F495568

General Info

Members Datasets Scaffolds Average Seq Length
1750 424 3500 264

Family's Representative Sequence

Representative Sequence 3300049592|Ga0501076_0187137|Ga0501076_0187137_16_942
Length 308
Sequence LTKRGGSEPRYAWNDTDSGSASRTVPRVASAPDVAVDCAHVDSAERPFRIAHLSDLHCGGPYFEAALLERAISEINELRPEMVICTGDLTTFGFKHEYQMARQYLDQLDCDAFVVVPGNHDARNVGYVHFEELFGARASVLRKGGVAVVAVDSTEPDLDHGQIGRGRYAWIEEQFAAEPSVFRIFVLHHHLLPVPGTGRERNVVYDAGDAIECLLRARVHLVLSGHKHVPYAWRLENLFVVNTGTVSSLRLRGNTRPCYNVVEINGHHVSISRRHPFHGEERIIQFSTETFAYEKYTGRIEEEVTTRG

Samples

Sample ID Description Type Environment
1 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
2 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
3 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
4 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
5 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
6 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
7 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
8 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
9 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
10 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
11 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
12 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
13 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
14 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
15 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
16 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
17 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
18 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
19 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
20 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
21 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
22 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
23 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
24 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
25 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
26 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
27 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
28 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
29 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
30 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
31 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
32 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
33 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
34 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
35 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
36 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
37 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
38 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
39 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
40 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
41 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
42 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
43 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
44 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
45 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
46 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
47 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
48 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
49 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
50 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
51 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
52 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
53 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
54 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
55 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
56 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
57 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
58 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
59 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
60 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
61 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
62 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
63 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
64 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
65 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
66 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
67 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
68 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
69 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
70 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
71 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
72 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
73 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
74 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
75 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
76 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
77 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
78 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
79 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
80 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
81 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
82 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
83 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
84 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
85 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
86 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
87 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
88 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
89 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
90 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
91 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
92 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
93 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
94 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
95 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
96 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
97 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
98 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
99 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
100 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
101 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
102 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
103 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
104 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
105 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
106 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
107 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
108 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
109 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
110 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
111 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
112 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
113 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
114 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
115 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
116 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
117 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
118 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
119 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
120 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
121 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
122 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
123 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
124 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
125 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
126 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
127 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
128 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
129 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
130 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
131 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
132 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
133 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
134 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
135 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
136 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
137 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
138 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
139 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
140 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
141 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
142 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
143 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
144 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
145 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
146 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
147 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
148 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
213 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
217 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
218 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
219 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
220 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
221 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
222 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
223 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
224 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
225 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
226 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
227 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
228 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
229 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
230 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
231 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
232 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
233 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
234 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
235 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
236 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
237 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
238 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
239 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
240 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
241 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
242 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
243 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
244 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
245 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
246 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
247 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
248 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
249 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
250 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
251 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
252 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
253 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
254 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
255 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
256 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
257 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
258 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
259 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
260 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
261 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
262 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
263 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
264 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
265 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
266 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
267 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
268 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
269 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
270 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
271 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
272 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
273 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
274 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
275 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
276 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
277 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
278 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
279 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
280 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
281 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
282 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
283 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
