100013807 | 3300005340 | Bacteria | 5851 |
| 63 | Ga0070689_100315260 | 3300005340 | Unclassified | 1305 |
| 64 | Ga0070689_100452693 | 3300005340 | Archaea | 1092 |
| 65 | Ga0070689_100479721 | 3300005340 | Unclassified | 1062 |
| 66 | Ga0070691_10006093 | 3300005341 | Bacteria | 5504 |
| 67 | Ga0070691_10017595 | 3300005341 | Bacteria | 3288 |
| 68 | Ga0070687_100160404 | 3300005343 | Archaea | 1329 |
| 69 | Ga0070661_100015521 | 3300005344 | Bacteria | 5375 |
| 70 | Ga0070661_100029869 | 3300005344 | Bacteria | 3936 |
| 71 | Ga0070661_100067320 | 3300005344 | Bacteria | 2631 |
| 72 | Ga0070661_100082044 | 3300005344 | Bacteria | 2381 |
| 73 | Ga0070661_100180127 | 3300005344 | Bacteria | 1607 |
| 74 | Ga0070661_100247230 | 3300005344 | Unclassified | 1375 |
| 75 | Ga0070692_10002026 | 3300005345 | Bacteria | 7694 |
| 76 | Ga0070692_10104946 | 3300005345 | Bacteria | 1554 |
| 77 | Ga0070668_100008587 | 3300005347 | Bacteria | 7587 |
| 78 | Ga0070668_100085170 | 3300005347 | Bacteria | 2484 |
| 79 | Ga0070668_100104067 | 3300005347 | Bacteria | 2252 |
| 80 | Ga0070669_100350257 | 3300005353 | Bacteria | 1199 |
| 81 | Ga0070675_100014084 | 3300005354 | Bacteria | 6299 |
| 82 | Ga0070675_100016698 | 3300005354 | Bacteria | 5826 |
| 83 | Ga0070675_100114665 | 3300005354 | Bacteria | 2283 |
| 84 | Ga0070675_100322462 | 3300005354 | Bacteria | 1365 |
| 85 | Ga0070671_100108632 | 3300005355 | Bacteria | 2329 |
| 86 | Ga0070671_100271744 | 3300005355 | Unclassified | 1441 |
| 87 | Ga0070671_100300141 | 3300005355 | Archaea | 1368 |
| 88 | Ga0070674_100031128 | 3300005356 | Bacteria | 3533 |
| 89 | Ga0070674_100034195 | 3300005356 | Bacteria | 3392 |
| 90 | Ga0070674_100034478 | 3300005356 | Bacteria | 3381 |
| 91 | Ga0070674_100114708 | 3300005356 | Bacteria | 1985 |
| 92 | Ga0070674_100223944 | 3300005356 | Unclassified | 1465 |
| 93 | Ga0070674_100226548 | 3300005356 | Bacteria | 1457 |
| 94 | Ga0070674_100237668 | 3300005356 | Bacteria | 1425 |
| 95 | Ga0070674_100319660 | 3300005356 | Bacteria | 1244 |
| 96 | Ga0070673_100011553 | 3300005364 | Bacteria | 6031 |
| 97 | Ga0070673_100639350 | 3300005364 | Bacteria | 973 |
| 98 | Ga0070688_100002663 | 3300005365 | Bacteria | 9067 |
| 99 | Ga0070659_100023844 | 3300005366 | Bacteria | 4686 |
| 100 | Ga0070659_100072492 | 3300005366 | Bacteria | 2741 |
| 101 | Ga0070659_100149492 | 3300005366 | Bacteria | 1905 |
| 102 | Ga0070659_100200187 | 3300005366 | Unclassified | 1644 |
| 103 | Ga0070659_100261591 | 3300005366 | Bacteria | 1436 |
| 104 | Ga0070659_100269761 | 3300005366 | Bacteria | 1414 |
| 105 | Ga0070659_100322311 | 3300005366 | Unclassified | 1292 |
| 106 | Ga0070659_100323522 | 3300005366 | Bacteria | 1289 |
| 107 | Ga0070659_100399550 | 3300005366 | Unclassified | 1160 |
| 108 | Ga0070667_100012127 | 3300005367 | Bacteria | 7135 |
| 109 | Ga0070709_10009338 | 3300005434 | Bacteria | 5406 |
| 110 | Ga0070714_100050153 | 3300005435 | Bacteria | 3554 |
| 111 | Ga0070714_100098935 | 3300005435 | Bacteria | 2567 |
| 112 | Ga0070714_100136522 | 3300005435 | Bacteria | 2197 |
| 113 | Ga0070714_100391044 | 3300005435 | Unclassified | 1313 |
| 114 | Ga0070714_100397285 | 3300005435 | Bacteria | 1302 |
| 115 | Ga0070713_100005892 | 3300005436 | Bacteria | 8425 |
| 116 | Ga0070713_100281646 | 3300005436 | Bacteria | 1525 |
| 117 | Ga0070713_100334099 | 3300005436 | Bacteria | 1402 |
| 118 | Ga0070713_100665190 | 3300005436 | Unclassified | 993 |
| 119 | Ga0070710_10002302 | 3300005437 | Bacteria | 9043 |
| 120 | Ga0070710_10030936 | 3300005437 | Bacteria | 2884 |
| 121 | Ga0070710_10080242 | 3300005437 | Bacteria | 1903 |
| 122 | Ga0070710_10099831 | 3300005437 | Bacteria | 1726 |
| 123 | Ga0070701_10022094 | 3300005438 | Bacteria | 3046 |
| 124 | Ga0070701_10183836 | 3300005438 | Unclassified | 1225 |
| 125 | Ga0070711_100023268 | 3300005439 | Bacteria | 4027 |
| 126 | Ga0070711_100119492 | 3300005439 | Bacteria | 1947 |
| 127 | Ga0070711_100124518 | 3300005439 | Bacteria | 1911 |
| 128 | Ga0070705_100071440 | 3300005440 | Bacteria | 2099 |
| 129 | Ga0070705_100089979 | 3300005440 | Bacteria | 1909 |
| 130 | Ga0070705_100145677 | 3300005440 | Unclassified | 1564 |
| 131 | Ga0070700_100004141 | 3300005441 | Bacteria | 7560 |
| 132 | Ga0070700_100101635 | 3300005441 | Bacteria | 1895 |
| 133 | Ga0070700_100261277 | 3300005441 | Bacteria | 1247 |
| 134 | Ga0070700_100280609 | 3300005441 | Bacteria | 1208 |
| 135 | Ga0070694_100029605 | 3300005444 | Bacteria | 3575 |
| 136 | Ga0070694_100359545 | 3300005444 | Bacteria | 1130 |
| 137 | Ga0070708_100029579 | 3300005445 | Bacteria | 4725 |
| 138 | Ga0070708_100029675 | 3300005445 | Bacteria | 4719 |
| 139 | Ga0070708_100041886 | 3300005445 | Bacteria | 4017 |
| 140 | Ga0070708_100119944 | 3300005445 | Unclassified | 2425 |
| 141 | Ga0070708_100216222 | 3300005445 | Bacteria | 1796 |
| 142 | Ga0070708_100301140 | 3300005445 | Unclassified | 1510 |
| 143 | Ga0070708_100386036 | 3300005445 | Unclassified | 1320 |
| 144 | Ga0070663_100082044 | 3300005455 | Bacteria | 2371 |
| 145 | Ga0070663_100167993 | 3300005455 | Bacteria | 1693 |
| 146 | Ga0070663_100184665 | 3300005455 | Bacteria | 1620 |
| 147 | Ga0070678_100030384 | 3300005456 | Bacteria | 3713 |
| 148 | Ga0070678_100036526 | 3300005456 | Bacteria | 3440 |
| 149 | Ga0070678_100069856 | 3300005456 | Bacteria | 2624 |
| 150 | Ga0070662_100002025 | 3300005457 | Bacteria | 12417 |
| 151 | Ga0070662_100014195 | 3300005457 | Bacteria | 5316 |
| 152 | Ga0070662_100273845 | 3300005457 | Bacteria | 1364 |
| 153 | Ga0070662_100293119 | 3300005457 | Bacteria | 1319 |
| 154 | Ga0070681_10001955 | 3300005458 | Bacteria | 18619 |
| 155 | Ga0070681_10005851 | 3300005458 | Bacteria | 11906 |
| 156 | Ga0070681_10020993 | 3300005458 | Bacteria | 6543 |
| 157 | Ga0070681_10050117 | 3300005458 | Bacteria | 4167 |
| 158 | Ga0070681_10066022 | 3300005458 | Bacteria | 3587 |
| 159 | Ga0070681_10067851 | 3300005458 | Bacteria | 3534 |
| 160 | Ga0070681_10081715 | 3300005458 | Bacteria | 3187 |
| 161 | Ga0070681_10148830 | 3300005458 | Bacteria | 2269 |
| 162 | Ga0070681_10174626 | 3300005458 | Bacteria | 2070 |
| 163 | Ga0070681_10263669 | 3300005458 | Unclassified | 1635 |
| 164 | Ga0070681_10461483 | 3300005458 | Bacteria | 1182 |
| 165 | Ga0068867_100012414 | 3300005459 | Bacteria | 6026 |
| 166 | Ga0068867_100180479 | 3300005459 | Unclassified | 1678 |
| 167 | Ga0070685_10004001 | 3300005466 | Bacteria | 7445 |
| 168 | Ga0070685_10064574 | 3300005466 | Bacteria | 2152 |
| 169 | Ga0070706_100035448 | 3300005467 | Bacteria | 4608 |
| 170 | Ga0070706_100038867 | 3300005467 | Bacteria | 4392 |
| 171 | Ga0070707_100000328 | 3300005468 | Bacteria | 46683 |
| 172 | Ga0070707_100004648 | 3300005468 | Bacteria | 12854 |
| 173 | Ga0070707_100049962 | 3300005468 | Bacteria | 4009 |
| 174 | Ga0070707_100119199 | 3300005468 | Bacteria | 2562 |
| 175 | Ga0070707_100188723 | 3300005468 | Unclassified | 2009 |
| 176 | Ga0070707_100742184 | 3300005468 | Unclassified | 945 |
| 177 | Ga0070698_100006381 | 3300005471 | Bacteria | 12806 |
| 178 | Ga0070698_100009026 | 3300005471 | Bacteria | 10721 |
| 179 | Ga0070698_100013953 | 3300005471 | Bacteria | 8496 |
| 180 | Ga0070698_100084311 | 3300005471 | Bacteria | 3166 |
| 181 | Ga0070699_100042793 | 3300005518 | Bacteria | 3919 |
| 182 | Ga0070699_100107430 | 3300005518 | Unclassified | 2448 |
| 183 | Ga0070699_100139293 | 3300005518 | Bacteria | 2141 |
| 184 | Ga0070679_100027946 | 3300005530 | Bacteria | 5558 |
| 185 | Ga0070679_100073439 | 3300005530 | Bacteria | 3412 |
| 186 | Ga0070679_100100235 | 3300005530 | Bacteria | 2883 |
| 187 | Ga0070679_100139436 | 3300005530 | Bacteria | 2405 |
| 188 | Ga0070679_100340229 | 3300005530 | Unclassified | 1448 |
| 189 | Ga0070684_100000801 | 3300005535 | Bacteria | 21853 |
| 190 | Ga0070684_100006669 | 3300005535 | Bacteria | 8947 |
| 191 | Ga0070684_100008131 | 3300005535 | Bacteria | 8187 |
| 192 | Ga0070684_100014243 | 3300005535 | Bacteria | 6435 |
| 193 | Ga0070684_100015491 | 3300005535 | Bacteria | 6210 |
| 194 | Ga0070684_100016404 | 3300005535 | Bacteria | 6054 |
| 195 | Ga0070684_100020628 | 3300005535 | Bacteria | 5466 |
| 196 | Ga0070684_100024219 | 3300005535 | Bacteria | 5089 |
| 197 | Ga0070684_100033105 | 3300005535 | Bacteria | 4410 |
| 198 | Ga0070684_100034687 | 3300005535 | Bacteria | 4315 |
| 199 | Ga0070684_100042990 | 3300005535 | Bacteria | 3902 |
| 200 | Ga0070684_100061787 | 3300005535 | Bacteria | 3280 |
| 201 | Ga0070684_100113209 | 3300005535 | Unclassified | 2435 |
| 202 | Ga0070684_100115172 | 3300005535 | Unclassified | 2414 |
| 203 | Ga0070684_100203107 | 3300005535 | Bacteria | 1805 |
| 204 | Ga0070684_100456391 | 3300005535 | Bacteria | 1181 |
| 205 | Ga0070684_100522290 | 3300005535 | Bacteria | 1100 |
| 206 | Ga0070697_100357913 | 3300005536 | Bacteria | 1261 |
| 207 | Ga0070697_100485149 | 3300005536 | Bacteria | 1079 |
| 208 | Ga0068853_100007300 | 3300005539 | Bacteria | 8846 |
| 209 | Ga0068853_100204098 | 3300005539 | Bacteria | 1799 |
| 210 | Ga0068853_100386066 | 3300005539 | Bacteria | 1308 |
| 211 | Ga0070672_100016488 | 3300005543 | Bacteria | 5290 |
| 212 | Ga0070672_100026858 | 3300005543 | Bacteria | 4290 |
| 213 | Ga0070672_100174020 | 3300005543 | Bacteria | 1791 |
| 214 | Ga0070672_100259602 | 3300005543 | Bacteria | 1465 |
| 215 | Ga0070672_100334533 | 3300005543 | Bacteria | 1289 |
| 216 | Ga0070686_100017245 | 3300005544 | Bacteria | 4216 |
| 217 | Ga0070686_100038215 | 3300005544 | Bacteria | 2982 |
| 218 | Ga0070686_100044652 | 3300005544 | Bacteria | 2787 |
| 219 | Ga0070686_100333561 | 3300005544 | Bacteria | 1134 |
| 220 | Ga0070695_100002777 | 3300005545 | Bacteria | 10160 |
| 221 | Ga0070695_100173012 | 3300005545 | Unclassified | 1524 |
| 222 | Ga0070696_100095770 | 3300005546 | Bacteria | 2120 |
| 223 | Ga0070696_100106667 | 3300005546 | Bacteria | 2014 |
| 224 | Ga0070693_100048706 | 3300005547 | Bacteria | 2414 |
| 225 | Ga0070693_100132002 | 3300005547 | Bacteria | 1562 |
| 226 | Ga0070665_100005968 | 3300005548 | Bacteria | 12466 |
| 227 | Ga0070704_100005014 | 3300005549 | Bacteria | 7694 |
| 228 | Ga0070704_100400247 | 3300005549 | Unclassified | 1171 |
| 229 | Ga0068855_100006817 | 3300005563 | Bacteria | 13856 |
| 230 | Ga0068855_100012747 | 3300005563 | Bacteria | 10138 |
| 231 | Ga0068855_100036661 | 3300005563 | Bacteria | 5834 |
| 232 | Ga0068855_100071313 | 3300005563 | Bacteria | 4040 |
| 233 | Ga0068855_100142482 | 3300005563 | Bacteria | 2730 |
| 234 | Ga0068855_100236353 | 3300005563 | Bacteria | 2044 |
| 235 | Ga0068855_100257970 | 3300005563 | Bacteria | 1943 |
| 236 | Ga0068855_100300503 | 3300005563 | Bacteria | 1777 |
| 237 | Ga0068855_100319362 | 3300005563 | Bacteria | 1717 |
| 238 | Ga0068855_100475799 | 3300005563 | Bacteria | 1360 |
| 239 | Ga0070664_100044398 | 3300005564 | Bacteria | 3753 |
| 240 | Ga0070664_100055547 | 3300005564 | Bacteria | 3362 |
| 241 | Ga0070664_100204197 | 3300005564 | Unclassified | 1764 |
| 242 | Ga0068857_100009172 | 3300005577 | Bacteria | 8588 |
| 243 | Ga0068857_100011172 | 3300005577 | Bacteria | 7809 |
| 244 | Ga0068857_100167832 | 3300005577 | Bacteria | 1994 |
| 245 | Ga0068854_100002899 | 3300005578 | Bacteria | 10654 |
| 246 | Ga0068854_100098513 | 3300005578 | Bacteria | 2188 |
| 247 | Ga0068854_100202147 | 3300005578 | Bacteria | 1562 |
| 248 | Ga0068856_100006885 | 3300005614 | Bacteria | 11116 |
| 249 | Ga0068856_100025554 | 3300005614 | Bacteria | 5759 |
| 250 | Ga0068856_100047859 | 3300005614 | Bacteria | 4213 |
| 251 | Ga0068856_100086852 | 3300005614 | Bacteria | 3108 |
| 252 | Ga0068856_100129422 | 3300005614 | Bacteria | 2529 |
| 253 | Ga0070702_100011161 | 3300005615 | Bacteria | 4460 |
| 254 | Ga0070702_100011796 | 3300005615 | Bacteria | 4358 |
| 255 | Ga0070702_100032003 | 3300005615 | Bacteria | 2883 |
| 256 | Ga0070702_100057411 | 3300005615 | Unclassified | 2252 |
| 257 | Ga0070702_100190505 | 3300005615 | Bacteria | 1349 |
| 258 | Ga0068852_100002688 | 3300005616 | Bacteria | 12284 |
| 259 | Ga0068852_100058846 | 3300005616 | Bacteria | 3330 |
| 260 | Ga0068852_100335281 | 3300005616 | Bacteria | 1473 |
| 261 | Ga0068852_100575411 | 3300005616 | Bacteria | 1129 |
| 262 | Ga0068859_100045563 | 3300005617 | Bacteria | 4405 |
| 263 | Ga0068864_100048354 | 3300005618 | Bacteria | 3656 |
| 264 | Ga0068861_100003381 | 3300005719 | Bacteria | 10580 |
| 265 | Ga0068861_100051190 | 3300005719 | Bacteria | 3134 |
| 266 | Ga0068870_10004426 | 3300005840 | Bacteria | 6050 |
| 267 | Ga0068870_10018231 | 3300005840 | Bacteria | 3386 |
| 268 | Ga0068870_10225711 | 3300005840 | Bacteria | 1149 |
| 269 | Ga0068863_100014802 | 3300005841 | Bacteria | 7501 |
| 270 | Ga0068863_100874871 | 3300005841 | Unclassified | 898 |
| 271 | Ga0068858_100016953 | 3300005842 | Bacteria | 6839 |
| 272 | Ga0068858_100043753 | 3300005842 | Bacteria | 4152 |
| 273 | Ga0068860_100048020 | 3300005843 | Bacteria | 4068 |
| 274 | Ga0068860_100323053 | 3300005843 | Bacteria | 1515 |
| 275 | Ga0068862_100091213 | 3300005844 | Unclassified | 2653 |
| 276 | Ga0068862_100271902 | 3300005844 | Unclassified | 1550 |
| 277 | Ga0068862_100732158 | 3300005844 | Archaea | 961 |
| 278 | Ga0081455_10015398 | 3300005937 | Bacteria | 7433 |
| 279 | Ga0081455_10025233 | 3300005937 | Bacteria | 5491 |
| 280 | Ga0081455_10038614 | 3300005937 | Bacteria | 4227 |
| 281 | Ga0081455_10045221 | 3300005937 | Bacteria | 3832 |
| 282 | Ga0081455_10079373 | 3300005937 | Unclassified | 2695 |
| 283 | Ga0081455_10120011 | 3300005937 | Bacteria | 2073 |
| 284 | Ga0081455_10143496 | 3300005937 | Bacteria | 1851 |
| 285 | Ga0081455_10184175 | 3300005937 | Unclassified | 1578 |
| 286 | Ga0081455_10185613 | 3300005937 | Bacteria | 1571 |
| 287 | Ga0081538_10000035 | 3300005981 | Bacteria | 120009 |
| 288 | Ga0081538_10000152 | 3300005981 | Bacteria | 71751 |
| 289 | Ga0081538_10000696 | 3300005981 | Bacteria | 36915 |
| 290 | Ga0081538_10004814 | 3300005981 | Bacteria | 12303 |
| 291 | Ga0081538_10007205 | 3300005981 | Bacteria | 9655 |
| 292 | Ga0081538_10007559 | 3300005981 | Bacteria | 9381 |
| 293 | Ga0081538_10017792 | 3300005981 | Bacteria | 5373 |
| 294 | Ga0081538_10019711 | 3300005981 | Bacteria | 4996 |
| 295 | Ga0081538_10023770 | 3300005981 | Bacteria | 4393 |
| 296 | Ga0081538_10067111 | 3300005981 | Bacteria | 2005 |
| 297 | Ga0081538_10089409 | 3300005981 | Bacteria | 1599 |
| 298 | Ga0081538_10154437 | 3300005981 | Bacteria | 1032 |
| 299 | Ga0081540_1003561 | 3300005983 | Bacteria | 12252 |
| 300 | Ga0081539_10000866 | 3300005985 | Bacteria | 57957 |
| 301 | Ga0070717_10010696 | 3300006028 | Bacteria | 6940 |
| 302 | Ga0070717_10059005 | 3300006028 | Bacteria | 3174 |
| 303 | Ga0070717_10062245 | 3300006028 | Bacteria | 3094 |
| 304 | Ga0070717_10069828 | 3300006028 | Bacteria | 2926 |
| 305 | Ga0070717_10239093 | 3300006028 | Bacteria | 1601 |
| 306 | Ga0070717_10424003 | 3300006028 | Unclassified | 1197 |
| 307 | Ga0075365_10022967 | 3300006038 | Bacteria | 3916 |
| 308 | Ga0075365_10075872 | 3300006038 | Bacteria | 2269 |
| 309 | Ga0075365_10077318 | 3300006038 | Bacteria | 2248 |
| 310 | Ga0075363_100147218 | 3300006048 | Unclassified | 1328 |
| 311 | Ga0075364_10212198 | 3300006051 | Bacteria | 1313 |
| 312 | Ga0075432_10025925 | 3300006058 | Bacteria | 2012 |
| 313 | Ga0070715_10000913 | 3300006163 | Bacteria | 8202 |
| 314 | Ga0070715_10034552 | 3300006163 | Bacteria | 2073 |
| 315 | Ga0070715_10058699 | 3300006163 | Unclassified | 1681 |
| 316 | Ga0070716_100009358 | 3300006173 | Bacteria | 4881 |
| 317 | Ga0070716_100193774 | 3300006173 | Bacteria | 1345 |
| 318 | Ga0070716_100364919 | 3300006173 | Unclassified | 1027 |
| 319 | Ga0070712_100047801 | 3300006175 | Bacteria | 2963 |
| 320 | Ga0070712_100307085 | 3300006175 | Bacteria | 1286 |
| 321 | Ga0097621_100188436 | 3300006237 | Unclassified | 1785 |
| 322 | Ga0097621_100193422 | 3300006237 | Bacteria | 1763 |
| 323 | Ga0097621_100210300 | 3300006237 | Bacteria | 1692 |
| 324 | Ga0097621_100243759 | 3300006237 | Unclassified | 1572 |
| 325 | Ga0097621_100336906 | 3300006237 | Bacteria | 1339 |
| 326 | Ga0068871_100047256 | 3300006358 | Bacteria | 3470 |
| 327 | Ga0068871_100051770 | 3300006358 | Bacteria | 3324 |
| 328 | Ga0068871_100113713 | 3300006358 | Bacteria | 2280 |
| 329 | Ga0068871_100189530 | 3300006358 | Bacteria | 1771 |
| 330 | Ga0068871_100242454 | 3300006358 | Bacteria | 1567 |
| 331 | Ga0075428_100000308 | 3300006844 | Bacteria | 48042 |
| 332 | Ga0075428_100016622 | 3300006844 | Bacteria | 8126 |
| 333 | Ga0075428_100031695 | 3300006844 | Bacteria | 5840 |
| 334 | Ga0075428_100057000 | 3300006844 | Bacteria | 4278 |
| 335 | Ga0075428_100143498 | 3300006844 | Bacteria | 2595 |
| 336 | Ga0075428_100201563 | 3300006844 | Bacteria | 2151 |
| 337 | Ga0075428_100576163 | 3300006844 | Unclassified | 1203 |
| 338 | Ga0075430_100014948 | 3300006846 | Bacteria | 6610 |
| 339 | Ga0075430_100079063 | 3300006846 | Bacteria | 2757 |
| 340 | Ga0075430_100124588 | 3300006846 | Bacteria | 2148 |
| 341 | Ga0075431_100001086 | 3300006847 | Bacteria | 24354 |
| 342 | Ga0075431_100213838 | 3300006847 | Bacteria | 1968 |
| 343 | Ga0075433_10004225 | 3300006852 | Bacteria | 11151 |
| 344 | Ga0075433_10008511 | 3300006852 | Bacteria | 8184 |
| 345 | Ga0075433_10018044 | 3300006852 | Bacteria | 5858 |
| 346 | Ga0075433_10020180 | 3300006852 | Bacteria | 5567 |
| 347 | Ga0075433_10026335 | 3300006852 | Bacteria | 4922 |
| 348 | Ga0075433_10102791 | 3300006852 | Bacteria | 2531 |
| 349 | Ga0075433_10220254 | 3300006852 | Bacteria | 1686 |
| 350 | Ga0075433_10340825 | 3300006852 | Bacteria | 1325 |
| 351 | Ga0075434_100034316 | 3300006871 | Bacteria | 5009 |
| 352 | Ga0075434_100042923 | 3300006871 | Bacteria | 4484 |
| 353 | Ga0075434_100071698 | 3300006871 | Bacteria | 3456 |
| 354 | Ga0075434_100100842 | 3300006871 | Bacteria | 2893 |
| 355 | Ga0075434_100145973 | 3300006871 | Bacteria | 2386 |
| 356 | Ga0075434_100190125 | 3300006871 | Unclassified | 2073 |
| 357 | Ga0075434_100222390 | 3300006871 | Bacteria | 1908 |
| 358 | Ga0075434_100462362 | 3300006871 | Bacteria | 1290 |
| 359 | Ga0075429_100009919 | 3300006880 | Bacteria | 8255 |
| 360 | Ga0075429_100063627 | 3300006880 | Bacteria | 3213 |
| 361 | Ga0068865_100005196 | 3300006881 | Bacteria | 7872 |
| 362 | Ga0068865_100006771 | 3300006881 | Bacteria | 7014 |
| 363 | Ga0068865_100021067 | 3300006881 | Bacteria | 4237 |
| 364 | Ga0075436_100012016 | 3300006914 | Bacteria | 5938 |
| 365 | Ga0075436_100020780 | 3300006914 | Bacteria | 4504 |
| 366 | Ga0075436_100025190 | 3300006914 | Bacteria | 4092 |
| 367 | Ga0075436_100041263 | 3300006914 | Bacteria | 3184 |
| 368 | Ga0075436_100058124 | 3300006914 | Unclassified | 2671 |
| 369 | Ga0097620_100045562 | 3300006931 | Bacteria | 4405 |
| 370 | Ga0075435_100001303 | 3300007076 | Bacteria | 16035 |
| 371 | Ga0075435_100001673 | 3300007076 | Bacteria | 14387 |
| 372 | Ga0075435_100019419 | 3300007076 | Bacteria | 5192 |
| 373 | Ga0075435_100059776 | 3300007076 | Bacteria | 3089 |
| 374 | Ga0075435_100089967 | 3300007076 | Unclassified | 2532 |
| 375 | Ga0105250_10103406 | 3300009092 | Bacteria | 1163 |
| 376 | Ga0105240_10091363 | 3300009093 | Bacteria | 3720 |
| 377 | Ga0105240_10153525 | 3300009093 | Bacteria | 2740 |
| 378 | Ga0105240_10207907 | 3300009093 | Bacteria | 2289 |
| 379 | Ga0105240_10402632 | 3300009093 | Bacteria | 1541 |
| 380 | Ga0105240_10414550 | 3300009093 | Unclassified | 1514 |
| 381 | Ga0111539_10025162 | 3300009094 | Bacteria | 7297 |
| 382 | Ga0111539_10036454 | 3300009094 | Bacteria | 5946 |
| 383 | Ga0111539_10046564 | 3300009094 | Bacteria | 5187 |
| 384 | Ga0111539_10053903 | 3300009094 | Bacteria | 4787 |
| 385 | Ga0111539_10348473 | 3300009094 | Bacteria | 1724 |
| 386 | Ga0111539_10674745 | 3300009094 | Bacteria | 1203 |
| 387 | Ga0111539_10735108 | 3300009094 | Bacteria | 1149 |
| 388 | Ga0105245_10023554 | 3300009098 | Bacteria | 5405 |
| 389 | Ga0105245_10034621 | 3300009098 | Bacteria | 4480 |
| 390 | Ga0105245_10040300 | 3300009098 | Bacteria | 4160 |
| 391 | Ga0105245_10050235 | 3300009098 | Bacteria | 3736 |
| 392 | Ga0105245_10064068 | 3300009098 | Bacteria | 3322 |
| 393 | Ga0105245_10275728 | 3300009098 | Unclassified | 1642 |
| 394 | Ga0105245_10405202 | 3300009098 | Bacteria | 1364 |
| 395 | Ga0105245_10548773 | 3300009098 | Bacteria | 1177 |
| 396 | Ga0105247_10058614 | 3300009101 | Bacteria | 2383 |