284 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
285 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
286 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
287 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
288 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
289 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
290 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
291 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
292 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
293 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
294 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
295 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
296 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
297 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
298 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
299 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
300 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
301 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
302 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
303 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
304 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
305 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
306 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
307 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
308 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
309 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
310 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
311 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
312 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
313 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
314 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
315 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
316 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
317 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
318 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
319 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
320 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
321 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
322 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
323 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
324 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
325 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
326 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
327 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
328 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
329 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
330 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
331 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
332 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
333 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
334 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
335 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
336 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
337 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
338 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
339 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
340 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
341 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
342 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
343 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
344 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
345 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
346 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
347 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
348 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
349 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
350 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
351 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
352 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
353 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
354 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
355 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
356 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
357 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
358 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
359 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
360 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
361 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
362 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
363 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
364 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
365 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
366 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
367 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
368 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
369 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
370 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
371 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
372 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
373 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
374 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
375 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
376 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
377 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
378 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
379 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
380 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
381 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
382 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
383 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
384 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
385 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
386 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
387 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
388 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
389 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
390 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
391 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
392 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
393 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
394 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
395 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
396 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
397 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
398 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
399 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
400 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
401 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
402 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
403 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
404 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
405 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
406 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
407 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
408 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
409 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
410 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
411 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
412 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
413 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
414 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
415 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
416 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
417 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
418 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
419 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
420 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
421 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
422 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
423 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
424 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.86
Metatranscriptomes 1.14
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.51
Nodule 0
Rhizoplane 10.23
Rhizosphere 88.86
Stem 0
Stem Tuber 0
Unclassified 14.8

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501076_0187137 3300049592 Bacteria 1689
2 JGI24752J21851_1021037 3300001976 Archaea 851
3 JGI24746J21847_1008797 3300001977 Unclassified 1519
4 JGI24747J21853_1005673 3300001978 Bacteria 1160
5 JGI24739J22299_10023322 3300001989 Unclassified 2189
6 JGI24743J22301_10002240 3300001991 Bacteria 2872
7 JGI24743J22301_10002607 3300001991 Bacteria 2748
8 JGI24743J22301_10003655 3300001991 Bacteria 2451
9 JGI24745J21846_1004648 3300002073 Bacteria 1476
10 JGI24738J21930_10004033 3300002075 Bacteria 3639
11 JGI24738J21930_10014493 3300002075 Bacteria 1690
12 JGI24749J21850_1025441 3300002076 Archaea 843
13 JGI24744J21845_10010971 3300002077 Bacteria 1855
14 JGI24033J26618_1002043 3300002155 Bacteria 2031
15 JGI24742J22300_10006233 3300002244 Bacteria 1968
16 JGI25406J46586_10019731 3300003203 Unclassified 2739
17 JGI25407J50210_10008378 3300003373 Bacteria 2605
18 JGI25407J50210_10009726 3300003373 Unclassified 2441
19 JGI25407J50210_10014112 3300003373 Bacteria 2058
20 Ga0058862_12831764 3300004803 Bacteria 1400
21 Ga0070658_10015054 3300005327 Bacteria 6190
22 Ga0070658_10109397 3300005327 Bacteria 2288
23 Ga0070658_10120539 3300005327 Bacteria 2179
24 Ga0070658_10300504 3300005327 Bacteria 1369
25 Ga0070658_10546937 3300005327 Bacteria 1002
26 Ga0070683_100005201 3300005329 Bacteria 10833
27 Ga0070683_100062646 3300005329 Bacteria 3458
28 Ga0070683_100104634 3300005329 Bacteria 2667
29 Ga0070683_100108866 3300005329 Bacteria 2613
30 Ga0070683_100111274 3300005329 Bacteria 2583
31 Ga0070683_100117347 3300005329 Bacteria 2513
32 Ga0070683_100128256 3300005329 Bacteria 2399
33 Ga0070683_100196314 3300005329 Bacteria 1916
34 Ga0070683_100249141 3300005329 Bacteria 1689
35 Ga0070683_100426171 3300005329 Bacteria 1266
36 Ga0070683_100443193 3300005329 Unclassified 1239
37 Ga0070683_100445597 3300005329 Bacteria 1235
38 Ga0070670_100005716 3300005331 Bacteria 10509
39 Ga0070670_100030695 3300005331 Unclassified 4628
40 Ga0070670_100183745 3300005331 Bacteria 1815
41 Ga0070677_10134271 3300005333 Bacteria 1134
42 Ga0068869_100108886 3300005334 Bacteria 2105
43 Ga0068869_100115911 3300005334 Bacteria 2043
44 Ga0070680_100008148 3300005336 Bacteria 8007
45 Ga0070680_100047408 3300005336 Bacteria 3498
46 Ga0070680_100071038 3300005336 Bacteria 2860
47 Ga0070680_100095265 3300005336 Bacteria 2467
48 Ga0070680_100174114 3300005336 Bacteria 1811
49 Ga0070680_100257630 3300005336 Bacteria 1475
50 Ga0070682_100002738 3300005337 Bacteria 9767
51 Ga0070682_100031525 3300005337 Bacteria 3206
52 Ga0070682_100100688 3300005337 Bacteria 1907
53 Ga0070682_100271625 3300005337 Bacteria 1232
54 Ga0068868_100004372 3300005338 Bacteria 9903
55 Ga0068868_100170304 3300005338 Unclassified 1802
56 Ga0070660_100003874 3300005339 Bacteria 10334
57 Ga0070660_100004655 3300005339 Bacteria 9496
58 Ga0070660_100007596 3300005339 Bacteria 7557
59 Ga0070660_100008326 3300005339 Bacteria 7249
60 Ga0070660_100038835 3300005339 Bacteria 3616
61 Ga0070660_100264926 3300005339 Unclassified 1404
62 Ga0070689_100013807 3300005340 Bacteria 5851
63 Ga0070689_100315260 3300005340 Unclassified 1305
64 Ga0070689_100452693 3300005340 Archaea 1092
65 Ga0070689_100479721 3300005340 Unclassified 1062
66 Ga0070691_10006093 3300005341 Bacteria 5504
67 Ga0070691_10017595 3300005341 Bacteria 3288
68 Ga0070687_100160404 3300005343 Archaea 1329
69 Ga0070661_100015521 3300005344 Bacteria 5375
70 Ga0070661_100029869 3300005344 Bacteria 3936
71 Ga0070661_100067320 3300005344 Bacteria 2631
72 Ga0070661_100082044 3300005344 Bacteria 2381
73 Ga0070661_100180127 3300005344 Bacteria 1607
74 Ga0070661_100247230 3300005344 Unclassified 1375
75 Ga0070692_10002026 3300005345 Bacteria 7694
76 Ga0070692_10104946 3300005345 Bacteria 1554
77 Ga0070668_100008587 3300005347 Bacteria 7587
78 Ga0070668_100085170 3300005347 Bacteria 2484
79 Ga0070668_100104067 3300005347 Bacteria 2252
80 Ga0070669_100350257 3300005353 Bacteria 1199
81 Ga0070675_100014084 3300005354 Bacteria 6299
82 Ga0070675_100016698 3300005354 Bacteria 5826
83 Ga0070675_100114665 3300005354 Bacteria 2283
84 Ga0070675_100322462 3300005354 Bacteria 1365
85 Ga0070671_100108632 3300005355 Bacteria 2329
86 Ga0070671_100271744 3300005355 Unclassified 1441
87 Ga0070671_100300141 3300005355 Archaea 1368
88 Ga0070674_100031128 3300005356 Bacteria 3533
89 Ga0070674_100034195 3300005356 Bacteria 3392
90 Ga0070674_100034478 3300005356 Bacteria 3381
91 Ga0070674_100114708 3300005356 Bacteria 1985
92 Ga0070674_100223944 3300005356 Unclassified 1465
93 Ga0070674_100226548 3300005356 Bacteria 1457
94 Ga0070674_100237668 3300005356 Bacteria 1425
95 Ga0070674_100319660 3300005356 Bacteria 1244
96 Ga0070673_100011553 3300005364 Bacteria 6031
97 Ga0070673_100639350 3300005364 Bacteria 973
98 Ga0070688_100002663 3300005365 Bacteria 9067
99 Ga0070659_100023844 3300005366 Bacteria 4686
100 Ga0070659_100072492 3300005366 Bacteria 2741
101 Ga0070659_100149492 3300005366 Bacteria 1905
102 Ga0070659_100200187 3300005366 Unclassified 1644
103 Ga0070659_100261591 3300005366 Bacteria 1436
104 Ga0070659_100269761 3300005366 Bacteria 1414
105 Ga0070659_100322311 3300005366 Unclassified 1292
106 Ga0070659_100323522 3300005366 Bacteria 1289
107 Ga0070659_100399550 3300005366 Unclassified 1160
108 Ga0070667_100012127 3300005367 Bacteria 7135
109 Ga0070709_10009338 3300005434 Bacteria 5406
110 Ga0070714_100050153 3300005435 Bacteria 3554
111 Ga0070714_100098935 3300005435 Bacteria 2567
112 Ga0070714_100136522 3300005435 Bacteria 2197
113 Ga0070714_100391044 3300005435 Unclassified 1313
114 Ga0070714_100397285 3300005435 Bacteria 1302
115 Ga0070713_100005892 3300005436 Bacteria 8425
116 Ga0070713_100281646 3300005436 Bacteria 1525
117 Ga0070713_100334099 3300005436 Bacteria 1402
118 Ga0070713_100665190 3300005436 Unclassified 993
119 Ga0070710_10002302 3300005437 Bacteria 9043
120 Ga0070710_10030936 3300005437 Bacteria 2884
121 Ga0070710_10080242 3300005437 Bacteria 1903
122 Ga0070710_10099831 3300005437 Bacteria 1726
123 Ga0070701_10022094 3300005438 Bacteria 3046
124 Ga0070701_10183836 3300005438 Unclassified 1225
125 Ga0070711_100023268 3300005439 Bacteria 4027
126 Ga0070711_100119492 3300005439 Bacteria 1947
127 Ga0070711_100124518 3300005439 Bacteria 1911
128 Ga0070705_100071440 3300005440 Bacteria 2099
129 Ga0070705_100089979 3300005440 Bacteria 1909
130 Ga0070705_100145677 3300005440 Unclassified 1564
131 Ga0070700_100004141 3300005441 Bacteria 7560
132 Ga0070700_100101635 3300005441 Bacteria 1895
133 Ga0070700_100261277 3300005441 Bacteria 1247
134 Ga0070700_100280609 3300005441 Bacteria 1208
135 Ga0070694_100029605 3300005444 Bacteria 3575
136 Ga0070694_100359545 3300005444 Bacteria 1130
137 Ga0070708_100029579 3300005445 Bacteria 4725
138 Ga0070708_100029675 3300005445 Bacteria 4719
139 Ga0070708_100041886 3300005445 Bacteria 4017
140 Ga0070708_100119944 3300005445 Unclassified 2425
141 Ga0070708_100216222 3300005445 Bacteria 1796
142 Ga0070708_100301140 3300005445 Unclassified 1510
143 Ga0070708_100386036 3300005445 Unclassified 1320
144 Ga0070663_100082044 3300005455 Bacteria 2371
145 Ga0070663_100167993 3300005455 Bacteria 1693
146 Ga0070663_100184665 3300005455 Bacteria 1620
147 Ga0070678_100030384 3300005456 Bacteria 3713
148 Ga0070678_100036526 3300005456 Bacteria 3440
149 Ga0070678_100069856 3300005456 Bacteria 2624
150 Ga0070662_100002025 3300005457 Bacteria 12417
151 Ga0070662_100014195 3300005457 Bacteria 5316
152 Ga0070662_100273845 3300005457 Bacteria 1364
153 Ga0070662_100293119 3300005457 Bacteria 1319
154 Ga0070681_10001955 3300005458 Bacteria 18619
155 Ga0070681_10005851 3300005458 Bacteria 11906
156 Ga0070681_10020993 3300005458 Bacteria 6543
157 Ga0070681_10050117 3300005458 Bacteria 4167
158 Ga0070681_10066022 3300005458 Bacteria 3587
159 Ga0070681_10067851 3300005458 Bacteria 3534
160 Ga0070681_10081715 3300005458 Bacteria 3187
161 Ga0070681_10148830 3300005458 Bacteria 2269
162 Ga0070681_10174626 3300005458 Bacteria 2070
163 Ga0070681_10263669 3300005458 Unclassified 1635
164 Ga0070681_10461483 3300005458 Bacteria 1182
165 Ga0068867_100012414 3300005459 Bacteria 6026
166 Ga0068867_100180479 3300005459 Unclassified 1678
167 Ga0070685_10004001 3300005466 Bacteria 7445
168 Ga0070685_10064574 3300005466 Bacteria 2152
169 Ga0070706_100035448 3300005467 Bacteria 4608
170 Ga0070706_100038867 3300005467 Bacteria 4392
171 Ga0070707_100000328 3300005468 Bacteria 46683
172 Ga0070707_100004648 3300005468 Bacteria 12854
173 Ga0070707_100049962 3300005468 Bacteria 4009
174 Ga0070707_100119199 3300005468 Bacteria 2562
175 Ga0070707_100188723 3300005468 Unclassified 2009
176 Ga0070707_100742184 3300005468 Unclassified 945
177 Ga0070698_100006381 3300005471 Bacteria 12806
178 Ga0070698_100009026 3300005471 Bacteria 10721
179 Ga0070698_100013953 3300005471 Bacteria 8496
180 Ga0070698_100084311 3300005471 Bacteria 3166
181 Ga0070699_100042793 3300005518 Bacteria 3919
182 Ga0070699_100107430 3300005518 Unclassified 2448
183 Ga0070699_100139293 3300005518 Bacteria 2141
184 Ga0070679_100027946 3300005530 Bacteria 5558
185 Ga0070679_100073439 3300005530 Bacteria 3412
186 Ga0070679_100100235 3300005530 Bacteria 2883
187 Ga0070679_100139436 3300005530 Bacteria 2405
188 Ga0070679_100340229 3300005530 Unclassified 1448
189 Ga0070684_100000801 3300005535 Bacteria 21853
190 Ga0070684_100006669 3300005535 Bacteria 8947
191 Ga0070684_100008131 3300005535 Bacteria 8187
192 Ga0070684_100014243 3300005535 Bacteria 6435
193 Ga0070684_100015491 3300005535 Bacteria 6210
194 Ga0070684_100016404 3300005535 Bacteria 6054
195 Ga0070684_100020628 3300005535 Bacteria 5466
196 Ga0070684_100024219 3300005535 Bacteria 5089
197 Ga0070684_100033105 3300005535 Bacteria 4410
198 Ga0070684_100034687 3300005535 Bacteria 4315
199 Ga0070684_100042990 3300005535 Bacteria 3902
200 Ga0070684_100061787 3300005535 Bacteria 3280
201 Ga0070684_100113209 3300005535 Unclassified 2435
202 Ga0070684_100115172 3300005535 Unclassified 2414
203 Ga0070684_100203107 3300005535 Bacteria 1805
204 Ga0070684_100456391 3300005535 Bacteria 1181
205 Ga0070684_100522290 3300005535 Bacteria 1100
206 Ga0070697_100357913 3300005536 Bacteria 1261
207 Ga0070697_100485149 3300005536 Bacteria 1079
208 Ga0068853_100007300 3300005539 Bacteria 8846
209 Ga0068853_100204098 3300005539 Bacteria 1799
210 Ga0068853_100386066 3300005539 Bacteria 1308
211 Ga0070672_100016488 3300005543 Bacteria 5290
212 Ga0070672_100026858 3300005543 Bacteria 4290
213 Ga0070672_100174020 3300005543 Bacteria 1791
214 Ga0070672_100259602 3300005543 Bacteria 1465
215 Ga0070672_100334533 3300005543 Bacteria 1289
216 Ga0070686_100017245 3300005544 Bacteria 4216
217 Ga0070686_100038215 3300005544 Bacteria 2982
218 Ga0070686_100044652 3300005544 Bacteria 2787
219 Ga0070686_100333561 3300005544 Bacteria 1134
220 Ga0070695_100002777 3300005545 Bacteria 10160
221 Ga0070695_100173012 3300005545 Unclassified 1524
222 Ga0070696_100095770 3300005546 Bacteria 2120
223 Ga0070696_100106667 3300005546 Bacteria 2014
224 Ga0070693_100048706 3300005547 Bacteria 2414
225 Ga0070693_100132002 3300005547 Bacteria 1562
226 Ga0070665_100005968 3300005548 Bacteria 12466
227 Ga0070704_100005014 3300005549 Bacteria 7694
228 Ga0070704_100400247 3300005549 Unclassified 1171
229 Ga0068855_100006817 3300005563 Bacteria 13856
230 Ga0068855_100012747 3300005563 Bacteria 10138
231 Ga0068855_100036661 3300005563 Bacteria 5834
232 Ga0068855_100071313 3300005563 Bacteria 4040
233 Ga0068855_100142482 3300005563 Bacteria 2730
234 Ga0068855_100236353 3300005563 Bacteria 2044
235 Ga0068855_100257970 3300005563 Bacteria 1943
236 Ga0068855_100300503 3300005563 Bacteria 1777
237 Ga0068855_100319362 3300005563 Bacteria 1717
238 Ga0068855_100475799 3300005563 Bacteria 1360
239 Ga0070664_100044398 3300005564 Bacteria 3753
240 Ga0070664_100055547 3300005564 Bacteria 3362
241 Ga0070664_100204197 3300005564 Unclassified 1764
242 Ga0068857_100009172 3300005577 Bacteria 8588
243 Ga0068857_100011172 3300005577 Bacteria 7809
244 Ga0068857_100167832 3300005577 Bacteria 1994
245 Ga0068854_100002899 3300005578 Bacteria 10654
246 Ga0068854_100098513 3300005578 Bacteria 2188
247 Ga0068854_100202147 3300005578 Bacteria 1562
248 Ga0068856_100006885 3300005614 Bacteria 11116
249 Ga0068856_100025554 3300005614 Bacteria 5759
250 Ga0068856_100047859 3300005614 Bacteria 4213
251 Ga0068856_100086852 3300005614 Bacteria 3108
252 Ga0068856_100129422 3300005614 Bacteria 2529
253 Ga0070702_100011161 3300005615 Bacteria 4460
254 Ga0070702_100011796 3300005615 Bacteria 4358
255 Ga0070702_100032003 3300005615 Bacteria 2883
256 Ga0070702_100057411 3300005615 Unclassified 2252
257 Ga0070702_100190505 3300005615 Bacteria 1349
258 Ga0068852_100002688 3300005616 Bacteria 12284
259 Ga0068852_100058846 3300005616 Bacteria 3330
260 Ga0068852_100335281 3300005616 Bacteria 1473
261 Ga0068852_100575411 3300005616 Bacteria 1129
262 Ga0068859_100045563 3300005617 Bacteria 4405
263 Ga0068864_100048354 3300005618 Bacteria 3656
264 Ga0068861_100003381 3300005719 Bacteria 10580
265 Ga0068861_100051190 3300005719 Bacteria 3134
266 Ga0068870_10004426 3300005840 Bacteria 6050
267 Ga0068870_10018231 3300005840 Bacteria 3386
268 Ga0068870_10225711 3300005840 Bacteria 1149
269 Ga0068863_100014802 3300005841 Bacteria 7501
270 Ga0068863_100874871 3300005841 Unclassified 898
271 Ga0068858_100016953 3300005842 Bacteria 6839
272 Ga0068858_100043753 3300005842 Bacteria 4152
273 Ga0068860_100048020 3300005843 Bacteria 4068
274 Ga0068860_100323053 3300005843 Bacteria 1515
275 Ga0068862_100091213 3300005844 Unclassified 2653
276 Ga0068862_100271902 3300005844 Unclassified 1550
277 Ga0068862_100732158 3300005844 Archaea 961
278 Ga0081455_10015398 3300005937 Bacteria 7433
279 Ga0081455_10025233 3300005937 Bacteria 5491
280 Ga0081455_10038614 3300005937 Bacteria 4227
281 Ga0081455_10045221 3300005937 Bacteria 3832
282 Ga0081455_10079373 3300005937 Unclassified 2695
283 Ga0081455_10120011 3300005937 Bacteria 2073
284 Ga0081455_10143496 3300005937 Bacteria 1851
285 Ga0081455_10184175 3300005937 Unclassified 1578
286 Ga0081455_10185613 3300005937 Bacteria 1571
287 Ga0081538_10000035 3300005981 Bacteria 120009
288 Ga0081538_10000152 3300005981 Bacteria 71751
289 Ga0081538_10000696 3300005981 Bacteria 36915
290 Ga0081538_10004814 3300005981 Bacteria 12303
291 Ga0081538_10007205 3300005981 Bacteria 9655
292 Ga0081538_10007559 3300005981 Bacteria 9381
293 Ga0081538_10017792 3300005981 Bacteria 5373
294 Ga0081538_10019711 3300005981 Bacteria 4996
295 Ga0081538_10023770 3300005981 Bacteria 4393
296 Ga0081538_10067111 3300005981 Bacteria 2005
297 Ga0081538_10089409 3300005981 Bacteria 1599
298 Ga0081538_10154437 3300005981 Bacteria 1032
299 Ga0081540_1003561 3300005983 Bacteria 12252
300 Ga0081539_10000866 3300005985 Bacteria 57957
301 Ga0070717_10010696 3300006028 Bacteria 6940
302 Ga0070717_10059005 3300006028 Bacteria 3174
303 Ga0070717_10062245 3300006028 Bacteria 3094
304 Ga0070717_10069828 3300006028 Bacteria 2926
305 Ga0070717_10239093 3300006028 Bacteria 1601
306 Ga0070717_10424003 3300006028 Unclassified 1197
307 Ga0075365_10022967 3300006038 Bacteria 3916
308 Ga0075365_10075872 3300006038 Bacteria 2269
309 Ga0075365_10077318 3300006038 Bacteria 2248
310 Ga0075363_100147218 3300006048 Unclassified 1328
311 Ga0075364_10212198 3300006051 Bacteria 1313
312 Ga0075432_10025925 3300006058 Bacteria 2012
313 Ga0070715_10000913 3300006163 Bacteria 8202
314 Ga0070715_10034552 3300006163 Bacteria 2073
315 Ga0070715_10058699 3300006163 Unclassified 1681
316 Ga0070716_100009358 3300006173 Bacteria 4881
317 Ga0070716_100193774 3300006173 Bacteria 1345
318 Ga0070716_100364919 3300006173 Unclassified 1027
319 Ga0070712_100047801 3300006175 Bacteria 2963
320 Ga0070712_100307085 3300006175 Bacteria 1286
321 Ga0097621_100188436 3300006237 Unclassified 1785
322 Ga0097621_100193422 3300006237 Bacteria 1763
323 Ga0097621_100210300 3300006237 Bacteria 1692
324 Ga0097621_100243759 3300006237 Unclassified 1572
325 Ga0097621_100336906 3300006237 Bacteria 1339
326 Ga0068871_100047256 3300006358 Bacteria 3470
327 Ga0068871_100051770 3300006358 Bacteria 3324
328 Ga0068871_100113713 3300006358 Bacteria 2280
329 Ga0068871_100189530 3300006358 Bacteria 1771
330 Ga0068871_100242454 3300006358 Bacteria 1567
331 Ga0075428_100000308 3300006844 Bacteria 48042
332 Ga0075428_100016622 3300006844 Bacteria 8126
333 Ga0075428_100031695 3300006844 Bacteria 5840
334 Ga0075428_100057000 3300006844 Bacteria 4278
335 Ga0075428_100143498 3300006844 Bacteria 2595
336 Ga0075428_100201563 3300006844 Bacteria 2151
337 Ga0075428_100576163 3300006844 Unclassified 1203
338 Ga0075430_100014948 3300006846 Bacteria 6610
339 Ga0075430_100079063 3300006846 Bacteria 2757
340 Ga0075430_100124588 3300006846 Bacteria 2148
341 Ga0075431_100001086 3300006847 Bacteria 24354
342 Ga0075431_100213838 3300006847 Bacteria 1968
343 Ga0075433_10004225 3300006852 Bacteria 11151
344 Ga0075433_10008511 3300006852 Bacteria 8184
345 Ga0075433_10018044 3300006852 Bacteria 5858
346 Ga0075433_10020180 3300006852 Bacteria 5567
347 Ga0075433_10026335 3300006852 Bacteria 4922
348 Ga0075433_10102791 3300006852 Bacteria 2531
349 Ga0075433_10220254 3300006852 Bacteria 1686
350 Ga0075433_10340825 3300006852 Bacteria 1325
351 Ga0075434_100034316 3300006871 Bacteria 5009
352 Ga0075434_100042923 3300006871 Bacteria 4484
353 Ga0075434_100071698 3300006871 Bacteria 3456
354 Ga0075434_100100842 3300006871 Bacteria 2893
355 Ga0075434_100145973 3300006871 Bacteria 2386
356 Ga0075434_100190125 3300006871 Unclassified 2073
357 Ga0075434_100222390 3300006871 Bacteria 1908