| 397 | Ga0105247_10121100 | 3300009101 | Bacteria | 1695 |
| 398 | Ga0105247_10350767 | 3300009101 | Unclassified | 1038 |
| 399 | Ga0114129_10001167 | 3300009147 | Bacteria | 34830 |
| 400 | Ga0114129_10015322 | 3300009147 | Bacteria | 10908 |
| 401 | Ga0114129_10035977 | 3300009147 | Bacteria | 6993 |
| 402 | Ga0114129_10047971 | 3300009147 | Bacteria | 6000 |
| 403 | Ga0114129_10058348 | 3300009147 | Bacteria | 5398 |
| 404 | Ga0114129_10068265 | 3300009147 | Bacteria | 4957 |
| 405 | Ga0114129_10083350 | 3300009147 | Bacteria | 4442 |
| 406 | Ga0114129_10106333 | 3300009147 | Bacteria | 3876 |
| 407 | Ga0114129_10110043 | 3300009147 | Bacteria | 3803 |
| 408 | Ga0114129_10986670 | 3300009147 | Bacteria | 1062 |
| 409 | Ga0114129_11321501 | 3300009147 | Bacteria | 893 |
| 410 | Ga0105243_10005881 | 3300009148 | Bacteria | 9499 |
| 411 | Ga0105243_10011846 | 3300009148 | Bacteria | 6594 |
| 412 | Ga0105243_10012988 | 3300009148 | Bacteria | 6291 |
| 413 | Ga0105243_10014105 | 3300009148 | Bacteria | 6046 |
| 414 | Ga0105243_10031726 | 3300009148 | Bacteria | 4076 |
| 415 | Ga0105241_10120527 | 3300009174 | Bacteria | 2112 |
| 416 | Ga0105241_10124678 | 3300009174 | Bacteria | 2079 |
| 417 | Ga0105241_10252848 | 3300009174 | Unclassified | 1495 |
| 418 | Ga0105241_10289956 | 3300009174 | Bacteria | 1401 |
| 419 | Ga0105242_10032279 | 3300009176 | Bacteria | 4187 |
| 420 | Ga0105242_10044066 | 3300009176 | Bacteria | 3611 |
| 421 | Ga0105242_10177159 | 3300009176 | Bacteria | 1878 |
| 422 | Ga0105242_10305139 | 3300009176 | Bacteria | 1454 |
| 423 | Ga0105242_10317261 | 3300009176 | Unclassified | 1428 |
| 424 | Ga0105242_10416309 | 3300009176 | Bacteria | 1258 |
| 425 | Ga0105242_10519777 | 3300009176 | Bacteria | 1135 |
| 426 | Ga0105248_10004837 | 3300009177 | Bacteria | 14910 |
| 427 | Ga0105248_10097147 | 3300009177 | Bacteria | 3319 |
| 428 | Ga0105248_10115249 | 3300009177 | Bacteria | 3031 |
| 429 | Ga0105237_10104549 | 3300009545 | Bacteria | 2823 |
| 430 | Ga0105238_10033649 | 3300009551 | Bacteria | 5215 |
| 431 | Ga0105238_10035597 | 3300009551 | Bacteria | 5061 |
| 432 | Ga0105238_10699398 | 3300009551 | Unclassified | 1026 |
| 433 | Ga0105249_10233914 | 3300009553 | Unclassified | 1813 |
| 434 | Ga0105249_10445292 | 3300009553 | Bacteria | 1333 |
| 435 | Ga0105249_10609334 | 3300009553 | Bacteria | 1147 |
| 436 | Ga0105239_10003394 | 3300010375 | Bacteria | 19536 |
| 437 | Ga0105239_10044245 | 3300010375 | Bacteria | 4881 |
| 438 | Ga0105239_10056507 | 3300010375 | Bacteria | 4305 |
| 439 | Ga0105239_10069567 | 3300010375 | Bacteria | 3867 |
| 440 | Ga0105239_10144698 | 3300010375 | Bacteria | 2650 |
| 441 | Ga0105239_10321666 | 3300010375 | Unclassified | 1744 |
| 442 | Ga0105239_10457383 | 3300010375 | Unclassified | 1448 |
| 443 | Ga0105239_10492084 | 3300010375 | Bacteria | 1394 |
| 444 | Ga0105239_10607300 | 3300010375 | Bacteria | 1248 |
| 445 | Ga0105239_10741254 | 3300010375 | Bacteria | 1124 |
| 446 | Ga0105246_10022509 | 3300011119 | Bacteria | 4066 |
| 447 | Ga0105246_10024629 | 3300011119 | Bacteria | 3912 |
| 448 | Ga0105246_10149778 | 3300011119 | Bacteria | 1765 |
| 449 | Ga0105246_10224083 | 3300011119 | Bacteria | 1476 |
| 450 | Ga0157373_10032117 | 3300013100 | Bacteria | 3779 |
| 451 | Ga0157373_10354263 | 3300013100 | Unclassified | 1047 |
| 452 | Ga0157371_10004355 | 3300013102 | Bacteria | 12399 |
| 453 | Ga0157371_10115418 | 3300013102 | Bacteria | 1907 |
| 454 | Ga0157371_10436756 | 3300013102 | Unclassified | 961 |
| 455 | Ga0157370_10018791 | 3300013104 | Bacteria | 6949 |
| 456 | Ga0157370_10028361 | 3300013104 | Bacteria | 5507 |
| 457 | Ga0157370_10031019 | 3300013104 | Bacteria | 5234 |
| 458 | Ga0157370_10196259 | 3300013104 | Bacteria | 1873 |
| 459 | Ga0157370_10286411 | 3300013104 | Unclassified | 1522 |
| 460 | Ga0157369_10002497 | 3300013105 | Bacteria | 22048 |
| 461 | Ga0157369_10023069 | 3300013105 | Bacteria | 6935 |
| 462 | Ga0157369_10029987 | 3300013105 | Bacteria | 6002 |
| 463 | Ga0157369_10046466 | 3300013105 | Bacteria | 4718 |
| 464 | Ga0157369_10086575 | 3300013105 | Bacteria | 3346 |
| 465 | Ga0157369_10116737 | 3300013105 | Bacteria | 2833 |
| 466 | Ga0157369_10204935 | 3300013105 | Unclassified | 2069 |
| 467 | Ga0157369_10397992 | 3300013105 | Bacteria | 1429 |
| 468 | Ga0157374_10029179 | 3300013296 | Bacteria | 4992 |
| 469 | Ga0157374_10047966 | 3300013296 | Bacteria | 3962 |
| 470 | Ga0157374_10201556 | 3300013296 | Bacteria | 1949 |
| 471 | Ga0157374_10336403 | 3300013296 | Unclassified | 1498 |
| 472 | Ga0157378_10131447 | 3300013297 | Unclassified | 2317 |
| 473 | Ga0157378_10243868 | 3300013297 | Unclassified | 1718 |
| 474 | Ga0157378_10365848 | 3300013297 | Bacteria | 1412 |
| 475 | Ga0157378_10699694 | 3300013297 | Bacteria | 1033 |
| 476 | Ga0163162_10072172 | 3300013306 | Bacteria | 3507 |
| 477 | Ga0163162_10136557 | 3300013306 | Bacteria | 2563 |
| 478 | Ga0163162_10197617 | 3300013306 | Bacteria | 2140 |
| 479 | Ga0157372_10006332 | 3300013307 | Bacteria | 12594 |
| 480 | Ga0157372_10026486 | 3300013307 | Bacteria | 6310 |
| 481 | Ga0157372_10055345 | 3300013307 | Bacteria | 4430 |
| 482 | Ga0157372_10072372 | 3300013307 | Bacteria | 3885 |
| 483 | Ga0157372_10085452 | 3300013307 | Bacteria | 3578 |
| 484 | Ga0157372_10316757 | 3300013307 | Bacteria | 1816 |
| 485 | Ga0157372_10450680 | 3300013307 | Bacteria | 1500 |
| 486 | Ga0157372_10846308 | 3300013307 | Bacteria | 1062 |
| 487 | Ga0157375_10001779 | 3300013308 | Bacteria | 18476 |
| 488 | Ga0157375_10025998 | 3300013308 | Bacteria | 5449 |
| 489 | Ga0157375_10130854 | 3300013308 | Bacteria | 2628 |
| 490 | Ga0157375_10151600 | 3300013308 | Bacteria | 2454 |
| 491 | Ga0157375_10171846 | 3300013308 | Bacteria | 2315 |
| 492 | Ga0157375_10504055 | 3300013308 | Unclassified | 1374 |
| 493 | Ga0157375_10767236 | 3300013308 | Bacteria | 1115 |
| 494 | Ga0163163_10003453 | 3300014325 | Bacteria | 13427 |
| 495 | Ga0163163_10107381 | 3300014325 | Bacteria | 2818 |
| 496 | Ga0163163_10203191 | 3300014325 | Unclassified | 2030 |
| 497 | Ga0163163_10570985 | 3300014325 | Bacteria | 1194 |
| 498 | Ga0157380_10009901 | 3300014326 | Bacteria | 6843 |
| 499 | Ga0157380_10031821 | 3300014326 | Bacteria | 4052 |
| 500 | Ga0157380_10061307 | 3300014326 | Bacteria | 3009 |
| 501 | Ga0157380_10086324 | 3300014326 | Bacteria | 2578 |
| 502 | Ga0157380_10198097 | 3300014326 | Unclassified | 1779 |
| 503 | Ga0182008_10200898 | 3300014497 | Unclassified | 1014 |
| 504 | Ga0157377_10002578 | 3300014745 | Bacteria | 8049 |
| 505 | Ga0157377_10008386 | 3300014745 | Bacteria | 5038 |
| 506 | Ga0157377_10139382 | 3300014745 | Unclassified | 1489 |
| 507 | Ga0157379_10079000 | 3300014968 | Bacteria | 2947 |
| 508 | Ga0157379_10116988 | 3300014968 | Bacteria | 2398 |
| 509 | Ga0157379_10237982 | 3300014968 | Bacteria | 1651 |
| 510 | Ga0157376_10001398 | 3300014969 | Bacteria | 15859 |
| 511 | Ga0157376_10299931 | 3300014969 | Bacteria | 1521 |
| 512 | Ga0157376_10388814 | 3300014969 | Unclassified | 1346 |
| 513 | Ga0182006_1075373 | 3300015261 | Bacteria | 1241 |
| 514 | Ga0197907_10103628 | 3300020069 | Unclassified | 1950 |
| 515 | Ga0197907_10204941 | 3300020069 | Bacteria | 2985 |
| 516 | Ga0197907_10404823 | 3300020069 | Bacteria | 2921 |
| 517 | Ga0197907_10875030 | 3300020069 | Unclassified | 2231 |
| 518 | Ga0206356_10494061 | 3300020070 | Bacteria | 1588 |
| 519 | Ga0206356_10694969 | 3300020070 | Bacteria | 2042 |
| 520 | Ga0206356_11740764 | 3300020070 | Bacteria | 1206 |
| 521 | Ga0206356_11755174 | 3300020070 | Unclassified | 1269 |
| 522 | Ga0206351_10370816 | 3300020077 | Bacteria | 1725 |
| 523 | Ga0206352_10571842 | 3300020078 | Bacteria | 1539 |
| 524 | Ga0206352_10799947 | 3300020078 | Unclassified | 1372 |
| 525 | Ga0206350_10458094 | 3300020080 | Bacteria | 1555 |
| 526 | Ga0206354_10093548 | 3300020081 | Bacteria | 1212 |
| 527 | Ga0206353_10839899 | 3300020082 | Bacteria | 2470 |
| 528 | Ga0206353_11387566 | 3300020082 | Bacteria | 4498 |
| 529 | Ga0224712_10020529 | 3300022467 | Bacteria | 2245 |
| 530 | Ga0224712_10025783 | 3300022467 | Unclassified | 2070 |
| 531 | Ga0224712_10041489 | 3300022467 | Bacteria | 1738 |
| 532 | Ga0224712_10209000 | 3300022467 | Bacteria | 889 |
| 533 | Ga0207697_10087404 | 3300025315 | Bacteria | 1319 |
| 534 | Ga0207656_10083391 | 3300025321 | Unclassified | 1440 |
| 535 | Ga0207653_10001160 | 3300025885 | Bacteria | 8623 |
| 536 | Ga0207682_10068153 | 3300025893 | Bacteria | 1503 |
| 537 | Ga0207692_10069347 | 3300025898 | Unclassified | 1852 |
| 538 | Ga0207692_10117514 | 3300025898 | Unclassified | 1484 |
| 539 | Ga0207710_10175983 | 3300025900 | Bacteria | 1048 |
| 540 | Ga0207688_10000295 | 3300025901 | Bacteria | 22861 |
| 541 | Ga0207688_10196776 | 3300025901 | Bacteria | 1207 |
| 542 | Ga0207647_10178812 | 3300025904 | Bacteria | 1233 |
| 543 | Ga0207685_10000585 | 3300025905 | Bacteria | 6339 |
| 544 | Ga0207685_10148711 | 3300025905 | Bacteria | 1058 |
| 545 | Ga0207699_10060867 | 3300025906 | Bacteria | 2269 |
| 546 | Ga0207699_10095704 | 3300025906 | Bacteria | 1873 |
| 547 | Ga0207645_10049494 | 3300025907 | Bacteria | 2683 |
| 548 | Ga0207643_10003093 | 3300025908 | Bacteria | 8945 |
| 549 | Ga0207643_10070389 | 3300025908 | Bacteria | 2012 |
| 550 | Ga0207705_10019484 | 3300025909 | Bacteria | 4852 |
| 551 | Ga0207705_10020119 | 3300025909 | Bacteria | 4774 |
| 552 | Ga0207705_10090345 | 3300025909 | Bacteria | 2242 |
| 553 | Ga0207705_10153742 | 3300025909 | Bacteria | 1725 |
| 554 | Ga0207684_10075284 | 3300025910 | Bacteria | 2869 |
| 555 | Ga0207684_10093531 | 3300025910 | Bacteria | 2564 |
| 556 | Ga0207654_10139839 | 3300025911 | Bacteria | 1542 |
| 557 | Ga0207654_10258070 | 3300025911 | Unclassified | 1171 |
| 558 | Ga0207707_10006792 | 3300025912 | Bacteria | 9984 |
| 559 | Ga0207707_10008124 | 3300025912 | Bacteria | 9112 |
| 560 | Ga0207707_10043146 | 3300025912 | Bacteria | 3935 |
| 561 | Ga0207707_10078554 | 3300025912 | Bacteria | 2882 |
| 562 | Ga0207707_10103694 | 3300025912 | Bacteria | 2486 |
| 563 | Ga0207707_10134715 | 3300025912 | Unclassified | 2160 |
| 564 | Ga0207707_10135647 | 3300025912 | Bacteria | 2152 |
| 565 | Ga0207707_10174541 | 3300025912 | Bacteria | 1877 |
| 566 | Ga0207707_10278409 | 3300025912 | Bacteria | 1449 |
| 567 | Ga0207707_10288078 | 3300025912 | Unclassified | 1421 |
| 568 | Ga0207707_10424055 | 3300025912 | Bacteria | 1140 |
| 569 | Ga0207695_10083465 | 3300025913 | Bacteria | 3227 |
| 570 | Ga0207695_10345702 | 3300025913 | Bacteria | 1375 |
| 571 | Ga0207695_10712186 | 3300025913 | Unclassified | 884 |
| 572 | Ga0207693_10002991 | 3300025915 | Bacteria | 14628 |
| 573 | Ga0207693_10004428 | 3300025915 | Bacteria | 11878 |
| 574 | Ga0207693_10006759 | 3300025915 | Bacteria | 9470 |
| 575 | Ga0207693_10008709 | 3300025915 | Bacteria | 8296 |
| 576 | Ga0207693_10022035 | 3300025915 | Bacteria | 5065 |
| 577 | Ga0207693_10041523 | 3300025915 | Bacteria | 3621 |
| 578 | Ga0207663_10010865 | 3300025916 | Bacteria | 4863 |
| 579 | Ga0207663_10025121 | 3300025916 | Bacteria | 3439 |
| 580 | Ga0207663_10033479 | 3300025916 | Unclassified | 3062 |
| 581 | Ga0207663_10201736 | 3300025916 | Bacteria | 1435 |
| 582 | Ga0207663_10386693 | 3300025916 | Bacteria | 1067 |
| 583 | Ga0207660_10016370 | 3300025917 | Bacteria | 4907 |
| 584 | Ga0207660_10035726 | 3300025917 | Bacteria | 3452 |
| 585 | Ga0207660_10100927 | 3300025917 | Bacteria | 2155 |
| 586 | Ga0207660_10236601 | 3300025917 | Bacteria | 1437 |
| 587 | Ga0207660_10440763 | 3300025917 | Bacteria | 1052 |
| 588 | Ga0207662_10118327 | 3300025918 | Bacteria | 1659 |
| 589 | Ga0207657_10000046 | 3300025919 | Bacteria | 113887 |
| 590 | Ga0207657_10002149 | 3300025919 | Bacteria | 21362 |
| 591 | Ga0207657_10002359 | 3300025919 | Bacteria | 20451 |
| 592 | Ga0207657_10007745 | 3300025919 | Bacteria | 10968 |
| 593 | Ga0207657_10007972 | 3300025919 | Bacteria | 10797 |
| 594 | Ga0207657_10099989 | 3300025919 | Unclassified | 2408 |
| 595 | Ga0207657_10176801 | 3300025919 | Bacteria | 1727 |
| 596 | Ga0207657_10219350 | 3300025919 | Unclassified | 1524 |
| 597 | Ga0207657_10221056 | 3300025919 | Bacteria | 1517 |
| 598 | Ga0207649_10008800 | 3300025920 | Bacteria | 5508 |
| 599 | Ga0207649_10119557 | 3300025920 | Bacteria | 1774 |
| 600 | Ga0207649_10168041 | 3300025920 | Bacteria | 1525 |
| 601 | Ga0207649_10217118 | 3300025920 | Bacteria | 1360 |
| 602 | Ga0207649_10363486 | 3300025920 | Unclassified | 1075 |
| 603 | Ga0207652_10015699 | 3300025921 | Bacteria | 6168 |
| 604 | Ga0207652_10027233 | 3300025921 | Bacteria | 4762 |
| 605 | Ga0207652_10028459 | 3300025921 | Bacteria | 4662 |
| 606 | Ga0207652_10038654 | 3300025921 | Bacteria | 4047 |
| 607 | Ga0207652_10153591 | 3300025921 | Bacteria | 2062 |
| 608 | Ga0207652_10290157 | 3300025921 | Bacteria | 1476 |
| 609 | Ga0207652_10300993 | 3300025921 | Bacteria | 1447 |
| 610 | Ga0207652_10507859 | 3300025921 | Bacteria | 1085 |
| 611 | Ga0207646_10000835 | 3300025922 | Bacteria | 40092 |
| 612 | Ga0207646_10001503 | 3300025922 | Bacteria | 28669 |
| 613 | Ga0207646_10045537 | 3300025922 | Bacteria | 3939 |
| 614 | Ga0207646_10210908 | 3300025922 | Bacteria | 1754 |
| 615 | Ga0207681_10016252 | 3300025923 | Bacteria | 4653 |
| 616 | Ga0207681_10091249 | 3300025923 | Unclassified | 2176 |
| 617 | Ga0207694_10017573 | 3300025924 | Bacteria | 5407 |
| 618 | Ga0207694_10045933 | 3300025924 | Bacteria | 3375 |
| 619 | Ga0207694_10179638 | 3300025924 | Bacteria | 1716 |
| 620 | Ga0207650_10003626 | 3300025925 | Bacteria | 10578 |
| 621 | Ga0207650_10017795 | 3300025925 | Bacteria | 4978 |
| 622 | Ga0207650_10128800 | 3300025925 | Unclassified | 1978 |
| 623 | Ga0207659_10079846 | 3300025926 | Bacteria | 2415 |
| 624 | Ga0207659_10095799 | 3300025926 | Unclassified | 2226 |
| 625 | Ga0207687_10035439 | 3300025927 | Bacteria | 3394 |
| 626 | Ga0207687_10047111 | 3300025927 | Unclassified | 2987 |
| 627 | Ga0207687_10079516 | 3300025927 | Unclassified | 2364 |
| 628 | Ga0207687_10098003 | 3300025927 | Bacteria | 2152 |
| 629 | Ga0207687_10270241 | 3300025927 | Bacteria | 1359 |
| 630 | Ga0207687_10314883 | 3300025927 | Bacteria | 1265 |
| 631 | Ga0207687_10371949 | 3300025927 | Unclassified | 1169 |
| 632 | Ga0207687_10647647 | 3300025927 | Bacteria | 894 |
| 633 | Ga0207700_10013428 | 3300025928 | Bacteria | 5329 |
| 634 | Ga0207700_10029054 | 3300025928 | Bacteria | 3897 |
| 635 | Ga0207700_10245582 | 3300025928 | Bacteria | 1527 |
| 636 | Ga0207664_10006174 | 3300025929 | Bacteria | 8220 |
| 637 | Ga0207664_10016830 | 3300025929 | Bacteria | 5343 |
| 638 | Ga0207664_10023674 | 3300025929 | Bacteria | 4605 |
| 639 | Ga0207664_10030636 | 3300025929 | Unclassified | 4110 |
| 640 | Ga0207664_10163985 | 3300025929 | Bacteria | 1897 |
| 641 | Ga0207664_10240129 | 3300025929 | Bacteria | 1578 |
| 642 | Ga0207664_10463437 | 3300025929 | Bacteria | 1132 |
| 643 | Ga0207664_10661246 | 3300025929 | Unclassified | 939 |
| 644 | Ga0207644_10057035 | 3300025931 | Bacteria | 2819 |
| 645 | Ga0207644_10444752 | 3300025931 | Archaea | 1064 |
| 646 | Ga0207690_10013980 | 3300025932 | Bacteria | 4837 |
| 647 | Ga0207690_10060399 | 3300025932 | Bacteria | 2572 |
| 648 | Ga0207690_10088629 | 3300025932 | Unclassified | 2180 |
| 649 | Ga0207690_10104351 | 3300025932 | Bacteria | 2030 |
| 650 | Ga0207690_10310119 | 3300025932 | Bacteria | 1237 |
| 651 | Ga0207690_10487808 | 3300025932 | Unclassified | 995 |
| 652 | Ga0207690_10497624 | 3300025932 | Bacteria | 985 |
| 653 | Ga0207706_10009744 | 3300025933 | Bacteria | 8816 |
| 654 | Ga0207706_10027954 | 3300025933 | Bacteria | 5040 |
| 655 | Ga0207706_10050444 | 3300025933 | Bacteria | 3677 |
| 656 | Ga0207706_10295927 | 3300025933 | Bacteria | 1411 |
| 657 | Ga0207686_10031586 | 3300025934 | Bacteria | 3146 |
| 658 | Ga0207686_10032319 | 3300025934 | Bacteria | 3114 |
| 659 | Ga0207686_10103308 | 3300025934 | Unclassified | 1907 |
| 660 | Ga0207686_10108315 | 3300025934 | Bacteria | 1869 |
| 661 | Ga0207686_10181187 | 3300025934 | Bacteria | 1494 |
| 662 | Ga0207686_10280341 | 3300025934 | Bacteria | 1230 |
| 663 | Ga0207709_10030813 | 3300025935 | Bacteria | 3124 |
| 664 | Ga0207709_10079412 | 3300025935 | Bacteria | 2110 |
| 665 | Ga0207709_10130382 | 3300025935 | Bacteria | 1713 |
| 666 | Ga0207670_10003061 | 3300025936 | Bacteria | 8828 |
| 667 | Ga0207669_10008057 | 3300025937 | Bacteria | 4927 |
| 668 | Ga0207669_10021197 | 3300025937 | Bacteria | 3425 |
| 669 | Ga0207669_10061864 | 3300025937 | Bacteria | 2303 |
| 670 | Ga0207669_10104068 | 3300025937 | Unclassified | 1884 |
| 671 | Ga0207704_10002504 | 3300025938 | Bacteria | 8279 |
| 672 | Ga0207704_10150272 | 3300025938 | Bacteria | 1642 |
| 673 | Ga0207704_10193957 | 3300025938 | Unclassified | 1480 |
| 674 | Ga0207704_10426384 | 3300025938 | Bacteria | 1053 |
| 675 | Ga0207665_10000336 | 3300025939 | Bacteria | 32436 |
| 676 | Ga0207665_10009424 | 3300025939 | Bacteria | 6408 |
| 677 | Ga0207665_10305111 | 3300025939 | Unclassified | 1191 |
| 678 | Ga0207691_10014333 | 3300025940 | Bacteria | 7558 |
| 679 | Ga0207691_10042275 | 3300025940 | Bacteria | 4202 |
| 680 | Ga0207691_10142905 | 3300025940 | Bacteria | 2108 |
| 681 | Ga0207691_10474730 | 3300025940 | Bacteria | 1063 |
| 682 | Ga0207691_10587835 | 3300025940 | Bacteria | 943 |
| 683 | Ga0207711_10559826 | 3300025941 | Bacteria | 1066 |
| 684 | Ga0207689_10020194 | 3300025942 | Bacteria | 5610 |
| 685 | Ga0207689_10232023 | 3300025942 | Unclassified | 1525 |
| 686 | Ga0207661_10035507 | 3300025944 | Bacteria | 3885 |
| 687 | Ga0207661_10040814 | 3300025944 | Bacteria | 3651 |
| 688 | Ga0207661_10052608 | 3300025944 | Bacteria | 3254 |
| 689 | Ga0207661_10058519 | 3300025944 | Bacteria | 3101 |
| 690 | Ga0207661_10059188 | 3300025944 | Unclassified | 3086 |
| 691 | Ga0207661_10094976 | 3300025944 | Bacteria | 2491 |
| 692 | Ga0207661_10148807 | 3300025944 | Bacteria | 2022 |
| 693 | Ga0207661_10150765 | 3300025944 | Unclassified | 2009 |
| 694 | Ga0207661_10231300 | 3300025944 | Bacteria | 1637 |
| 695 | Ga0207661_10396730 | 3300025944 | Bacteria | 1250 |
| 696 | Ga0207661_10829156 | 3300025944 | Bacteria | 851 |
| 697 | Ga0207679_10048143 | 3300025945 | Unclassified | 3101 |
| 698 | Ga0207679_10415651 | 3300025945 | Unclassified | 1186 |
| 699 | Ga0207679_10662016 | 3300025945 | Bacteria | 945 |
| 700 | Ga0207667_10049523 | 3300025949 | Bacteria | 4436 |
| 701 | Ga0207667_10052443 | 3300025949 | Bacteria | 4295 |
| 702 | Ga0207667_10071362 | 3300025949 | Bacteria | 3611 |
| 703 | Ga0207667_10109111 | 3300025949 | Bacteria | 2855 |
| 704 | Ga0207667_10154405 | 3300025949 | Bacteria | 2362 |
| 705 | Ga0207667_10214420 | 3300025949 | Bacteria | 1973 |
| 706 | Ga0207667_10277037 | 3300025949 | Bacteria | 1714 |
| 707 | Ga0207667_10397603 | 3300025949 | Bacteria | 1403 |
| 708 | Ga0207667_10500751 | 3300025949 | Unclassified | 1232 |
| 709 | Ga0207651_10009014 | 3300025960 | Bacteria | 5426 |
| 710 | Ga0207651_10230977 | 3300025960 | Bacteria | 1502 |
| 711 | Ga0207668_10008754 | 3300025972 | Bacteria | 6048 |
| 712 | Ga0207668_10074890 | 3300025972 | Bacteria | 2432 |
| 713 | Ga0207668_10637961 | 3300025972 | Bacteria | 931 |
| 714 | Ga0207640_10010996 | 3300025981 | Bacteria | 5109 |
| 715 | Ga0207640_10172003 | 3300025981 | Bacteria | 1615 |
| 716 | Ga0207640_10211804 | 3300025981 | Unclassified | 1477 |
| 717 | Ga0207658_10004838 | 3300025986 | Bacteria | 9311 |
| 718 | Ga0207658_10114119 | 3300025986 | Bacteria | 2142 |
| 719 | Ga0207677_10078690 | 3300026023 | Unclassified | 2355 |
| 720 | Ga0207677_10433651 | 3300026023 | Viruses | 1122 |
| 721 | Ga0207703_10014085 | 3300026035 | Bacteria | 6233 |
| 722 | Ga0207703_10152853 | 3300026035 | Bacteria | 2014 |
| 723 | Ga0207639_10067705 | 3300026041 | Bacteria | 2779 |
| 724 | Ga0207639_10316350 | 3300026041 | Bacteria | 1385 |
| 725 | Ga0207639_10332069 | 3300026041 | Bacteria | 1353 |
| 726 | Ga0207639_10363730 | 3300026041 | Bacteria | 1295 |
| 727 | Ga0207639_10552061 | 3300026041 | Bacteria | 1058 |
| 728 | Ga0207678_10008584 | 3300026067 | Bacteria | 9001 |
| 729 | Ga0207678_10083870 | 3300026067 | Bacteria | 2726 |
| 730 | Ga0207678_10330939 | 3300026067 | Unclassified | 1311 |
| 731 | Ga0207708_10013763 | 3300026075 | Bacteria | 6046 |
| 732 | Ga0207708_10028141 | 3300026075 | Bacteria | 4256 |