358 Ga0075434_100462362 3300006871 Bacteria 1290
359 Ga0075429_100009919 3300006880 Bacteria 8255
360 Ga0075429_100063627 3300006880 Bacteria 3213
361 Ga0068865_100005196 3300006881 Bacteria 7872
362 Ga0068865_100006771 3300006881 Bacteria 7014
363 Ga0068865_100021067 3300006881 Bacteria 4237
364 Ga0075436_100012016 3300006914 Bacteria 5938
365 Ga0075436_100020780 3300006914 Bacteria 4504
366 Ga0075436_100025190 3300006914 Bacteria 4092
367 Ga0075436_100041263 3300006914 Bacteria 3184
368 Ga0075436_100058124 3300006914 Unclassified 2671
369 Ga0097620_100045562 3300006931 Bacteria 4405
370 Ga0075435_100001303 3300007076 Bacteria 16035
371 Ga0075435_100001673 3300007076 Bacteria 14387
372 Ga0075435_100019419 3300007076 Bacteria 5192
373 Ga0075435_100059776 3300007076 Bacteria 3089
374 Ga0075435_100089967 3300007076 Unclassified 2532
375 Ga0105250_10103406 3300009092 Bacteria 1163
376 Ga0105240_10091363 3300009093 Bacteria 3720
377 Ga0105240_10153525 3300009093 Bacteria 2740
378 Ga0105240_10207907 3300009093 Bacteria 2289
379 Ga0105240_10402632 3300009093 Bacteria 1541
380 Ga0105240_10414550 3300009093 Unclassified 1514
381 Ga0111539_10025162 3300009094 Bacteria 7297
382 Ga0111539_10036454 3300009094 Bacteria 5946
383 Ga0111539_10046564 3300009094 Bacteria 5187
384 Ga0111539_10053903 3300009094 Bacteria 4787
385 Ga0111539_10348473 3300009094 Bacteria 1724
386 Ga0111539_10674745 3300009094 Bacteria 1203
387 Ga0111539_10735108 3300009094 Bacteria 1149
388 Ga0105245_10023554 3300009098 Bacteria 5405
389 Ga0105245_10034621 3300009098 Bacteria 4480
390 Ga0105245_10040300 3300009098 Bacteria 4160
391 Ga0105245_10050235 3300009098 Bacteria 3736
392 Ga0105245_10064068 3300009098 Bacteria 3322
393 Ga0105245_10275728 3300009098 Unclassified 1642
394 Ga0105245_10405202 3300009098 Bacteria 1364
395 Ga0105245_10548773 3300009098 Bacteria 1177
396 Ga0105247_10058614 3300009101 Bacteria 2383
397 Ga0105247_10121100 3300009101 Bacteria 1695
398 Ga0105247_10350767 3300009101 Unclassified 1038
399 Ga0114129_10001167 3300009147 Bacteria 34830
400 Ga0114129_10015322 3300009147 Bacteria 10908
401 Ga0114129_10035977 3300009147 Bacteria 6993
402 Ga0114129_10047971 3300009147 Bacteria 6000
403 Ga0114129_10058348 3300009147 Bacteria 5398
404 Ga0114129_10068265 3300009147 Bacteria 4957
405 Ga0114129_10083350 3300009147 Bacteria 4442
406 Ga0114129_10106333 3300009147 Bacteria 3876
407 Ga0114129_10110043 3300009147 Bacteria 3803
408 Ga0114129_10986670 3300009147 Bacteria 1062
409 Ga0114129_11321501 3300009147 Bacteria 893
410 Ga0105243_10005881 3300009148 Bacteria 9499
411 Ga0105243_10011846 3300009148 Bacteria 6594
412 Ga0105243_10012988 3300009148 Bacteria 6291
413 Ga0105243_10014105 3300009148 Bacteria 6046
414 Ga0105243_10031726 3300009148 Bacteria 4076
415 Ga0105241_10120527 3300009174 Bacteria 2112
416 Ga0105241_10124678 3300009174 Bacteria 2079
417 Ga0105241_10252848 3300009174 Unclassified 1495
418 Ga0105241_10289956 3300009174 Bacteria 1401
419 Ga0105242_10032279 3300009176 Bacteria 4187
420 Ga0105242_10044066 3300009176 Bacteria 3611
421 Ga0105242_10177159 3300009176 Bacteria 1878
422 Ga0105242_10305139 3300009176 Bacteria 1454
423 Ga0105242_10317261 3300009176 Unclassified 1428
424 Ga0105242_10416309 3300009176 Bacteria 1258
425 Ga0105242_10519777 3300009176 Bacteria 1135
426 Ga0105248_10004837 3300009177 Bacteria 14910
427 Ga0105248_10097147 3300009177 Bacteria 3319
428 Ga0105248_10115249 3300009177 Bacteria 3031
429 Ga0105237_10104549 3300009545 Bacteria 2823
430 Ga0105238_10033649 3300009551 Bacteria 5215
431 Ga0105238_10035597 3300009551 Bacteria 5061
432 Ga0105238_10699398 3300009551 Unclassified 1026
433 Ga0105249_10233914 3300009553 Unclassified 1813
434 Ga0105249_10445292 3300009553 Bacteria 1333
435 Ga0105249_10609334 3300009553 Bacteria 1147
436 Ga0105239_10003394 3300010375 Bacteria 19536
437 Ga0105239_10044245 3300010375 Bacteria 4881
438 Ga0105239_10056507 3300010375 Bacteria 4305
439 Ga0105239_10069567 3300010375 Bacteria 3867
440 Ga0105239_10144698 3300010375 Bacteria 2650
441 Ga0105239_10321666 3300010375 Unclassified 1744
442 Ga0105239_10457383 3300010375 Unclassified 1448
443 Ga0105239_10492084 3300010375 Bacteria 1394
444 Ga0105239_10607300 3300010375 Bacteria 1248
445 Ga0105239_10741254 3300010375 Bacteria 1124
446 Ga0105246_10022509 3300011119 Bacteria 4066
447 Ga0105246_10024629 3300011119 Bacteria 3912
448 Ga0105246_10149778 3300011119 Bacteria 1765
449 Ga0105246_10224083 3300011119 Bacteria 1476
450 Ga0157373_10032117 3300013100 Bacteria 3779
451 Ga0157373_10354263 3300013100 Unclassified 1047
452 Ga0157371_10004355 3300013102 Bacteria 12399
453 Ga0157371_10115418 3300013102 Bacteria 1907
454 Ga0157371_10436756 3300013102 Unclassified 961
455 Ga0157370_10018791 3300013104 Bacteria 6949
456 Ga0157370_10028361 3300013104 Bacteria 5507
457 Ga0157370_10031019 3300013104 Bacteria 5234
458 Ga0157370_10196259 3300013104 Bacteria 1873
459 Ga0157370_10286411 3300013104 Unclassified 1522
460 Ga0157369_10002497 3300013105 Bacteria 22048
461 Ga0157369_10023069 3300013105 Bacteria 6935
462 Ga0157369_10029987 3300013105 Bacteria 6002
463 Ga0157369_10046466 3300013105 Bacteria 4718
464 Ga0157369_10086575 3300013105 Bacteria 3346
465 Ga0157369_10116737 3300013105 Bacteria 2833
466 Ga0157369_10204935 3300013105 Unclassified 2069
467 Ga0157369_10397992 3300013105 Bacteria 1429
468 Ga0157374_10029179 3300013296 Bacteria 4992
469 Ga0157374_10047966 3300013296 Bacteria 3962
470 Ga0157374_10201556 3300013296 Bacteria 1949
471 Ga0157374_10336403 3300013296 Unclassified 1498
472 Ga0157378_10131447 3300013297 Unclassified 2317
473 Ga0157378_10243868 3300013297 Unclassified 1718
474 Ga0157378_10365848 3300013297 Bacteria 1412
475 Ga0157378_10699694 3300013297 Bacteria 1033
476 Ga0163162_10072172 3300013306 Bacteria 3507
477 Ga0163162_10136557 3300013306 Bacteria 2563
478 Ga0163162_10197617 3300013306 Bacteria 2140
479 Ga0157372_10006332 3300013307 Bacteria 12594
480 Ga0157372_10026486 3300013307 Bacteria 6310
481 Ga0157372_10055345 3300013307 Bacteria 4430
482 Ga0157372_10072372 3300013307 Bacteria 3885
483 Ga0157372_10085452 3300013307 Bacteria 3578
484 Ga0157372_10316757 3300013307 Bacteria 1816
485 Ga0157372_10450680 3300013307 Bacteria 1500
486 Ga0157372_10846308 3300013307 Bacteria 1062
487 Ga0157375_10001779 3300013308 Bacteria 18476
488 Ga0157375_10025998 3300013308 Bacteria 5449
489 Ga0157375_10130854 3300013308 Bacteria 2628
490 Ga0157375_10151600 3300013308 Bacteria 2454
491 Ga0157375_10171846 3300013308 Bacteria 2315
492 Ga0157375_10504055 3300013308 Unclassified 1374
493 Ga0157375_10767236 3300013308 Bacteria 1115
494 Ga0163163_10003453 3300014325 Bacteria 13427
495 Ga0163163_10107381 3300014325 Bacteria 2818
496 Ga0163163_10203191 3300014325 Unclassified 2030
497 Ga0163163_10570985 3300014325 Bacteria 1194
498 Ga0157380_10009901 3300014326 Bacteria 6843
499 Ga0157380_10031821 3300014326 Bacteria 4052
500 Ga0157380_10061307 3300014326 Bacteria 3009
501 Ga0157380_10086324 3300014326 Bacteria 2578
502 Ga0157380_10198097 3300014326 Unclassified 1779
503 Ga0182008_10200898 3300014497 Unclassified 1014
504 Ga0157377_10002578 3300014745 Bacteria 8049
505 Ga0157377_10008386 3300014745 Bacteria 5038
506 Ga0157377_10139382 3300014745 Unclassified 1489
507 Ga0157379_10079000 3300014968 Bacteria 2947
508 Ga0157379_10116988 3300014968 Bacteria 2398
509 Ga0157379_10237982 3300014968 Bacteria 1651
510 Ga0157376_10001398 3300014969 Bacteria 15859
511 Ga0157376_10299931 3300014969 Bacteria 1521
512 Ga0157376_10388814 3300014969 Unclassified 1346
513 Ga0182006_1075373 3300015261 Bacteria 1241
514 Ga0197907_10103628 3300020069 Unclassified 1950
515 Ga0197907_10204941 3300020069 Bacteria 2985
516 Ga0197907_10404823 3300020069 Bacteria 2921
517 Ga0197907_10875030 3300020069 Unclassified 2231
518 Ga0206356_10494061 3300020070 Bacteria 1588
519 Ga0206356_10694969 3300020070 Bacteria 2042
520 Ga0206356_11740764 3300020070 Bacteria 1206
521 Ga0206356_11755174 3300020070 Unclassified 1269
522 Ga0206351_10370816 3300020077 Bacteria 1725
523 Ga0206352_10571842 3300020078 Bacteria 1539
524 Ga0206352_10799947 3300020078 Unclassified 1372
525 Ga0206350_10458094 3300020080 Bacteria 1555
526 Ga0206354_10093548 3300020081 Bacteria 1212
527 Ga0206353_10839899 3300020082 Bacteria 2470
528 Ga0206353_11387566 3300020082 Bacteria 4498
529 Ga0224712_10020529 3300022467 Bacteria 2245
530 Ga0224712_10025783 3300022467 Unclassified 2070
531 Ga0224712_10041489 3300022467 Bacteria 1738
532 Ga0224712_10209000 3300022467 Bacteria 889
533 Ga0207697_10087404 3300025315 Bacteria 1319
534 Ga0207656_10083391 3300025321 Unclassified 1440
535 Ga0207653_10001160 3300025885 Bacteria 8623
536 Ga0207682_10068153 3300025893 Bacteria 1503
537 Ga0207692_10069347 3300025898 Unclassified 1852
538 Ga0207692_10117514 3300025898 Unclassified 1484
539 Ga0207710_10175983 3300025900 Bacteria 1048
540 Ga0207688_10000295 3300025901 Bacteria 22861
541 Ga0207688_10196776 3300025901 Bacteria 1207
542 Ga0207647_10178812 3300025904 Bacteria 1233
543 Ga0207685_10000585 3300025905 Bacteria 6339
544 Ga0207685_10148711 3300025905 Bacteria 1058
545 Ga0207699_10060867 3300025906 Bacteria 2269
546 Ga0207699_10095704 3300025906 Bacteria 1873
547 Ga0207645_10049494 3300025907 Bacteria 2683
548 Ga0207643_10003093 3300025908 Bacteria 8945
549 Ga0207643_10070389 3300025908 Bacteria 2012
550 Ga0207705_10019484 3300025909 Bacteria 4852
551 Ga0207705_10020119 3300025909 Bacteria 4774
552 Ga0207705_10090345 3300025909 Bacteria 2242
553 Ga0207705_10153742 3300025909 Bacteria 1725
554 Ga0207684_10075284 3300025910 Bacteria 2869
555 Ga0207684_10093531 3300025910 Bacteria 2564
556 Ga0207654_10139839 3300025911 Bacteria 1542
557 Ga0207654_10258070 3300025911 Unclassified 1171
558 Ga0207707_10006792 3300025912 Bacteria 9984
559 Ga0207707_10008124 3300025912 Bacteria 9112
560 Ga0207707_10043146 3300025912 Bacteria 3935
561 Ga0207707_10078554 3300025912 Bacteria 2882
562 Ga0207707_10103694 3300025912 Bacteria 2486
563 Ga0207707_10134715 3300025912 Unclassified 2160
564 Ga0207707_10135647 3300025912 Bacteria 2152
565 Ga0207707_10174541 3300025912 Bacteria 1877
566 Ga0207707_10278409 3300025912 Bacteria 1449
567 Ga0207707_10288078 3300025912 Unclassified 1421
568 Ga0207707_10424055 3300025912 Bacteria 1140
569 Ga0207695_10083465 3300025913 Bacteria 3227
570 Ga0207695_10345702 3300025913 Bacteria 1375
571 Ga0207695_10712186 3300025913 Unclassified 884
572 Ga0207693_10002991 3300025915 Bacteria 14628
573 Ga0207693_10004428 3300025915 Bacteria 11878
574 Ga0207693_10006759 3300025915 Bacteria 9470
575 Ga0207693_10008709 3300025915 Bacteria 8296
576 Ga0207693_10022035 3300025915 Bacteria 5065
577 Ga0207693_10041523 3300025915 Bacteria 3621
578 Ga0207663_10010865 3300025916 Bacteria 4863
579 Ga0207663_10025121 3300025916 Bacteria 3439
580 Ga0207663_10033479 3300025916 Unclassified 3062
581 Ga0207663_10201736 3300025916 Bacteria 1435
582 Ga0207663_10386693 3300025916 Bacteria 1067
583 Ga0207660_10016370 3300025917 Bacteria 4907
584 Ga0207660_10035726 3300025917 Bacteria 3452
585 Ga0207660_10100927 3300025917 Bacteria 2155
586 Ga0207660_10236601 3300025917 Bacteria 1437
587 Ga0207660_10440763 3300025917 Bacteria 1052
588 Ga0207662_10118327 3300025918 Bacteria 1659
589 Ga0207657_10000046 3300025919 Bacteria 113887
590 Ga0207657_10002149 3300025919 Bacteria 21362
591 Ga0207657_10002359 3300025919 Bacteria 20451
592 Ga0207657_10007745 3300025919 Bacteria 10968
593 Ga0207657_10007972 3300025919 Bacteria 10797
594 Ga0207657_10099989 3300025919 Unclassified 2408
595 Ga0207657_10176801 3300025919 Bacteria 1727
596 Ga0207657_10219350 3300025919 Unclassified 1524
597 Ga0207657_10221056 3300025919 Bacteria 1517
598 Ga0207649_10008800 3300025920 Bacteria 5508
599 Ga0207649_10119557 3300025920 Bacteria 1774
600 Ga0207649_10168041 3300025920 Bacteria 1525
601 Ga0207649_10217118 3300025920 Bacteria 1360
602 Ga0207649_10363486 3300025920 Unclassified 1075
603 Ga0207652_10015699 3300025921 Bacteria 6168
604 Ga0207652_10027233 3300025921 Bacteria 4762
605 Ga0207652_10028459 3300025921 Bacteria 4662
606 Ga0207652_10038654 3300025921 Bacteria 4047
607 Ga0207652_10153591 3300025921 Bacteria 2062
608 Ga0207652_10290157 3300025921 Bacteria 1476
609 Ga0207652_10300993 3300025921 Bacteria 1447
610 Ga0207652_10507859 3300025921 Bacteria 1085
611 Ga0207646_10000835 3300025922 Bacteria 40092
612 Ga0207646_10001503 3300025922 Bacteria 28669
613 Ga0207646_10045537 3300025922 Bacteria 3939
614 Ga0207646_10210908 3300025922 Bacteria 1754
615 Ga0207681_10016252 3300025923 Bacteria 4653
616 Ga0207681_10091249 3300025923 Unclassified 2176
617 Ga0207694_10017573 3300025924 Bacteria 5407
618 Ga0207694_10045933 3300025924 Bacteria 3375
619 Ga0207694_10179638 3300025924 Bacteria 1716
620 Ga0207650_10003626 3300025925 Bacteria 10578
621 Ga0207650_10017795 3300025925 Bacteria 4978
622 Ga0207650_10128800 3300025925 Unclassified 1978
623 Ga0207659_10079846 3300025926 Bacteria 2415