| 733 | Ga0207702_10005093 | 3300026078 | Bacteria | 11551 |
| 734 | Ga0207702_10016688 | 3300026078 | Bacteria | 6078 |
| 735 | Ga0207702_10030487 | 3300026078 | Bacteria | 4495 |
| 736 | Ga0207702_10081441 | 3300026078 | Bacteria | 2811 |
| 737 | Ga0207702_10107262 | 3300026078 | Bacteria | 2476 |
| 738 | Ga0207702_10496304 | 3300026078 | Bacteria | 1189 |
| 739 | Ga0207641_10575921 | 3300026088 | Bacteria | 1100 |
| 740 | Ga0207648_10017489 | 3300026089 | Bacteria | 6521 |
| 741 | Ga0207648_10069092 | 3300026089 | Bacteria | 3078 |
| 742 | Ga0207676_10704504 | 3300026095 | Bacteria | 978 |
| 743 | Ga0207676_11241681 | 3300026095 | Bacteria | 739 |
| 744 | Ga0207674_10002821 | 3300026116 | Bacteria | 21604 |
| 745 | Ga0207674_10041842 | 3300026116 | Bacteria | 4736 |
| 746 | Ga0207674_10139150 | 3300026116 | Bacteria | 2388 |
| 747 | Ga0207674_10153418 | 3300026116 | Bacteria | 2259 |
| 748 | Ga0207674_10550577 | 3300026116 | Bacteria | 1114 |
| 749 | Ga0207675_100002655 | 3300026118 | Bacteria | 17641 |
| 750 | Ga0207675_100002688 | 3300026118 | Bacteria | 17542 |
| 751 | Ga0207675_100224847 | 3300026118 | Unclassified | 1809 |
| 752 | Ga0207683_10018336 | 3300026121 | Bacteria | 5970 |
| 753 | Ga0207683_10019988 | 3300026121 | Bacteria | 5721 |
| 754 | Ga0207683_10030783 | 3300026121 | Bacteria | 4652 |
| 755 | Ga0207683_10032768 | 3300026121 | Bacteria | 4514 |
| 756 | Ga0207683_10041263 | 3300026121 | Bacteria | 4029 |
| 757 | Ga0207698_10007523 | 3300026142 | Bacteria | 6827 |
| 758 | Ga0207698_10229384 | 3300026142 | Bacteria | 1685 |
| 759 | Ga0207698_10693616 | 3300026142 | Bacteria | 1012 |
| 760 | Ga0207698_10840846 | 3300026142 | Bacteria | 922 |
| 761 | Ga0207428_10024156 | 3300027907 | Bacteria | 5105 |
| 762 | Ga0207428_10031019 | 3300027907 | Bacteria | 4416 |
| 763 | Ga0207428_10038452 | 3300027907 | Bacteria | 3889 |
| 764 | Ga0207428_10125373 | 3300027907 | Bacteria | 1967 |
| 765 | Ga0207428_10142811 | 3300027907 | Bacteria | 1826 |
| 766 | Ga0207428_10230413 | 3300027907 | Unclassified | 1386 |
| 767 | Ga0268266_10020487 | 3300028379 | Bacteria | 5637 |
| 768 | Ga0268266_10270108 | 3300028379 | Unclassified | 1578 |
| 769 | Ga0268266_10816926 | 3300028379 | Unclassified | 901 |
| 770 | Ga0268265_10117659 | 3300028380 | Bacteria | 2183 |
| 771 | Ga0268265_10135980 | 3300028380 | Unclassified | 2051 |
| 772 | Ga0268264_10082317 | 3300028381 | Bacteria | 2754 |
| 773 | Ga0265334_10010096 | 3300028573 | Bacteria | 3987 |
| 774 | Ga0265318_10010050 | 3300028577 | Bacteria | 4137 |
| 775 | Ga0265318_10037064 | 3300028577 | Bacteria | 1869 |
| 776 | Ga0265336_10002579 | 3300028666 | Bacteria | 7406 |
| 777 | Ga0265336_10057096 | 3300028666 | Bacteria | 1172 |
| 778 | Ga0265338_10007091 | 3300028800 | Bacteria | 14041 |
| 779 | Ga0265338_10010810 | 3300028800 | Bacteria | 10641 |
| 780 | Ga0265338_10017185 | 3300028800 | Bacteria | 7814 |
| 781 | Ga0265338_10082217 | 3300028800 | Bacteria | 2697 |
| 782 | Ga0265338_10136375 | 3300028800 | Bacteria | 1928 |
| 783 | Ga0265324_10018729 | 3300029957 | Bacteria | 2500 |
| 784 | Ga0265320_10060231 | 3300031240 | Bacteria | 1813 |
| 785 | Ga0265339_10009216 | 3300031249 | Bacteria | 6223 |
| 786 | Ga0265331_10043314 | 3300031250 | Bacteria | 2181 |
| 787 | Ga0265327_10042865 | 3300031251 | Bacteria | 2426 |
| 788 | Ga0265327_10074306 | 3300031251 | Bacteria | 1694 |
| 789 | Ga0307408_100192265 | 3300031548 | Bacteria | 1645 |
| 790 | Ga0265313_10011904 | 3300031595 | Bacteria | 5369 |
| 791 | Ga0265314_10011431 | 3300031711 | Bacteria | 7328 |
| 792 | Ga0307405_10140772 | 3300031731 | Bacteria | 1682 |
| 793 | Ga0307410_10248392 | 3300031852 | Bacteria | 1382 |
| 794 | Ga0307406_10170663 | 3300031901 | Bacteria | 1574 |
| 795 | Ga0307412_10285345 | 3300031911 | Bacteria | 1298 |
| 796 | Ga0307409_100013556 | 3300031995 | Bacteria | 5254 |
| 797 | Ga0307409_100080100 | 3300031995 | Bacteria | 2634 |
| 798 | Ga0307409_100154478 | 3300031995 | Bacteria | 1998 |
| 799 | Ga0307409_100688980 | 3300031995 | Bacteria | 1020 |
| 800 | Ga0307415_100072492 | 3300032126 | Bacteria | 2426 |
| 801 | Ga0316583_10053325 | 3300032133 | Bacteria | 1422 |
| 802 | Ga0373958_0004712 | 3300034819 | Bacteria | 2032 |
| 803 | Ga0373928_0005179 | 3300035084 | Bacteria | 2488 |
| 804 | Ga0373940_0020246 | 3300035088 | Bacteria | 1688 |
| 805 | Ga0373944_0047146 | 3300035089 | Unclassified | 1349 |
| 806 | Ga0373949_0031541 | 3300035090 | Bacteria | 1264 |
| 807 | Ga0373951_0003334 | 3300035091 | Bacteria | 3929 |
| 808 | Ga0373952_0001629 | 3300035092 | Bacteria | 4086 |
| 809 | Ga0373932_0002933 | 3300035112 | Bacteria | 4203 |
| 810 | Ga0373936_0017166 | 3300035113 | Bacteria | 2785 |
| 811 | Ga0373939_0014676 | 3300035114 | Bacteria | 2037 |
| 812 | Ga0373945_0003618 | 3300035116 | Bacteria | 4869 |
| 813 | Ga0373945_0030800 | 3300035116 | Bacteria | 1892 |
| 814 | Ga0373953_0117933 | 3300035117 | Bacteria | 1126 |
| 815 | Ga0373960_0005893 | 3300035121 | Bacteria | 2852 |
| 816 | Ga0373960_0006215 | 3300035121 | Bacteria | 2794 |
| 817 | Ga0373943_0006431 | 3300035170 | Bacteria | 5275 |
| 818 | Ga0373946_0017378 | 3300035171 | Bacteria | 2752 |
| 819 | Ga0373946_0050585 | 3300035171 | Bacteria | 1736 |
| 820 | Ga0373955_0224463 | 3300035172 | Bacteria | 1123 |
| 821 | Ga0373955_0287626 | 3300035172 | Unclassified | 990 |
| 822 | Ga0373942_0013065 | 3300035207 | Bacteria | 1991 |
| 823 | Ga0373942_0073200 | 3300035207 | Bacteria | 1004 |
| 824 | Ga0373961_0008338 | 3300035241 | Bacteria | 2520 |
| 825 | Ga0373961_0008521 | 3300035241 | Bacteria | 2494 |
| 826 | Ga0373962_0003210 | 3300035242 | Bacteria | 3922 |
| 827 | Ga0316574_0013253 | 3300035398 | Bacteria | 4735 |
| 828 | Ga0373924_0098938 | 3300035410 | Bacteria | 1253 |
| 829 | Ga0373931_0008030 | 3300035691 | Bacteria | 4994 |
| 830 | Ga0373931_0023902 | 3300035691 | Bacteria | 3089 |
| 831 | Ga0373931_0064143 | 3300035691 | Bacteria | 1987 |
| 832 | Ga0373935_0024832 | 3300035692 | Bacteria | 3691 |
| 833 | Ga0373935_0198469 | 3300035692 | Bacteria | 1385 |
| 834 | Ga0373947_0000590 | 3300035725 | Bacteria | 21313 |
| 835 | Ga0373947_0002156 | 3300035725 | Bacteria | 11960 |
| 836 | Ga0373947_0009289 | 3300035725 | Bacteria | 5649 |
| 837 | Ga0373947_0038227 | 3300035725 | Bacteria | 2850 |
| 838 | Ga0373937_0078598 | 3300036401 | Bacteria | 3049 |
| 839 | Ga0373937_0079049 | 3300036401 | Bacteria | 3040 |
| 840 | Ga0373925_0008041 | 3300037068 | Bacteria | 7682 |
| 841 | Ga0373925_0019221 | 3300037068 | Bacteria | 4968 |
| 842 | Ga0395899_0001492 | 3300037312 | Bacteria | 19877 |
| 843 | Ga0395899_0005009 | 3300037312 | Bacteria | 10306 |
| 844 | Ga0395899_0005435 | 3300037312 | Bacteria | 9885 |
| 845 | Ga0395899_0007004 | 3300037312 | Bacteria | 8727 |
| 846 | Ga0395899_0019451 | 3300037312 | Bacteria | 5158 |
| 847 | Ga0395899_0021446 | 3300037312 | Bacteria | 4900 |
| 848 | Ga0395899_0031033 | 3300037312 | Bacteria | 4018 |
| 849 | Ga0395899_0032696 | 3300037312 | Bacteria | 3909 |
| 850 | Ga0395899_0054157 | 3300037312 | Bacteria | 2969 |
| 851 | Ga0395899_0141336 | 3300037312 | Unclassified | 1712 |
| 852 | Ga0395899_0212757 | 3300037312 | Bacteria | 1343 |
| 853 | Ga0395899_0264261 | 3300037312 | Bacteria | 1176 |
| 854 | Ga0395900_0002249 | 3300037418 | Bacteria | 21466 |
| 855 | Ga0395900_0002962 | 3300037418 | Bacteria | 18481 |
| 856 | Ga0395900_0005184 | 3300037418 | Bacteria | 13682 |
| 857 | Ga0395900_0008768 | 3300037418 | Bacteria | 10390 |
| 858 | Ga0395900_0011825 | 3300037418 | Bacteria | 8925 |
| 859 | Ga0395900_0015152 | 3300037418 | Bacteria | 7861 |
| 860 | Ga0395900_0021106 | 3300037418 | Bacteria | 6655 |
| 861 | Ga0395900_0031804 | 3300037418 | Bacteria | 5424 |
| 862 | Ga0395900_0050359 | 3300037418 | Bacteria | 4290 |
| 863 | Ga0395900_0060273 | 3300037418 | Bacteria | 3906 |
| 864 | Ga0395900_0072551 | 3300037418 | Bacteria | 3539 |
| 865 | Ga0395900_0074483 | 3300037418 | Bacteria | 3490 |
| 866 | Ga0395900_0079316 | 3300037418 | Bacteria | 3373 |
| 867 | Ga0395900_0081382 | 3300037418 | Bacteria | 3327 |
| 868 | Ga0395900_0086757 | 3300037418 | Unclassified | 3216 |
| 869 | Ga0395900_0105591 | 3300037418 | Bacteria | 2894 |
| 870 | Ga0395900_0109750 | 3300037418 | Bacteria | 2834 |
| 871 | Ga0395900_0143504 | 3300037418 | Unclassified | 2443 |
| 872 | Ga0395900_0150702 | 3300037418 | Bacteria | 2376 |
| 873 | Ga0395900_0171524 | 3300037418 | Bacteria | 2208 |
| 874 | Ga0395900_0186308 | 3300037418 | Bacteria | 2107 |
| 875 | Ga0395900_0234107 | 3300037418 | Bacteria | 1846 |
| 876 | Ga0395900_0235434 | 3300037418 | Bacteria | 1839 |
| 877 | Ga0395900_0408815 | 3300037418 | Bacteria | 1320 |
| 878 | Ga0395900_0622298 | 3300037418 | Unclassified | 1018 |
| 879 | Ga0395900_0745970 | 3300037418 | Bacteria | 909 |
| 880 | Ga0395898_0001213 | 3300037466 | Bacteria | 38909 |
| 881 | Ga0395898_0001862 | 3300037466 | Bacteria | 27022 |
| 882 | Ga0395898_0010024 | 3300037466 | Bacteria | 9923 |
| 883 | Ga0395898_0012117 | 3300037466 | Bacteria | 8926 |
| 884 | Ga0395898_0012770 | 3300037466 | Bacteria | 8673 |
| 885 | Ga0395898_0016061 | 3300037466 | Bacteria | 7669 |
| 886 | Ga0395898_0017469 | 3300037466 | Bacteria | 7325 |
| 887 | Ga0395898_0018501 | 3300037466 | Bacteria | 7101 |
| 888 | Ga0395898_0020827 | 3300037466 | Bacteria | 6655 |
| 889 | Ga0395898_0034509 | 3300037466 | Bacteria | 5041 |
| 890 | Ga0395898_0043430 | 3300037466 | Bacteria | 4429 |
| 891 | Ga0395898_0047102 | 3300037466 | Bacteria | 4232 |
| 892 | Ga0395898_0057630 | 3300037466 | Bacteria | 3785 |
| 893 | Ga0395898_0079296 | 3300037466 | Bacteria | 3168 |
| 894 | Ga0395898_0086795 | 3300037466 | Bacteria | 3015 |
| 895 | Ga0395898_0119142 | 3300037466 | Unclassified | 2528 |
| 896 | Ga0395898_0563873 | 3300037466 | Bacteria | 1081 |
| 897 | Ga0395898_0578377 | 3300037466 | Bacteria | 1065 |
| 898 | Ga0395905_0004021 | 3300037471 | Bacteria | 15433 |
| 899 | Ga0395905_0007290 | 3300037471 | Bacteria | 11023 |
| 900 | Ga0395905_0018249 | 3300037471 | Bacteria | 6660 |
| 901 | Ga0395905_0018594 | 3300037471 | Bacteria | 6592 |
| 902 | Ga0395905_0048739 | 3300037471 | Bacteria | 3969 |
| 903 | Ga0395905_0052112 | 3300037471 | Bacteria | 3832 |
| 904 | Ga0395905_0113171 | 3300037471 | Bacteria | 2549 |
| 905 | Ga0395905_0171590 | 3300037471 | Unclassified | 2037 |
| 906 | Ga0395905_0194856 | 3300037471 | Bacteria | 1900 |
| 907 | Ga0395905_0413410 | 3300037471 | Bacteria | 1244 |
| 908 | Ga0395905_0459555 | 3300037471 | Unclassified | 1171 |
| 909 | Ga0395901_0000809 | 3300038443 | Bacteria | 34767 |
| 910 | Ga0395901_0001901 | 3300038443 | Bacteria | 21558 |
| 911 | Ga0395901_0002490 | 3300038443 | Bacteria | 18665 |
| 912 | Ga0395901_0008659 | 3300038443 | Bacteria | 10280 |
| 913 | Ga0395901_0009351 | 3300038443 | Bacteria | 9939 |
| 914 | Ga0395901_0032973 | 3300038443 | Bacteria | 5343 |
| 915 | Ga0395901_0039132 | 3300038443 | Bacteria | 4906 |
| 916 | Ga0395901_0041742 | 3300038443 | Unclassified | 4755 |
| 917 | Ga0395901_0050752 | 3300038443 | Bacteria | 4309 |
| 918 | Ga0395901_0051027 | 3300038443 | Bacteria | 4299 |
| 919 | Ga0395901_0059937 | 3300038443 | Bacteria | 3960 |
| 920 | Ga0395901_0066313 | 3300038443 | Bacteria | 3760 |
| 921 | Ga0395901_0106747 | 3300038443 | Bacteria | 2939 |
| 922 | Ga0395901_0116948 | 3300038443 | Unclassified | 2801 |
| 923 | Ga0395901_0128039 | 3300038443 | Bacteria | 2668 |
| 924 | Ga0395901_0263567 | 3300038443 | Bacteria | 1793 |
| 925 | Ga0395901_0277743 | 3300038443 | Bacteria | 1741 |
| 926 | Ga0395901_0282952 | 3300038443 | Unclassified | 1722 |
| 927 | Ga0395901_0359150 | 3300038443 | Bacteria | 1502 |
| 928 | Ga0395901_0461644 | 3300038443 | Bacteria | 1297 |
| 929 | Ga0395901_0483924 | 3300038443 | Bacteria | 1262 |
| 930 | Ga0395901_0609890 | 3300038443 | Bacteria | 1099 |
| 931 | Ga0242420_004502 | 3300038996 | Bacteria | 2112 |
| 932 | Ga0436365_1254107 | 3300039437 | Bacteria | 1030 |
| 933 | Ga0436360_0528570 | 3300039438 | Bacteria | 12723 |
| 934 | Ga0436363_0737093 | 3300039450 | Bacteria | 1332 |
| 935 | Ga0439439_0005013 | 3300041406 | Bacteria | 3007 |
| 936 | Ga0439461_0003668 | 3300041410 | Bacteria | 2532 |
| 937 | Ga0439461_0004257 | 3300041410 | Bacteria | 2382 |
| 938 | Ga0451793_0630142 | 3300041452 | Unclassified | 1592 |
| 939 | Ga0451800_1364113 | 3300041459 | Bacteria | 2143 |
| 940 | Ga0451807_1292183 | 3300041486 | Bacteria | 2230 |
| 941 | Ga0451839_1137856 | 3300041496 | Unclassified | 1753 |
| 942 | Ga0451847_0357059 | 3300041503 | Bacteria | 1018 |
| 943 | Ga0451853_0212631 | 3300041512 | Bacteria | 6314 |
| 944 | Ga0451853_0402185 | 3300041512 | Bacteria | 3552 |
| 945 | Ga0451853_2653982 | 3300041512 | Bacteria | 1954 |
| 946 | Ga0450905_011737 | 3300042142 | Unclassified | 1228 |
| 947 | Ga0450907_004083 | 3300042146 | Bacteria | 2530 |
| 948 | Ga0450907_020314 | 3300042146 | Unclassified | 1115 |
| 949 | Ga0450910_011683 | 3300042147 | Unclassified | 1262 |
| 950 | Ga0439446_0000185 | 3300042156 | Bacteria | 11046 |
| 951 | Ga0439434_0016341 | 3300042435 | Bacteria | 2217 |
| 952 | Ga0439460_0031843 | 3300042461 | Bacteria | 1507 |
| 953 | Ga0466969_0000388 | 3300044656 | Bacteria | 24129 |
| 954 | Ga0466969_0044191 | 3300044656 | Bacteria | 2218 |
| 955 | Ga0466969_0116144 | 3300044656 | Bacteria | 1249 |
| 956 | Ga0466972_0128669 | 3300044658 | Bacteria | 1193 |
| 957 | Ga0466965_0046401 | 3300044683 | Bacteria | 2151 |
| 958 | Ga0466965_0152181 | 3300044683 | Bacteria | 1209 |
| 959 | Ga0466965_0158190 | 3300044683 | Bacteria | 1187 |
| 960 | Ga0466965_0228553 | 3300044683 | Unclassified | 993 |
| 961 | Ga0466966_0002834 | 3300044684 | Bacteria | 11411 |
| 962 | Ga0466966_0057272 | 3300044684 | Bacteria | 2464 |
| 963 | Ga0466966_0085742 | 3300044684 | Bacteria | 1958 |
| 964 | Ga0466966_0138822 | 3300044684 | Bacteria | 1486 |
| 965 | Ga0466966_0172378 | 3300044684 | Bacteria | 1314 |
| 966 | Ga0466961_0007905 | 3300044693 | Bacteria | 6776 |
| 967 | Ga0466961_0023641 | 3300044693 | Bacteria | 3954 |
| 968 | Ga0466961_0037806 | 3300044693 | Bacteria | 3096 |
| 969 | Ga0466961_0189443 | 3300044693 | Bacteria | 1275 |
| 970 | Ga0466963_0011013 | 3300044694 | Bacteria | 5498 |
| 971 | Ga0466963_0018103 | 3300044694 | Bacteria | 4398 |
| 972 | Ga0466963_0031898 | 3300044694 | Bacteria | 3407 |
| 973 | Ga0466963_0033265 | 3300044694 | Bacteria | 3345 |
| 974 | Ga0466963_0042077 | 3300044694 | Bacteria | 2998 |
| 975 | Ga0466963_0073846 | 3300044694 | Unclassified | 2300 |
| 976 | Ga0466963_0100887 | 3300044694 | Bacteria | 1975 |
| 977 | Ga0466963_0112053 | 3300044694 | Bacteria | 1873 |
| 978 | Ga0466963_0165973 | 3300044694 | Unclassified | 1538 |
| 979 | Ga0466963_0184360 | 3300044694 | Bacteria | 1457 |
| 980 | Ga0466964_0004468 | 3300044706 | Bacteria | 5166 |
| 981 | Ga0466964_0005246 | 3300044706 | Bacteria | 4803 |
| 982 | Ga0466964_0012091 | 3300044706 | Bacteria | 3265 |
| 983 | Ga0466964_0088629 | 3300044706 | Bacteria | 1342 |
| 984 | Ga0466964_0134568 | 3300044706 | Bacteria | 1129 |
| 985 | Ga0466964_0210372 | 3300044706 | Unclassified | 939 |
| 986 | Ga0466971_0015252 | 3300044719 | Bacteria | 3382 |
| 987 | Ga0466971_0020720 | 3300044719 | Bacteria | 2923 |
| 988 | Ga0466968_0004580 | 3300044735 | Bacteria | 5170 |
| 989 | Ga0466968_0006008 | 3300044735 | Bacteria | 4555 |
| 990 | Ga0466968_0010497 | 3300044735 | Bacteria | 3593 |
| 991 | Ga0466968_0122035 | 3300044735 | Bacteria | 1180 |
| 992 | Ga0466968_0142788 | 3300044735 | Unclassified | 1096 |
| 993 | Ga0466970_0015670 | 3300044765 | Bacteria | 3903 |
| 994 | Ga0466970_0077391 | 3300044765 | Bacteria | 1793 |
| 995 | Ga0466957_0004248 | 3300044842 | Bacteria | 7943 |
| 996 | Ga0466957_0007431 | 3300044842 | Bacteria | 6190 |
| 997 | Ga0466957_0024815 | 3300044842 | Bacteria | 3551 |
| 998 | Ga0466957_0101147 | 3300044842 | Bacteria | 1817 |
| 999 | Ga0466957_0139420 | 3300044842 | Bacteria | 1561 |
| 1000 | Ga0466957_0283966 | 3300044842 | Unclassified | 1108 |
| 1001 | Ga0466957_0360383 | 3300044842 | Unclassified | 988 |
| 1002 | Ga0466960_0097361 | 3300044901 | Bacteria | 1509 |
| 1003 | Ga0466960_0152349 | 3300044901 | Bacteria | 1236 |
| 1004 | Ga0466960_0156814 | 3300044901 | Bacteria | 1219 |
| 1005 | Ga0466959_0016642 | 3300045049 | Bacteria | 5376 |
| 1006 | Ga0466959_0022152 | 3300045049 | Bacteria | 4694 |
| 1007 | Ga0466959_0023743 | 3300045049 | Bacteria | 4539 |
| 1008 | Ga0466959_0142155 | 3300045049 | Bacteria | 1695 |
| 1009 | Ga0466959_0160187 | 3300045049 | Bacteria | 1582 |
| 1010 | Ga0466959_0348847 | 3300045049 | Unclassified | 1009 |
| 1011 | Ga0466958_0003870 | 3300045836 | Bacteria | 7832 |
| 1012 | Ga0466958_0005189 | 3300045836 | Bacteria | 6975 |
| 1013 | Ga0466958_0015930 | 3300045836 | Bacteria | 4321 |
| 1014 | Ga0466958_0017408 | 3300045836 | Bacteria | 4153 |
| 1015 | Ga0466958_0123610 | 3300045836 | Bacteria | 1621 |
| 1016 | Ga0466958_0375681 | 3300045836 | Bacteria | 916 |
| 1017 | Ga0466967_0000179 | 3300045976 | Bacteria | 26199 |
| 1018 | Ga0466967_0000656 | 3300045976 | Bacteria | 17383 |
| 1019 | Ga0466967_0001283 | 3300045976 | Bacteria | 14292 |
| 1020 | Ga0466967_0004521 | 3300045976 | Bacteria | 9404 |
| 1021 | Ga0466967_0004681 | 3300045976 | Bacteria | 9291 |
| 1022 | Ga0466967_0028066 | 3300045976 | Bacteria | 4693 |
| 1023 | Ga0466967_0030515 | 3300045976 | Bacteria | 4525 |
| 1024 | Ga0466967_0034259 | 3300045976 | Bacteria | 4308 |
| 1025 | Ga0466967_0044519 | 3300045976 | Bacteria | 3850 |
| 1026 | Ga0466967_0050109 | 3300045976 | Bacteria | 3655 |
| 1027 | Ga0466967_0063731 | 3300045976 | Bacteria | 3276 |
| 1028 | Ga0466967_0102426 | 3300045976 | Bacteria | 2619 |
| 1029 | Ga0466967_0127577 | 3300045976 | Bacteria | 2358 |
| 1030 | Ga0466967_0202110 | 3300045976 | Bacteria | 1882 |
| 1031 | Ga0466967_0229568 | 3300045976 | Bacteria | 1767 |
| 1032 | Ga0466967_0248872 | 3300045976 | Bacteria | 1697 |
| 1033 | Ga0466967_0320110 | 3300045976 | Bacteria | 1495 |
| 1034 | Ga0466967_0333892 | 3300045976 | Bacteria | 1464 |
| 1035 | Ga0466967_0422071 | 3300045976 | Bacteria | 1300 |
| 1036 | Ga0466967_0454692 | 3300045976 | Bacteria | 1252 |
| 1037 | Ga0466967_0464655 | 3300045976 | Unclassified | 1238 |
| 1038 | Ga0466967_0526083 | 3300045976 | Unclassified | 1162 |
| 1039 | Ga0466967_0540734 | 3300045976 | Unclassified | 1146 |
| 1040 | Ga0466967_0641939 | 3300045976 | Bacteria | 1049 |
| 1041 | Ga0466967_0687005 | 3300045976 | Bacteria | 1013 |
| 1042 | Ga0495592_0004809 | 3300046454 | Bacteria | 9927 |
| 1043 | Ga0495592_0139641 | 3300046454 | Bacteria | 1686 |
| 1044 | Ga0495592_0226588 | 3300046454 | Bacteria | 1247 |
| 1045 | Ga0495603_0009387 | 3300046455 | Bacteria | 5912 |
| 1046 | Ga0495603_0011343 | 3300046455 | Bacteria | 5396 |
| 1047 | Ga0495603_0024368 | 3300046455 | Bacteria | 3658 |
| 1048 | Ga0495603_0099225 | 3300046455 | Bacteria | 1700 |
| 1049 | Ga0495603_0198893 | 3300046455 | Unclassified | 1158 |
| 1050 | Ga0495629_0029124 | 3300046459 | Bacteria | 3918 |
| 1051 | Ga0495629_0053152 | 3300046459 | Bacteria | 2834 |
| 1052 | Ga0495629_0075375 | 3300046459 | Bacteria | 2356 |
| 1053 | Ga0495629_0362804 | 3300046459 | Bacteria | 987 |
| 1054 | Ga0495641_0004261 | 3300046461 | Bacteria | 10218 |
| 1055 | Ga0495641_0004552 | 3300046461 | Bacteria | 9732 |
| 1056 | Ga0495641_0034632 | 3300046461 | Bacteria | 2386 |
| 1057 | Ga0495641_0041124 | 3300046461 | Bacteria | 2148 |
| 1058 | Ga0495641_0107765 | 3300046461 | Unclassified | 1243 |
| 1059 | Ga0495641_0117542 | 3300046461 | Bacteria | 1186 |
| 1060 | Ga0495641_0209208 | 3300046461 | Unclassified | 874 |
| 1061 | Ga0495651_0048218 | 3300046462 | Bacteria | 3290 |
| 1062 | Ga0495651_0062960 | 3300046462 | Bacteria | 2837 |
| 1063 | Ga0495651_0132325 | 3300046462 | Bacteria | 1819 |
| 1064 | Ga0495651_0212894 | 3300046462 | Unclassified | 1343 |
| 1065 | Ga0495653_0032638 | 3300046463 | Bacteria | 4132 |
| 1066 | Ga0495653_0052203 | 3300046463 | Bacteria | 3135 |
| 1067 | Ga0495653_0362986 | 3300046463 | Unclassified | 929 |
| 1068 | Ga0495580_0021561 | 3300046472 | Bacteria | 4751 |
| 1069 | Ga0495582_0016397 | 3300046473 | Bacteria | 4059 |
| 1070 | Ga0495582_0020921 | 3300046473 | Unclassified | 3583 |
| 1071 | Ga0495582_0115484 | 3300046473 | Unclassified | 1509 |
| 1072 | Ga0495582_0240061 | 3300046473 | Bacteria | 1038 |
| 1073 | Ga0495605_0030222 | 3300046474 | Bacteria | 2780 |
| 1074 | Ga0495605_0092944 | 3300046474 | Unclassified | 1396 |
| 1075 | Ga0495662_0051678 | 3300046476 | Unclassified | 1984 |
| 1076 | Ga0495664_0136923 | 3300046477 | Unclassified | 1484 |
| 1077 | Ga0495664_0250254 | 3300046477 | Unclassified | 1072 |
| 1078 | Ga0495584_0019339 | 3300046491 | Bacteria | 3459 |
| 1079 | Ga0495584_0101788 | 3300046491 | Bacteria | 1452 |
| 1080 | Ga0495584_0170043 | 3300046491 | Bacteria | 1108 |
| 1081 | Ga0495585_0198884 | 3300046492 | Bacteria | 1022 |
| 1082 | Ga0495594_0006747 | 3300046499 | Bacteria | 5905 |
| 1083 | Ga0495596_0028494 | 3300046500 | Bacteria | 2242 |
| 1084 | Ga0495596_0071261 | 3300046500 | Bacteria | 1350 |
| 1085 | Ga0495607_0057044 | 3300046501 | Bacteria | 2240 |
| 1086 | Ga0495608_0009760 | 3300046511 | Bacteria | 6698 |
| 1087 | Ga0495608_0016338 | 3300046511 | Bacteria | 5135 |
| 1088 | Ga0495608_0027278 | 3300046511 | Bacteria | 3886 |
| 1089 | Ga0495608_0032676 | 3300046511 | Bacteria | 3517 |
| 1090 | Ga0495608_0091243 | 3300046511 | Bacteria | 1970 |
| 1091 | Ga0495608_0097849 | 3300046511 | Unclassified | 1894 |
| 1092 | Ga0495618_0020745 | 3300046514 | Bacteria | 4044 |
| 1093 | Ga0495618_0021960 | 3300046514 | Bacteria | 3938 |
| 1094 | Ga0495618_0174993 | 3300046514 | Bacteria | 1365 |
| 1095 | Ga0495618_0236200 | 3300046514 | Unclassified | 1150 |
| 1096 | Ga0495618_0254979 | 3300046514 | Bacteria | 1100 |
| 1097 | Ga0495628_0018631 | 3300046516 | Bacteria | 5746 |
| 1098 | Ga0495628_0021733 | 3300046516 | Bacteria | 5273 |
| 1099 | Ga0495628_0043819 | 3300046516 | Bacteria | 3562 |
| 1100 | Ga0495628_0235254 | 3300046516 | Unclassified | 1372 |
| 1101 | Ga0495628_0430949 | 3300046516 | Bacteria | 960 |
| 1102 | Ga0495630_0002368 | 3300046517 | Bacteria | 13075 |
| 1103 | Ga0495630_0025512 | 3300046517 | Bacteria | 4372 |
| 1104 | Ga0495630_0026574 | 3300046517 | Bacteria | 4286 |
| 1105 | Ga0495630_0046074 | 3300046517 | Bacteria | 3259 |
| 1106 | Ga0495630_0064270 | 3300046517 | Bacteria | 2757 |
| 1107 | Ga0495630_0121028 | 3300046517 | Bacteria | 1986 |
| 1108 | Ga0495630_0161302 | 3300046517 | Bacteria | 1707 |
| 1109 | Ga0495644_0069197 | 3300046523 | Bacteria | 1326 |
| 1110 | Ga0495644_0071726 | 3300046523 | Bacteria | 1302 |
| 1111 | Ga0495663_0008382 | 3300046525 | Bacteria | 2863 |
| 1112 | Ga0495666_0023225 | 3300046526 | Bacteria | 3067 |
| 1113 | Ga0495652_0050425 | 3300046529 | Bacteria | 3558 |
| 1114 | Ga0495652_0053385 | 3300046529 | Bacteria | 3444 |
| 1115 | Ga0495652_0220663 | 3300046529 | Bacteria | 1425 |
| 1116 | Ga0495652_0352895 | 3300046529 | Bacteria | 1053 |
| 1117 | Ga0495640_0003223 | 3300046533 | Bacteria | 13136 |
| 1118 | Ga0495587_0101164 | 3300046536 | Bacteria | 1660 |
| 1119 | Ga0495598_0050459 | 3300046537 | Bacteria | 1251 |
| 1120 | Ga0495609_0038387 | 3300046538 | Bacteria | 2159 |
| 1121 | Ga0495645_0026587 | 3300046543 | Bacteria | 4201 |
| 1122 | Ga0495645_0263870 | 3300046543 | Bacteria | 1139 |
| 1123 | Ga0495667_0005166 | 3300046559 | Bacteria | 8818 |
| 1124 | Ga0495667_0005794 | 3300046559 | Bacteria | 8371 |
| 1125 | Ga0495667_0015042 | 3300046559 | Bacteria | 5223 |
| 1126 | Ga0495667_0047038 | 3300046559 | Bacteria | 2851 |
| 1127 | Ga0495667_0064462 | 3300046559 | Bacteria | 2397 |
| 1128 | Ga0495667_0072299 | 3300046559 | Bacteria | 2248 |
| 1129 | Ga0495667_0090116 | 3300046559 | Bacteria | 1987 |
| 1130 | Ga0495656_0018093 | 3300046615 | Bacteria | 2700 |
| 1131 | Ga0495656_0074891 | 3300046615 | Unclassified | 1513 |
| 1132 | Ga0495656_0306226 | 3300046615 | Unclassified | 815 |
| 1133 | Ga0495634_0029419 | 3300046642 | Bacteria | 3803 |
| 1134 | Ga0495634_0140823 | 3300046642 | Bacteria | 1531 |
| 1135 | Ga0495634_0214500 | 3300046642 | Bacteria | 1190 |
| 1136 | Ga0495635_0063485 | 3300046663 | Unclassified | 2536 |
| 1137 | Ga0495635_0102663 | 3300046663 | Bacteria | 1954 |
| 1138 | Ga0495635_0142434 | 3300046663 | Bacteria | 1632 |
| 1139 | Ga0495659_0040113 | 3300046664 | Bacteria | 1667 |
| 1140 | Ga0495588_0001498 | 3300046674 | Bacteria | 10008 |
| 1141 | Ga0495588_0059613 | 3300046674 | Bacteria | 1975 |
| 1142 | Ga0495588_0112700 | 3300046674 | Unclassified | 1433 |
| 1143 | Ga0495588_0162451 | 3300046674 | Unclassified | 1181 |
| 1144 | Ga0495657_0014645 | 3300046675 | Bacteria | 5756 |
| 1145 | Ga0495657_0021973 | 3300046675 | Bacteria | 4574 |
| 1146 | Ga0495657_0029620 | 3300046675 | Bacteria | 3838 |
| 1147 | Ga0495657_0077532 | 3300046675 | Bacteria | 2156 |
| 1148 | Ga0495657_0163961 | 3300046675 | Unclassified | 1373 |
| 1149 | Ga0495599_0035987 | 3300046678 | Bacteria | 3107 |
| 1150 | Ga0495599_0040203 | 3300046678 | Bacteria | 2937 |
| 1151 | Ga0495599_0230653 | 3300046678 | Unclassified | 1130 |
| 1152 | Ga0495646_0065653 | 3300046680 | Bacteria | 2148 |
| 1153 | Ga0495647_0062961 | 3300046681 | Bacteria | 1468 |
| 1154 | Ga0495647_0225809 | 3300046681 | Bacteria | 828 |
| 1155 | Ga0495658_0038859 | 3300046683 | Bacteria | 2637 |
| 1156 | Ga0495658_0082123 | 3300046683 | Bacteria | 1893 |
| 1157 | Ga0495658_0131448 | 3300046683 | Bacteria | 1524 |
| 1158 | Ga0495669_0053379 | 3300046684 | Bacteria | 1818 |
| 1159 | Ga0495613_0013348 | 3300046689 | Bacteria | 6102 |
| 1160 | Ga0495613_0060400 | 3300046689 | Bacteria | 2776 |
| 1161 | Ga0495613_0076521 | 3300046689 | Bacteria | 2435 |
| 1162 | Ga0495613_0251403 | 3300046689 | Bacteria | 1233 |
| 1163 | Ga0495613_0397206 | 3300046689 | Bacteria | 941 |
| 1164 | Ga0495613_0465385 | 3300046689 | Bacteria | 855 |
| 1165 | Ga0495613_0506700 | 3300046689 | Bacteria | 812 |
| 1166 | Ga0495624_0028280 | 3300046690 | Bacteria | 3666 |
| 1167 | Ga0495624_0238841 | 3300046690 | Bacteria | 1100 |
| 1168 | Ga0495589_0007869 | 3300046794 | Bacteria | 5580 |
| 1169 | Ga0495589_0030930 | 3300046794 | Bacteria | 2696 |
| 1170 | Ga0495600_0059332 | 3300046809 | Bacteria | 2499 |
| 1171 | Ga0495581_0098473 | 3300047315 | Bacteria | 1698 |
| 1172 | Ga0495581_0376020 | 3300047315 | Unclassified | 829 |
| 1173 | Ga0495604_0034480 | 3300047317 | Bacteria | 4003 |
| 1174 | Ga0495604_0042806 | 3300047317 | Bacteria | 3547 |
| 1175 | Ga0495604_0043274 | 3300047317 | Bacteria | 3526 |
| 1176 | Ga0495604_0187013 | 3300047317 | Bacteria | 1446 |
| 1177 | Ga0495604_0203778 | 3300047317 | Unclassified | 1371 |
| 1178 | Ga0495674_0004451 | 3300047319 | Bacteria | 13482 |
| 1179 | Ga0495674_0025185 | 3300047319 | Bacteria | 5460 |
| 1180 | Ga0495674_0043481 | 3300047319 | Bacteria | 3998 |
| 1181 | Ga0495674_0055289 | 3300047319 | Bacteria | 3482 |
| 1182 | Ga0495674_0094283 | 3300047319 | Bacteria | 2553 |
| 1183 | Ga0495674_0255651 | 3300047319 | Bacteria | 1440 |
| 1184 | Ga0495676_0003895 | 3300047321 | Bacteria | 13567 |
| 1185 | Ga0495676_0032039 | 3300047321 | Bacteria | 4442 |
| 1186 | Ga0495676_0039920 | 3300047321 | Bacteria | 3881 |
| 1187 | Ga0495676_0072884 | 3300047321 | Bacteria | 2635 |
| 1188 | Ga0495676_0137106 | 3300047321 | Bacteria | 1758 |
| 1189 | Ga0495676_0178386 | 3300047321 | Bacteria | 1490 |
| 1190 | Ga0495676_0225777 | 3300047321 | Bacteria | 1288 |
| 1191 | Ga0495680_0005919 | 3300047322 | Bacteria | 11429 |
| 1192 | Ga0495680_0006645 | 3300047322 | Bacteria | 10710 |
| 1193 | Ga0495680_0019953 | 3300047322 | Bacteria | 5650 |
| 1194 | Ga0495680_0280071 | 3300047322 | Bacteria | 1175 |
| 1195 | Ga0495680_0384996 | 3300047322 | Unclassified | 971 |
| 1196 | Ga0495675_0029801 | 3300047444 | Unclassified | 3481 |
| 1197 | Ga0495675_0034489 | 3300047444 | Bacteria | 3231 |
| 1198 | Ga0495675_0223398 | 3300047444 | Bacteria | 1139 |
| 1199 | Ga0495675_0293943 | 3300047444 | Unclassified | 966 |
| 1200 | Ga0495684_0008847 | 3300047471 | Bacteria | 7781 |
| 1201 | Ga0495684_0049103 | 3300047471 | Bacteria | 3225 |
| 1202 | Ga0495593_0231269 | 3300047673 | Bacteria | 927 |
| 1203 | Ga0495602_0058823 | 3300048088 | Bacteria | 3361 |
| 1204 | Ga0495602_0107769 | 3300048088 | Bacteria | 2270 |
| 1205 | Ga0495602_0198738 | 3300048088 | Bacteria | 1531 |
| 1206 | Ga0495602_0213287 | 3300048088 | Unclassified | 1463 |
| 1207 | Ga0495602_0215437 | 3300048088 | Bacteria | 1454 |
| 1208 | Ga0496100_0005439 | 3300048903 | Bacteria | 6860 |
| 1209 | Ga0496100_0017682 | 3300048903 | Bacteria | 4215 |
| 1210 | Ga0496100_0019060 | 3300048903 | Bacteria | 4085 |
| 1211 | Ga0496100_0031408 | 3300048903 | Bacteria | 3302 |
| 1212 | Ga0496100_0066748 | 3300048903 | Bacteria | 2387 |
| 1213 | Ga0496100_0372367 | 3300048903 | Unclassified | 1083 |
| 1214 | Ga0496101_0005268 | 3300048904 | Bacteria | 8234 |
| 1215 | Ga0496101_0011606 | 3300048904 | Bacteria | 5851 |
| 1216 | Ga0496101_0017750 | 3300048904 | Bacteria | 4827 |
| 1217 | Ga0496101_0020243 | 3300048904 | Bacteria | 4551 |
| 1218 | Ga0496101_0021389 | 3300048904 | Bacteria | 4445 |
| 1219 | Ga0496101_0068341 | 3300048904 | Unclassified | 2597 |
| 1220 | Ga0496101_0122910 | 3300048904 | Bacteria | 1964 |
| 1221 | Ga0496101_0209056 | 3300048904 | Bacteria | 1511 |
| 1222 | Ga0496101_0264247 | 3300048904 | Bacteria | 1343 |
| 1223 | Ga0496102_0005991 | 3300048905 | Bacteria | 10353 |
| 1224 | Ga0496102_0019028 | 3300048905 | Bacteria | 6043 |
| 1225 | Ga0496102_0019449 | 3300048905 | Bacteria | 5981 |
| 1226 | Ga0496102_0029581 | 3300048905 | Bacteria | 4902 |
| 1227 | Ga0496102_0069500 | 3300048905 | Bacteria | 3232 |
| 1228 | Ga0496102_0096187 | 3300048905 | Bacteria | 2745 |
| 1229 | Ga0496102_0235577 | 3300048905 | Bacteria | 1726 |
| 1230 | Ga0496102_0257663 | 3300048905 | Bacteria | 1645 |
| 1231 | Ga0496102_0542232 | 3300048905 | Archaea | 1086 |
| 1232 | Ga0496103_0013174 | 3300048906 | Bacteria | 4902 |
| 1233 | Ga0496103_0039044 | 3300048906 | Bacteria | 2916 |
| 1234 | Ga0496103_0066965 | 3300048906 | Bacteria | 2242 |
| 1235 | Ga0496103_0090187 | 3300048906 | Unclassified | 1934 |
| 1236 | Ga0496104_0001293 | 3300048907 | Bacteria | 21572 |
| 1237 | Ga0496104_0011990 | 3300048907 | Bacteria | 7776 |
| 1238 | Ga0496104_0015894 | 3300048907 | Bacteria | 6830 |
| 1239 | Ga0496104_0020926 | 3300048907 | Bacteria | 6001 |
| 1240 | Ga0496104_0039608 | 3300048907 | Bacteria | 4412 |
| 1241 | Ga0496104_0086788 | 3300048907 | Bacteria | 2987 |
| 1242 | Ga0496104_0087742 | 3300048907 | Unclassified | 2971 |
| 1243 | Ga0496104_0104059 | 3300048907 | Bacteria | 2720 |
| 1244 | Ga0496104_0191235 | 3300048907 | Unclassified | 1958 |
| 1245 | Ga0496104_0416726 | 3300048907 | Bacteria | 1255 |
| 1246 | Ga0496104_0421615 | 3300048907 | Unclassified | 1246 |
| 1247 | Ga0496104_0923534 | 3300048907 | Bacteria | 778 |
| 1248 | Ga0496105_0001494 | 3300048908 | Bacteria | 16523 |
| 1249 | Ga0496105_0002671 | 3300048908 | Bacteria | 12983 |
| 1250 | Ga0496105_0008290 | 3300048908 | Bacteria | 8077 |
| 1251 | Ga0496105_0025878 | 3300048908 | Bacteria | 4780 |
| 1252 | Ga0496105_0039885 | 3300048908 | Bacteria | 3871 |
| 1253 | Ga0496105_0040125 | 3300048908 | Bacteria | 3859 |
| 1254 | Ga0496105_0044664 | 3300048908 | Bacteria | 3655 |
| 1255 | Ga0496105_0108697 | 3300048908 | Bacteria | 2289 |
| 1256 | Ga0496105_0113952 | 3300048908 | Unclassified | 2230 |
| 1257 | Ga0496105_0179752 | 3300048908 | Unclassified | 1733 |
| 1258 | Ga0496105_0351953 | 3300048908 | Bacteria | 1176 |
| 1259 | Ga0496105_0518868 | 3300048908 | Bacteria | 933 |
| 1260 | Ga0496106_0003662 | 3300048909 | Bacteria | 11458 |
| 1261 | Ga0496106_0012801 | 3300048909 | Bacteria | 6193 |
| 1262 | Ga0496106_0031455 | 3300048909 | Bacteria | 3955 |
| 1263 | Ga0496106_0034897 | 3300048909 | Bacteria | 3759 |
| 1264 | Ga0496106_0042412 | 3300048909 | Bacteria | 3412 |
| 1265 | Ga0496106_0051599 | 3300048909 | Bacteria | 3102 |
| 1266 | Ga0496106_0131237 | 3300048909 | Unclassified | 1965 |
| 1267 | Ga0496106_0300703 | 3300048909 | Unclassified | 1287 |
| 1268 | Ga0496107_0005800 | 3300048910 | Bacteria | 8453 |
| 1269 | Ga0496107_0017385 | 3300048910 | Bacteria | 5058 |
| 1270 | Ga0496107_0019319 | 3300048910 | Bacteria | 4808 |
| 1271 | Ga0496107_0019681 | 3300048910 | Bacteria | 4763 |
| 1272 | Ga0496107_0024006 | 3300048910 | Bacteria | 4310 |
| 1273 | Ga0496107_0036112 | 3300048910 | Bacteria | 3544 |
| 1274 | Ga0496107_0109827 | 3300048910 | Bacteria | 2026 |
| 1275 | Ga0496107_0220230 | 3300048910 | Bacteria | 1412 |
| 1276 | Ga0496107_0226220 | 3300048910 | Bacteria | 1392 |
| 1277 | Ga0496108_0001327 | 3300048911 | Bacteria | 19451 |
| 1278 | Ga0496108_0006069 | 3300048911 | Bacteria | 9769 |
| 1279 | Ga0496108_0006797 | 3300048911 | Bacteria | 9262 |
| 1280 | Ga0496108_0008941 | 3300048911 | Bacteria | 8119 |
| 1281 | Ga0496108_0018951 | 3300048911 | Bacteria | 5643 |
| 1282 | Ga0496108_0027773 | 3300048911 | Bacteria | 4678 |
| 1283 | Ga0496108_0063353 | 3300048911 | Bacteria | 3114 |
| 1284 | Ga0496108_0128616 | 3300048911 | Unclassified | 2176 |
| 1285 | Ga0496108_0513582 | 3300048911 | Bacteria | 1046 |
| 1286 | Ga0496109_0002789 | 3300048912 | Bacteria | 14634 |
| 1287 | Ga0496109_0003215 | 3300048912 | Bacteria | 13604 |
| 1288 | Ga0496109_0004424 | 3300048912 | Bacteria | 11742 |
| 1289 | Ga0496109_0006043 | 3300048912 | Bacteria | 10173 |
| 1290 | Ga0496109_0013816 | 3300048912 | Bacteria | 7015 |
| 1291 | Ga0496109_0021106 | 3300048912 | Bacteria | 5758 |
| 1292 | Ga0496109_0027854 | 3300048912 | Bacteria | 5050 |
| 1293 | Ga0496109_0031229 | 3300048912 | Bacteria | 4778 |
| 1294 | Ga0496109_0037658 | 3300048912 | Bacteria | 4370 |
| 1295 | Ga0496109_0069840 | 3300048912 | Bacteria | 3222 |
| 1296 | Ga0496109_0076574 | 3300048912 | Bacteria | 3077 |
| 1297 | Ga0496109_0125038 | 3300048912 | Bacteria | 2397 |
| 1298 | Ga0496109_0144970 | 3300048912 | Unclassified | 2221 |
| 1299 | Ga0496109_0278516 | 3300048912 | Bacteria | 1576 |
| 1300 | Ga0496109_0311327 | 3300048912 | Bacteria | 1485 |
| 1301 | Ga0496109_0478323 | 3300048912 | Unclassified | 1176 |
| 1302 | Ga0496109_0497008 | 3300048912 | Unclassified | 1151 |
| 1303 | Ga0496109_0644829 | 3300048912 | Unclassified | 996 |
| 1304 | Ga0496110_0000607 | 3300048913 | Bacteria | 24647 |
| 1305 | Ga0496110_0000686 | 3300048913 | Bacteria | 23305 |
| 1306 | Ga0496110_0001231 | 3300048913 | Bacteria | 18265 |
| 1307 | Ga0496110_0005411 | 3300048913 | Bacteria | 10014 |
| 1308 | Ga0496110_0015765 | 3300048913 | Bacteria | 6299 |
| 1309 | Ga0496110_0023470 | 3300048913 | Bacteria | 5247 |
| 1310 | Ga0496110_0047139 | 3300048913 | Bacteria | 3772 |
| 1311 | Ga0496110_0073042 | 3300048913 | Bacteria | 3044 |
| 1312 | Ga0496110_0098293 | 3300048913 | Bacteria | 2623 |
| 1313 | Ga0496110_0104580 | 3300048913 | Unclassified | 2540 |
| 1314 | Ga0496110_0179573 | 3300048913 | Bacteria | 1922 |
| 1315 | Ga0496110_0246488 | 3300048913 | Unclassified | 1626 |
| 1316 | Ga0496110_0255102 | 3300048913 | Bacteria | 1596 |
| 1317 | Ga0496110_0403969 | 3300048913 | Bacteria | 1245 |
| 1318 | Ga0496110_0409782 | 3300048913 | Unclassified | 1236 |
| 1319 | Ga0496110_0517893 | 3300048913 | Bacteria | 1085 |
| 1320 | Ga0496110_0750656 | 3300048913 | Unclassified | 879 |
| 1321 | Ga0496111_0000665 | 3300048914 | Bacteria | 18058 |
| 1322 | Ga0496111_0003353 | 3300048914 | Bacteria | 9906 |
| 1323 | Ga0496111_0006770 | 3300048914 | Bacteria | 7468 |
| 1324 | Ga0496111_0015441 | 3300048914 | Bacteria | 5242 |
| 1325 | Ga0496111_0036332 | 3300048914 | Bacteria | 3522 |
| 1326 | Ga0496111_0043351 | 3300048914 | Bacteria | 3233 |
| 1327 | Ga0496111_0053709 | 3300048914 | Bacteria | 2911 |
| 1328 | Ga0496111_0076589 | 3300048914 | Unclassified | 2438 |
| 1329 | Ga0496111_0117752 | 3300048914 | Bacteria | 1960 |
| 1330 | Ga0496111_0146702 | 3300048914 | Bacteria | 1749 |
| 1331 | Ga0496111_0210087 | 3300048914 | Bacteria | 1446 |
| 1332 | Ga0496111_0247549 | 3300048914 | Unclassified | 1323 |
| 1333 | Ga0496111_0313075 | 3300048914 | Bacteria | 1163 |
| 1334 | Ga0496111_0323154 | 3300048914 | Bacteria | 1143 |
| 1335 | Ga0496111_0528199 | 3300048914 | Bacteria | 867 |
| 1336 | Ga0496112_0002974 | 3300048915 | Bacteria | 13822 |
| 1337 | Ga0496112_0009862 | 3300048915 | Bacteria | 8631 |
| 1338 | Ga0496112_0039231 | 3300048915 | Bacteria | 4627 |
| 1339 | Ga0496112_0105593 | 3300048915 | Bacteria | 2786 |
| 1340 | Ga0496112_0141876 | 3300048915 | Bacteria | 2371 |
| 1341 | Ga0496112_0195725 | 3300048915 | Bacteria | 1982 |
| 1342 | Ga0496112_0220191 | 3300048915 | Bacteria | 1854 |
| 1343 | Ga0496112_0263617 | 3300048915 | Bacteria | 1672 |
| 1344 | Ga0496112_0279136 | 3300048915 | Unclassified | 1618 |
| 1345 | Ga0496112_0349450 | 3300048915 | Unclassified | 1421 |
| 1346 | Ga0496112_0501650 | 3300048915 | Bacteria | 1149 |
| 1347 | Ga0496112_0828601 | 3300048915 | Bacteria | 849 |
| 1348 | Ga0496113_0030491 | 3300048916 | Bacteria | 3904 |
| 1349 | Ga0496113_0043660 | 3300048916 | Bacteria | 3318 |
| 1350 | Ga0496113_0102989 | 3300048916 | Unclassified | 2214 |
| 1351 | Ga0496113_0120019 | 3300048916 | Unclassified | 2054 |
| 1352 | Ga0496114_0001676 | 3300048917 | Bacteria | 16823 |
| 1353 | Ga0496114_0002457 | 3300048917 | Bacteria | 14154 |
| 1354 | Ga0496114_0003730 | 3300048917 | Bacteria | 11736 |
| 1355 | Ga0496114_0004356 | 3300048917 | Bacteria | 10956 |
| 1356 | Ga0496114_0007678 | 3300048917 | Bacteria | 8528 |
| 1357 | Ga0496114_0009413 | 3300048917 | Bacteria | 7755 |
| 1358 | Ga0496114_0012976 | 3300048917 | Bacteria | 6677 |
| 1359 | Ga0496114_0027912 | 3300048917 | Bacteria | 4627 |
| 1360 | Ga0496114_0038680 | 3300048917 | Bacteria | 3947 |
| 1361 | Ga0496114_0039785 | 3300048917 | Bacteria | 3891 |
| 1362 | Ga0496114_0057985 | 3300048917 | Bacteria | 3233 |
| 1363 | Ga0496114_0058587 | 3300048917 | Bacteria | 3216 |
| 1364 | Ga0496114_0063704 | 3300048917 | Bacteria | 3087 |
| 1365 | Ga0496114_0067784 | 3300048917 | Bacteria | 2994 |
| 1366 | Ga0496114_0116204 | 3300048917 | Unclassified | 2297 |
| 1367 | Ga0496114_0191134 | 3300048917 | Bacteria | 1791 |
| 1368 | Ga0496114_0321617 | 3300048917 | Unclassified | 1367 |
| 1369 | Ga0496114_0373626 | 3300048917 | Unclassified | 1262 |
| 1370 | Ga0496115_0000961 | 3300048918 | Bacteria | 20922 |
| 1371 | Ga0496115_0005151 | 3300048918 | Bacteria | 9511 |
| 1372 | Ga0496115_0018520 | 3300048918 | Bacteria | 5349 |
| 1373 | Ga0496115_0046954 | 3300048918 | Bacteria | 3452 |
| 1374 | Ga0496115_0086635 | 3300048918 | Bacteria | 2555 |
| 1375 | Ga0496115_0089319 | 3300048918 | Bacteria | 2516 |
| 1376 | Ga0496115_0113751 | 3300048918 | Bacteria | 2224 |
| 1377 | Ga0496115_0147712 | 3300048918 | Bacteria | 1941 |
| 1378 | Ga0496115_0160846 | 3300048918 | Unclassified | 1855 |
| 1379 | Ga0496115_0229858 | 3300048918 | Bacteria | 1530 |
| 1380 | Ga0496115_0232782 | 3300048918 | Unclassified | 1519 |
| 1381 | Ga0496115_0249221 | 3300048918 | Bacteria | 1462 |
| 1382 | Ga0496115_0255454 | 3300048918 | Bacteria | 1442 |
| 1383 | Ga0496115_0277100 | 3300048918 | Unclassified | 1377 |
| 1384 | Ga0501031_0000345 | 3300049568 | Bacteria | 26982 |
| 1385 | Ga0501031_0000615 | 3300049568 | Bacteria | 21046 |
| 1386 | Ga0501031_0012796 | 3300049568 | Bacteria | 5482 |
| 1387 | Ga0501031_0018104 | 3300049568 | Bacteria | 4582 |
| 1388 | Ga0501031_0065546 | 3300049568 | Unclassified | 2366 |
| 1389 | Ga0501031_0127793 | 3300049568 | Bacteria | 1660 |
| 1390 | Ga0501032_0016904 | 3300049569 | Bacteria | 5128 |
| 1391 | Ga0501032_0050972 | 3300049569 | Unclassified | 2791 |
| 1392 | Ga0501032_0077747 | 3300049569 | Unclassified | 2209 |
| 1393 | Ga0501033_0014528 | 3300049570 | Bacteria | 5977 |
| 1394 | Ga0501033_0021157 | 3300049570 | Bacteria | 4909 |
| 1395 | Ga0501033_0050866 | 3300049570 | Bacteria | 3072 |
| 1396 | Ga0501033_0072389 | 3300049570 | Unclassified | 2531 |
| 1397 | Ga0501034_0046410 | 3300049571 | Bacteria | 4390 |
| 1398 | Ga0501034_0079909 | 3300049571 | Bacteria | 3274 |
| 1399 | Ga0501034_0109014 | 3300049571 | Bacteria | 2760 |
| 1400 | Ga0501034_0319457 | 3300049571 | Bacteria | 1486 |
| 1401 | Ga0501036_0000798 | 3300049572 | Bacteria | 23392 |
| 1402 | Ga0501036_0005203 | 3300049572 | Bacteria | 10515 |
| 1403 | Ga0501036_0010111 | 3300049572 | Bacteria | 7776 |
| 1404 | Ga0501036_0012670 | 3300049572 | Bacteria | 6995 |
| 1405 | Ga0501036_0016694 | 3300049572 | Bacteria | 6131 |
| 1406 | Ga0501036_0071310 | 3300049572 | Bacteria | 2937 |
| 1407 | Ga0501036_0078014 | 3300049572 | Unclassified | 2802 |
| 1408 | Ga0501036_0100066 | 3300049572 | Bacteria | 2452 |
| 1409 | Ga0501036_0165946 | 3300049572 | Unclassified | 1861 |
| 1410 | Ga0501036_0197560 | 3300049572 | Bacteria | 1692 |