624 Ga0207659_10095799 3300025926 Unclassified 2226
625 Ga0207687_10035439 3300025927 Bacteria 3394
626 Ga0207687_10047111 3300025927 Unclassified 2987
627 Ga0207687_10079516 3300025927 Unclassified 2364
628 Ga0207687_10098003 3300025927 Bacteria 2152
629 Ga0207687_10270241 3300025927 Bacteria 1359
630 Ga0207687_10314883 3300025927 Bacteria 1265
631 Ga0207687_10371949 3300025927 Unclassified 1169
632 Ga0207687_10647647 3300025927 Bacteria 894
633 Ga0207700_10013428 3300025928 Bacteria 5329
634 Ga0207700_10029054 3300025928 Bacteria 3897
635 Ga0207700_10245582 3300025928 Bacteria 1527
636 Ga0207664_10006174 3300025929 Bacteria 8220
637 Ga0207664_10016830 3300025929 Bacteria 5343
638 Ga0207664_10023674 3300025929 Bacteria 4605
639 Ga0207664_10030636 3300025929 Unclassified 4110
640 Ga0207664_10163985 3300025929 Bacteria 1897
641 Ga0207664_10240129 3300025929 Bacteria 1578
642 Ga0207664_10463437 3300025929 Bacteria 1132
643 Ga0207664_10661246 3300025929 Unclassified 939
644 Ga0207644_10057035 3300025931 Bacteria 2819
645 Ga0207644_10444752 3300025931 Archaea 1064
646 Ga0207690_10013980 3300025932 Bacteria 4837
647 Ga0207690_10060399 3300025932 Bacteria 2572
648 Ga0207690_10088629 3300025932 Unclassified 2180
649 Ga0207690_10104351 3300025932 Bacteria 2030
650 Ga0207690_10310119 3300025932 Bacteria 1237
651 Ga0207690_10487808 3300025932 Unclassified 995
652 Ga0207690_10497624 3300025932 Bacteria 985
653 Ga0207706_10009744 3300025933 Bacteria 8816
654 Ga0207706_10027954 3300025933 Bacteria 5040
655 Ga0207706_10050444 3300025933 Bacteria 3677
656 Ga0207706_10295927 3300025933 Bacteria 1411
657 Ga0207686_10031586 3300025934 Bacteria 3146
658 Ga0207686_10032319 3300025934 Bacteria 3114
659 Ga0207686_10103308 3300025934 Unclassified 1907
660 Ga0207686_10108315 3300025934 Bacteria 1869
661 Ga0207686_10181187 3300025934 Bacteria 1494
662 Ga0207686_10280341 3300025934 Bacteria 1230
663 Ga0207709_10030813 3300025935 Bacteria 3124
664 Ga0207709_10079412 3300025935 Bacteria 2110
665 Ga0207709_10130382 3300025935 Bacteria 1713
666 Ga0207670_10003061 3300025936 Bacteria 8828
667 Ga0207669_10008057 3300025937 Bacteria 4927
668 Ga0207669_10021197 3300025937 Bacteria 3425
669 Ga0207669_10061864 3300025937 Bacteria 2303
670 Ga0207669_10104068 3300025937 Unclassified 1884
671 Ga0207704_10002504 3300025938 Bacteria 8279
672 Ga0207704_10150272 3300025938 Bacteria 1642
673 Ga0207704_10193957 3300025938 Unclassified 1480
674 Ga0207704_10426384 3300025938 Bacteria 1053
675 Ga0207665_10000336 3300025939 Bacteria 32436
676 Ga0207665_10009424 3300025939 Bacteria 6408
677 Ga0207665_10305111 3300025939 Unclassified 1191
678 Ga0207691_10014333 3300025940 Bacteria 7558
679 Ga0207691_10042275 3300025940 Bacteria 4202
680 Ga0207691_10142905 3300025940 Bacteria 2108
681 Ga0207691_10474730 3300025940 Bacteria 1063
682 Ga0207691_10587835 3300025940 Bacteria 943
683 Ga0207711_10559826 3300025941 Bacteria 1066
684 Ga0207689_10020194 3300025942 Bacteria 5610
685 Ga0207689_10232023 3300025942 Unclassified 1525
686 Ga0207661_10035507 3300025944 Bacteria 3885
687 Ga0207661_10040814 3300025944 Bacteria 3651
688 Ga0207661_10052608 3300025944 Bacteria 3254
689 Ga0207661_10058519 3300025944 Bacteria 3101
690 Ga0207661_10059188 3300025944 Unclassified 3086
691 Ga0207661_10094976 3300025944 Bacteria 2491
692 Ga0207661_10148807 3300025944 Bacteria 2022
693 Ga0207661_10150765 3300025944 Unclassified 2009
694 Ga0207661_10231300 3300025944 Bacteria 1637
695 Ga0207661_10396730 3300025944 Bacteria 1250
696 Ga0207661_10829156 3300025944 Bacteria 851
697 Ga0207679_10048143 3300025945 Unclassified 3101
698 Ga0207679_10415651 3300025945 Unclassified 1186
699 Ga0207679_10662016 3300025945 Bacteria 945
700 Ga0207667_10049523 3300025949 Bacteria 4436
701 Ga0207667_10052443 3300025949 Bacteria 4295
702 Ga0207667_10071362 3300025949 Bacteria 3611
703 Ga0207667_10109111 3300025949 Bacteria 2855
704 Ga0207667_10154405 3300025949 Bacteria 2362
705 Ga0207667_10214420 3300025949 Bacteria 1973
706 Ga0207667_10277037 3300025949 Bacteria 1714
707 Ga0207667_10397603 3300025949 Bacteria 1403
708 Ga0207667_10500751 3300025949 Unclassified 1232
709 Ga0207651_10009014 3300025960 Bacteria 5426
710 Ga0207651_10230977 3300025960 Bacteria 1502
711 Ga0207668_10008754 3300025972 Bacteria 6048
712 Ga0207668_10074890 3300025972 Bacteria 2432
713 Ga0207668_10637961 3300025972 Bacteria 931
714 Ga0207640_10010996 3300025981 Bacteria 5109
715 Ga0207640_10172003 3300025981 Bacteria 1615
716 Ga0207640_10211804 3300025981 Unclassified 1477
717 Ga0207658_10004838 3300025986 Bacteria 9311
718 Ga0207658_10114119 3300025986 Bacteria 2142
719 Ga0207677_10078690 3300026023 Unclassified 2355
720 Ga0207677_10433651 3300026023 Viruses 1122
721 Ga0207703_10014085 3300026035 Bacteria 6233
722 Ga0207703_10152853 3300026035 Bacteria 2014
723 Ga0207639_10067705 3300026041 Bacteria 2779
724 Ga0207639_10316350 3300026041 Bacteria 1385
725 Ga0207639_10332069 3300026041 Bacteria 1353
726 Ga0207639_10363730 3300026041 Bacteria 1295
727 Ga0207639_10552061 3300026041 Bacteria 1058
728 Ga0207678_10008584 3300026067 Bacteria 9001
729 Ga0207678_10083870 3300026067 Bacteria 2726
730 Ga0207678_10330939 3300026067 Unclassified 1311
731 Ga0207708_10013763 3300026075 Bacteria 6046
732 Ga0207708_10028141 3300026075 Bacteria 4256
733 Ga0207702_10005093 3300026078 Bacteria 11551
734 Ga0207702_10016688 3300026078 Bacteria 6078
735 Ga0207702_10030487 3300026078 Bacteria 4495
736 Ga0207702_10081441 3300026078 Bacteria 2811
737 Ga0207702_10107262 3300026078 Bacteria 2476
738 Ga0207702_10496304 3300026078 Bacteria 1189
739 Ga0207641_10575921 3300026088 Bacteria 1100
740 Ga0207648_10017489 3300026089 Bacteria 6521
741 Ga0207648_10069092 3300026089 Bacteria 3078
742 Ga0207676_10704504 3300026095 Bacteria 978
743 Ga0207676_11241681 3300026095 Bacteria 739
744 Ga0207674_10002821 3300026116 Bacteria 21604
745 Ga0207674_10041842 3300026116 Bacteria 4736
746 Ga0207674_10139150 3300026116 Bacteria 2388
747 Ga0207674_10153418 3300026116 Bacteria 2259
748 Ga0207674_10550577 3300026116 Bacteria 1114
749 Ga0207675_100002655 3300026118 Bacteria 17641
750 Ga0207675_100002688 3300026118 Bacteria 17542
751 Ga0207675_100224847 3300026118 Unclassified 1809
752 Ga0207683_10018336 3300026121 Bacteria 5970
753 Ga0207683_10019988 3300026121 Bacteria 5721
754 Ga0207683_10030783 3300026121 Bacteria 4652
755 Ga0207683_10032768 3300026121 Bacteria 4514
756 Ga0207683_10041263 3300026121 Bacteria 4029
757 Ga0207698_10007523 3300026142 Bacteria 6827
758 Ga0207698_10229384 3300026142 Bacteria 1685
759 Ga0207698_10693616 3300026142 Bacteria 1012
760 Ga0207698_10840846 3300026142 Bacteria 922
761 Ga0207428_10024156 3300027907 Bacteria 5105
762 Ga0207428_10031019 3300027907 Bacteria 4416
763 Ga0207428_10038452 3300027907 Bacteria 3889
764 Ga0207428_10125373 3300027907 Bacteria 1967
765 Ga0207428_10142811 3300027907 Bacteria 1826
766 Ga0207428_10230413 3300027907 Unclassified 1386
767 Ga0268266_10020487 3300028379 Bacteria 5637
768 Ga0268266_10270108 3300028379 Unclassified 1578
769 Ga0268266_10816926 3300028379 Unclassified 901
770 Ga0268265_10117659 3300028380 Bacteria 2183
771 Ga0268265_10135980 3300028380 Unclassified 2051
772 Ga0268264_10082317 3300028381 Bacteria 2754
773 Ga0265334_10010096 3300028573 Bacteria 3987
774 Ga0265318_10010050 3300028577 Bacteria 4137
775 Ga0265318_10037064 3300028577 Bacteria 1869
776 Ga0265336_10002579 3300028666 Bacteria 7406
777 Ga0265336_10057096 3300028666 Bacteria 1172
778 Ga0265338_10007091 3300028800 Bacteria 14041
779 Ga0265338_10010810 3300028800 Bacteria 10641
780 Ga0265338_10017185 3300028800 Bacteria 7814
781 Ga0265338_10082217 3300028800 Bacteria 2697
782 Ga0265338_10136375 3300028800 Bacteria 1928
783 Ga0265324_10018729 3300029957 Bacteria 2500
784 Ga0265320_10060231 3300031240 Bacteria 1813
785 Ga0265339_10009216 3300031249 Bacteria 6223
786 Ga0265331_10043314 3300031250 Bacteria 2181
787 Ga0265327_10042865 3300031251 Bacteria 2426
788 Ga0265327_10074306 3300031251 Bacteria 1694
789 Ga0307408_100192265 3300031548 Bacteria 1645
790 Ga0265313_10011904 3300031595 Bacteria 5369
791 Ga0265314_10011431 3300031711 Bacteria 7328
792 Ga0307405_10140772 3300031731 Bacteria 1682
793 Ga0307410_10248392 3300031852 Bacteria 1382
794 Ga0307406_10170663 3300031901 Bacteria 1574
795 Ga0307412_10285345 3300031911 Bacteria 1298
796 Ga0307409_100013556 3300031995 Bacteria 5254
797 Ga0307409_100080100 3300031995 Bacteria 2634
798 Ga0307409_100154478 3300031995 Bacteria 1998
799 Ga0307409_100688980 3300031995 Bacteria 1020
800 Ga0307415_100072492 3300032126 Bacteria 2426
801 Ga0316583_10053325 3300032133 Bacteria 1422
802 Ga0373958_0004712 3300034819 Bacteria 2032
803 Ga0373928_0005179 3300035084 Bacteria 2488
804 Ga0373940_0020246 3300035088 Bacteria 1688
805 Ga0373944_0047146 3300035089 Unclassified 1349
806 Ga0373949_0031541 3300035090 Bacteria 1264
807 Ga0373951_0003334 3300035091 Bacteria 3929
808 Ga0373952_0001629 3300035092 Bacteria 4086
809 Ga0373932_0002933 3300035112 Bacteria 4203
810 Ga0373936_0017166 3300035113 Bacteria 2785
811 Ga0373939_0014676 3300035114 Bacteria 2037
812 Ga0373945_0003618 3300035116 Bacteria 4869
813 Ga0373945_0030800 3300035116 Bacteria 1892
814 Ga0373953_0117933 3300035117 Bacteria 1126
815 Ga0373960_0005893 3300035121 Bacteria 2852
816 Ga0373960_0006215 3300035121 Bacteria 2794
817 Ga0373943_0006431 3300035170 Bacteria 5275
818 Ga0373946_0017378 3300035171 Bacteria 2752
819 Ga0373946_0050585 3300035171 Bacteria 1736
820 Ga0373955_0224463 3300035172 Bacteria 1123
821 Ga0373955_0287626 3300035172 Unclassified 990
822 Ga0373942_0013065 3300035207 Bacteria 1991
823 Ga0373942_0073200 3300035207 Bacteria 1004
824 Ga0373961_0008338 3300035241 Bacteria 2520
825 Ga0373961_0008521 3300035241 Bacteria 2494
826 Ga0373962_0003210 3300035242 Bacteria 3922
827 Ga0316574_0013253 3300035398 Bacteria 4735
828 Ga0373924_0098938 3300035410 Bacteria 1253
829 Ga0373931_0008030 3300035691 Bacteria 4994
830 Ga0373931_0023902 3300035691 Bacteria 3089
831 Ga0373931_0064143 3300035691 Bacteria 1987
832 Ga0373935_0024832 3300035692 Bacteria 3691
833 Ga0373935_0198469 3300035692 Bacteria 1385
834 Ga0373947_0000590 3300035725 Bacteria 21313
835 Ga0373947_0002156 3300035725 Bacteria 11960
836 Ga0373947_0009289 3300035725 Bacteria 5649
837 Ga0373947_0038227 3300035725 Bacteria 2850
838 Ga0373937_0078598 3300036401 Bacteria 3049
839 Ga0373937_0079049 3300036401 Bacteria 3040
840 Ga0373925_0008041 3300037068 Bacteria 7682
841 Ga0373925_0019221 3300037068 Bacteria 4968
842 Ga0395899_0001492 3300037312 Bacteria 19877
843 Ga0395899_0005009 3300037312 Bacteria 10306
844 Ga0395899_0005435 3300037312 Bacteria 9885
845 Ga0395899_0007004 3300037312 Bacteria 8727
846 Ga0395899_0019451 3300037312 Bacteria 5158
847 Ga0395899_0021446 3300037312 Bacteria 4900
848 Ga0395899_0031033 3300037312 Bacteria 4018
849 Ga0395899_0032696 3300037312 Bacteria 3909
850 Ga0395899_0054157 3300037312 Bacteria 2969
851 Ga0395899_0141336 3300037312 Unclassified 1712
852 Ga0395899_0212757 3300037312 Bacteria 1343
853 Ga0395899_0264261 3300037312 Bacteria 1176
854 Ga0395900_0002249 3300037418 Bacteria 21466
855 Ga0395900_0002962 3300037418 Bacteria 18481
856 Ga0395900_0005184 3300037418 Bacteria 13682
857 Ga0395900_0008768 3300037418 Bacteria 10390
858 Ga0395900_0011825 3300037418 Bacteria 8925
859 Ga0395900_0015152 3300037418 Bacteria 7861
860 Ga0395900_0021106 3300037418 Bacteria 6655
861 Ga0395900_0031804 3300037418 Bacteria 5424
862 Ga0395900_0050359 3300037418 Bacteria 4290
863 Ga0395900_0060273 3300037418 Bacteria 3906
864 Ga0395900_0072551 3300037418 Bacteria 3539
865 Ga0395900_0074483 3300037418 Bacteria 3490
866 Ga0395900_0079316 3300037418 Bacteria 3373
867 Ga0395900_0081382 3300037418 Bacteria 3327
868 Ga0395900_0086757 3300037418 Unclassified 3216
869 Ga0395900_0105591 3300037418 Bacteria 2894
870 Ga0395900_0109750 3300037418 Bacteria 2834
871 Ga0395900_0143504 3300037418 Unclassified 2443
872 Ga0395900_0150702 3300037418 Bacteria 2376
873 Ga0395900_0171524 3300037418 Bacteria 2208
874 Ga0395900_0186308 3300037418 Bacteria 2107
875 Ga0395900_0234107 3300037418 Bacteria 1846
876 Ga0395900_0235434 3300037418 Bacteria 1839
877 Ga0395900_0408815 3300037418 Bacteria 1320
878 Ga0395900_0622298 3300037418 Unclassified 1018
879 Ga0395900_0745970 3300037418 Bacteria 909
880 Ga0395898_0001213 3300037466 Bacteria 38909
881 Ga0395898_0001862 3300037466 Bacteria 27022
882 Ga0395898_0010024 3300037466 Bacteria 9923
883 Ga0395898_0012117 3300037466 Bacteria 8926
884 Ga0395898_0012770 3300037466 Bacteria 8673
885 Ga0395898_0016061 3300037466 Bacteria 7669
886 Ga0395898_0017469 3300037466 Bacteria 7325
887 Ga0395898_0018501 3300037466 Bacteria 7101
888 Ga0395898_0020827 3300037466 Bacteria 6655
889 Ga0395898_0034509 3300037466 Bacteria 5041
890 Ga0395898_0043430 3300037466 Bacteria 4429
891 Ga0395898_0047102 3300037466 Bacteria 4232
892 Ga0395898_0057630 3300037466 Bacteria 3785