| 1411 | Ga0501036_0203132 | 3300049572 | Bacteria | 1666 |
| 1412 | Ga0501036_0269707 | 3300049572 | Bacteria | 1425 |
| 1413 | Ga0501037_0003886 | 3300049573 | Bacteria | 10839 |
| 1414 | Ga0501037_0036273 | 3300049573 | Bacteria | 3634 |
| 1415 | Ga0501037_0184176 | 3300049573 | Bacteria | 1481 |
| 1416 | Ga0501037_0279147 | 3300049573 | Bacteria | 1164 |
| 1417 | Ga0501037_0293183 | 3300049573 | Bacteria | 1131 |
| 1418 | Ga0501038_0013992 | 3300049574 | Bacteria | 7312 |
| 1419 | Ga0501038_0018352 | 3300049574 | Bacteria | 6316 |
| 1420 | Ga0501038_0018769 | 3300049574 | Bacteria | 6243 |
| 1421 | Ga0501038_0064564 | 3300049574 | Bacteria | 3121 |
| 1422 | Ga0501038_0214425 | 3300049574 | Bacteria | 1539 |
| 1423 | Ga0501038_0238833 | 3300049574 | Bacteria | 1443 |
| 1424 | Ga0501038_0361244 | 3300049574 | Unclassified | 1129 |
| 1425 | Ga0501039_0003205 | 3300049575 | Bacteria | 12242 |
| 1426 | Ga0501039_0011836 | 3300049575 | Bacteria | 6644 |
| 1427 | Ga0501039_0016268 | 3300049575 | Bacteria | 5697 |
| 1428 | Ga0501039_0017988 | 3300049575 | Bacteria | 5421 |
| 1429 | Ga0501039_0019591 | 3300049575 | Bacteria | 5188 |
| 1430 | Ga0501039_0034884 | 3300049575 | Bacteria | 3882 |
| 1431 | Ga0501039_0248020 | 3300049575 | Unclassified | 1400 |
| 1432 | Ga0501040_0001055 | 3300049576 | Bacteria | 17455 |
| 1433 | Ga0501040_0003253 | 3300049576 | Bacteria | 10502 |
| 1434 | Ga0501040_0004545 | 3300049576 | Bacteria | 9006 |
| 1435 | Ga0501040_0010284 | 3300049576 | Bacteria | 6119 |
| 1436 | Ga0501040_0022657 | 3300049576 | Bacteria | 4207 |
| 1437 | Ga0501040_0045329 | 3300049576 | Unclassified | 2999 |
| 1438 | Ga0501040_0095280 | 3300049576 | Bacteria | 2071 |
| 1439 | Ga0501040_0134878 | 3300049576 | Unclassified | 1738 |
| 1440 | Ga0501040_0170309 | 3300049576 | Bacteria | 1542 |
| 1441 | Ga0501040_0224265 | 3300049576 | Unclassified | 1337 |
| 1442 | Ga0501040_0270275 | 3300049576 | Bacteria | 1214 |
| 1443 | Ga0501041_0004444 | 3300049577 | Bacteria | 8117 |
| 1444 | Ga0501041_0006237 | 3300049577 | Bacteria | 6970 |
| 1445 | Ga0501041_0008151 | 3300049577 | Bacteria | 6163 |
| 1446 | Ga0501041_0009854 | 3300049577 | Bacteria | 5626 |
| 1447 | Ga0501041_0022782 | 3300049577 | Bacteria | 3752 |
| 1448 | Ga0501041_0095737 | 3300049577 | Bacteria | 1835 |
| 1449 | Ga0501041_0135402 | 3300049577 | Unclassified | 1535 |
| 1450 | Ga0501041_0144277 | 3300049577 | Bacteria | 1485 |
| 1451 | Ga0501041_0211776 | 3300049577 | Bacteria | 1215 |
| 1452 | Ga0501041_0215761 | 3300049577 | Bacteria | 1204 |
| 1453 | Ga0501041_0255727 | 3300049577 | Bacteria | 1101 |
| 1454 | Ga0501042_0007552 | 3300049578 | Bacteria | 7132 |
| 1455 | Ga0501042_0013615 | 3300049578 | Bacteria | 5538 |
| 1456 | Ga0501042_0020443 | 3300049578 | Bacteria | 4607 |
| 1457 | Ga0501042_0040672 | 3300049578 | Bacteria | 3304 |
| 1458 | Ga0501042_0098871 | 3300049578 | Bacteria | 2098 |
| 1459 | Ga0501042_0103151 | 3300049578 | Bacteria | 2052 |
| 1460 | Ga0501042_0247212 | 3300049578 | Bacteria | 1287 |
| 1461 | Ga0501043_0007147 | 3300049579 | Bacteria | 8881 |
| 1462 | Ga0501043_0024169 | 3300049579 | Bacteria | 4768 |
| 1463 | Ga0501043_0031763 | 3300049579 | Bacteria | 4151 |
| 1464 | Ga0501043_0118461 | 3300049579 | Bacteria | 2077 |
| 1465 | Ga0501043_0614931 | 3300049579 | Unclassified | 801 |
| 1466 | Ga0501046_0000652 | 3300049580 | Bacteria | 33827 |
| 1467 | Ga0501046_0004105 | 3300049580 | Bacteria | 13269 |
| 1468 | Ga0501046_0013964 | 3300049580 | Bacteria | 6784 |
| 1469 | Ga0501046_0019876 | 3300049580 | Bacteria | 5563 |
| 1470 | Ga0501046_0115969 | 3300049580 | Bacteria | 2042 |
| 1471 | Ga0501047_0047759 | 3300049581 | Bacteria | 4135 |
| 1472 | Ga0501047_0094945 | 3300049581 | Bacteria | 2861 |
| 1473 | Ga0501047_0169719 | 3300049581 | Bacteria | 2051 |
| 1474 | Ga0501047_0446711 | 3300049581 | Unclassified | 1123 |
| 1475 | Ga0501048_0006478 | 3300049582 | Bacteria | 8899 |
| 1476 | Ga0501048_0007579 | 3300049582 | Bacteria | 8228 |
| 1477 | Ga0501048_0013192 | 3300049582 | Bacteria | 6133 |
| 1478 | Ga0501048_0028649 | 3300049582 | Bacteria | 4042 |
| 1479 | Ga0501048_0047994 | 3300049582 | Unclassified | 3046 |
| 1480 | Ga0501048_0071298 | 3300049582 | Bacteria | 2453 |
| 1481 | Ga0501048_0076880 | 3300049582 | Unclassified | 2356 |
| 1482 | Ga0501067_0019442 | 3300049583 | Bacteria | 3761 |
| 1483 | Ga0501067_0020400 | 3300049583 | Bacteria | 3668 |
| 1484 | Ga0501067_0024772 | 3300049583 | Bacteria | 3327 |
| 1485 | Ga0501067_0093019 | 3300049583 | Bacteria | 1674 |
| 1486 | Ga0501067_0136611 | 3300049583 | Unclassified | 1365 |
| 1487 | Ga0501067_0155882 | 3300049583 | Bacteria | 1272 |
| 1488 | Ga0501068_0001869 | 3300049584 | Bacteria | 11202 |
| 1489 | Ga0501068_0004858 | 3300049584 | Bacteria | 7318 |
| 1490 | Ga0501068_0022285 | 3300049584 | Bacteria | 3703 |
| 1491 | Ga0501068_0046973 | 3300049584 | Bacteria | 2603 |
| 1492 | Ga0501068_0058960 | 3300049584 | Unclassified | 2330 |
| 1493 | Ga0501068_0068606 | 3300049584 | Unclassified | 2161 |
| 1494 | Ga0501068_0072779 | 3300049584 | Bacteria | 2099 |
| 1495 | Ga0501068_0204177 | 3300049584 | Bacteria | 1254 |
| 1496 | Ga0501068_0208105 | 3300049584 | Unclassified | 1242 |
| 1497 | Ga0501068_0442817 | 3300049584 | Bacteria | 840 |
| 1498 | Ga0501069_0001257 | 3300049585 | Bacteria | 12419 |
| 1499 | Ga0501069_0003809 | 3300049585 | Bacteria | 7759 |
| 1500 | Ga0501069_0007494 | 3300049585 | Bacteria | 5731 |
| 1501 | Ga0501069_0011745 | 3300049585 | Bacteria | 4644 |
| 1502 | Ga0501069_0024983 | 3300049585 | Bacteria | 3262 |
| 1503 | Ga0501069_0049781 | 3300049585 | Unclassified | 2329 |
| 1504 | Ga0501069_0052474 | 3300049585 | Bacteria | 2270 |
| 1505 | Ga0501069_0135988 | 3300049585 | Bacteria | 1409 |
| 1506 | Ga0501070_0001079 | 3300049586 | Bacteria | 24456 |
| 1507 | Ga0501070_0013182 | 3300049586 | Bacteria | 6967 |
| 1508 | Ga0501070_0016785 | 3300049586 | Bacteria | 6146 |
| 1509 | Ga0501070_0022709 | 3300049586 | Bacteria | 5253 |
| 1510 | Ga0501070_0030096 | 3300049586 | Bacteria | 4549 |
| 1511 | Ga0501070_0049374 | 3300049586 | Bacteria | 3494 |
| 1512 | Ga0501070_0077181 | 3300049586 | Bacteria | 2757 |
| 1513 | Ga0501070_0123561 | 3300049586 | Bacteria | 2139 |
| 1514 | Ga0501070_0142056 | 3300049586 | Bacteria | 1982 |
| 1515 | Ga0501070_0142571 | 3300049586 | Bacteria | 1978 |
| 1516 | Ga0501070_0309516 | 3300049586 | Bacteria | 1286 |
| 1517 | Ga0501071_0001467 | 3300049587 | Bacteria | 13687 |
| 1518 | Ga0501071_0009780 | 3300049587 | Bacteria | 6399 |
| 1519 | Ga0501071_0061155 | 3300049587 | Bacteria | 2727 |
| 1520 | Ga0501071_0062543 | 3300049587 | Bacteria | 2697 |
| 1521 | Ga0501071_0063452 | 3300049587 | Bacteria | 2678 |
| 1522 | Ga0501071_0079746 | 3300049587 | Bacteria | 2393 |
| 1523 | Ga0501071_0091331 | 3300049587 | Bacteria | 2237 |
| 1524 | Ga0501071_0098447 | 3300049587 | Bacteria | 2154 |
| 1525 | Ga0501071_0103912 | 3300049587 | Bacteria | 2096 |
| 1526 | Ga0501071_0123405 | 3300049587 | Bacteria | 1921 |
| 1527 | Ga0501071_0596546 | 3300049587 | Bacteria | 849 |
| 1528 | Ga0501072_0001288 | 3300049588 | Bacteria | 18753 |
| 1529 | Ga0501072_0007841 | 3300049588 | Bacteria | 8110 |
| 1530 | Ga0501072_0015236 | 3300049588 | Bacteria | 5893 |
| 1531 | Ga0501072_0059835 | 3300049588 | Bacteria | 3003 |
| 1532 | Ga0501072_0169463 | 3300049588 | Bacteria | 1743 |
| 1533 | Ga0501072_0185138 | 3300049588 | Unclassified | 1661 |
| 1534 | Ga0501072_0257448 | 3300049588 | Bacteria | 1389 |
| 1535 | Ga0501072_0349146 | 3300049588 | Unclassified | 1175 |
| 1536 | Ga0501073_0006605 | 3300049589 | Bacteria | 8633 |
| 1537 | Ga0501073_0036395 | 3300049589 | Bacteria | 3497 |
| 1538 | Ga0501073_0157058 | 3300049589 | Bacteria | 1576 |
| 1539 | Ga0501074_0005057 | 3300049590 | Bacteria | 9463 |
| 1540 | Ga0501074_0012591 | 3300049590 | Bacteria | 6149 |
| 1541 | Ga0501074_0015529 | 3300049590 | Bacteria | 5535 |
| 1542 | Ga0501074_0016417 | 3300049590 | Bacteria | 5376 |
| 1543 | Ga0501074_0019711 | 3300049590 | Bacteria | 4897 |
| 1544 | Ga0501074_0032686 | 3300049590 | Bacteria | 3768 |
| 1545 | Ga0501074_0044906 | 3300049590 | Bacteria | 3197 |
| 1546 | Ga0501074_0170294 | 3300049590 | Unclassified | 1554 |
| 1547 | Ga0501074_0288142 | 3300049590 | Bacteria | 1167 |
| 1548 | Ga0501074_0301423 | 3300049590 | Bacteria | 1138 |
| 1549 | Ga0501075_0001411 | 3300049591 | Bacteria | 15652 |
| 1550 | Ga0501075_0007062 | 3300049591 | Bacteria | 7759 |
| 1551 | Ga0501075_0007654 | 3300049591 | Bacteria | 7496 |
| 1552 | Ga0501075_0017206 | 3300049591 | Bacteria | 5219 |
| 1553 | Ga0501075_0035506 | 3300049591 | Bacteria | 3719 |
| 1554 | Ga0501075_0041275 | 3300049591 | Bacteria | 3457 |
| 1555 | Ga0501075_0080937 | 3300049591 | Bacteria | 2458 |
| 1556 | Ga0501075_0106072 | 3300049591 | Bacteria | 2135 |
| 1557 | Ga0501075_0378412 | 3300049591 | Unclassified | 1079 |
| 1558 | Ga0501075_0467596 | 3300049591 | Bacteria | 962 |
| 1559 | Ga0501076_0000812 | 3300049592 | Bacteria | 20232 |
| 1560 | Ga0501076_0002379 | 3300049592 | Bacteria | 12876 |
| 1561 | Ga0501076_0022035 | 3300049592 | Bacteria | 4893 |
| 1562 | Ga0501076_0024142 | 3300049592 | Bacteria | 4695 |
| 1563 | Ga0501076_0037773 | 3300049592 | Bacteria | 3789 |
| 1564 | Ga0501076_0044812 | 3300049592 | Unclassified | 3490 |
| 1565 | Ga0501076_0189506 | 3300049592 | Bacteria | 1678 |
| 1566 | Ga0501076_0204749 | 3300049592 | Bacteria | 1612 |
| 1567 | Ga0501076_0254768 | 3300049592 | Bacteria | 1436 |
| 1568 | Ga0501076_0267305 | 3300049592 | Bacteria | 1400 |
| 1569 | Ga0501076_0272459 | 3300049592 | Unclassified | 1386 |
| 1570 | Ga0501076_0342297 | 3300049592 | Bacteria | 1227 |
| 1571 | Ga0501076_0438541 | 3300049592 | Unclassified | 1075 |
| 1572 | Ga0501077_0000499 | 3300049593 | Bacteria | 23813 |
| 1573 | Ga0501077_0003790 | 3300049593 | Bacteria | 9105 |
| 1574 | Ga0501077_0004497 | 3300049593 | Bacteria | 8470 |
| 1575 | Ga0501077_0004745 | 3300049593 | Bacteria | 8264 |
| 1576 | Ga0501077_0014155 | 3300049593 | Bacteria | 5006 |
| 1577 | Ga0501077_0020724 | 3300049593 | Bacteria | 4162 |
| 1578 | Ga0501077_0052671 | 3300049593 | Bacteria | 2584 |
| 1579 | Ga0501077_0054742 | 3300049593 | Bacteria | 2533 |
| 1580 | Ga0501077_0078011 | 3300049593 | Bacteria | 2099 |
| 1581 | Ga0501077_0115274 | 3300049593 | Bacteria | 1703 |
| 1582 | Ga0501077_0286431 | 3300049593 | Bacteria | 1049 |
| 1583 | Ga0501079_0000803 | 3300049741 | Bacteria | 21406 |
| 1584 | Ga0501079_0010238 | 3300049741 | Bacteria | 7119 |
| 1585 | Ga0501079_0016932 | 3300049741 | Bacteria | 5568 |
| 1586 | Ga0501079_0018380 | 3300049741 | Bacteria | 5342 |
| 1587 | Ga0501079_0033804 | 3300049741 | Bacteria | 3934 |
| 1588 | Ga0501079_0045496 | 3300049741 | Bacteria | 3387 |
| 1589 | Ga0501079_0054055 | 3300049741 | Bacteria | 3097 |
| 1590 | Ga0501079_0074562 | 3300049741 | Bacteria | 2623 |
| 1591 | Ga0501079_0141918 | 3300049741 | Bacteria | 1871 |
| 1592 | Ga0501079_0247931 | 3300049741 | Bacteria | 1392 |
| 1593 | Ga0501079_0417116 | 3300049741 | Bacteria | 1053 |
| 1594 | Ga0501079_0545740 | 3300049741 | Bacteria | 911 |
| 1595 | Ga0501080_0003048 | 3300049742 | Bacteria | 14789 |
| 1596 | Ga0501080_0005883 | 3300049742 | Bacteria | 10986 |
| 1597 | Ga0501080_0009672 | 3300049742 | Bacteria | 8802 |
| 1598 | Ga0501080_0010704 | 3300049742 | Bacteria | 8391 |
| 1599 | Ga0501080_0039743 | 3300049742 | Bacteria | 4390 |
| 1600 | Ga0501080_0046497 | 3300049742 | Bacteria | 4041 |
| 1601 | Ga0501080_0065049 | 3300049742 | Bacteria | 3392 |
| 1602 | Ga0501080_0081348 | 3300049742 | Bacteria | 3009 |
| 1603 | Ga0501080_0202432 | 3300049742 | Unclassified | 1822 |
| 1604 | Ga0501080_0360520 | 3300049742 | Unclassified | 1312 |
| 1605 | Ga0501080_0448489 | 3300049742 | Unclassified | 1157 |
| 1606 | Ga0501081_0010433 | 3300049743 | Bacteria | 6059 |
| 1607 | Ga0501081_0010461 | 3300049743 | Bacteria | 6053 |
| 1608 | Ga0501081_0134977 | 3300049743 | Unclassified | 1766 |
| 1609 | Ga0501081_0199805 | 3300049743 | Bacteria | 1449 |
| 1610 | Ga0501081_0250287 | 3300049743 | Unclassified | 1293 |
| 1611 | Ga0501083_0001262 | 3300049744 | Bacteria | 17164 |
| 1612 | Ga0501083_0008045 | 3300049744 | Bacteria | 7458 |
| 1613 | Ga0501083_0008383 | 3300049744 | Bacteria | 7308 |
| 1614 | Ga0501083_0013676 | 3300049744 | Bacteria | 5675 |
| 1615 | Ga0501083_0081982 | 3300049744 | Bacteria | 2138 |
| 1616 | Ga0501083_0093101 | 3300049744 | Bacteria | 1990 |
| 1617 | Ga0501083_0146467 | 3300049744 | Bacteria | 1546 |
| 1618 | Ga0501083_0165411 | 3300049744 | Bacteria | 1446 |
| 1619 | Ga0501035_0006890 | 3300049822 | Bacteria | 10616 |
| 1620 | Ga0501035_0014173 | 3300049822 | Bacteria | 7356 |
| 1621 | Ga0501035_0087847 | 3300049822 | Bacteria | 2740 |
| 1622 | Ga0501035_0109683 | 3300049822 | Unclassified | 2419 |
| 1623 | Ga0501035_0207599 | 3300049822 | Bacteria | 1677 |
| 1624 | Ga0501044_0043798 | 3300049823 | Bacteria | 4648 |
| 1625 | Ga0501044_0049698 | 3300049823 | Bacteria | 4329 |
| 1626 | Ga0501044_0067848 | 3300049823 | Bacteria | 3634 |
| 1627 | Ga0501044_0388080 | 3300049823 | Unclassified | 1311 |
| 1628 | Ga0501045_0004392 | 3300049824 | Bacteria | 9722 |
| 1629 | Ga0501045_0005064 | 3300049824 | Bacteria | 9123 |
| 1630 | Ga0501045_0018778 | 3300049824 | Bacteria | 4921 |
| 1631 | Ga0501045_0023088 | 3300049824 | Bacteria | 4457 |
| 1632 | Ga0501045_0032796 | 3300049824 | Bacteria | 3764 |
| 1633 | Ga0501045_0072610 | 3300049824 | Unclassified | 2533 |
| 1634 | Ga0501045_0126160 | 3300049824 | Bacteria | 1901 |
| 1635 | Ga0501045_0138710 | 3300049824 | Bacteria | 1808 |
| 1636 | nmdc:mga03n38_101905_c1 | 3300050490 | Unclassified | 1385 |
| 1637 | nmdc:mga00v17_240143_c1 | 3300050491 | Bacteria | 1174 |
| 1638 | nmdc:mga0yw44_257714_c1 | 3300050492 | Unclassified | 1162 |
| 1639 | nmdc:mga06z11_284480_c1 | 3300050494 | Unclassified | 980 |
| 1640 | nmdc:mga05p37_101073_c1 | 3300050507 | Bacteria | 3552 |
| 1641 | nmdc:mga05p37_1092092_c1 | 3300050507 | Bacteria | 836 |
| 1642 | nmdc:mga05p37_133731_c1 | 3300050507 | Bacteria | 3042 |
| 1643 | nmdc:mga05p37_1560_c1 | 3300050507 | Bacteria | 26624 |
| 1644 | nmdc:mga05p37_162922_c1 | 3300050507 | Bacteria | 2723 |
| 1645 | nmdc:mga05p37_206607_c1 | 3300050507 | Bacteria | 2375 |
| 1646 | nmdc:mga05p37_251987_c1 | 3300050507 | Bacteria | 2117 |
| 1647 | nmdc:mga05p37_41002_c1 | 3300050507 | Bacteria | 5685 |
| 1648 | nmdc:mga05p37_48042_c1 | 3300050507 | Bacteria | 5249 |
| 1649 | nmdc:mga05p37_493713_c1 | 3300050507 | Bacteria | 1407 |
| 1650 | nmdc:mga05p37_97853_c1 | 3300050507 | Bacteria | 3614 |
| 1651 | nmdc:mga09592_49260_c1 | 3300050508 | Bacteria | 3552 |
| 1652 | nmdc:mga09592_629_c3 | 3300050508 | Bacteria | 11653 |
| 1653 | nmdc:mga09592_77520_c1 | 3300050508 | Unclassified | 2827 |
| 1654 | nmdc:mga0qj67_30247_c1 | 3300050509 | Bacteria | 4213 |
| 1655 | nmdc:mga06r32_141265_c1 | 3300050510 | Bacteria | 2384 |
| 1656 | nmdc:mga06r32_1948_c1 | 3300050510 | Bacteria | 18394 |
| 1657 | nmdc:mga08y16_13610_c1 | 3300050511 | Bacteria | 8562 |
| 1658 | nmdc:mga08y16_174258_c1 | 3300050511 | Bacteria | 2234 |
| 1659 | nmdc:mga08y16_35984_c1 | 3300050511 | Bacteria | 5199 |
| 1660 | nmdc:mga08y16_569620_c1 | 3300050511 | Unclassified | 1144 |
| 1661 | nmdc:mga08y16_8316_c1 | 3300050511 | Bacteria | 10862 |
| 1662 | nmdc:mga08y16_97894_c1 | 3300050511 | Bacteria | 3055 |
| 1663 | nmdc:mga0n895_1537_c1 | 3300050512 | Bacteria | 17340 |
| 1664 | nmdc:mga0n895_179483_c1 | 3300050512 | Unclassified | 2149 |
| 1665 | nmdc:mga0n895_240067_c1 | 3300050512 | Bacteria | 1839 |
| 1666 | nmdc:mga0n895_406044_c1 | 3300050512 | Unclassified | 1378 |
| 1667 | nmdc:mga0n895_428467_c1 | 3300050512 | Unclassified | 1337 |
| 1668 | nmdc:mga0n895_55813_c1 | 3300050512 | Bacteria | 3888 |
| 1669 | nmdc:mga0rr50_1170_c1 | 3300050513 | Bacteria | 14267 |
| 1670 | nmdc:mga0rr50_180830_c1 | 3300050513 | Bacteria | 1724 |
| 1671 | nmdc:mga0rr50_2130_c1 | 3300050513 | Bacteria | 11067 |
| 1672 | nmdc:mga0rr50_227647_c1 | 3300050513 | Bacteria | 1542 |
| 1673 | nmdc:mga0rr50_42090_c1 | 3300050513 | Bacteria | 3333 |
| 1674 | nmdc:mga0rr50_74002_c1 | 3300050513 | Unclassified | 2606 |
| 1675 | nmdc:mga08x19_101312_c1 | 3300050514 | Bacteria | 1911 |
| 1676 | nmdc:mga08x19_135960_c1 | 3300050514 | Bacteria | 1657 |
| 1677 | nmdc:mga08x19_4011_c1 | 3300050514 | Bacteria | 8760 |
| 1678 | nmdc:mga08x19_6462_c1 | 3300050514 | Bacteria | 6938 |
| 1679 | nmdc:mga08x19_69986_c1 | 3300050514 | Unclassified | 2286 |
| 1680 | nmdc:mga08x19_72831_c1 | 3300050514 | Bacteria | 2242 |
| 1681 | nmdc:mga0a205_108307_c1 | 3300050515 | Unclassified | 2677 |
| 1682 | nmdc:mga0a205_12007_c1 | 3300050515 | Bacteria | 8000 |
| 1683 | nmdc:mga0a205_120607_c1 | 3300050515 | Bacteria | 2522 |
| 1684 | nmdc:mga0a205_143589_c1 | 3300050515 | Bacteria | 2287 |
| 1685 | nmdc:mga0a205_202153_c1 | 3300050515 | Bacteria | 1877 |
| 1686 | nmdc:mga0a205_22203_c1 | 3300050515 | Bacteria | 6008 |
| 1687 | nmdc:mga0a205_321961_c1 | 3300050515 | Bacteria | 1417 |
| 1688 | nmdc:mga0a205_734803_c1 | 3300050515 | Bacteria | 836 |
| 1689 | nmdc:mga0a205_98752_c1 | 3300050515 | Bacteria | 2818 |
| 1690 | Ga0495601_0020058 | 3300053077 | Bacteria | 4079 |
| 1691 | Ga0495601_0028098 | 3300053077 | Bacteria | 3482 |
| 1692 | Ga0495601_0045737 | 3300053077 | Bacteria | 2753 |
| 1693 | Ga0495601_0051205 | 3300053077 | Bacteria | 2606 |
| 1694 | Ga0495601_0125400 | 3300053077 | Bacteria | 1670 |
| 1695 | Ga0495612_0017122 | 3300053078 | Bacteria | 2903 |
| 1696 | Ga0495612_0128100 | 3300053078 | Bacteria | 1095 |
| 1697 | Ga0495595_0019166 | 3300053084 | Unclassified | 2966 |
| 1698 | Ga0495595_0032162 | 3300053084 | Bacteria | 2361 |
| 1699 | Ga0495595_0164755 | 3300053084 | Bacteria | 1095 |
| 1700 | Ga0495619_0014992 | 3300053085 | Bacteria | 4897 |
| 1701 | Ga0495619_0034422 | 3300053085 | Bacteria | 3293 |
| 1702 | Ga0495619_0058661 | 3300053085 | Bacteria | 2555 |
| 1703 | Ga0495619_0071902 | 3300053085 | Bacteria | 2315 |
| 1704 | Ga0501084_0005692 | 3300054114 | Bacteria | 10238 |
| 1705 | Ga0501084_0015481 | 3300054114 | Bacteria | 6325 |
| 1706 | Ga0501084_0024209 | 3300054114 | Bacteria | 5064 |
| 1707 | Ga0501084_0031104 | 3300054114 | Bacteria | 4464 |
| 1708 | Ga0501084_0031839 | 3300054114 | Bacteria | 4410 |
| 1709 | Ga0501084_0034448 | 3300054114 | Bacteria | 4234 |
| 1710 | Ga0501084_0040892 | 3300054114 | Bacteria | 3879 |
| 1711 | Ga0501084_0068454 | 3300054114 | Bacteria | 2972 |
| 1712 | Ga0501084_0074550 | 3300054114 | Bacteria | 2842 |
| 1713 | Ga0501084_0163222 | 3300054114 | Unclassified | 1879 |
| 1714 | Ga0501084_0172197 | 3300054114 | Unclassified | 1827 |
| 1715 | Ga0501084_0180909 | 3300054114 | Bacteria | 1780 |
| 1716 | Ga0501084_0203114 | 3300054114 | Unclassified | 1672 |
| 1717 | Ga0501084_0496632 | 3300054114 | Bacteria | 1031 |
| 1718 | Ga0501084_0563734 | 3300054114 | Bacteria | 962 |
| 1719 | Ga0590071_008630 | 3300059421 | Bacteria | 2397 |
| 1720 | Ga0590071_021250 | 3300059421 | Bacteria | 1530 |
| 1721 | Ga0590075_007204 | 3300059424 | Bacteria | 2641 |
| 1722 | Ga0590075_012428 | 3300059424 | Bacteria | 2068 |
| 1723 | Ga0590077_023368 | 3300059426 | Unclassified | 1323 |
| 1724 | Ga0501082_0001765 | 3300060353 | Bacteria | 19028 |
| 1725 | Ga0501082_0003599 | 3300060353 | Bacteria | 13536 |
| 1726 | Ga0501082_0003644 | 3300060353 | Bacteria | 13450 |
| 1727 | Ga0501082_0027247 | 3300060353 | Bacteria | 4920 |
| 1728 | Ga0501082_0036967 | 3300060353 | Bacteria | 4207 |
| 1729 | Ga0501082_0088482 | 3300060353 | Bacteria | 2672 |
| 1730 | Ga0501082_0098416 | 3300060353 | Unclassified | 2529 |
| 1731 | Ga0501082_0120479 | 3300060353 | Bacteria | 2274 |
| 1732 | Ga0501082_0202593 | 3300060353 | Bacteria | 1727 |
| 1733 | Ga0501082_0445868 | 3300060353 | Unclassified | 1131 |
| 1734 | Ga0501082_0676243 | 3300060353 | Unclassified | 903 |
| 1735 | Ga0466962_0001252 | 3300061719 | Bacteria | 11717 |
| 1736 | Ga0466962_0006223 | 3300061719 | Bacteria | 5732 |
| 1737 | Ga0466962_0061799 | 3300061719 | Bacteria | 1788 |
| 1738 | Ga0530510_0004557 | 3300061734 | Bacteria | 9589 |
| 1739 | Ga0530510_0012442 | 3300061734 | Bacteria | 5977 |
| 1740 | Ga0530510_0070661 | 3300061734 | Bacteria | 2533 |
| 1741 | Ga0530510_0076791 | 3300061734 | Bacteria | 2427 |
| 1742 | Ga0530510_0078804 | 3300061734 | Bacteria | 2396 |
| 1743 | Ga0530510_0089484 | 3300061734 | Bacteria | 2244 |