893 Ga0395898_0079296 3300037466 Bacteria 3168
894 Ga0395898_0086795 3300037466 Bacteria 3015
895 Ga0395898_0119142 3300037466 Unclassified 2528
896 Ga0395898_0563873 3300037466 Bacteria 1081
897 Ga0395898_0578377 3300037466 Bacteria 1065
898 Ga0395905_0004021 3300037471 Bacteria 15433
899 Ga0395905_0007290 3300037471 Bacteria 11023
900 Ga0395905_0018249 3300037471 Bacteria 6660
901 Ga0395905_0018594 3300037471 Bacteria 6592
902 Ga0395905_0048739 3300037471 Bacteria 3969
903 Ga0395905_0052112 3300037471 Bacteria 3832
904 Ga0395905_0113171 3300037471 Bacteria 2549
905 Ga0395905_0171590 3300037471 Unclassified 2037
906 Ga0395905_0194856 3300037471 Bacteria 1900
907 Ga0395905_0413410 3300037471 Bacteria 1244
908 Ga0395905_0459555 3300037471 Unclassified 1171
909 Ga0395901_0000809 3300038443 Bacteria 34767
910 Ga0395901_0001901 3300038443 Bacteria 21558
911 Ga0395901_0002490 3300038443 Bacteria 18665
912 Ga0395901_0008659 3300038443 Bacteria 10280
913 Ga0395901_0009351 3300038443 Bacteria 9939
914 Ga0395901_0032973 3300038443 Bacteria 5343
915 Ga0395901_0039132 3300038443 Bacteria 4906
916 Ga0395901_0041742 3300038443 Unclassified 4755
917 Ga0395901_0050752 3300038443 Bacteria 4309
918 Ga0395901_0051027 3300038443 Bacteria 4299
919 Ga0395901_0059937 3300038443 Bacteria 3960
920 Ga0395901_0066313 3300038443 Bacteria 3760
921 Ga0395901_0106747 3300038443 Bacteria 2939
922 Ga0395901_0116948 3300038443 Unclassified 2801
923 Ga0395901_0128039 3300038443 Bacteria 2668
924 Ga0395901_0263567 3300038443 Bacteria 1793
925 Ga0395901_0277743 3300038443 Bacteria 1741
926 Ga0395901_0282952 3300038443 Unclassified 1722
927 Ga0395901_0359150 3300038443 Bacteria 1502
928 Ga0395901_0461644 3300038443 Bacteria 1297
929 Ga0395901_0483924 3300038443 Bacteria 1262
930 Ga0395901_0609890 3300038443 Bacteria 1099
931 Ga0242420_004502 3300038996 Bacteria 2112
932 Ga0436365_1254107 3300039437 Bacteria 1030
933 Ga0436360_0528570 3300039438 Bacteria 12723
934 Ga0436363_0737093 3300039450 Bacteria 1332
935 Ga0439439_0005013 3300041406 Bacteria 3007
936 Ga0439461_0003668 3300041410 Bacteria 2532
937 Ga0439461_0004257 3300041410 Bacteria 2382
938 Ga0451793_0630142 3300041452 Unclassified 1592
939 Ga0451800_1364113 3300041459 Bacteria 2143
940 Ga0451807_1292183 3300041486 Bacteria 2230
941 Ga0451839_1137856 3300041496 Unclassified 1753
942 Ga0451847_0357059 3300041503 Bacteria 1018
943 Ga0451853_0212631 3300041512 Bacteria 6314
944 Ga0451853_0402185 3300041512 Bacteria 3552
945 Ga0451853_2653982 3300041512 Bacteria 1954
946 Ga0450905_011737 3300042142 Unclassified 1228
947 Ga0450907_004083 3300042146 Bacteria 2530
948 Ga0450907_020314 3300042146 Unclassified 1115
949 Ga0450910_011683 3300042147 Unclassified 1262
950 Ga0439446_0000185 3300042156 Bacteria 11046
951 Ga0439434_0016341 3300042435 Bacteria 2217
952 Ga0439460_0031843 3300042461 Bacteria 1507
953 Ga0466969_0000388 3300044656 Bacteria 24129
954 Ga0466969_0044191 3300044656 Bacteria 2218
955 Ga0466969_0116144 3300044656 Bacteria 1249
956 Ga0466972_0128669 3300044658 Bacteria 1193
957 Ga0466965_0046401 3300044683 Bacteria 2151
958 Ga0466965_0152181 3300044683 Bacteria 1209
959 Ga0466965_0158190 3300044683 Bacteria 1187
960 Ga0466965_0228553 3300044683 Unclassified 993
961 Ga0466966_0002834 3300044684 Bacteria 11411
962 Ga0466966_0057272 3300044684 Bacteria 2464
963 Ga0466966_0085742 3300044684 Bacteria 1958
964 Ga0466966_0138822 3300044684 Bacteria 1486
965 Ga0466966_0172378 3300044684 Bacteria 1314
966 Ga0466961_0007905 3300044693 Bacteria 6776
967 Ga0466961_0023641 3300044693 Bacteria 3954
968 Ga0466961_0037806 3300044693 Bacteria 3096
969 Ga0466961_0189443 3300044693 Bacteria 1275
970 Ga0466963_0011013 3300044694 Bacteria 5498
971 Ga0466963_0018103 3300044694 Bacteria 4398
972 Ga0466963_0031898 3300044694 Bacteria 3407
973 Ga0466963_0033265 3300044694 Bacteria 3345
974 Ga0466963_0042077 3300044694 Bacteria 2998
975 Ga0466963_0073846 3300044694 Unclassified 2300
976 Ga0466963_0100887 3300044694 Bacteria 1975
977 Ga0466963_0112053 3300044694 Bacteria 1873
978 Ga0466963_0165973 3300044694 Unclassified 1538
979 Ga0466963_0184360 3300044694 Bacteria 1457
980 Ga0466964_0004468 3300044706 Bacteria 5166
981 Ga0466964_0005246 3300044706 Bacteria 4803
982 Ga0466964_0012091 3300044706 Bacteria 3265
983 Ga0466964_0088629 3300044706 Bacteria 1342
984 Ga0466964_0134568 3300044706 Bacteria 1129
985 Ga0466964_0210372 3300044706 Unclassified 939
986 Ga0466971_0015252 3300044719 Bacteria 3382
987 Ga0466971_0020720 3300044719 Bacteria 2923
988 Ga0466968_0004580 3300044735 Bacteria 5170
989 Ga0466968_0006008 3300044735 Bacteria 4555
990 Ga0466968_0010497 3300044735 Bacteria 3593
991 Ga0466968_0122035 3300044735 Bacteria 1180
992 Ga0466968_0142788 3300044735 Unclassified 1096
993 Ga0466970_0015670 3300044765 Bacteria 3903
994 Ga0466970_0077391 3300044765 Bacteria 1793
995 Ga0466957_0004248 3300044842 Bacteria 7943
996 Ga0466957_0007431 3300044842 Bacteria 6190
997 Ga0466957_0024815 3300044842 Bacteria 3551
998 Ga0466957_0101147 3300044842 Bacteria 1817
999 Ga0466957_0139420 3300044842 Bacteria 1561
1000 Ga0466957_0283966 3300044842 Unclassified 1108
1001 Ga0466957_0360383 3300044842 Unclassified 988
1002 Ga0466960_0097361 3300044901 Bacteria 1509
1003 Ga0466960_0152349 3300044901 Bacteria 1236
1004 Ga0466960_0156814 3300044901 Bacteria 1219
1005 Ga0466959_0016642 3300045049 Bacteria 5376
1006 Ga0466959_0022152 3300045049 Bacteria 4694
1007 Ga0466959_0023743 3300045049 Bacteria 4539
1008 Ga0466959_0142155 3300045049 Bacteria 1695
1009 Ga0466959_0160187 3300045049 Bacteria 1582
1010 Ga0466959_0348847 3300045049 Unclassified 1009
1011 Ga0466958_0003870 3300045836 Bacteria 7832
1012 Ga0466958_0005189 3300045836 Bacteria 6975
1013 Ga0466958_0015930 3300045836 Bacteria 4321
1014 Ga0466958_0017408 3300045836 Bacteria 4153
1015 Ga0466958_0123610 3300045836 Bacteria 1621
1016 Ga0466958_0375681 3300045836 Bacteria 916
1017 Ga0466967_0000179 3300045976 Bacteria 26199
1018 Ga0466967_0000656 3300045976 Bacteria 17383
1019 Ga0466967_0001283 3300045976 Bacteria 14292
1020 Ga0466967_0004521 3300045976 Bacteria 9404
1021 Ga0466967_0004681 3300045976 Bacteria 9291
1022 Ga0466967_0028066 3300045976 Bacteria 4693
1023 Ga0466967_0030515 3300045976 Bacteria 4525
1024 Ga0466967_0034259 3300045976 Bacteria 4308
1025 Ga0466967_0044519 3300045976 Bacteria 3850
1026 Ga0466967_0050109 3300045976 Bacteria 3655
1027 Ga0466967_0063731 3300045976 Bacteria 3276
1028 Ga0466967_0102426 3300045976 Bacteria 2619
1029 Ga0466967_0127577 3300045976 Bacteria 2358
1030 Ga0466967_0202110 3300045976 Bacteria 1882
1031 Ga0466967_0229568 3300045976 Bacteria 1767
1032 Ga0466967_0248872 3300045976 Bacteria 1697
1033 Ga0466967_0320110 3300045976 Bacteria 1495
1034 Ga0466967_0333892 3300045976 Bacteria 1464
1035 Ga0466967_0422071 3300045976 Bacteria 1300
1036 Ga0466967_0454692 3300045976 Bacteria 1252
1037 Ga0466967_0464655 3300045976 Unclassified 1238
1038 Ga0466967_0526083 3300045976 Unclassified 1162
1039 Ga0466967_0540734 3300045976 Unclassified 1146
1040 Ga0466967_0641939 3300045976 Bacteria 1049
1041 Ga0466967_0687005 3300045976 Bacteria 1013
1042 Ga0495592_0004809 3300046454 Bacteria 9927
1043 Ga0495592_0139641 3300046454 Bacteria 1686
1044 Ga0495592_0226588 3300046454 Bacteria 1247
1045 Ga0495603_0009387 3300046455 Bacteria 5912
1046 Ga0495603_0011343 3300046455 Bacteria 5396
1047 Ga0495603_0024368 3300046455 Bacteria 3658
1048 Ga0495603_0099225 3300046455 Bacteria 1700
1049 Ga0495603_0198893 3300046455 Unclassified 1158
1050 Ga0495629_0029124 3300046459 Bacteria 3918
1051 Ga0495629_0053152 3300046459 Bacteria 2834
1052 Ga0495629_0075375 3300046459 Bacteria 2356
1053 Ga0495629_0362804 3300046459 Bacteria 987
1054 Ga0495641_0004261 3300046461 Bacteria 10218
1055 Ga0495641_0004552 3300046461 Bacteria 9732
1056 Ga0495641_0034632 3300046461 Bacteria 2386
1057 Ga0495641_0041124 3300046461 Bacteria 2148
1058 Ga0495641_0107765 3300046461 Unclassified 1243
1059 Ga0495641_0117542 3300046461 Bacteria 1186
1060 Ga0495641_0209208 3300046461 Unclassified 874
1061 Ga0495651_0048218 3300046462 Bacteria 3290
1062 Ga0495651_0062960 3300046462 Bacteria 2837
1063 Ga0495651_0132325 3300046462 Bacteria 1819
1064 Ga0495651_0212894 3300046462 Unclassified 1343
1065 Ga0495653_0032638 3300046463 Bacteria 4132
1066 Ga0495653_0052203 3300046463 Bacteria 3135
1067 Ga0495653_0362986 3300046463 Unclassified 929
1068 Ga0495580_0021561 3300046472 Bacteria 4751
1069 Ga0495582_0016397 3300046473 Bacteria 4059
1070 Ga0495582_0020921 3300046473 Unclassified 3583
1071 Ga0495582_0115484 3300046473 Unclassified 1509
1072 Ga0495582_0240061 3300046473 Bacteria 1038
1073 Ga0495605_0030222 3300046474 Bacteria 2780
1074 Ga0495605_0092944 3300046474 Unclassified 1396
1075 Ga0495662_0051678 3300046476 Unclassified 1984
1076 Ga0495664_0136923 3300046477 Unclassified 1484
1077 Ga0495664_0250254 3300046477 Unclassified 1072
1078 Ga0495584_0019339 3300046491 Bacteria 3459
1079 Ga0495584_0101788 3300046491 Bacteria 1452
1080 Ga0495584_0170043 3300046491 Bacteria 1108
1081 Ga0495585_0198884 3300046492 Bacteria 1022
1082 Ga0495594_0006747 3300046499 Bacteria 5905
1083 Ga0495596_0028494 3300046500 Bacteria 2242
1084 Ga0495596_0071261 3300046500 Bacteria 1350
1085 Ga0495607_0057044 3300046501 Bacteria 2240
1086 Ga0495608_0009760 3300046511 Bacteria 6698
1087 Ga0495608_0016338 3300046511 Bacteria 5135
1088 Ga0495608_0027278 3300046511 Bacteria 3886
1089 Ga0495608_0032676 3300046511 Bacteria 3517
1090 Ga0495608_0091243 3300046511 Bacteria 1970
1091 Ga0495608_0097849 3300046511 Unclassified 1894
1092 Ga0495618_0020745 3300046514 Bacteria 4044
1093 Ga0495618_0021960 3300046514 Bacteria 3938
1094 Ga0495618_0174993 3300046514 Bacteria 1365
1095 Ga0495618_0236200 3300046514 Unclassified 1150
1096 Ga0495618_0254979 3300046514 Bacteria 1100
1097 Ga0495628_0018631 3300046516 Bacteria 5746
1098 Ga0495628_0021733 3300046516 Bacteria 5273
1099 Ga0495628_0043819 3300046516 Bacteria 3562
1100 Ga0495628_0235254 3300046516 Unclassified 1372
1101 Ga0495628_0430949 3300046516 Bacteria 960
1102 Ga0495630_0002368 3300046517 Bacteria 13075
1103 Ga0495630_0025512 3300046517 Bacteria 4372
1104 Ga0495630_0026574 3300046517 Bacteria 4286
1105 Ga0495630_0046074 3300046517 Bacteria 3259
1106 Ga0495630_0064270 3300046517 Bacteria 2757
1107 Ga0495630_0121028 3300046517 Bacteria 1986
1108 Ga0495630_0161302 3300046517 Bacteria 1707
1109 Ga0495644_0069197 3300046523 Bacteria 1326
1110 Ga0495644_0071726 3300046523 Bacteria 1302
1111 Ga0495663_0008382 3300046525 Bacteria 2863
1112 Ga0495666_0023225 3300046526 Bacteria 3067
1113 Ga0495652_0050425 3300046529 Bacteria 3558
1114 Ga0495652_0053385 3300046529 Bacteria 3444
1115 Ga0495652_0220663 3300046529 Bacteria 1425
1116 Ga0495652_0352895 3300046529 Bacteria 1053
1117 Ga0495640_0003223 3300046533 Bacteria 13136
1118 Ga0495587_0101164 3300046536 Bacteria 1660
1119 Ga0495598_0050459 3300046537 Bacteria 1251
1120 Ga0495609_0038387 3300046538 Bacteria 2159
1121 Ga0495645_0026587 3300046543 Bacteria 4201
1122 Ga0495645_0263870 3300046543 Bacteria 1139
1123 Ga0495667_0005166 3300046559 Bacteria 8818
1124 Ga0495667_0005794 3300046559 Bacteria 8371
1125 Ga0495667_0015042 3300046559 Bacteria 5223
1126 Ga0495667_0047038 3300046559 Bacteria 2851
1127 Ga0495667_0064462 3300046559 Bacteria 2397
1128 Ga0495667_0072299 3300046559 Bacteria 2248
1129 Ga0495667_0090116 3300046559 Bacteria 1987
1130 Ga0495656_0018093 3300046615 Bacteria 2700
1131 Ga0495656_0074891 3300046615 Unclassified 1513
1132 Ga0495656_0306226 3300046615 Unclassified 815
1133 Ga0495634_0029419 3300046642 Bacteria 3803
1134 Ga0495634_0140823 3300046642 Bacteria 1531
1135 Ga0495634_0214500 3300046642 Bacteria 1190
1136 Ga0495635_0063485 3300046663 Unclassified 2536
1137 Ga0495635_0102663 3300046663 Bacteria 1954
1138 Ga0495635_0142434 3300046663 Bacteria 1632
1139 Ga0495659_0040113 3300046664 Bacteria 1667
1140 Ga0495588_0001498 3300046674 Bacteria 10008
1141 Ga0495588_0059613 3300046674 Bacteria 1975
1142 Ga0495588_0112700 3300046674 Unclassified 1433
1143 Ga0495588_0162451 3300046674 Unclassified 1181
1144 Ga0495657_0014645 3300046675 Bacteria 5756
1145 Ga0495657_0021973 3300046675 Bacteria 4574
1146 Ga0495657_0029620 3300046675 Bacteria 3838
1147 Ga0495657_0077532 3300046675 Bacteria 2156
1148 Ga0495657_0163961 3300046675 Unclassified 1373
1149 Ga0495599_0035987 3300046678 Bacteria 3107
1150 Ga0495599_0040203 3300046678 Bacteria 2937
1151 Ga0495599_0230653 3300046678 Unclassified 1130
1152 Ga0495646_0065653 3300046680 Bacteria 2148
1153 Ga0495647_0062961 3300046681 Bacteria 1468
1154 Ga0495647_0225809 3300046681 Bacteria 828
1155 Ga0495658_0038859 3300046683 Bacteria 2637
1156 Ga0495658_0082123 3300046683 Bacteria 1893
1157 Ga0495658_0131448 3300046683 Bacteria 1524
1158 Ga0495669_0053379 3300046684 Bacteria 1818
1159 Ga0495613_0013348 3300046689 Bacteria 6102
1160 Ga0495613_0060400 3300046689 Bacteria 2776
1161 Ga0495613_0076521 3300046689 Bacteria 2435