| 1744 | Ga0530510_0116728 | 3300061734 | Bacteria | 1957 |
| 1745 | Ga0530510_0147421 | 3300061734 | Bacteria | 1736 |
| 1746 | Ga0530510_0148541 | 3300061734 | Unclassified | 1729 |
| 1747 | Ga0530510_0252217 | 3300061734 | Unclassified | 1315 |
| 1748 | Ga0530510_0320316 | 3300061734 | Bacteria | 1162 |
| 1749 | Ga0530510_0397015 | 3300061734 | Bacteria | 1039 |
| 1750 | Ga0530510_0454625 | 3300061734 | Bacteria | 968 |
| 1751 | Ga0501076_0187137 | |||
| 1752 | JGI24752J21851_1021037 | |||
| 1753 | JGI24746J21847_1008797 | |||
| 1754 | JGI24747J21853_1005673 | |||
| 1755 | JGI24739J22299_10023322 | |||
| 1756 | JGI24743J22301_10002240 | |||
| 1757 | JGI24743J22301_10002607 | |||
| 1758 | JGI24743J22301_10003655 | |||
| 1759 | JGI24745J21846_1004648 | |||
| 1760 | JGI24738J21930_10004033 | |||
| 1761 | JGI24738J21930_10014493 | |||
| 1762 | JGI24749J21850_1025441 | |||
| 1763 | JGI24744J21845_10010971 | |||
| 1764 | JGI24033J26618_1002043 | |||
| 1765 | JGI24742J22300_10006233 | |||
| 1766 | JGI25406J46586_10019731 | |||
| 1767 | JGI25407J50210_10008378 | |||
| 1768 | JGI25407J50210_10009726 | |||
| 1769 | JGI25407J50210_10014112 | |||
| 1770 | Ga0058862_12831764 | |||
| 1771 | Ga0070658_10015054 | |||
| 1772 | Ga0070658_10109397 | |||
| 1773 | Ga0070658_10120539 | |||
| 1774 | Ga0070658_10300504 | |||
| 1775 | Ga0070658_10546937 | |||
| 1776 | Ga0070683_100005201 | |||
| 1777 | Ga0070683_100062646 | |||
| 1778 | Ga0070683_100104634 | |||
| 1779 | Ga0070683_100108866 | |||
| 1780 | Ga0070683_100111274 | |||
| 1781 | Ga0070683_100117347 | |||
| 1782 | Ga0070683_100128256 | |||
| 1783 | Ga0070683_100196314 | |||
| 1784 | Ga0070683_100249141 | |||
| 1785 | Ga0070683_100426171 | |||
| 1786 | Ga0070683_100443193 | |||
| 1787 | Ga0070683_100445597 | |||
| 1788 | Ga0070670_100005716 | |||
| 1789 | Ga0070670_100030695 | |||
| 1790 | Ga0070670_100183745 | |||
| 1791 | Ga0070677_10134271 | |||
| 1792 | Ga0068869_100108886 | |||
| 1793 | Ga0068869_100115911 | |||
| 1794 | Ga0070680_100008148 | |||
| 1795 | Ga0070680_100047408 | |||
| 1796 | Ga0070680_100071038 | |||
| 1797 | Ga0070680_100095265 | |||
| 1798 | Ga0070680_100174114 | |||
| 1799 | Ga0070680_100257630 | |||
| 1800 | Ga0070682_100002738 | |||
| 1801 | Ga0070682_100031525 | |||
| 1802 | Ga0070682_100100688 | |||
| 1803 | Ga0070682_100271625 | |||
| 1804 | Ga0068868_100004372 | |||
| 1805 | Ga0068868_100170304 | |||
| 1806 | Ga0070660_100003874 | |||
| 1807 | Ga0070660_100004655 | |||
| 1808 | Ga0070660_100007596 | |||
| 1809 | Ga0070660_100008326 | |||
| 1810 | Ga0070660_100038835 | |||
| 1811 | Ga0070660_100264926 | |||
| 1812 | Ga0070689_100013807 | |||
| 1813 | Ga0070689_100315260 | |||
| 1814 | Ga0070689_100452693 | |||
| 1815 | Ga0070689_100479721 | |||
| 1816 | Ga0070691_10006093 | |||
| 1817 | Ga0070691_10017595 | |||
| 1818 | Ga0070687_100160404 | |||
| 1819 | Ga0070661_100015521 | |||
| 1820 | Ga0070661_100029869 | |||
| 1821 | Ga0070661_100067320 | |||
| 1822 | Ga0070661_100082044 | |||
| 1823 | Ga0070661_100180127 | |||
| 1824 | Ga0070661_100247230 | |||
| 1825 | Ga0070692_10002026 | |||
| 1826 | Ga0070692_10104946 | |||
| 1827 | Ga0070668_100008587 | |||
| 1828 | Ga0070668_100085170 | |||
| 1829 | Ga0070668_100104067 | |||
| 1830 | Ga0070669_100350257 | |||
| 1831 | Ga0070675_100014084 | |||
| 1832 | Ga0070675_100016698 | |||
| 1833 | Ga0070675_100114665 | |||
| 1834 | Ga0070675_100322462 | |||
| 1835 | Ga0070671_100108632 | |||
| 1836 | Ga0070671_100271744 | |||
| 1837 | Ga0070671_100300141 | |||
| 1838 | Ga0070674_100031128 | |||
| 1839 | Ga0070674_100034195 | |||
| 1840 | Ga0070674_100034478 | |||
| 1841 | Ga0070674_100114708 | |||
| 1842 | Ga0070674_100223944 | |||
| 1843 | Ga0070674_100226548 | |||
| 1844 | Ga0070674_100237668 | |||
| 1845 | Ga0070674_100319660 | |||
| 1846 | Ga0070673_100011553 | |||
| 1847 | Ga0070673_100639350 | |||
| 1848 | Ga0070688_100002663 | |||
| 1849 | Ga0070659_100023844 | |||
| 1850 | Ga0070659_100072492 | |||
| 1851 | Ga0070659_100149492 | |||
| 1852 | Ga0070659_100200187 | |||
| 1853 | Ga0070659_100261591 | |||
| 1854 | Ga0070659_100269761 | |||
| 1855 | Ga0070659_100322311 | |||
| 1856 | Ga0070659_100323522 | |||
| 1857 | Ga0070659_100399550 | |||
| 1858 | Ga0070667_100012127 | |||
| 1859 | Ga0070709_10009338 | |||
| 1860 | Ga0070714_100050153 | |||
| 1861 | Ga0070714_100098935 | |||
| 1862 | Ga0070714_100136522 | |||
| 1863 | Ga0070714_100391044 | |||
| 1864 | Ga0070714_100397285 | |||
| 1865 | Ga0070713_100005892 | |||
| 1866 | Ga0070713_100281646 | |||
| 1867 | Ga0070713_100334099 | |||
| 1868 | Ga0070713_100665190 | |||
| 1869 | Ga0070710_10002302 | |||
| 1870 | Ga0070710_10030936 | |||
| 1871 | Ga0070710_10080242 | |||
| 1872 | Ga0070710_10099831 | |||
| 1873 | Ga0070701_10022094 | |||
| 1874 | Ga0070701_10183836 | |||
| 1875 | Ga0070711_100023268 | |||
| 1876 | Ga0070711_100119492 | |||
| 1877 | Ga0070711_100124518 | |||
| 1878 | Ga0070705_100071440 | |||
| 1879 | Ga0070705_100089979 | |||
| 1880 | Ga0070705_100145677 | |||
| 1881 | Ga0070700_100004141 | |||
| 1882 | Ga0070700_100101635 | |||
| 1883 | Ga0070700_100261277 | |||
| 1884 | Ga0070700_100280609 | |||
| 1885 | Ga0070694_100029605 | |||
| 1886 | Ga0070694_100359545 | |||
| 1887 | Ga0070708_100029579 | |||
| 1888 | Ga0070708_100029675 | |||
| 1889 | Ga0070708_100041886 | |||
| 1890 | Ga0070708_100119944 | |||
| 1891 | Ga0070708_100216222 | |||
| 1892 | Ga0070708_100301140 | |||
| 1893 | Ga0070708_100386036 | |||
| 1894 | Ga0070663_100082044 | |||
| 1895 | Ga0070663_100167993 | |||
| 1896 | Ga0070663_100184665 | |||
| 1897 | Ga0070678_100030384 | |||
| 1898 | Ga0070678_100036526 | |||
| 1899 | Ga0070678_100069856 | |||
| 1900 | Ga0070662_100002025 | |||
| 1901 | Ga0070662_100014195 | |||
| 1902 | Ga0070662_100273845 | |||
| 1903 | Ga0070662_100293119 | |||
| 1904 | Ga0070681_10001955 | |||
| 1905 | Ga0070681_10005851 | |||
| 1906 | Ga0070681_10020993 | |||
| 1907 | Ga0070681_10050117 | |||
| 1908 | Ga0070681_10066022 | |||
| 1909 | Ga0070681_10067851 | |||
| 1910 | Ga0070681_10081715 | |||
| 1911 | Ga0070681_10148830 | |||
| 1912 | Ga0070681_10174626 | |||
| 1913 | Ga0070681_10263669 | |||
| 1914 | Ga0070681_10461483 | |||
| 1915 | Ga0068867_100012414 | |||
| 1916 | Ga0068867_100180479 | |||
| 1917 | Ga0070685_10004001 | |||
| 1918 | Ga0070685_10064574 | |||
| 1919 | Ga0070706_100035448 | |||
| 1920 | Ga0070706_100038867 | |||
| 1921 | Ga0070707_100000328 | |||
| 1922 | Ga0070707_100004648 | |||
| 1923 | Ga0070707_100049962 | |||
| 1924 | Ga0070707_100119199 | |||
| 1925 | Ga0070707_100188723 | |||
| 1926 | Ga0070707_100742184 | |||
| 1927 | Ga0070698_100006381 | |||
| 1928 | Ga0070698_100009026 | |||
| 1929 | Ga0070698_100013953 | |||
| 1930 | Ga0070698_100084311 | |||
| 1931 | Ga0070699_100042793 | |||
| 1932 | Ga0070699_100107430 | |||
| 1933 | Ga0070699_100139293 | |||
| 1934 | Ga0070679_100027946 | |||
| 1935 | Ga0070679_100073439 | |||
| 1936 | Ga0070679_100100235 | |||
| 1937 | Ga0070679_100139436 | |||
| 1938 | Ga0070679_100340229 | |||
| 1939 | Ga0070684_100000801 | |||
| 1940 | Ga0070684_100006669 | |||
| 1941 | Ga0070684_100008131 | |||
| 1942 | Ga0070684_100014243 | |||
| 1943 | Ga0070684_100015491 | |||
| 1944 | Ga0070684_100016404 | |||
| 1945 | Ga0070684_100020628 | |||
| 1946 | Ga0070684_100024219 | |||
| 1947 | Ga0070684_100033105 | |||
| 1948 | Ga0070684_100034687 | |||
| 1949 | Ga0070684_100042990 | |||
| 1950 | Ga0070684_100061787 | |||
| 1951 | Ga0070684_100113209 | |||
| 1952 | Ga0070684_100115172 | |||
| 1953 | Ga0070684_100203107 | |||
| 1954 | Ga0070684_100456391 | |||
| 1955 | Ga0070684_100522290 | |||
| 1956 | Ga0070697_100357913 | |||
| 1957 | Ga0070697_100485149 | |||
| 1958 | Ga0068853_100007300 | |||
| 1959 | Ga0068853_100204098 | |||
| 1960 | Ga0068853_100386066 | |||
| 1961 | Ga0070672_100016488 | |||
| 1962 | Ga0070672_100026858 | |||
| 1963 | Ga0070672_100174020 | |||
| 1964 | Ga0070672_100259602 | |||
| 1965 | Ga0070672_100334533 | |||
| 1966 | Ga0070686_100017245 | |||
| 1967 | Ga0070686_100038215 | |||
| 1968 | Ga0070686_100044652 | |||
| 1969 | Ga0070686_100333561 | |||
| 1970 | Ga0070695_100002777 | |||
| 1971 | Ga0070695_100173012 | |||
| 1972 | Ga0070696_100095770 | |||
| 1973 | Ga0070696_100106667 | |||
| 1974 | Ga0070693_100048706 | |||
| 1975 | Ga0070693_100132002 | |||
| 1976 | Ga0070665_100005968 | |||
| 1977 | Ga0070704_100005014 | |||
| 1978 | Ga0070704_100400247 | |||
| 1979 | Ga0068855_100006817 | |||
| 1980 | Ga0068855_100012747 | |||
| 1981 | Ga0068855_100036661 | |||
| 1982 | Ga0068855_100071313 | |||
| 1983 | Ga0068855_100142482 | |||
| 1984 | Ga0068855_100236353 | |||
| 1985 | Ga0068855_100257970 | |||
| 1986 | Ga0068855_100300503 | |||
| 1987 | Ga0068855_100319362 | |||
| 1988 | Ga0068855_100475799 | |||
| 1989 | Ga0070664_100044398 | |||
| 1990 | Ga0070664_100055547 | |||
| 1991 | Ga0070664_100204197 | |||
| 1992 | Ga0068857_100009172 | |||
| 1993 | Ga0068857_100011172 | |||
| 1994 | Ga0068857_100167832 | |||
| 1995 | Ga0068854_100002899 | |||
| 1996 | Ga0068854_100098513 | |||
| 1997 | Ga0068854_100202147 | |||
| 1998 | Ga0068856_100006885 | |||
| 1999 | Ga0068856_100025554 | |||
| 2000 | Ga0068856_100047859 | |||
| 2001 | Ga0068856_100086852 | |||
| 2002 | Ga0068856_100129422 | |||
| 2003 | Ga0070702_100011161 | |||
| 2004 | Ga0070702_100011796 | |||
| 2005 | Ga0070702_100032003 | |||
| 2006 | Ga0070702_100057411 | |||
| 2007 | Ga0070702_100190505 | |||
| 2008 | Ga0068852_100002688 | |||
| 2009 | Ga0068852_100058846 | |||
| 2010 | Ga0068852_100335281 | |||
| 2011 | Ga0068852_100575411 | |||
| 2012 | Ga0068859_100045563 | |||
| 2013 | Ga0068864_100048354 | |||
| 2014 | Ga0068861_100003381 | |||
| 2015 | Ga0068861_100051190 | |||
| 2016 | Ga0068870_10004426 | |||
| 2017 | Ga0068870_10018231 | |||
| 2018 | Ga0068870_10225711 | |||
| 2019 | Ga0068863_100014802 | |||
| 2020 | Ga0068863_100874871 | |||
| 2021 | Ga0068858_100016953 | |||
| 2022 | Ga0068858_100043753 | |||
| 2023 | Ga0068860_100048020 | |||
| 2024 | Ga0068860_100323053 | |||
| 2025 | Ga0068862_100091213 | |||
| 2026 | Ga0068862_100271902 | |||
| 2027 | Ga0068862_100732158 | |||
| 2028 | Ga0081455_10015398 | |||
| 2029 | Ga0081455_10025233 | |||
| 2030 | Ga0081455_10038614 | |||
| 2031 | Ga0081455_10045221 | |||
| 2032 | Ga0081455_10079373 | |||
| 2033 | Ga0081455_10120011 | |||
| 2034 | Ga0081455_10143496 | |||
| 2035 | Ga0081455_10184175 | |||
| 2036 | Ga0081455_10185613 | |||
| 2037 | Ga0081538_10000035 | |||
| 2038 | Ga0081538_10000152 | |||
| 2039 | Ga0081538_10000696 | |||
| 2040 | Ga0081538_10004814 | |||
| 2041 | Ga0081538_10007205 | |||
| 2042 | Ga0081538_10007559 | |||
| 2043 | Ga0081538_10017792 | |||
| 2044 | Ga0081538_10019711 | |||
| 2045 | Ga0081538_10023770 | |||
| 2046 | Ga0081538_10067111 | |||
| 2047 | Ga0081538_10089409 | |||
| 2048 | Ga0081538_10154437 | |||
| 2049 | Ga0081540_1003561 | |||
| 2050 | Ga0081539_10000866 | |||
| 2051 | Ga0070717_10010696 | |||
| 2052 | Ga0070717_10059005 | |||
| 2053 | Ga0070717_10062245 | |||
| 2054 | Ga0070717_10069828 | |||
| 2055 | Ga0070717_10239093 | |||
| 2056 | Ga0070717_10424003 | |||
| 2057 | Ga0075365_10022967 | |||
| 2058 | Ga0075365_10075872 | |||
| 2059 | Ga0075365_10077318 | |||
| 2060 | Ga0075363_100147218 | |||
| 2061 | Ga0075364_10212198 | |||
| 2062 | Ga0075432_10025925 | |||
| 2063 | Ga0070715_10000913 | |||
| 2064 | Ga0070715_10034552 | |||
| 2065 | Ga0070715_10058699 | |||
| 2066 | Ga0070716_100009358 | |||
| 2067 | Ga0070716_100193774 | |||
| 2068 | Ga0070716_100364919 | |||
| 2069 | Ga0070712_100047801 | |||
| 2070 | Ga0070712_100307085 | |||
| 2071 | Ga0097621_100188436 | |||
| 2072 | Ga0097621_100193422 | |||
| 2073 | Ga0097621_100210300 | |||
| 2074 | Ga0097621_100243759 | |||
| 2075 | Ga0097621_100336906 | |||
| 2076 | Ga0068871_100047256 | |||
| 2077 | Ga0068871_100051770 | |||
| 2078 | Ga0068871_100113713 | |||
| 2079 | Ga0068871_100189530 | |||
| 2080 | Ga0068871_100242454 | |||
| 2081 | Ga0075428_100000308 | |||
| 2082 | Ga0075428_100016622 | |||
| 2083 | Ga0075428_100031695 | |||
| 2084 | Ga0075428_100057000 | |||
| 2085 | Ga0075428_100143498 | |||
| 2086 | Ga0075428_100201563 | |||
| 2087 | Ga0075428_100576163 | |||
| 2088 | Ga0075430_100014948 | |||
| 2089 | Ga0075430_100079063 | |||
| 2090 | Ga0075430_100124588 | |||
| 2091 | Ga0075431_100001086 | |||
| 2092 | Ga0075431_100213838 | |||
| 2093 | Ga0075433_10004225 | |||
| 2094 | Ga0075433_10008511 | |||
| 2095 | Ga0075433_10018044 | |||
| 2096 | Ga0075433_10020180 | |||
| 2097 | Ga0075433_10026335 | |||
| 2098 | Ga0075433_10102791 | |||
| 2099 | Ga0075433_10220254 | |||
| 2100 | Ga0075433_10340825 | |||
| 2101 | Ga0075434_100034316 | |||
| 2102 | Ga0075434_100042923 | |||
| 2103 | Ga0075434_100071698 | |||
| 2104 | Ga0075434_100100842 | |||
| 2105 | Ga0075434_100145973 | |||
| 2106 | Ga0075434_100190125 | |||
| 2107 | Ga0075434_100222390 | |||
| 2108 | Ga0075434_100462362 | |||
| 2109 | Ga0075429_100009919 | |||
| 2110 | Ga0075429_100063627 | |||
| 2111 | Ga0068865_100005196 | |||
| 2112 | Ga0068865_100006771 | |||
| 2113 | Ga0068865_100021067 | |||
| 2114 | Ga0075436_100012016 | |||
| 2115 | Ga0075436_100020780 | |||
| 2116 | Ga0075436_100025190 | |||
| 2117 | Ga0075436_100041263 | |||
| 2118 | Ga0075436_100058124 | |||
| 2119 | Ga0097620_100045562 | |||
| 2120 | Ga0075435_100001303 | |||
| 2121 | Ga0075435_100001673 | |||
| 2122 | Ga0075435_100019419 | |||
| 2123 | Ga0075435_100059776 | |||
| 2124 | Ga0075435_100089967 | |||
| 2125 | Ga0105250_10103406 | |||
| 2126 | Ga0105240_10091363 | |||
| 2127 | Ga0105240_10153525 | |||
| 2128 | Ga0105240_10207907 | |||
| 2129 | Ga0105240_10402632 | |||
| 2130 | Ga0105240_10414550 | |||
| 2131 | Ga0111539_10025162 | |||
| 2132 | Ga0111539_10036454 | |||
| 2133 | Ga0111539_10046564 | |||
| 2134 | Ga0111539_10053903 | |||
| 2135 | Ga0111539_10348473 | |||
| 2136 | Ga0111539_10674745 | |||
| 2137 | Ga0111539_10735108 | |||
| 2138 | Ga0105245_10023554 | |||
| 2139 | Ga0105245_10034621 | |||
| 2140 | Ga0105245_10040300 | |||
| 2141 | Ga0105245_10050235 | |||
| 2142 | Ga0105245_10064068 | |||
| 2143 | Ga0105245_10275728 | |||
| 2144 | Ga0105245_10405202 | |||
| 2145 | Ga0105245_10548773 | |||
| 2146 | Ga0105247_10058614 | |||
| 2147 | Ga0105247_10121100 | |||
| 2148 | Ga0105247_10350767 | |||
| 2149 | Ga0114129_10001167 | |||
| 2150 | Ga0114129_10015322 | |||
| 2151 | Ga0114129_10035977 | |||
| 2152 | Ga0114129_10047971 | |||
| 2153 | Ga0114129_10058348 | |||
| 2154 | Ga0114129_10068265 | |||
| 2155 | Ga0114129_10083350 | |||
| 2156 | Ga0114129_10106333 | |||
| 2157 | Ga0114129_10110043 | |||
| 2158 | Ga0114129_10986670 | |||
| 2159 | Ga0114129_11321501 | |||
| 2160 | Ga0105243_10005881 | |||
| 2161 | Ga0105243_10011846 | |||
| 2162 | Ga0105243_10012988 | |||
| 2163 | Ga0105243_10014105 | |||
| 2164 | Ga0105243_10031726 | |||
| 2165 | Ga0105241_10120527 | |||
| 2166 | Ga0105241_10124678 | |||
| 2167 | Ga0105241_10252848 | |||
| 2168 | Ga0105241_10289956 | |||
| 2169 | Ga0105242_10032279 | |||
| 2170 | Ga0105242_10044066 | |||
| 2171 | Ga0105242_10177159 | |||
| 2172 | Ga0105242_10305139 | |||
| 2173 | Ga0105242_10317261 | |||
| 2174 | Ga0105242_10416309 | |||
| 2175 | Ga0105242_10519777 | |||
| 2176 | Ga0105248_10004837 | |||
| 2177 | Ga0105248_10097147 | |||
| 2178 | Ga0105248_10115249 | |||
| 2179 | Ga0105237_10104549 | |||
| 2180 | Ga0105238_10033649 | |||
| 2181 | Ga0105238_10035597 | |||
| 2182 | Ga0105238_10699398 | |||
| 2183 | Ga0105249_10233914 | |||
| 2184 | Ga0105249_10445292 | |||
| 2185 | Ga0105249_10609334 | |||
| 2186 | Ga0105239_10003394 | |||
| 2187 | Ga0105239_10044245 | |||
| 2188 | Ga0105239_10056507 | |||
| 2189 | Ga0105239_10069567 | |||
| 2190 | Ga0105239_10144698 | |||
| 2191 | Ga0105239_10321666 | |||
| 2192 | Ga0105239_10457383 | |||
| 2193 | Ga0105239_10492084 | |||
| 2194 | Ga0105239_10607300 | |||
| 2195 | Ga0105239_10741254 | |||
| 2196 | Ga0105246_10022509 | |||
| 2197 | Ga0105246_10024629 | |||
| 2198 | Ga0105246_10149778 | |||
| 2199 | Ga0105246_10224083 | |||
| 2200 | Ga0157373_10032117 | |||
| 2201 | Ga0157373_10354263 | |||
| 2202 | Ga0157371_10004355 | |||
| 2203 | Ga0157371_10115418 | |||
| 2204 | Ga0157371_10436756 | |||
| 2205 | Ga0157370_10018791 | |||
| 2206 | Ga0157370_10028361 | |||
| 2207 | Ga0157370_10031019 | |||
| 2208 | Ga0157370_10196259 | |||
| 2209 | Ga0157370_10286411 | |||
| 2210 | Ga0157369_10002497 | |||
| 2211 | Ga0157369_10023069 | |||
| 2212 | Ga0157369_10029987 | |||
| 2213 | Ga0157369_10046466 | |||
| 2214 | Ga0157369_10086575 | |||
| 2215 | Ga0157369_10116737 | |||
| 2216 | Ga0157369_10204935 | |||
| 2217 | Ga0157369_10397992 | |||
| 2218 | Ga0157374_10029179 | |||
| 2219 | Ga0157374_10047966 | |||
| 2220 | Ga0157374_10201556 | |||
| 2221 | Ga0157374_10336403 | |||
| 2222 | Ga0157378_10131447 | |||
| 2223 | Ga0157378_10243868 | |||
| 2224 | Ga0157378_10365848 | |||
| 2225 | Ga0157378_10699694 | |||
| 2226 | Ga0163162_10072172 | |||
| 2227 | Ga0163162_10136557 | |||
| 2228 | Ga0163162_10197617 | |||
| 2229 | Ga0157372_10006332 | |||
| 2230 | Ga0157372_10026486 | |||
| 2231 | Ga0157372_10055345 | |||
| 2232 | Ga0157372_10072372 | |||
| 2233 | Ga0157372_10085452 | |||
| 2234 | Ga0157372_10316757 | |||
| 2235 | Ga0157372_10450680 | |||
| 2236 | Ga0157372_10846308 | |||
| 2237 | Ga0157375_10001779 | |||
| 2238 | Ga0157375_10025998 | |||
| 2239 | Ga0157375_10130854 | |||
| 2240 | Ga0157375_10151600 | |||
| 2241 | Ga0157375_10171846 | |||
| 2242 | Ga0157375_10504055 | |||
| 2243 | Ga0157375_10767236 | |||
| 2244 | Ga0163163_10003453 | |||
| 2245 | Ga0163163_10107381 | |||
| 2246 | Ga0163163_10203191 | |||
| 2247 | Ga0163163_10570985 | |||
| 2248 | Ga0157380_10009901 | |||
| 2249 | Ga0157380_10031821 | |||
| 2250 | Ga0157380_10061307 | |||
| 2251 | Ga0157380_10086324 | |||
| 2252 | Ga0157380_10198097 | |||
| 2253 | Ga0182008_10200898 | |||
| 2254 | Ga0157377_10002578 | |||
| 2255 | Ga0157377_10008386 | |||
| 2256 | Ga0157377_10139382 | |||
| 2257 | Ga0157379_10079000 | |||
| 2258 | Ga0157379_10116988 | |||
| 2259 | Ga0157379_10237982 | |||
| 2260 | Ga0157376_10001398 | |||
| 2261 | Ga0157376_10299931 | |||
| 2262 | Ga0157376_10388814 | |||
| 2263 | Ga0182006_1075373 | |||
| 2264 | Ga0197907_10103628 | |||
| 2265 | Ga0197907_10204941 | |||
| 2266 | Ga0197907_10404823 | |||
| 2267 | Ga0197907_10875030 | |||
| 2268 | Ga0206356_10494061 | |||
| 2269 | Ga0206356_10694969 | |||
| 2270 | Ga0206356_11740764 | |||
| 2271 | Ga0206356_11755174 | |||
| 2272 | Ga0206351_10370816 | |||
| 2273 | Ga0206352_10571842 | |||
| 2274 | Ga0206352_10799947 | |||
| 2275 | Ga0206350_10458094 | |||
| 2276 | Ga0206354_10093548 | |||
| 2277 | Ga0206353_10839899 | |||
| 2278 | Ga0206353_11387566 | |||
| 2279 | Ga0224712_10020529 | |||
| 2280 | Ga0224712_10025783 | |||
| 2281 | Ga0224712_10041489 | |||
| 2282 | Ga0224712_10209000 | |||
| 2283 | Ga0207697_10087404 | |||
| 2284 | Ga0207656_10083391 | |||
| 2285 | Ga0207653_10001160 | |||
| 2286 | Ga0207682_10068153 | |||
| 2287 | Ga0207692_10069347 | |||
| 2288 | Ga0207692_10117514 | |||
| 2289 | Ga0207710_10175983 | |||
| 2290 | Ga0207688_10000295 | |||
| 2291 | Ga0207688_10196776 | |||
| 2292 | Ga0207647_10178812 | |||
| 2293 | Ga0207685_10000585 | |||
| 2294 | Ga0207685_10148711 | |||
| 2295 | Ga0207699_10060867 | |||
| 2296 | Ga0207699_10095704 | |||
| 2297 | Ga0207645_10049494 | |||
| 2298 | Ga0207643_10003093 | |||
| 2299 | Ga0207643_10070389 | |||
| 2300 | Ga0207705_10019484 | |||
| 2301 | Ga0207705_10020119 | |||
| 2302 | Ga0207705_10090345 | |||
| 2303 | Ga0207705_10153742 | |||
| 2304 | Ga0207684_10075284 | |||
| 2305 | Ga0207684_10093531 | |||
| 2306 | Ga0207654_10139839 | |||
| 2307 | Ga0207654_10258070 | |||
| 2308 | Ga0207707_10006792 | |||
| 2309 | Ga0207707_10008124 | |||
| 2310 | Ga0207707_10043146 | |||
| 2311 | Ga0207707_10078554 | |||
| 2312 | Ga0207707_10103694 | |||
| 2313 | Ga0207707_10134715 | |||
| 2314 | Ga0207707_10135647 | |||
| 2315 | Ga0207707_10174541 | |||
| 2316 | Ga0207707_10278409 | |||
| 2317 | Ga0207707_10288078 | |||
| 2318 | Ga0207707_10424055 | |||
| 2319 | Ga0207695_10083465 | |||
| 2320 | Ga0207695_10345702 | |||
| 2321 | Ga0207695_10712186 | |||
| 2322 | Ga0207693_10002991 | |||
| 2323 | Ga0207693_10004428 | |||
| 2324 | Ga0207693_10006759 | |||
| 2325 | Ga0207693_10008709 | |||
| 2326 | Ga0207693_10022035 | |||
| 2327 | Ga0207693_10041523 | |||
| 2328 | Ga0207663_10010865 | |||
| 2329 | Ga0207663_10025121 | |||
| 2330 | Ga0207663_10033479 | |||
| 2331 | Ga0207663_10201736 | |||
| 2332 | Ga0207663_10386693 | |||
| 2333 | Ga0207660_10016370 | |||
| 2334 | Ga0207660_10035726 | |||
| 2335 | Ga0207660_10100927 | |||
| 2336 | Ga0207660_10236601 | |||
| 2337 | Ga0207660_10440763 | |||
| 2338 | Ga0207662_10118327 | |||
| 2339 | Ga0207657_10000046 | |||
| 2340 | Ga0207657_10002149 | |||
| 2341 | Ga0207657_10002359 | |||
| 2342 | Ga0207657_10007745 | |||
| 2343 | Ga0207657_10007972 | |||
| 2344 | Ga0207657_10099989 | |||
| 2345 | Ga0207657_10176801 | |||
| 2346 | Ga0207657_10219350 | |||
| 2347 | Ga0207657_10221056 | |||
| 2348 | Ga0207649_10008800 | |||
| 2349 | Ga0207649_10119557 | |||
| 2350 | Ga0207649_10168041 | |||
| 2351 | Ga0207649_10217118 | |||
| 2352 | Ga0207649_10363486 | |||
| 2353 | Ga0207652_10015699 | |||
| 2354 | Ga0207652_10027233 | |||
| 2355 | Ga0207652_10028459 | |||
| 2356 | Ga0207652_10038654 | |||
| 2357 | Ga0207652_10153591 | |||
| 2358 | Ga0207652_10290157 | |||
| 2359 | Ga0207652_10300993 | |||
| 2360 | Ga0207652_10507859 | |||
| 2361 | Ga0207646_10000835 | |||
| 2362 | Ga0207646_10001503 | |||
| 2363 | Ga0207646_10045537 | |||
| 2364 | Ga0207646_10210908 | |||
| 2365 | Ga0207681_10016252 | |||
| 2366 | Ga0207681_10091249 | |||
| 2367 | Ga0207694_10017573 | |||
| 2368 | Ga0207694_10045933 | |||
| 2369 | Ga0207694_10179638 | |||
| 2370 | Ga0207650_10003626 | |||
| 2371 | Ga0207650_10017795 | |||
| 2372 | Ga0207650_10128800 | |||
| 2373 | Ga0207659_10079846 | |||
| 2374 | Ga0207659_10095799 | |||
| 2375 | Ga0207687_10035439 | |||
| 2376 | Ga0207687_10047111 | |||
| 2377 | Ga0207687_10079516 | |||
| 2378 | Ga0207687_10098003 | |||
| 2379 | Ga0207687_10270241 | |||
| 2380 | Ga0207687_10314883 | |||
| 2381 | Ga0207687_10371949 | |||
| 2382 | Ga0207687_10647647 | |||
| 2383 | Ga0207700_10013428 | |||
| 2384 | Ga0207700_10029054 | |||
| 2385 | Ga0207700_10245582 | |||
| 2386 | Ga0207664_10006174 | |||
| 2387 | Ga0207664_10016830 | |||
| 2388 | Ga0207664_10023674 | |||
| 2389 | Ga0207664_10030636 | |||
| 2390 | Ga0207664_10163985 | |||
| 2391 | Ga0207664_10240129 | |||
| 2392 | Ga0207664_10463437 | |||
| 2393 | Ga0207664_10661246 | |||
| 2394 | Ga0207644_10057035 | |||
| 2395 | Ga0207644_10444752 | |||
| 2396 | Ga0207690_10013980 | |||
| 2397 | Ga0207690_10060399 | |||
| 2398 | Ga0207690_10088629 | |||
| 2399 | Ga0207690_10104351 | |||
| 2400 | Ga0207690_10310119 | |||
| 2401 | Ga0207690_10487808 | |||
| 2402 | Ga0207690_10497624 | |||
| 2403 | Ga0207706_10009744 | |||
| 2404 | Ga0207706_10027954 | |||
| 2405 | Ga0207706_10050444 | |||
| 2406 | Ga0207706_10295927 | |||
| 2407 | Ga0207686_10031586 | |||
| 2408 | Ga0207686_10032319 | |||
| 2409 | Ga0207686_10103308 | |||
| 2410 | Ga0207686_10108315 | |||
| 2411 | Ga0207686_10181187 | |||
| 2412 | Ga0207686_10280341 | |||
| 2413 | Ga0207709_10030813 | |||
| 2414 | Ga0207709_10079412 | |||
| 2415 | Ga0207709_10130382 | |||
| 2416 | Ga0207670_10003061 | |||
| 2417 | Ga0207669_10008057 | |||
| 2418 | Ga0207669_10021197 | |||
| 2419 | Ga0207669_10061864 | |||
| 2420 | Ga0207669_10104068 | |||
| 2421 | Ga0207704_10002504 | |||
| 2422 | Ga0207704_10150272 | |||
| 2423 | Ga0207704_10193957 | |||
| 2424 | Ga0207704_10426384 | |||
| 2425 | Ga0207665_10000336 | |||
| 2426 | Ga0207665_10009424 | |||
| 2427 | Ga0207665_10305111 | |||
| 2428 | Ga0207691_10014333 | |||
| 2429 | Ga0207691_10042275 | |||
| 2430 | Ga0207691_10142905 | |||
| 2431 | Ga0207691_10474730 | |||
| 2432 | Ga0207691_10587835 | |||
| 2433 | Ga0207711_10559826 | |||
| 2434 | Ga0207689_10020194 | |||
| 2435 | Ga0207689_10232023 | |||
| 2436 | Ga0207661_10035507 | |||
| 2437 | Ga0207661_10040814 | |||
| 2438 | Ga0207661_10052608 | |||
| 2439 | Ga0207661_10058519 | |||
| 2440 | Ga0207661_10059188 | |||
| 2441 | Ga0207661_10094976 | |||
| 2442 | Ga0207661_10148807 | |||
| 2443 | Ga0207661_10150765 | |||
| 2444 | Ga0207661_10231300 | |||
| 2445 | Ga0207661_10396730 | |||
| 2446 | Ga0207661_10829156 | |||
| 2447 | Ga0207679_10048143 | |||
| 2448 | Ga0207679_10415651 | |||
| 2449 | Ga0207679_10662016 | |||
| 2450 | Ga0207667_10049523 | |||
| 2451 | Ga0207667_10052443 | |||
| 2452 | Ga0207667_10071362 | |||
| 2453 | Ga0207667_10109111 | |||
| 2454 | Ga0207667_10154405 | |||
| 2455 | Ga0207667_10214420 | |||
| 2456 | Ga0207667_10277037 | |||
| 2457 | Ga0207667_10397603 | |||
| 2458 | Ga0207667_10500751 | |||
| 2459 | Ga0207651_10009014 | |||
| 2460 | Ga0207651_10230977 | |||
| 2461 | Ga0207668_10008754 | |||
| 2462 | Ga0207668_10074890 | |||
| 2463 | Ga0207668_10637961 | |||
| 2464 | Ga0207640_10010996 | |||
| 2465 | Ga0207640_10172003 | |||
| 2466 | Ga0207640_10211804 | |||
| 2467 | Ga0207658_10004838 | |||
| 2468 | Ga0207658_10114119 | |||
| 2469 | Ga0207677_10078690 | |||
| 2470 | Ga0207677_10433651 | |||
| 2471 | Ga0207703_10014085 | |||
| 2472 | Ga0207703_10152853 | |||
| 2473 | Ga0207639_10067705 | |||
| 2474 | Ga0207639_10316350 | |||
| 2475 | Ga0207639_10332069 | |||
| 2476 | Ga0207639_10363730 | |||
| 2477 | Ga0207639_10552061 | |||
| 2478 | Ga0207678_10008584 | |||
| 2479 | Ga0207678_10083870 | |||
| 2480 | Ga0207678_10330939 | |||
| 2481 | Ga0207708_10013763 | |||
| 2482 | Ga0207708_10028141 | |||
| 2483 | Ga0207702_10005093 | |||
| 2484 | Ga0207702_10016688 | |||
| 2485 | Ga0207702_10030487 | |||
| 2486 | Ga0207702_10081441 | |||
| 2487 | Ga0207702_10107262 | |||
| 2488 | Ga0207702_10496304 | |||
| 2489 | Ga0207641_10575921 | |||
| 2490 | Ga0207648_10017489 | |||
| 2491 | Ga0207648_10069092 | |||
| 2492 | Ga0207676_10704504 | |||
| 2493 | Ga0207676_11241681 | |||
| 2494 | Ga0207674_10002821 | |||
| 2495 | Ga0207674_10041842 | |||
| 2496 | Ga0207674_10139150 | |||
| 2497 | Ga0207674_10153418 | |||
| 2498 | Ga0207674_10550577 | |||
| 2499 | Ga0207675_100002655 | |||
| 2500 | Ga0207675_100002688 | |||
| 2501 | Ga0207675_100224847 | |||
| 2502 | Ga0207683_10018336 | |||
| 2503 | Ga0207683_10019988 | |||
| 2504 | Ga0207683_10030783 | |||
| 2505 | Ga0207683_10032768 | |||
| 2506 | Ga0207683_10041263 | |||
| 2507 | Ga0207698_10007523 | |||
| 2508 | Ga0207698_10229384 | |||
| 2509 | Ga0207698_10693616 | |||
| 2510 | Ga0207698_10840846 | |||
| 2511 | Ga0207428_10024156 | |||
| 2512 | Ga0207428_10031019 | |||
| 2513 | Ga0207428_10038452 | |||
| 2514 | Ga0207428_10125373 | |||
| 2515 | Ga0207428_10142811 | |||
| 2516 | Ga0207428_10230413 | |||
| 2517 | Ga0268266_10020487 | |||
| 2518 | Ga0268266_10270108 | |||
| 2519 | Ga0268266_10816926 | |||
| 2520 | Ga0268265_10117659 | |||
| 2521 | Ga0268265_10135980 | |||
| 2522 | Ga0268264_10082317 | |||
| 2523 | Ga0265334_10010096 | |||
| 2524 | Ga0265318_10010050 | |||
| 2525 | Ga0265318_10037064 | |||
| 2526 | Ga0265336_10002579 | |||
| 2527 | Ga0265336_10057096 | |||
| 2528 | Ga0265338_10007091 | |||
| 2529 | Ga0265338_10010810 | |||
| 2530 | Ga0265338_10017185 | |||
| 2531 | Ga0265338_10082217 | |||
| 2532 | Ga0265338_10136375 | |||
| 2533 | Ga0265324_10018729 | |||
| 2534 | Ga0265320_10060231 | |||
| 2535 | Ga0265339_10009216 | |||
| 2536 | Ga0265331_10043314 | |||
| 2537 | Ga0265327_10042865 | |||
| 2538 | Ga0265327_10074306 | |||
| 2539 | Ga0307408_100192265 | |||
| 2540 | Ga0265313_10011904 | |||
| 2541 | Ga0265314_10011431 | |||
| 2542 | Ga0307405_10140772 | |||
| 2543 | Ga0307410_10248392 | |||
| 2544 | Ga0307406_10170663 | |||
| 2545 | Ga0307412_10285345 | |||
| 2546 | Ga0307409_100013556 | |||
| 2547 | Ga0307409_100080100 | |||
| 2548 | Ga0307409_100154478 | |||
| 2549 | Ga0307409_100688980 | |||
| 2550 | Ga0307415_100072492 | |||
| 2551 | Ga0316583_10053325 | |||
| 2552 | Ga0373958_0004712 | |||
| 2553 | Ga0373928_0005179 | |||
| 2554 | Ga0373940_0020246 | |||
| 2555 | Ga0373944_0047146 | |||
| 2556 | Ga0373949_0031541 | |||
| 2557 | Ga0373951_0003334 | |||
| 2558 | Ga0373952_0001629 | |||
| 2559 | Ga0373932_0002933 | |||
| 2560 | Ga0373936_0017166 | |||
| 2561 | Ga0373939_0014676 | |||
| 2562 | Ga0373945_0003618 | |||
| 2563 | Ga0373945_0030800 | |||
| 2564 | Ga0373953_0117933 | |||
| 2565 | Ga0373960_0005893 | |||
| 2566 | Ga0373960_0006215 | |||
| 2567 | Ga0373943_0006431 | |||
| 2568 | Ga0373946_0017378 | |||
| 2569 | Ga0373946_0050585 | |||
| 2570 | Ga0373955_0224463 | |||
| 2571 | Ga0373955_0287626 | |||
| 2572 | Ga0373942_0013065 | |||
| 2573 | Ga0373942_0073200 | |||
| 2574 | Ga0373961_0008338 | |||
| 2575 | Ga0373961_0008521 | |||
| 2576 | Ga0373962_0003210 | |||
| 2577 | Ga0316574_0013253 | |||
| 2578 | Ga0373924_0098938 | |||
| 2579 | Ga0373931_0008030 | |||
| 2580 | Ga0373931_0023902 | |||
| 2581 | Ga0373931_0064143 | |||
| 2582 | Ga0373935_0024832 | |||
| 2583 | Ga0373935_0198469 | |||
| 2584 | Ga0373947_0000590 | |||
| 2585 | Ga0373947_0002156 | |||
| 2586 | Ga0373947_0009289 | |||
| 2587 | Ga0373947_0038227 | |||
| 2588 | Ga0373937_0078598 | |||
| 2589 | Ga0373937_0079049 | |||
| 2590 | Ga0373925_0008041 | |||
| 2591 | Ga0373925_0019221 | |||
| 2592 | Ga0395899_0001492 | |||
| 2593 | Ga0395899_0005009 | |||
| 2594 | Ga0395899_0005435 | |||
| 2595 | Ga0395899_0007004 | |||
| 2596 | Ga0395899_0019451 | |||
| 2597 | Ga0395899_0021446 | |||
| 2598 | Ga0395899_0031033 | |||
| 2599 | Ga0395899_0032696 | |||
| 2600 | Ga0395899_0054157 | |||
| 2601 | Ga0395899_0141336 | |||
| 2602 | Ga0395899_0212757 | |||
| 2603 | Ga0395899_0264261 | |||
| 2604 | Ga0395900_0002249 | |||
| 2605 | Ga0395900_0002962 | |||
| 2606 | Ga0395900_0005184 | |||
| 2607 | Ga0395900_0008768 | |||
| 2608 | Ga0395900_0011825 | |||
| 2609 | Ga0395900_0015152 | |||
| 2610 | Ga0395900_0021106 | |||
| 2611 | Ga0395900_0031804 | |||
| 2612 | Ga0395900_0050359 | |||
| 2613 | Ga0395900_0060273 | |||
| 2614 | Ga0395900_0072551 | |||
| 2615 | Ga0395900_0074483 | |||
| 2616 | Ga0395900_0079316 | |||
| 2617 | Ga0395900_0081382 | |||
| 2618 | Ga0395900_0086757 | |||
| 2619 | Ga0395900_0105591 | |||
| 2620 | Ga0395900_0109750 | |||
| 2621 | Ga0395900_0143504 | |||
| 2622 | Ga0395900_0150702 | |||
| 2623 | Ga0395900_0171524 | |||
| 2624 | Ga0395900_0186308 | |||
| 2625 | Ga0395900_0234107 | |||
| 2626 | Ga0395900_0235434 | |||
| 2627 | Ga0395900_0408815 | |||
| 2628 | Ga0395900_0622298 | |||
| 2629 | Ga0395900_0745970 | |||
| 2630 | Ga0395898_0001213 | |||
| 2631 | Ga0395898_0001862 | |||
| 2632 | Ga0395898_0010024 | |||
| 2633 | Ga0395898_0012117 | |||
| 2634 | Ga0395898_0012770 | |||
| 2635 | Ga0395898_0016061 | |||
| 2636 | Ga0395898_0017469 | |||
| 2637 | Ga0395898_0018501 | |||
| 2638 | Ga0395898_0020827 | |||
| 2639 | Ga0395898_0034509 | |||
| 2640 | Ga0395898_0043430 | |||
| 2641 | Ga0395898_0047102 | |||
| 2642 | Ga0395898_0057630 | |||
| 2643 | Ga0395898_0079296 | |||
| 2644 | Ga0395898_0086795 | |||
| 2645 | Ga0395898_0119142 | |||
| 2646 | Ga0395898_0563873 | |||
| 2647 | Ga0395898_0578377 | |||
| 2648 | Ga0395905_0004021 | |||
| 2649 | Ga0395905_0007290 | |||
| 2650 | Ga0395905_0018249 | |||
| 2651 | Ga0395905_0018594 | |||
| 2652 | Ga0395905_0048739 | |||
| 2653 | Ga0395905_0052112 | |||
| 2654 | Ga0395905_0113171 | |||
| 2655 | Ga0395905_0171590 | |||
| 2656 | Ga0395905_0194856 | |||
| 2657 | Ga0395905_0413410 | |||
| 2658 | Ga0395905_0459555 | |||
| 2659 | Ga0395901_0000809 | |||
| 2660 | Ga0395901_0001901 | |||
| 2661 | Ga0395901_0002490 | |||
| 2662 | Ga0395901_0008659 | |||
| 2663 | Ga0395901_0009351 | |||
| 2664 | Ga0395901_0032973 | |||
| 2665 | Ga0395901_0039132 | |||
| 2666 | Ga0395901_0041742 | |||
| 2667 | Ga0395901_0050752 | |||
| 2668 | Ga0395901_0051027 | |||
| 2669 | Ga0395901_0059937 | |||
| 2670 | Ga0395901_0066313 | |||
| 2671 | Ga0395901_0106747 | |||
| 2672 | Ga0395901_0116948 | |||
| 2673 | Ga0395901_0128039 | |||
| 2674 | Ga0395901_0263567 | |||
| 2675 | Ga0395901_0277743 | |||
| 2676 | Ga0395901_0282952 | |||
| 2677 | Ga0395901_0359150 | |||
| 2678 | Ga0395901_0461644 | |||
| 2679 | Ga0395901_0483924 | |||
| 2680 | Ga0395901_0609890 | |||
| 2681 | Ga0242420_004502 | |||
| 2682 | Ga0436365_1254107 | |||
| 2683 | Ga0436360_0528570 | |||
| 2684 | Ga0436363_0737093 | |||
| 2685 | Ga0439439_0005013 | |||
| 2686 | Ga0439461_0003668 | |||
| 2687 | Ga0439461_0004257 | |||
| 2688 | Ga0451793_0630142 | |||
| 2689 | Ga0451800_1364113 | |||
| 2690 | Ga0451807_1292183 | |||
| 2691 | Ga0451839_1137856 | |||
| 2692 | Ga0451847_0357059 | |||
| 2693 | Ga0451853_0212631 | |||
| 2694 | Ga0451853_0402185 | |||
| 2695 | Ga0451853_2653982 | |||
| 2696 | Ga0450905_011737 | |||
| 2697 | Ga0450907_004083 | |||
| 2698 | Ga0450907_020314 | |||
| 2699 | Ga0450910_011683 | |||
| 2700 | Ga0439446_0000185 | |||
| 2701 | Ga0439434_0016341 | |||
| 2702 | Ga0439460_0031843 | |||
| 2703 | Ga0466969_0000388 | |||
| 2704 | Ga0466969_0044191 | |||
| 2705 | Ga0466969_0116144 | |||
| 2706 | Ga0466972_0128669 | |||
| 2707 | Ga0466965_0046401 | |||
| 2708 | Ga0466965_0152181 | |||
| 2709 | Ga0466965_0158190 | |||
| 2710 | Ga0466965_0228553 | |||
| 2711 | Ga0466966_0002834 | |||
| 2712 | Ga0466966_0057272 | |||
| 2713 | Ga0466966_0085742 | |||
| 2714 | Ga0466966_0138822 | |||
| 2715 | Ga0466966_0172378 | |||
| 2716 | Ga0466961_0007905 | |||
| 2717 | Ga0466961_0023641 | |||
| 2718 | Ga0466961_0037806 | |||
| 2719 | Ga0466961_0189443 | |||
| 2720 | Ga0466963_0011013 | |||
| 2721 | Ga0466963_0018103 | |||
| 2722 | Ga0466963_0031898 | |||
| 2723 | Ga0466963_0033265 | |||
| 2724 | Ga0466963_0042077 | |||
| 2725 | Ga0466963_0073846 | |||
| 2726 | Ga0466963_0100887 | |||
| 2727 | Ga0466963_0112053 | |||
| 2728 | Ga0466963_0165973 | |||
| 2729 | Ga0466963_0184360 | |||
| 2730 | Ga0466964_0004468 | |||
| 2731 | Ga0466964_0005246 | |||
| 2732 | Ga0466964_0012091 | |||
| 2733 | Ga0466964_0088629 | |||
| 2734 | Ga0466964_0134568 | |||
| 2735 | Ga0466964_0210372 | |||
| 2736 | Ga0466971_0015252 | |||
| 2737 | Ga0466971_0020720 | |||
| 2738 | Ga0466968_0004580 | |||
| 2739 | Ga0466968_0006008 | |||
| 2740 | Ga0466968_0010497 | |||
| 2741 | Ga0466968_0122035 | |||
| 2742 | Ga0466968_0142788 | |||
| 2743 | Ga0466970_0015670 | |||
| 2744 | Ga0466970_0077391 | |||
| 2745 | Ga0466957_0004248 | |||
| 2746 | Ga0466957_0007431 | |||
| 2747 | Ga0466957_0024815 | |||
| 2748 | Ga0466957_0101147 | |||
| 2749 | Ga0466957_0139420 | |||
| 2750 | Ga0466957_0283966 | |||
| 2751 | Ga0466957_0360383 | |||
| 2752 | Ga0466960_0097361 | |||
| 2753 | Ga0466960_0152349 | |||
| 2754 | Ga0466960_0156814 | |||
| 2755 | Ga0466959_0016642 | |||
| 2756 | Ga0466959_0022152 | |||
| 2757 | Ga0466959_0023743 | |||
| 2758 | Ga0466959_0142155 | |||
| 2759 | Ga0466959_0160187 | |||
| 2760 | Ga0466959_0348847 | |||
| 2761 | Ga0466958_0003870 | |||
| 2762 | Ga0466958_0005189 | |||
| 2763 | Ga0466958_0015930 | |||
| 2764 | Ga0466958_0017408 | |||
| 2765 | Ga0466958_0123610 | |||
| 2766 | Ga0466958_0375681 | |||
| 2767 | Ga0466967_0000179 | |||
| 2768 | Ga0466967_0000656 | |||
| 2769 | Ga0466967_0001283 | |||
| 2770 | Ga0466967_0004521 | |||
| 2771 | Ga0466967_0004681 | |||
| 2772 | Ga0466967_0028066 | |||
| 2773 | Ga0466967_0030515 | |||
| 2774 | Ga0466967_0034259 | |||
| 2775 | Ga0466967_0044519 | |||
| 2776 | Ga0466967_0050109 | |||
| 2777 | Ga0466967_0063731 | |||
| 2778 | Ga0466967_0102426 | |||
| 2779 | Ga0466967_0127577 | |||
| 2780 | Ga0466967_0202110 | |||
| 2781 | Ga0466967_0229568 | |||
| 2782 | Ga0466967_0248872 | |||
| 2783 | Ga0466967_0320110 | |||
| 2784 | Ga0466967_0333892 | |||
| 2785 | Ga0466967_0422071 | |||
| 2786 | Ga0466967_0454692 | |||
| 2787 | Ga0466967_0464655 | |||
| 2788 | Ga0466967_0526083 | |||
| 2789 | Ga0466967_0540734 | |||
| 2790 | Ga0466967_0641939 | |||
| 2791 | Ga0466967_0687005 | |||
| 2792 | Ga0495592_0004809 | |||
| 2793 | Ga0495592_0139641 | |||
| 2794 | Ga0495592_0226588 | |||
| 2795 | Ga0495603_0009387 | |||
| 2796 | Ga0495603_0011343 | |||
| 2797 | Ga0495603_0024368 | |||
| 2798 | Ga0495603_0099225 | |||
| 2799 | Ga0495603_0198893 | |||
| 2800 | Ga0495629_0029124 | |||
| 2801 | Ga0495629_0053152 | |||
| 2802 | Ga0495629_0075375 | |||
| 2803 | Ga0495629_0362804 | |||
| 2804 | Ga0495641_0004261 | |||
| 2805 | Ga0495641_0004552 | |||
| 2806 | Ga0495641_0034632 | |||
| 2807 | Ga0495641_0041124 | |||
| 2808 | Ga0495641_0107765 | |||
| 2809 | Ga0495641_0117542 | |||
| 2810 | Ga0495641_0209208 | |||
| 2811 | Ga0495651_0048218 | |||
| 2812 | Ga0495651_0062960 | |||
| 2813 | Ga0495651_0132325 | |||
| 2814 | Ga0495651_0212894 | |||
| 2815 | Ga0495653_0032638 | |||
| 2816 | Ga0495653_0052203 | |||
| 2817 | Ga0495653_0362986 | |||
| 2818 | Ga0495580_0021561 | |||
| 2819 | Ga0495582_0016397 | |||
| 2820 | Ga0495582_0020921 | |||
| 2821 | Ga0495582_0115484 | |||
| 2822 | Ga0495582_0240061 | |||
| 2823 | Ga0495605_0030222 | |||
| 2824 | Ga0495605_0092944 | |||
| 2825 | Ga0495662_0051678 | |||
| 2826 | Ga0495664_0136923 | |||
| 2827 | Ga0495664_0250254 | |||
| 2828 | Ga0495584_0019339 | |||
| 2829 | Ga0495584_0101788 | |||
| 2830 | Ga0495584_0170043 | |||
| 2831 | Ga0495585_0198884 | |||
| 2832 | Ga0495594_0006747 | |||
| 2833 | Ga0495596_0028494 | |||
| 2834 | Ga0495596_0071261 | |||
| 2835 | Ga0495607_0057044 | |||
| 2836 | Ga0495608_0009760 | |||
| 2837 | Ga0495608_0016338 | |||
| 2838 | Ga0495608_0027278 | |||
| 2839 | Ga0495608_0032676 | |||
| 2840 | Ga0495608_0091243 | |||
| 2841 | Ga0495608_0097849 | |||
| 2842 | Ga0495618_0020745 | |||
| 2843 | Ga0495618_0021960 | |||
| 2844 | Ga0495618_0174993 | |||
| 2845 | Ga0495618_0236200 | |||
| 2846 | Ga0495618_0254979 | |||
| 2847 | Ga0495628_0018631 | |||
| 2848 | Ga0495628_0021733 | |||
| 2849 | Ga0495628_0043819 | |||
| 2850 | Ga0495628_0235254 | |||
| 2851 | Ga0495628_0430949 | |||
| 2852 | Ga0495630_0002368 | |||
| 2853 | Ga0495630_0025512 | |||
| 2854 | Ga0495630_0026574 | |||
| 2855 | Ga0495630_0046074 | |||
| 2856 | Ga0495630_0064270 | |||
| 2857 | Ga0495630_0121028 | |||
| 2858 | Ga0495630_0161302 | |||
| 2859 | Ga0495644_0069197 | |||
| 2860 | Ga0495644_0071726 | |||
| 2861 | Ga0495663_0008382 | |||
| 2862 | Ga0495666_0023225 | |||
| 2863 | Ga0495652_0050425 | |||
| 2864 | Ga0495652_0053385 | |||
| 2865 | Ga0495652_0220663 | |||
| 2866 | Ga0495652_0352895 | |||
| 2867 | Ga0495640_0003223 | |||
| 2868 | Ga0495587_0101164 | |||
| 2869 | Ga0495598_0050459 | |||
| 2870 | Ga0495609_0038387 | |||
| 2871 | Ga0495645_0026587 | |||
| 2872 | Ga0495645_0263870 | |||
| 2873 | Ga0495667_0005166 | |||
| 2874 | Ga0495667_0005794 | |||
| 2875 | Ga0495667_0015042 | |||
| 2876 | Ga0495667_0047038 | |||
| 2877 | Ga0495667_0064462 | |||
| 2878 | Ga0495667_0072299 | |||
| 2879 | Ga0495667_0090116 | |||
| 2880 | Ga0495656_0018093 | |||
| 2881 | Ga0495656_0074891 | |||
| 2882 | Ga0495656_0306226 | |||
| 2883 | Ga0495634_0029419 | |||
| 2884 | Ga0495634_0140823 | |||
| 2885 | Ga0495634_0214500 | |||
| 2886 | Ga0495635_0063485 | |||
| 2887 | Ga0495635_0102663 | |||
| 2888 | Ga0495635_0142434 | |||
| 2889 | Ga0495659_0040113 | |||
| 2890 | Ga0495588_0001498 | |||
| 2891 | Ga0495588_0059613 | |||
| 2892 | Ga0495588_0112700 | |||
| 2893 | Ga0495588_0162451 | |||
| 2894 | Ga0495657_0014645 | |||
| 2895 | Ga0495657_0021973 | |||
| 2896 | Ga0495657_0029620 | |||
| 2897 | Ga0495657_0077532 | |||
| 2898 | Ga0495657_0163961 | |||
| 2899 | Ga0495599_0035987 | |||
| 2900 | Ga0495599_0040203 | |||
| 2901 | Ga0495599_0230653 | |||
| 2902 | Ga0495646_0065653 | |||
| 2903 | Ga0495647_0062961 | |||
| 2904 | Ga0495647_0225809 | |||
| 2905 | Ga0495658_0038859 | |||
| 2906 | Ga0495658_0082123 | |||
| 2907 | Ga0495658_0131448 | |||
| 2908 | Ga0495669_0053379 | |||
| 2909 | Ga0495613_0013348 | |||
| 2910 | Ga0495613_0060400 | |||
| 2911 | Ga0495613_0076521 | |||
| 2912 | Ga0495613_0251403 | |||
| 2913 | Ga0495613_0397206 | |||
| 2914 | Ga0495613_0465385 | |||
| 2915 | Ga0495613_0506700 | |||
| 2916 | Ga0495624_0028280 | |||
| 2917 | Ga0495624_0238841 | |||
| 2918 | Ga0495589_0007869 | |||
| 2919 | Ga0495589_0030930 | |||
| 2920 | Ga0495600_0059332 | |||
| 2921 | Ga0495581_0098473 | |||
| 2922 | Ga0495581_0376020 | |||
| 2923 | Ga0495604_0034480 | |||
| 2924 | Ga0495604_0042806 | |||
| 2925 | Ga0495604_0043274 | |||
| 2926 | Ga0495604_0187013 | |||
| 2927 | Ga0495604_0203778 | |||
| 2928 | Ga0495674_0004451 | |||
| 2929 | Ga0495674_0025185 | |||
| 2930 | Ga0495674_0043481 | |||
| 2931 | Ga0495674_0055289 | |||
| 2932 | Ga0495674_0094283 | |||
| 2933 | Ga0495674_0255651 | |||
| 2934 | Ga0495676_0003895 | |||
| 2935 | Ga0495676_0032039 | |||
| 2936 | Ga0495676_0039920 | |||
| 2937 | Ga0495676_0072884 | |||
| 2938 | Ga0495676_0137106 | |||
| 2939 | Ga0495676_0178386 | |||
| 2940 | Ga0495676_0225777 | |||
| 2941 | Ga0495680_0005919 | |||