1162 Ga0495613_0251403 3300046689 Bacteria 1233
1163 Ga0495613_0397206 3300046689 Bacteria 941
1164 Ga0495613_0465385 3300046689 Bacteria 855
1165 Ga0495613_0506700 3300046689 Bacteria 812
1166 Ga0495624_0028280 3300046690 Bacteria 3666
1167 Ga0495624_0238841 3300046690 Bacteria 1100
1168 Ga0495589_0007869 3300046794 Bacteria 5580
1169 Ga0495589_0030930 3300046794 Bacteria 2696
1170 Ga0495600_0059332 3300046809 Bacteria 2499
1171 Ga0495581_0098473 3300047315 Bacteria 1698
1172 Ga0495581_0376020 3300047315 Unclassified 829
1173 Ga0495604_0034480 3300047317 Bacteria 4003
1174 Ga0495604_0042806 3300047317 Bacteria 3547
1175 Ga0495604_0043274 3300047317 Bacteria 3526
1176 Ga0495604_0187013 3300047317 Bacteria 1446
1177 Ga0495604_0203778 3300047317 Unclassified 1371
1178 Ga0495674_0004451 3300047319 Bacteria 13482
1179 Ga0495674_0025185 3300047319 Bacteria 5460
1180 Ga0495674_0043481 3300047319 Bacteria 3998
1181 Ga0495674_0055289 3300047319 Bacteria 3482
1182 Ga0495674_0094283 3300047319 Bacteria 2553
1183 Ga0495674_0255651 3300047319 Bacteria 1440
1184 Ga0495676_0003895 3300047321 Bacteria 13567
1185 Ga0495676_0032039 3300047321 Bacteria 4442
1186 Ga0495676_0039920 3300047321 Bacteria 3881
1187 Ga0495676_0072884 3300047321 Bacteria 2635
1188 Ga0495676_0137106 3300047321 Bacteria 1758
1189 Ga0495676_0178386 3300047321 Bacteria 1490
1190 Ga0495676_0225777 3300047321 Bacteria 1288
1191 Ga0495680_0005919 3300047322 Bacteria 11429
1192 Ga0495680_0006645 3300047322 Bacteria 10710
1193 Ga0495680_0019953 3300047322 Bacteria 5650
1194 Ga0495680_0280071 3300047322 Bacteria 1175
1195 Ga0495680_0384996 3300047322 Unclassified 971
1196 Ga0495675_0029801 3300047444 Unclassified 3481
1197 Ga0495675_0034489 3300047444 Bacteria 3231
1198 Ga0495675_0223398 3300047444 Bacteria 1139
1199 Ga0495675_0293943 3300047444 Unclassified 966
1200 Ga0495684_0008847 3300047471 Bacteria 7781
1201 Ga0495684_0049103 3300047471 Bacteria 3225
1202 Ga0495593_0231269 3300047673 Bacteria 927
1203 Ga0495602_0058823 3300048088 Bacteria 3361
1204 Ga0495602_0107769 3300048088 Bacteria 2270
1205 Ga0495602_0198738 3300048088 Bacteria 1531
1206 Ga0495602_0213287 3300048088 Unclassified 1463
1207 Ga0495602_0215437 3300048088 Bacteria 1454
1208 Ga0496100_0005439 3300048903 Bacteria 6860
1209 Ga0496100_0017682 3300048903 Bacteria 4215
1210 Ga0496100_0019060 3300048903 Bacteria 4085
1211 Ga0496100_0031408 3300048903 Bacteria 3302
1212 Ga0496100_0066748 3300048903 Bacteria 2387
1213 Ga0496100_0372367 3300048903 Unclassified 1083
1214 Ga0496101_0005268 3300048904 Bacteria 8234
1215 Ga0496101_0011606 3300048904 Bacteria 5851
1216 Ga0496101_0017750 3300048904 Bacteria 4827
1217 Ga0496101_0020243 3300048904 Bacteria 4551
1218 Ga0496101_0021389 3300048904 Bacteria 4445
1219 Ga0496101_0068341 3300048904 Unclassified 2597
1220 Ga0496101_0122910 3300048904 Bacteria 1964
1221 Ga0496101_0209056 3300048904 Bacteria 1511
1222 Ga0496101_0264247 3300048904 Bacteria 1343
1223 Ga0496102_0005991 3300048905 Bacteria 10353
1224 Ga0496102_0019028 3300048905 Bacteria 6043
1225 Ga0496102_0019449 3300048905 Bacteria 5981
1226 Ga0496102_0029581 3300048905 Bacteria 4902
1227 Ga0496102_0069500 3300048905 Bacteria 3232
1228 Ga0496102_0096187 3300048905 Bacteria 2745
1229 Ga0496102_0235577 3300048905 Bacteria 1726
1230 Ga0496102_0257663 3300048905 Bacteria 1645
1231 Ga0496102_0542232 3300048905 Archaea 1086
1232 Ga0496103_0013174 3300048906 Bacteria 4902
1233 Ga0496103_0039044 3300048906 Bacteria 2916
1234 Ga0496103_0066965 3300048906 Bacteria 2242
1235 Ga0496103_0090187 3300048906 Unclassified 1934
1236 Ga0496104_0001293 3300048907 Bacteria 21572
1237 Ga0496104_0011990 3300048907 Bacteria 7776
1238 Ga0496104_0015894 3300048907 Bacteria 6830
1239 Ga0496104_0020926 3300048907 Bacteria 6001
1240 Ga0496104_0039608 3300048907 Bacteria 4412
1241 Ga0496104_0086788 3300048907 Bacteria 2987
1242 Ga0496104_0087742 3300048907 Unclassified 2971
1243 Ga0496104_0104059 3300048907 Bacteria 2720
1244 Ga0496104_0191235 3300048907 Unclassified 1958
1245 Ga0496104_0416726 3300048907 Bacteria 1255
1246 Ga0496104_0421615 3300048907 Unclassified 1246
1247 Ga0496104_0923534 3300048907 Bacteria 778
1248 Ga0496105_0001494 3300048908 Bacteria 16523
1249 Ga0496105_0002671 3300048908 Bacteria 12983
1250 Ga0496105_0008290 3300048908 Bacteria 8077
1251 Ga0496105_0025878 3300048908 Bacteria 4780
1252 Ga0496105_0039885 3300048908 Bacteria 3871
1253 Ga0496105_0040125 3300048908 Bacteria 3859
1254 Ga0496105_0044664 3300048908 Bacteria 3655
1255 Ga0496105_0108697 3300048908 Bacteria 2289
1256 Ga0496105_0113952 3300048908 Unclassified 2230
1257 Ga0496105_0179752 3300048908 Unclassified 1733
1258 Ga0496105_0351953 3300048908 Bacteria 1176
1259 Ga0496105_0518868 3300048908 Bacteria 933
1260 Ga0496106_0003662 3300048909 Bacteria 11458
1261 Ga0496106_0012801 3300048909 Bacteria 6193
1262 Ga0496106_0031455 3300048909 Bacteria 3955
1263 Ga0496106_0034897 3300048909 Bacteria 3759
1264 Ga0496106_0042412 3300048909 Bacteria 3412
1265 Ga0496106_0051599 3300048909 Bacteria 3102
1266 Ga0496106_0131237 3300048909 Unclassified 1965
1267 Ga0496106_0300703 3300048909 Unclassified 1287
1268 Ga0496107_0005800 3300048910 Bacteria 8453
1269 Ga0496107_0017385 3300048910 Bacteria 5058
1270 Ga0496107_0019319 3300048910 Bacteria 4808
1271 Ga0496107_0019681 3300048910 Bacteria 4763
1272 Ga0496107_0024006 3300048910 Bacteria 4310
1273 Ga0496107_0036112 3300048910 Bacteria 3544
1274 Ga0496107_0109827 3300048910 Bacteria 2026
1275 Ga0496107_0220230 3300048910 Bacteria 1412
1276 Ga0496107_0226220 3300048910 Bacteria 1392
1277 Ga0496108_0001327 3300048911 Bacteria 19451
1278 Ga0496108_0006069 3300048911 Bacteria 9769
1279 Ga0496108_0006797 3300048911 Bacteria 9262
1280 Ga0496108_0008941 3300048911 Bacteria 8119
1281 Ga0496108_0018951 3300048911 Bacteria 5643
1282 Ga0496108_0027773 3300048911 Bacteria 4678
1283 Ga0496108_0063353 3300048911 Bacteria 3114
1284 Ga0496108_0128616 3300048911 Unclassified 2176
1285 Ga0496108_0513582 3300048911 Bacteria 1046
1286 Ga0496109_0002789 3300048912 Bacteria 14634
1287 Ga0496109_0003215 3300048912 Bacteria 13604
1288 Ga0496109_0004424 3300048912 Bacteria 11742
1289 Ga0496109_0006043 3300048912 Bacteria 10173
1290 Ga0496109_0013816 3300048912 Bacteria 7015
1291 Ga0496109_0021106 3300048912 Bacteria 5758
1292 Ga0496109_0027854 3300048912 Bacteria 5050
1293 Ga0496109_0031229 3300048912 Bacteria 4778
1294 Ga0496109_0037658 3300048912 Bacteria 4370
1295 Ga0496109_0069840 3300048912 Bacteria 3222
1296 Ga0496109_0076574 3300048912 Bacteria 3077
1297 Ga0496109_0125038 3300048912 Bacteria 2397
1298 Ga0496109_0144970 3300048912 Unclassified 2221
1299 Ga0496109_0278516 3300048912 Bacteria 1576
1300 Ga0496109_0311327 3300048912 Bacteria 1485
1301 Ga0496109_0478323 3300048912 Unclassified 1176
1302 Ga0496109_0497008 3300048912 Unclassified 1151
1303 Ga0496109_0644829 3300048912 Unclassified 996
1304 Ga0496110_0000607 3300048913 Bacteria 24647
1305 Ga0496110_0000686 3300048913 Bacteria 23305
1306 Ga0496110_0001231 3300048913 Bacteria 18265
1307 Ga0496110_0005411 3300048913 Bacteria 10014
1308 Ga0496110_0015765 3300048913 Bacteria 6299
1309 Ga0496110_0023470 3300048913 Bacteria 5247
1310 Ga0496110_0047139 3300048913 Bacteria 3772
1311 Ga0496110_0073042 3300048913 Bacteria 3044
1312 Ga0496110_0098293 3300048913 Bacteria 2623
1313 Ga0496110_0104580 3300048913 Unclassified 2540
1314 Ga0496110_0179573 3300048913 Bacteria 1922
1315 Ga0496110_0246488 3300048913 Unclassified 1626
1316 Ga0496110_0255102 3300048913 Bacteria 1596
1317 Ga0496110_0403969 3300048913 Bacteria 1245
1318 Ga0496110_0409782 3300048913 Unclassified 1236
1319 Ga0496110_0517893 3300048913 Bacteria 1085
1320 Ga0496110_0750656 3300048913 Unclassified 879
1321 Ga0496111_0000665 3300048914 Bacteria 18058
1322 Ga0496111_0003353 3300048914 Bacteria 9906
1323 Ga0496111_0006770 3300048914 Bacteria 7468
1324 Ga0496111_0015441 3300048914 Bacteria 5242
1325 Ga0496111_0036332 3300048914 Bacteria 3522
1326 Ga0496111_0043351 3300048914 Bacteria 3233
1327 Ga0496111_0053709 3300048914 Bacteria 2911
1328 Ga0496111_0076589 3300048914 Unclassified 2438
1329 Ga0496111_0117752 3300048914 Bacteria 1960
1330 Ga0496111_0146702 3300048914 Bacteria 1749
1331 Ga0496111_0210087 3300048914 Bacteria 1446
1332 Ga0496111_0247549 3300048914 Unclassified 1323
1333 Ga0496111_0313075 3300048914 Bacteria 1163
1334 Ga0496111_0323154 3300048914 Bacteria 1143
1335 Ga0496111_0528199 3300048914 Bacteria 867
1336 Ga0496112_0002974 3300048915 Bacteria 13822
1337 Ga0496112_0009862 3300048915 Bacteria 8631
1338 Ga0496112_0039231 3300048915 Bacteria 4627
1339 Ga0496112_0105593 3300048915 Bacteria 2786
1340 Ga0496112_0141876 3300048915 Bacteria 2371
1341 Ga0496112_0195725 3300048915 Bacteria 1982
1342 Ga0496112_0220191 3300048915 Bacteria 1854
1343 Ga0496112_0263617 3300048915 Bacteria 1672
1344 Ga0496112_0279136 3300048915 Unclassified 1618
1345 Ga0496112_0349450 3300048915 Unclassified 1421
1346 Ga0496112_0501650 3300048915 Bacteria 1149
1347 Ga0496112_0828601 3300048915 Bacteria 849
1348 Ga0496113_0030491 3300048916 Bacteria 3904
1349 Ga0496113_0043660 3300048916 Bacteria 3318
1350 Ga0496113_0102989 3300048916 Unclassified 2214
1351 Ga0496113_0120019 3300048916 Unclassified 2054
1352 Ga0496114_0001676 3300048917 Bacteria 16823
1353 Ga0496114_0002457 3300048917 Bacteria 14154
1354 Ga0496114_0003730 3300048917 Bacteria 11736
1355 Ga0496114_0004356 3300048917 Bacteria 10956
1356 Ga0496114_0007678 3300048917 Bacteria 8528
1357 Ga0496114_0009413 3300048917 Bacteria 7755
1358 Ga0496114_0012976 3300048917 Bacteria 6677
1359 Ga0496114_0027912 3300048917 Bacteria 4627
1360 Ga0496114_0038680 3300048917 Bacteria 3947
1361 Ga0496114_0039785 3300048917 Bacteria 3891
1362 Ga0496114_0057985 3300048917 Bacteria 3233
1363 Ga0496114_0058587 3300048917 Bacteria 3216
1364 Ga0496114_0063704 3300048917 Bacteria 3087
1365 Ga0496114_0067784 3300048917 Bacteria 2994
1366 Ga0496114_0116204 3300048917 Unclassified 2297
1367 Ga0496114_0191134 3300048917 Bacteria 1791
1368 Ga0496114_0321617 3300048917 Unclassified 1367
1369 Ga0496114_0373626 3300048917 Unclassified 1262
1370 Ga0496115_0000961 3300048918 Bacteria 20922
1371 Ga0496115_0005151 3300048918 Bacteria 9511
1372 Ga0496115_0018520 3300048918 Bacteria 5349
1373 Ga0496115_0046954 3300048918 Bacteria 3452
1374 Ga0496115_0086635 3300048918 Bacteria 2555
1375 Ga0496115_0089319 3300048918 Bacteria 2516
1376 Ga0496115_0113751 3300048918 Bacteria 2224
1377 Ga0496115_0147712 3300048918 Bacteria 1941
1378 Ga0496115_0160846 3300048918 Unclassified 1855
1379 Ga0496115_0229858 3300048918 Bacteria 1530
1380 Ga0496115_0232782 3300048918 Unclassified 1519
1381 Ga0496115_0249221 3300048918 Bacteria 1462
1382 Ga0496115_0255454 3300048918 Bacteria 1442
1383 Ga0496115_0277100 3300048918 Unclassified 1377
1384 Ga0501031_0000345 3300049568 Bacteria 26982
1385 Ga0501031_0000615 3300049568 Bacteria 21046
1386 Ga0501031_0012796 3300049568 Bacteria 5482
1387 Ga0501031_0018104 3300049568 Bacteria 4582
1388 Ga0501031_0065546 3300049568 Unclassified 2366
1389 Ga0501031_0127793 3300049568 Bacteria 1660
1390 Ga0501032_0016904 3300049569 Bacteria 5128
1391 Ga0501032_0050972 3300049569 Unclassified 2791
1392 Ga0501032_0077747 3300049569 Unclassified 2209
1393 Ga0501033_0014528 3300049570 Bacteria 5977
1394 Ga0501033_0021157 3300049570 Bacteria 4909
1395 Ga0501033_0050866 3300049570 Bacteria 3072
1396 Ga0501033_0072389 3300049570 Unclassified 2531
1397 Ga0501034_0046410 3300049571 Bacteria 4390
1398 Ga0501034_0079909 3300049571 Bacteria 3274
1399 Ga0501034_0109014 3300049571 Bacteria 2760
1400 Ga0501034_0319457 3300049571 Bacteria 1486
1401 Ga0501036_0000798 3300049572 Bacteria 23392
1402 Ga0501036_0005203 3300049572 Bacteria 10515
1403 Ga0501036_0010111 3300049572 Bacteria 7776
1404 Ga0501036_0012670 3300049572 Bacteria 6995
1405 Ga0501036_0016694 3300049572 Bacteria 6131
1406 Ga0501036_0071310 3300049572 Bacteria 2937
1407 Ga0501036_0078014 3300049572 Unclassified 2802
1408 Ga0501036_0100066 3300049572 Bacteria 2452
1409 Ga0501036_0165946 3300049572 Unclassified 1861
1410 Ga0501036_0197560 3300049572 Bacteria 1692
1411 Ga0501036_0203132 3300049572 Bacteria 1666
1412 Ga0501036_0269707 3300049572 Bacteria 1425
1413 Ga0501037_0003886 3300049573 Bacteria 10839
1414 Ga0501037_0036273 3300049573 Bacteria 3634
1415 Ga0501037_0184176 3300049573 Bacteria 1481
1416 Ga0501037_0279147 3300049573 Bacteria 1164
1417 Ga0501037_0293183 3300049573 Bacteria 1131
1418 Ga0501038_0013992 3300049574 Bacteria 7312
1419 Ga0501038_0018352 3300049574 Bacteria 6316
1420 Ga0501038_0018769 3300049574 Bacteria 6243
1421 Ga0501038_0064564 3300049574 Bacteria 3121
1422 Ga0501038_0214425 3300049574 Bacteria 1539
1423 Ga0501038_0238833 3300049574 Bacteria 1443
1424 Ga0501038_0361244 3300049574 Unclassified 1129
1425 Ga0501039_0003205 3300049575 Bacteria 12242
1426 Ga0501039_0011836 3300049575 Bacteria 6644
1427 Ga0501039_0016268 3300049575 Bacteria 5697
1428 Ga0501039_0017988 3300049575 Bacteria 5421