| 2942 | Ga0495680_0006645 | |||
| 2943 | Ga0495680_0019953 | |||
| 2944 | Ga0495680_0280071 | |||
| 2945 | Ga0495680_0384996 | |||
| 2946 | Ga0495675_0029801 | |||
| 2947 | Ga0495675_0034489 | |||
| 2948 | Ga0495675_0223398 | |||
| 2949 | Ga0495675_0293943 | |||
| 2950 | Ga0495684_0008847 | |||
| 2951 | Ga0495684_0049103 | |||
| 2952 | Ga0495593_0231269 | |||
| 2953 | Ga0495602_0058823 | |||
| 2954 | Ga0495602_0107769 | |||
| 2955 | Ga0495602_0198738 | |||
| 2956 | Ga0495602_0213287 | |||
| 2957 | Ga0495602_0215437 | |||
| 2958 | Ga0496100_0005439 | |||
| 2959 | Ga0496100_0017682 | |||
| 2960 | Ga0496100_0019060 | |||
| 2961 | Ga0496100_0031408 | |||
| 2962 | Ga0496100_0066748 | |||
| 2963 | Ga0496100_0372367 | |||
| 2964 | Ga0496101_0005268 | |||
| 2965 | Ga0496101_0011606 | |||
| 2966 | Ga0496101_0017750 | |||
| 2967 | Ga0496101_0020243 | |||
| 2968 | Ga0496101_0021389 | |||
| 2969 | Ga0496101_0068341 | |||
| 2970 | Ga0496101_0122910 | |||
| 2971 | Ga0496101_0209056 | |||
| 2972 | Ga0496101_0264247 | |||
| 2973 | Ga0496102_0005991 | |||
| 2974 | Ga0496102_0019028 | |||
| 2975 | Ga0496102_0019449 | |||
| 2976 | Ga0496102_0029581 | |||
| 2977 | Ga0496102_0069500 | |||
| 2978 | Ga0496102_0096187 | |||
| 2979 | Ga0496102_0235577 | |||
| 2980 | Ga0496102_0257663 | |||
| 2981 | Ga0496102_0542232 | |||
| 2982 | Ga0496103_0013174 | |||
| 2983 | Ga0496103_0039044 | |||
| 2984 | Ga0496103_0066965 | |||
| 2985 | Ga0496103_0090187 | |||
| 2986 | Ga0496104_0001293 | |||
| 2987 | Ga0496104_0011990 | |||
| 2988 | Ga0496104_0015894 | |||
| 2989 | Ga0496104_0020926 | |||
| 2990 | Ga0496104_0039608 | |||
| 2991 | Ga0496104_0086788 | |||
| 2992 | Ga0496104_0087742 | |||
| 2993 | Ga0496104_0104059 | |||
| 2994 | Ga0496104_0191235 | |||
| 2995 | Ga0496104_0416726 | |||
| 2996 | Ga0496104_0421615 | |||
| 2997 | Ga0496104_0923534 | |||
| 2998 | Ga0496105_0001494 | |||
| 2999 | Ga0496105_0002671 | |||
| 3000 | Ga0496105_0008290 | |||
| 3001 | Ga0496105_0025878 | |||
| 3002 | Ga0496105_0039885 | |||
| 3003 | Ga0496105_0040125 | |||
| 3004 | Ga0496105_0044664 | |||
| 3005 | Ga0496105_0108697 | |||
| 3006 | Ga0496105_0113952 | |||
| 3007 | Ga0496105_0179752 | |||
| 3008 | Ga0496105_0351953 | |||
| 3009 | Ga0496105_0518868 | |||
| 3010 | Ga0496106_0003662 | |||
| 3011 | Ga0496106_0012801 | |||
| 3012 | Ga0496106_0031455 | |||
| 3013 | Ga0496106_0034897 | |||
| 3014 | Ga0496106_0042412 | |||
| 3015 | Ga0496106_0051599 | |||
| 3016 | Ga0496106_0131237 | |||
| 3017 | Ga0496106_0300703 | |||
| 3018 | Ga0496107_0005800 | |||
| 3019 | Ga0496107_0017385 | |||
| 3020 | Ga0496107_0019319 | |||
| 3021 | Ga0496107_0019681 | |||
| 3022 | Ga0496107_0024006 | |||
| 3023 | Ga0496107_0036112 | |||
| 3024 | Ga0496107_0109827 | |||
| 3025 | Ga0496107_0220230 | |||
| 3026 | Ga0496107_0226220 | |||
| 3027 | Ga0496108_0001327 | |||
| 3028 | Ga0496108_0006069 | |||
| 3029 | Ga0496108_0006797 | |||
| 3030 | Ga0496108_0008941 | |||
| 3031 | Ga0496108_0018951 | |||
| 3032 | Ga0496108_0027773 | |||
| 3033 | Ga0496108_0063353 | |||
| 3034 | Ga0496108_0128616 | |||
| 3035 | Ga0496108_0513582 | |||
| 3036 | Ga0496109_0002789 | |||
| 3037 | Ga0496109_0003215 | |||
| 3038 | Ga0496109_0004424 | |||
| 3039 | Ga0496109_0006043 | |||
| 3040 | Ga0496109_0013816 | |||
| 3041 | Ga0496109_0021106 | |||
| 3042 | Ga0496109_0027854 | |||
| 3043 | Ga0496109_0031229 | |||
| 3044 | Ga0496109_0037658 | |||
| 3045 | Ga0496109_0069840 | |||
| 3046 | Ga0496109_0076574 | |||
| 3047 | Ga0496109_0125038 | |||
| 3048 | Ga0496109_0144970 | |||
| 3049 | Ga0496109_0278516 | |||
| 3050 | Ga0496109_0311327 | |||
| 3051 | Ga0496109_0478323 | |||
| 3052 | Ga0496109_0497008 | |||
| 3053 | Ga0496109_0644829 | |||
| 3054 | Ga0496110_0000607 | |||
| 3055 | Ga0496110_0000686 | |||
| 3056 | Ga0496110_0001231 | |||
| 3057 | Ga0496110_0005411 | |||
| 3058 | Ga0496110_0015765 | |||
| 3059 | Ga0496110_0023470 | |||
| 3060 | Ga0496110_0047139 | |||
| 3061 | Ga0496110_0073042 | |||
| 3062 | Ga0496110_0098293 | |||
| 3063 | Ga0496110_0104580 | |||
| 3064 | Ga0496110_0179573 | |||
| 3065 | Ga0496110_0246488 | |||
| 3066 | Ga0496110_0255102 | |||
| 3067 | Ga0496110_0403969 | |||
| 3068 | Ga0496110_0409782 | |||
| 3069 | Ga0496110_0517893 | |||
| 3070 | Ga0496110_0750656 | |||
| 3071 | Ga0496111_0000665 | |||
| 3072 | Ga0496111_0003353 | |||
| 3073 | Ga0496111_0006770 | |||
| 3074 | Ga0496111_0015441 | |||
| 3075 | Ga0496111_0036332 | |||
| 3076 | Ga0496111_0043351 | |||
| 3077 | Ga0496111_0053709 | |||
| 3078 | Ga0496111_0076589 | |||
| 3079 | Ga0496111_0117752 | |||
| 3080 | Ga0496111_0146702 | |||
| 3081 | Ga0496111_0210087 | |||
| 3082 | Ga0496111_0247549 | |||
| 3083 | Ga0496111_0313075 | |||
| 3084 | Ga0496111_0323154 | |||
| 3085 | Ga0496111_0528199 | |||
| 3086 | Ga0496112_0002974 | |||
| 3087 | Ga0496112_0009862 | |||
| 3088 | Ga0496112_0039231 | |||
| 3089 | Ga0496112_0105593 | |||
| 3090 | Ga0496112_0141876 | |||
| 3091 | Ga0496112_0195725 | |||
| 3092 | Ga0496112_0220191 | |||
| 3093 | Ga0496112_0263617 | |||
| 3094 | Ga0496112_0279136 | |||
| 3095 | Ga0496112_0349450 | |||
| 3096 | Ga0496112_0501650 | |||
| 3097 | Ga0496112_0828601 | |||
| 3098 | Ga0496113_0030491 | |||
| 3099 | Ga0496113_0043660 | |||
| 3100 | Ga0496113_0102989 | |||
| 3101 | Ga0496113_0120019 | |||
| 3102 | Ga0496114_0001676 | |||
| 3103 | Ga0496114_0002457 | |||
| 3104 | Ga0496114_0003730 | |||
| 3105 | Ga0496114_0004356 | |||
| 3106 | Ga0496114_0007678 | |||
| 3107 | Ga0496114_0009413 | |||
| 3108 | Ga0496114_0012976 | |||
| 3109 | Ga0496114_0027912 | |||
| 3110 | Ga0496114_0038680 | |||
| 3111 | Ga0496114_0039785 | |||
| 3112 | Ga0496114_0057985 | |||
| 3113 | Ga0496114_0058587 | |||
| 3114 | Ga0496114_0063704 | |||
| 3115 | Ga0496114_0067784 | |||
| 3116 | Ga0496114_0116204 | |||
| 3117 | Ga0496114_0191134 | |||
| 3118 | Ga0496114_0321617 | |||
| 3119 | Ga0496114_0373626 | |||
| 3120 | Ga0496115_0000961 | |||
| 3121 | Ga0496115_0005151 | |||
| 3122 | Ga0496115_0018520 | |||
| 3123 | Ga0496115_0046954 | |||
| 3124 | Ga0496115_0086635 | |||
| 3125 | Ga0496115_0089319 | |||
| 3126 | Ga0496115_0113751 | |||
| 3127 | Ga0496115_0147712 | |||
| 3128 | Ga0496115_0160846 | |||
| 3129 | Ga0496115_0229858 | |||
| 3130 | Ga0496115_0232782 | |||
| 3131 | Ga0496115_0249221 | |||
| 3132 | Ga0496115_0255454 | |||
| 3133 | Ga0496115_0277100 | |||
| 3134 | Ga0501031_0000345 | |||
| 3135 | Ga0501031_0000615 | |||
| 3136 | Ga0501031_0012796 | |||
| 3137 | Ga0501031_0018104 | |||
| 3138 | Ga0501031_0065546 | |||
| 3139 | Ga0501031_0127793 | |||
| 3140 | Ga0501032_0016904 | |||
| 3141 | Ga0501032_0050972 | |||
| 3142 | Ga0501032_0077747 | |||
| 3143 | Ga0501033_0014528 | |||
| 3144 | Ga0501033_0021157 | |||
| 3145 | Ga0501033_0050866 | |||
| 3146 | Ga0501033_0072389 | |||
| 3147 | Ga0501034_0046410 | |||
| 3148 | Ga0501034_0079909 | |||
| 3149 | Ga0501034_0109014 | |||
| 3150 | Ga0501034_0319457 | |||
| 3151 | Ga0501036_0000798 | |||
| 3152 | Ga0501036_0005203 | |||
| 3153 | Ga0501036_0010111 | |||
| 3154 | Ga0501036_0012670 | |||
| 3155 | Ga0501036_0016694 | |||
| 3156 | Ga0501036_0071310 | |||
| 3157 | Ga0501036_0078014 | |||
| 3158 | Ga0501036_0100066 | |||
| 3159 | Ga0501036_0165946 | |||
| 3160 | Ga0501036_0197560 | |||
| 3161 | Ga0501036_0203132 | |||
| 3162 | Ga0501036_0269707 | |||
| 3163 | Ga0501037_0003886 | |||
| 3164 | Ga0501037_0036273 | |||
| 3165 | Ga0501037_0184176 | |||
| 3166 | Ga0501037_0279147 | |||
| 3167 | Ga0501037_0293183 | |||
| 3168 | Ga0501038_0013992 | |||
| 3169 | Ga0501038_0018352 | |||
| 3170 | Ga0501038_0018769 | |||
| 3171 | Ga0501038_0064564 | |||
| 3172 | Ga0501038_0214425 | |||
| 3173 | Ga0501038_0238833 | |||
| 3174 | Ga0501038_0361244 | |||
| 3175 | Ga0501039_0003205 | |||
| 3176 | Ga0501039_0011836 | |||
| 3177 | Ga0501039_0016268 | |||
| 3178 | Ga0501039_0017988 | |||
| 3179 | Ga0501039_0019591 | |||
| 3180 | Ga0501039_0034884 | |||
| 3181 | Ga0501039_0248020 | |||
| 3182 | Ga0501040_0001055 | |||
| 3183 | Ga0501040_0003253 | |||
| 3184 | Ga0501040_0004545 | |||
| 3185 | Ga0501040_0010284 | |||
| 3186 | Ga0501040_0022657 | |||
| 3187 | Ga0501040_0045329 | |||
| 3188 | Ga0501040_0095280 | |||
| 3189 | Ga0501040_0134878 | |||
| 3190 | Ga0501040_0170309 | |||
| 3191 | Ga0501040_0224265 | |||
| 3192 | Ga0501040_0270275 | |||
| 3193 | Ga0501041_0004444 | |||
| 3194 | Ga0501041_0006237 | |||
| 3195 | Ga0501041_0008151 | |||
| 3196 | Ga0501041_0009854 | |||
| 3197 | Ga0501041_0022782 | |||
| 3198 | Ga0501041_0095737 | |||
| 3199 | Ga0501041_0135402 | |||
| 3200 | Ga0501041_0144277 | |||
| 3201 | Ga0501041_0211776 | |||
| 3202 | Ga0501041_0215761 | |||
| 3203 | Ga0501041_0255727 | |||
| 3204 | Ga0501042_0007552 | |||
| 3205 | Ga0501042_0013615 | |||
| 3206 | Ga0501042_0020443 | |||
| 3207 | Ga0501042_0040672 | |||
| 3208 | Ga0501042_0098871 | |||
| 3209 | Ga0501042_0103151 | |||
| 3210 | Ga0501042_0247212 | |||
| 3211 | Ga0501043_0007147 | |||
| 3212 | Ga0501043_0024169 | |||
| 3213 | Ga0501043_0031763 | |||
| 3214 | Ga0501043_0118461 | |||
| 3215 | Ga0501043_0614931 | |||
| 3216 | Ga0501046_0000652 | |||
| 3217 | Ga0501046_0004105 | |||
| 3218 | Ga0501046_0013964 | |||
| 3219 | Ga0501046_0019876 | |||
| 3220 | Ga0501046_0115969 | |||
| 3221 | Ga0501047_0047759 | |||
| 3222 | Ga0501047_0094945 | |||
| 3223 | Ga0501047_0169719 | |||
| 3224 | Ga0501047_0446711 | |||
| 3225 | Ga0501048_0006478 | |||
| 3226 | Ga0501048_0007579 | |||
| 3227 | Ga0501048_0013192 | |||
| 3228 | Ga0501048_0028649 | |||
| 3229 | Ga0501048_0047994 | |||
| 3230 | Ga0501048_0071298 | |||
| 3231 | Ga0501048_0076880 | |||
| 3232 | Ga0501067_0019442 | |||
| 3233 | Ga0501067_0020400 | |||
| 3234 | Ga0501067_0024772 | |||
| 3235 | Ga0501067_0093019 | |||
| 3236 | Ga0501067_0136611 | |||
| 3237 | Ga0501067_0155882 | |||
| 3238 | Ga0501068_0001869 | |||
| 3239 | Ga0501068_0004858 | |||
| 3240 | Ga0501068_0022285 | |||
| 3241 | Ga0501068_0046973 | |||
| 3242 | Ga0501068_0058960 | |||
| 3243 | Ga0501068_0068606 | |||
| 3244 | Ga0501068_0072779 | |||
| 3245 | Ga0501068_0204177 | |||
| 3246 | Ga0501068_0208105 | |||
| 3247 | Ga0501068_0442817 | |||
| 3248 | Ga0501069_0001257 | |||
| 3249 | Ga0501069_0003809 | |||
| 3250 | Ga0501069_0007494 | |||
| 3251 | Ga0501069_0011745 | |||
| 3252 | Ga0501069_0024983 | |||
| 3253 | Ga0501069_0049781 | |||
| 3254 | Ga0501069_0052474 | |||
| 3255 | Ga0501069_0135988 | |||
| 3256 | Ga0501070_0001079 | |||
| 3257 | Ga0501070_0013182 | |||
| 3258 | Ga0501070_0016785 | |||
| 3259 | Ga0501070_0022709 | |||
| 3260 | Ga0501070_0030096 | |||
| 3261 | Ga0501070_0049374 | |||
| 3262 | Ga0501070_0077181 | |||
| 3263 | Ga0501070_0123561 | |||
| 3264 | Ga0501070_0142056 | |||
| 3265 | Ga0501070_0142571 | |||
| 3266 | Ga0501070_0309516 | |||
| 3267 | Ga0501071_0001467 | |||
| 3268 | Ga0501071_0009780 | |||
| 3269 | Ga0501071_0061155 | |||
| 3270 | Ga0501071_0062543 | |||
| 3271 | Ga0501071_0063452 | |||
| 3272 | Ga0501071_0079746 | |||
| 3273 | Ga0501071_0091331 | |||
| 3274 | Ga0501071_0098447 | |||
| 3275 | Ga0501071_0103912 | |||
| 3276 | Ga0501071_0123405 | |||
| 3277 | Ga0501071_0596546 | |||
| 3278 | Ga0501072_0001288 | |||
| 3279 | Ga0501072_0007841 | |||
| 3280 | Ga0501072_0015236 | |||
| 3281 | Ga0501072_0059835 | |||
| 3282 | Ga0501072_0169463 | |||
| 3283 | Ga0501072_0185138 | |||
| 3284 | Ga0501072_0257448 | |||
| 3285 | Ga0501072_0349146 | |||
| 3286 | Ga0501073_0006605 | |||
| 3287 | Ga0501073_0036395 | |||
| 3288 | Ga0501073_0157058 | |||
| 3289 | Ga0501074_0005057 | |||
| 3290 | Ga0501074_0012591 | |||
| 3291 | Ga0501074_0015529 | |||
| 3292 | Ga0501074_0016417 | |||
| 3293 | Ga0501074_0019711 | |||
| 3294 | Ga0501074_0032686 | |||
| 3295 | Ga0501074_0044906 | |||
| 3296 | Ga0501074_0170294 | |||
| 3297 | Ga0501074_0288142 | |||
| 3298 | Ga0501074_0301423 | |||
| 3299 | Ga0501075_0001411 | |||
| 3300 | Ga0501075_0007062 | |||
| 3301 | Ga0501075_0007654 | |||
| 3302 | Ga0501075_0017206 | |||
| 3303 | Ga0501075_0035506 | |||
| 3304 | Ga0501075_0041275 | |||
| 3305 | Ga0501075_0080937 | |||
| 3306 | Ga0501075_0106072 | |||
| 3307 | Ga0501075_0378412 | |||
| 3308 | Ga0501075_0467596 | |||
| 3309 | Ga0501076_0000812 | |||
| 3310 | Ga0501076_0002379 | |||
| 3311 | Ga0501076_0022035 | |||
| 3312 | Ga0501076_0024142 | |||
| 3313 | Ga0501076_0037773 | |||
| 3314 | Ga0501076_0044812 | |||
| 3315 | Ga0501076_0189506 | |||
| 3316 | Ga0501076_0204749 | |||
| 3317 | Ga0501076_0254768 | |||
| 3318 | Ga0501076_0267305 | |||
| 3319 | Ga0501076_0272459 | |||
| 3320 | Ga0501076_0342297 | |||
| 3321 | Ga0501076_0438541 | |||
| 3322 | Ga0501077_0000499 | |||
| 3323 | Ga0501077_0003790 | |||
| 3324 | Ga0501077_0004497 | |||
| 3325 | Ga0501077_0004745 | |||
| 3326 | Ga0501077_0014155 | |||
| 3327 | Ga0501077_0020724 | |||
| 3328 | Ga0501077_0052671 | |||
| 3329 | Ga0501077_0054742 | |||
| 3330 | Ga0501077_0078011 | |||
| 3331 | Ga0501077_0115274 | |||
| 3332 | Ga0501077_0286431 | |||
| 3333 | Ga0501079_0000803 | |||
| 3334 | Ga0501079_0010238 | |||
| 3335 | Ga0501079_0016932 | |||
| 3336 | Ga0501079_0018380 | |||
| 3337 | Ga0501079_0033804 | |||
| 3338 | Ga0501079_0045496 | |||
| 3339 | Ga0501079_0054055 | |||
| 3340 | Ga0501079_0074562 | |||
| 3341 | Ga0501079_0141918 | |||
| 3342 | Ga0501079_0247931 | |||
| 3343 | Ga0501079_0417116 | |||
| 3344 | Ga0501079_0545740 | |||
| 3345 | Ga0501080_0003048 | |||
| 3346 | Ga0501080_0005883 | |||
| 3347 | Ga0501080_0009672 | |||
| 3348 | Ga0501080_0010704 | |||
| 3349 | Ga0501080_0039743 | |||
| 3350 | Ga0501080_0046497 | |||
| 3351 | Ga0501080_0065049 | |||
| 3352 | Ga0501080_0081348 | |||
| 3353 | Ga0501080_0202432 | |||
| 3354 | Ga0501080_0360520 | |||
| 3355 | Ga0501080_0448489 | |||
| 3356 | Ga0501081_0010433 | |||
| 3357 | Ga0501081_0010461 | |||
| 3358 | Ga0501081_0134977 | |||
| 3359 | Ga0501081_0199805 | |||
| 3360 | Ga0501081_0250287 | |||
| 3361 | Ga0501083_0001262 | |||
| 3362 | Ga0501083_0008045 | |||
| 3363 | Ga0501083_0008383 | |||
| 3364 | Ga0501083_0013676 | |||
| 3365 | Ga0501083_0081982 | |||
| 3366 | Ga0501083_0093101 | |||
| 3367 | Ga0501083_0146467 | |||
| 3368 | Ga0501083_0165411 | |||
| 3369 | Ga0501035_0006890 | |||
| 3370 | Ga0501035_0014173 | |||
| 3371 | Ga0501035_0087847 | |||
| 3372 | Ga0501035_0109683 | |||
| 3373 | Ga0501035_0207599 | |||
| 3374 | Ga0501044_0043798 | |||
| 3375 | Ga0501044_0049698 | |||
| 3376 | Ga0501044_0067848 | |||
| 3377 | Ga0501044_0388080 | |||
| 3378 | Ga0501045_0004392 | |||
| 3379 | Ga0501045_0005064 | |||
| 3380 | Ga0501045_0018778 | |||
| 3381 | Ga0501045_0023088 | |||
| 3382 | Ga0501045_0032796 | |||
| 3383 | Ga0501045_0072610 | |||
| 3384 | Ga0501045_0126160 | |||
| 3385 | Ga0501045_0138710 | |||
| 3386 | nmdc:mga03n38_101905_c1 | |||
| 3387 | nmdc:mga00v17_240143_c1 | |||
| 3388 | nmdc:mga0yw44_257714_c1 | |||
| 3389 | nmdc:mga06z11_284480_c1 | |||
| 3390 | nmdc:mga05p37_101073_c1 | |||
| 3391 | nmdc:mga05p37_1092092_c1 | |||
| 3392 | nmdc:mga05p37_133731_c1 | |||
| 3393 | nmdc:mga05p37_1560_c1 | |||
| 3394 | nmdc:mga05p37_162922_c1 | |||
| 3395 | nmdc:mga05p37_206607_c1 | |||
| 3396 | nmdc:mga05p37_251987_c1 | |||
| 3397 | nmdc:mga05p37_41002_c1 | |||
| 3398 | nmdc:mga05p37_48042_c1 | |||
| 3399 | nmdc:mga05p37_493713_c1 | |||
| 3400 | nmdc:mga05p37_97853_c1 | |||
| 3401 | nmdc:mga09592_49260_c1 | |||
| 3402 | nmdc:mga09592_629_c3 | |||
| 3403 | nmdc:mga09592_77520_c1 | |||
| 3404 | nmdc:mga0qj67_30247_c1 | |||
| 3405 | nmdc:mga06r32_141265_c1 | |||
| 3406 | nmdc:mga06r32_1948_c1 | |||
| 3407 | nmdc:mga08y16_13610_c1 | |||
| 3408 | nmdc:mga08y16_174258_c1 | |||
| 3409 | nmdc:mga08y16_35984_c1 | |||
| 3410 | nmdc:mga08y16_569620_c1 | |||
| 3411 | nmdc:mga08y16_8316_c1 | |||
| 3412 | nmdc:mga08y16_97894_c1 | |||
| 3413 | nmdc:mga0n895_1537_c1 | |||
| 3414 | nmdc:mga0n895_179483_c1 | |||
| 3415 | nmdc:mga0n895_240067_c1 | |||
| 3416 | nmdc:mga0n895_406044_c1 | |||
| 3417 | nmdc:mga0n895_428467_c1 | |||
| 3418 | nmdc:mga0n895_55813_c1 | |||
| 3419 | nmdc:mga0rr50_1170_c1 | |||
| 3420 | nmdc:mga0rr50_180830_c1 | |||
| 3421 | nmdc:mga0rr50_2130_c1 | |||
| 3422 | nmdc:mga0rr50_227647_c1 | |||
| 3423 | nmdc:mga0rr50_42090_c1 | |||
| 3424 | nmdc:mga0rr50_74002_c1 | |||
| 3425 | nmdc:mga08x19_101312_c1 | |||
| 3426 | nmdc:mga08x19_135960_c1 | |||
| 3427 | nmdc:mga08x19_4011_c1 | |||
| 3428 | nmdc:mga08x19_6462_c1 | |||
| 3429 | nmdc:mga08x19_69986_c1 | |||
| 3430 | nmdc:mga08x19_72831_c1 | |||
| 3431 | nmdc:mga0a205_108307_c1 | |||
| 3432 | nmdc:mga0a205_12007_c1 | |||
| 3433 | nmdc:mga0a205_120607_c1 | |||
| 3434 | nmdc:mga0a205_143589_c1 | |||
| 3435 | nmdc:mga0a205_202153_c1 | |||
| 3436 | nmdc:mga0a205_22203_c1 | |||
| 3437 | nmdc:mga0a205_321961_c1 | |||
| 3438 | nmdc:mga0a205_734803_c1 | |||
| 3439 | nmdc:mga0a205_98752_c1 | |||
| 3440 | Ga0495601_0020058 | |||
| 3441 | Ga0495601_0028098 | |||
| 3442 | Ga0495601_0045737 | |||
| 3443 | Ga0495601_0051205 | |||
| 3444 | Ga0495601_0125400 | |||
| 3445 | Ga0495612_0017122 | |||
| 3446 | Ga0495612_0128100 | |||
| 3447 | Ga0495595_0019166 | |||
| 3448 | Ga0495595_0032162 | |||
| 3449 | Ga0495595_0164755 | |||
| 3450 | Ga0495619_0014992 | |||
| 3451 | Ga0495619_0034422 | |||
| 3452 | Ga0495619_0058661 | |||
| 3453 | Ga0495619_0071902 | |||
| 3454 | Ga0501084_0005692 | |||
| 3455 | Ga0501084_0015481 | |||
| 3456 | Ga0501084_0024209 | |||
| 3457 | Ga0501084_0031104 | |||
| 3458 | Ga0501084_0031839 | |||
| 3459 | Ga0501084_0034448 | |||
| 3460 | Ga0501084_0040892 | |||
| 3461 | Ga0501084_0068454 | |||
| 3462 | Ga0501084_0074550 | |||
| 3463 | Ga0501084_0163222 | |||
| 3464 | Ga0501084_0172197 | |||
| 3465 | Ga0501084_0180909 | |||
| 3466 | Ga0501084_0203114 | |||
| 3467 | Ga0501084_0496632 | |||
| 3468 | Ga0501084_0563734 | |||
| 3469 | Ga0590071_008630 | |||
| 3470 | Ga0590071_021250 | |||
| 3471 | Ga0590075_007204 | |||
| 3472 | Ga0590075_012428 | |||
| 3473 | Ga0590077_023368 | |||
| 3474 | Ga0501082_0001765 | |||
| 3475 | Ga0501082_0003599 | |||
| 3476 | Ga0501082_0003644 | |||
| 3477 | Ga0501082_0027247 | |||
| 3478 | Ga0501082_0036967 | |||
| 3479 | Ga0501082_0088482 | |||
| 3480 | Ga0501082_0098416 | |||
| 3481 | Ga0501082_0120479 | |||
| 3482 | Ga0501082_0202593 | |||
| 3483 | Ga0501082_0445868 | |||
| 3484 | Ga0501082_0676243 | |||
| 3485 | Ga0466962_0001252 | |||
| 3486 | Ga0466962_0006223 | |||
| 3487 | Ga0466962_0061799 | |||
| 3488 | Ga0530510_0004557 | |||
| 3489 | Ga0530510_0012442 | |||
| 3490 | Ga0530510_0070661 | |||
| 3491 | Ga0530510_0076791 | |||
| 3492 | Ga0530510_0078804 | |||
| 3493 | Ga0530510_0089484 | |||
| 3494 | Ga0530510_0116728 | |||
| 3495 | Ga0530510_0147421 | |||
| 3496 | Ga0530510_0148541 | |||
| 3497 | Ga0530510_0252217 | |||
| 3498 | Ga0530510_0320316 | |||
| 3499 | Ga0530510_0397015 | |||
| 3500 | Ga0530510_0454625 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2xmo-assembly2.cif.gz_B | the crystal structure of lmo2642 | 0.832 | 2 | 229 |
| 7qjg-assembly2.cif.gz_B | eed in complex with prc2 allosteric inhibitor compound 6 | 0.8122 | 211 | 240 |
| 7td5-assembly1.cif.gz_B | structure of human prc2-ezh1 containing phosphorylated suz12 | 0.8103 | 211 | 240 |
| 2hyo-assembly1.cif.gz_A-2 | crystal structure of rv0805 n97a mutant | 0.8025 | 2 | 228 |
| 5u5t-assembly1.cif.gz_A | crystal structure of eed in complex with h3k27me3 peptide and 3-(benzo[d][1,3]dioxol-4-ylmethyl)piperidine-1-carboximidamide | 0.8017 | 211 | 240 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q8IM55_21_293_3.60.21.10 | Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases | 0.841 | 1 | 230 | 3.60.21.10 |
| af_Q4DY11_62_216_3.60.21.40 | Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;GpdQ, catalytic alpha/beta sandwich domain | 0.8324 | 2 | 102 | 3.60.21.40 |
| 2dxlA02 | Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;GpdQ, beta-strand dimerisation domain | 0.7981 | 92 | 212 | 3.30.750.180 |
| 2xmoA01 | Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases | 0.7967 | 2 | 229 | 3.60.21.10 |
| 2hypA00 | Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases | 0.7956 | 2 | 228 | 3.60.21.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7X7SN91-F1-model_v4 | Metallophosphoesterase | 0.985 | 3 | 242 |
GO:0016787
|
| AF-A0A7W1FSK3-F1-model_v4 | Metallophosphoesterase | 0.9814 | 2 | 248 |
GO:0016787
|
| AF-A0A3A4V2Q8-F1-model_v4 | Metallophosphoesterase | 0.9801 | 2 | 240 |
GO:0016787
|
| AF-A0A2M6YG29-F1-model_v4 | deleted | 0.9795 | 1 | 200 |
|
| AF-A0A7V9R9N5-F1-model_v4 | Metallophosphoesterase | 0.9781 | 1 | 261 |
GO:0016787
|