1429 Ga0501039_0019591 3300049575 Bacteria 5188
1430 Ga0501039_0034884 3300049575 Bacteria 3882
1431 Ga0501039_0248020 3300049575 Unclassified 1400
1432 Ga0501040_0001055 3300049576 Bacteria 17455
1433 Ga0501040_0003253 3300049576 Bacteria 10502
1434 Ga0501040_0004545 3300049576 Bacteria 9006
1435 Ga0501040_0010284 3300049576 Bacteria 6119
1436 Ga0501040_0022657 3300049576 Bacteria 4207
1437 Ga0501040_0045329 3300049576 Unclassified 2999
1438 Ga0501040_0095280 3300049576 Bacteria 2071
1439 Ga0501040_0134878 3300049576 Unclassified 1738
1440 Ga0501040_0170309 3300049576 Bacteria 1542
1441 Ga0501040_0224265 3300049576 Unclassified 1337
1442 Ga0501040_0270275 3300049576 Bacteria 1214
1443 Ga0501041_0004444 3300049577 Bacteria 8117
1444 Ga0501041_0006237 3300049577 Bacteria 6970
1445 Ga0501041_0008151 3300049577 Bacteria 6163
1446 Ga0501041_0009854 3300049577 Bacteria 5626
1447 Ga0501041_0022782 3300049577 Bacteria 3752
1448 Ga0501041_0095737 3300049577 Bacteria 1835
1449 Ga0501041_0135402 3300049577 Unclassified 1535
1450 Ga0501041_0144277 3300049577 Bacteria 1485
1451 Ga0501041_0211776 3300049577 Bacteria 1215
1452 Ga0501041_0215761 3300049577 Bacteria 1204
1453 Ga0501041_0255727 3300049577 Bacteria 1101
1454 Ga0501042_0007552 3300049578 Bacteria 7132
1455 Ga0501042_0013615 3300049578 Bacteria 5538
1456 Ga0501042_0020443 3300049578 Bacteria 4607
1457 Ga0501042_0040672 3300049578 Bacteria 3304
1458 Ga0501042_0098871 3300049578 Bacteria 2098
1459 Ga0501042_0103151 3300049578 Bacteria 2052
1460 Ga0501042_0247212 3300049578 Bacteria 1287
1461 Ga0501043_0007147 3300049579 Bacteria 8881
1462 Ga0501043_0024169 3300049579 Bacteria 4768
1463 Ga0501043_0031763 3300049579 Bacteria 4151
1464 Ga0501043_0118461 3300049579 Bacteria 2077
1465 Ga0501043_0614931 3300049579 Unclassified 801
1466 Ga0501046_0000652 3300049580 Bacteria 33827
1467 Ga0501046_0004105 3300049580 Bacteria 13269
1468 Ga0501046_0013964 3300049580 Bacteria 6784
1469 Ga0501046_0019876 3300049580 Bacteria 5563
1470 Ga0501046_0115969 3300049580 Bacteria 2042
1471 Ga0501047_0047759 3300049581 Bacteria 4135
1472 Ga0501047_0094945 3300049581 Bacteria 2861
1473 Ga0501047_0169719 3300049581 Bacteria 2051
1474 Ga0501047_0446711 3300049581 Unclassified 1123
1475 Ga0501048_0006478 3300049582 Bacteria 8899
1476 Ga0501048_0007579 3300049582 Bacteria 8228
1477 Ga0501048_0013192 3300049582 Bacteria 6133
1478 Ga0501048_0028649 3300049582 Bacteria 4042
1479 Ga0501048_0047994 3300049582 Unclassified 3046
1480 Ga0501048_0071298 3300049582 Bacteria 2453
1481 Ga0501048_0076880 3300049582 Unclassified 2356
1482 Ga0501067_0019442 3300049583 Bacteria 3761
1483 Ga0501067_0020400 3300049583 Bacteria 3668
1484 Ga0501067_0024772 3300049583 Bacteria 3327
1485 Ga0501067_0093019 3300049583 Bacteria 1674
1486 Ga0501067_0136611 3300049583 Unclassified 1365
1487 Ga0501067_0155882 3300049583 Bacteria 1272
1488 Ga0501068_0001869 3300049584 Bacteria 11202
1489 Ga0501068_0004858 3300049584 Bacteria 7318
1490 Ga0501068_0022285 3300049584 Bacteria 3703
1491 Ga0501068_0046973 3300049584 Bacteria 2603
1492 Ga0501068_0058960 3300049584 Unclassified 2330
1493 Ga0501068_0068606 3300049584 Unclassified 2161
1494 Ga0501068_0072779 3300049584 Bacteria 2099
1495 Ga0501068_0204177 3300049584 Bacteria 1254
1496 Ga0501068_0208105 3300049584 Unclassified 1242
1497 Ga0501068_0442817 3300049584 Bacteria 840
1498 Ga0501069_0001257 3300049585 Bacteria 12419
1499 Ga0501069_0003809 3300049585 Bacteria 7759
1500 Ga0501069_0007494 3300049585 Bacteria 5731
1501 Ga0501069_0011745 3300049585 Bacteria 4644
1502 Ga0501069_0024983 3300049585 Bacteria 3262
1503 Ga0501069_0049781 3300049585 Unclassified 2329
1504 Ga0501069_0052474 3300049585 Bacteria 2270
1505 Ga0501069_0135988 3300049585 Bacteria 1409
1506 Ga0501070_0001079 3300049586 Bacteria 24456
1507 Ga0501070_0013182 3300049586 Bacteria 6967
1508 Ga0501070_0016785 3300049586 Bacteria 6146
1509 Ga0501070_0022709 3300049586 Bacteria 5253
1510 Ga0501070_0030096 3300049586 Bacteria 4549
1511 Ga0501070_0049374 3300049586 Bacteria 3494
1512 Ga0501070_0077181 3300049586 Bacteria 2757
1513 Ga0501070_0123561 3300049586 Bacteria 2139
1514 Ga0501070_0142056 3300049586 Bacteria 1982
1515 Ga0501070_0142571 3300049586 Bacteria 1978
1516 Ga0501070_0309516 3300049586 Bacteria 1286
1517 Ga0501071_0001467 3300049587 Bacteria 13687
1518 Ga0501071_0009780 3300049587 Bacteria 6399
1519 Ga0501071_0061155 3300049587 Bacteria 2727
1520 Ga0501071_0062543 3300049587 Bacteria 2697
1521 Ga0501071_0063452 3300049587 Bacteria 2678
1522 Ga0501071_0079746 3300049587 Bacteria 2393
1523 Ga0501071_0091331 3300049587 Bacteria 2237
1524 Ga0501071_0098447 3300049587 Bacteria 2154
1525 Ga0501071_0103912 3300049587 Bacteria 2096
1526 Ga0501071_0123405 3300049587 Bacteria 1921
1527 Ga0501071_0596546 3300049587 Bacteria 849
1528 Ga0501072_0001288 3300049588 Bacteria 18753
1529 Ga0501072_0007841 3300049588 Bacteria 8110
1530 Ga0501072_0015236 3300049588 Bacteria 5893
1531 Ga0501072_0059835 3300049588 Bacteria 3003
1532 Ga0501072_0169463 3300049588 Bacteria 1743
1533 Ga0501072_0185138 3300049588 Unclassified 1661
1534 Ga0501072_0257448 3300049588 Bacteria 1389
1535 Ga0501072_0349146 3300049588 Unclassified 1175
1536 Ga0501073_0006605 3300049589 Bacteria 8633
1537 Ga0501073_0036395 3300049589 Bacteria 3497
1538 Ga0501073_0157058 3300049589 Bacteria 1576
1539 Ga0501074_0005057 3300049590 Bacteria 9463
1540 Ga0501074_0012591 3300049590 Bacteria 6149
1541 Ga0501074_0015529 3300049590 Bacteria 5535
1542 Ga0501074_0016417 3300049590 Bacteria 5376
1543 Ga0501074_0019711 3300049590 Bacteria 4897
1544 Ga0501074_0032686 3300049590 Bacteria 3768
1545 Ga0501074_0044906 3300049590 Bacteria 3197
1546 Ga0501074_0170294 3300049590 Unclassified 1554
1547 Ga0501074_0288142 3300049590 Bacteria 1167
1548 Ga0501074_0301423 3300049590 Bacteria 1138
1549 Ga0501075_0001411 3300049591 Bacteria 15652
1550 Ga0501075_0007062 3300049591 Bacteria 7759
1551 Ga0501075_0007654 3300049591 Bacteria 7496
1552 Ga0501075_0017206 3300049591 Bacteria 5219
1553 Ga0501075_0035506 3300049591 Bacteria 3719
1554 Ga0501075_0041275 3300049591 Bacteria 3457
1555 Ga0501075_0080937 3300049591 Bacteria 2458
1556 Ga0501075_0106072 3300049591 Bacteria 2135
1557 Ga0501075_0378412 3300049591 Unclassified 1079
1558 Ga0501075_0467596 3300049591 Bacteria 962
1559 Ga0501076_0000812 3300049592 Bacteria 20232
1560 Ga0501076_0002379 3300049592 Bacteria 12876
1561 Ga0501076_0022035 3300049592 Bacteria 4893
1562 Ga0501076_0024142 3300049592 Bacteria 4695
1563 Ga0501076_0037773 3300049592 Bacteria 3789
1564 Ga0501076_0044812 3300049592 Unclassified 3490
1565 Ga0501076_0189506 3300049592 Bacteria 1678
1566 Ga0501076_0204749 3300049592 Bacteria 1612
1567 Ga0501076_0254768 3300049592 Bacteria 1436
1568 Ga0501076_0267305 3300049592 Bacteria 1400
1569 Ga0501076_0272459 3300049592 Unclassified 1386
1570 Ga0501076_0342297 3300049592 Bacteria 1227
1571 Ga0501076_0438541 3300049592 Unclassified 1075
1572 Ga0501077_0000499 3300049593 Bacteria 23813
1573 Ga0501077_0003790 3300049593 Bacteria 9105
1574 Ga0501077_0004497 3300049593 Bacteria 8470
1575 Ga0501077_0004745 3300049593 Bacteria 8264
1576 Ga0501077_0014155 3300049593 Bacteria 5006
1577 Ga0501077_0020724 3300049593 Bacteria 4162
1578 Ga0501077_0052671 3300049593 Bacteria 2584
1579 Ga0501077_0054742 3300049593 Bacteria 2533
1580 Ga0501077_0078011 3300049593 Bacteria 2099
1581 Ga0501077_0115274 3300049593 Bacteria 1703
1582 Ga0501077_0286431 3300049593 Bacteria 1049
1583 Ga0501079_0000803 3300049741 Bacteria 21406
1584 Ga0501079_0010238 3300049741 Bacteria 7119
1585 Ga0501079_0016932 3300049741 Bacteria 5568
1586 Ga0501079_0018380 3300049741 Bacteria 5342
1587 Ga0501079_0033804 3300049741 Bacteria 3934
1588 Ga0501079_0045496 3300049741 Bacteria 3387
1589 Ga0501079_0054055 3300049741 Bacteria 3097
1590 Ga0501079_0074562 3300049741 Bacteria 2623
1591 Ga0501079_0141918 3300049741 Bacteria 1871
1592 Ga0501079_0247931 3300049741 Bacteria 1392
1593 Ga0501079_0417116 3300049741 Bacteria 1053
1594 Ga0501079_0545740 3300049741 Bacteria 911
1595 Ga0501080_0003048 3300049742 Bacteria 14789
1596 Ga0501080_0005883 3300049742 Bacteria 10986
1597 Ga0501080_0009672 3300049742 Bacteria 8802
1598 Ga0501080_0010704 3300049742 Bacteria 8391
1599 Ga0501080_0039743 3300049742 Bacteria 4390
1600 Ga0501080_0046497 3300049742 Bacteria 4041
1601 Ga0501080_0065049 3300049742 Bacteria 3392
1602 Ga0501080_0081348 3300049742 Bacteria 3009
1603 Ga0501080_0202432 3300049742 Unclassified 1822
1604 Ga0501080_0360520 3300049742 Unclassified 1312
1605 Ga0501080_0448489 3300049742 Unclassified 1157
1606 Ga0501081_0010433 3300049743 Bacteria 6059
1607 Ga0501081_0010461 3300049743 Bacteria 6053
1608 Ga0501081_0134977 3300049743 Unclassified 1766
1609 Ga0501081_0199805 3300049743 Bacteria 1449
1610 Ga0501081_0250287 3300049743 Unclassified 1293
1611 Ga0501083_0001262 3300049744 Bacteria 17164
1612 Ga0501083_0008045 3300049744 Bacteria 7458
1613 Ga0501083_0008383 3300049744 Bacteria 7308
1614 Ga0501083_0013676 3300049744 Bacteria 5675
1615 Ga0501083_0081982 3300049744 Bacteria 2138
1616 Ga0501083_0093101 3300049744 Bacteria 1990
1617 Ga0501083_0146467 3300049744 Bacteria 1546
1618 Ga0501083_0165411 3300049744 Bacteria 1446
1619 Ga0501035_0006890 3300049822 Bacteria 10616
1620 Ga0501035_0014173 3300049822 Bacteria 7356
1621 Ga0501035_0087847 3300049822 Bacteria 2740
1622 Ga0501035_0109683 3300049822 Unclassified 2419
1623 Ga0501035_0207599 3300049822 Bacteria 1677
1624 Ga0501044_0043798 3300049823 Bacteria 4648
1625 Ga0501044_0049698 3300049823 Bacteria 4329
1626 Ga0501044_0067848 3300049823 Bacteria 3634
1627 Ga0501044_0388080 3300049823 Unclassified 1311
1628 Ga0501045_0004392 3300049824 Bacteria 9722
1629 Ga0501045_0005064 3300049824 Bacteria 9123
1630 Ga0501045_0018778 3300049824 Bacteria 4921
1631 Ga0501045_0023088 3300049824 Bacteria 4457
1632 Ga0501045_0032796 3300049824 Bacteria 3764
1633 Ga0501045_0072610 3300049824 Unclassified 2533
1634 Ga0501045_0126160 3300049824 Bacteria 1901
1635 Ga0501045_0138710 3300049824 Bacteria 1808
1636 nmdc:mga03n38_101905_c1 3300050490 Unclassified 1385
1637 nmdc:mga00v17_240143_c1 3300050491 Bacteria 1174
1638 nmdc:mga0yw44_257714_c1 3300050492 Unclassified 1162
1639 nmdc:mga06z11_284480_c1 3300050494 Unclassified 980
1640 nmdc:mga05p37_101073_c1 3300050507 Bacteria 3552
1641 nmdc:mga05p37_1092092_c1 3300050507 Bacteria 836
1642 nmdc:mga05p37_133731_c1 3300050507 Bacteria 3042
1643 nmdc:mga05p37_1560_c1 3300050507 Bacteria 26624
1644 nmdc:mga05p37_162922_c1 3300050507 Bacteria 2723
1645 nmdc:mga05p37_206607_c1 3300050507 Bacteria 2375
1646 nmdc:mga05p37_251987_c1 3300050507 Bacteria 2117
1647 nmdc:mga05p37_41002_c1 3300050507 Bacteria 5685
1648 nmdc:mga05p37_48042_c1 3300050507 Bacteria 5249
1649 nmdc:mga05p37_493713_c1 3300050507 Bacteria 1407
1650 nmdc:mga05p37_97853_c1 3300050507 Bacteria 3614
1651 nmdc:mga09592_49260_c1 3300050508 Bacteria 3552
1652 nmdc:mga09592_629_c3 3300050508 Bacteria 11653
1653 nmdc:mga09592_77520_c1 3300050508 Unclassified 2827
1654 nmdc:mga0qj67_30247_c1 3300050509 Bacteria 4213
1655 nmdc:mga06r32_141265_c1 3300050510 Bacteria 2384
1656 nmdc:mga06r32_1948_c1 3300050510 Bacteria 18394
1657 nmdc:mga08y16_13610_c1 3300050511 Bacteria 8562
1658 nmdc:mga08y16_174258_c1 3300050511 Bacteria 2234
1659 nmdc:mga08y16_35984_c1 3300050511 Bacteria 5199
1660 nmdc:mga08y16_569620_c1 3300050511 Unclassified 1144
1661 nmdc:mga08y16_8316_c1 3300050511 Bacteria 10862
1662 nmdc:mga08y16_97894_c1 3300050511 Bacteria 3055
1663 nmdc:mga0n895_1537_c1 3300050512 Bacteria 17340
1664 nmdc:mga0n895_179483_c1 3300050512 Unclassified 2149
1665 nmdc:mga0n895_240067_c1 3300050512 Bacteria 1839
1666 nmdc:mga0n895_406044_c1 3300050512 Unclassified 1378
1667 nmdc:mga0n895_428467_c1 3300050512 Unclassified 1337
1668 nmdc:mga0n895_55813_c1 3300050512 Bacteria 3888
1669 nmdc:mga0rr50_1170_c1 3300050513 Bacteria 14267
1670 nmdc:mga0rr50_180830_c1 3300050513 Bacteria 1724
1671 nmdc:mga0rr50_2130_c1 3300050513 Bacteria 11067
1672 nmdc:mga0rr50_227647_c1 3300050513 Bacteria 1542
1673 nmdc:mga0rr50_42090_c1 3300050513 Bacteria 3333
1674 nmdc:mga0rr50_74002_c1 3300050513 Unclassified 2606
1675 nmdc:mga08x19_101312_c1 3300050514 Bacteria 1911
1676 nmdc:mga08x19_135960_c1 3300050514 Bacteria 1657
1677 nmdc:mga08x19_4011_c1 3300050514 Bacteria 8760
1678 nmdc:mga08x19_6462_c1 3300050514 Bacteria 6938
1679 nmdc:mga08x19_69986_c1 3300050514 Unclassified 2286
1680 nmdc:mga08x19_72831_c1 3300050514 Bacteria 2242
1681 nmdc:mga0a205_108307_c1 3300050515 Unclassified 2677
1682 nmdc:mga0a205_12007_c1 3300050515 Bacteria 8000
1683 nmdc:mga0a205_120607_c1 3300050515 Bacteria 2522
1684 nmdc:mga0a205_143589_c1 3300050515 Bacteria 2287
1685 nmdc:mga0a205_202153_c1 3300050515 Bacteria 1877
1686 nmdc:mga0a205_22203_c1 3300050515 Bacteria 6008
1687 nmdc:mga0a205_321961_c1 3300050515 Bacteria 1417
1688 nmdc:mga0a205_734803_c1 3300050515 Bacteria 836
1689 nmdc:mga0a205_98752_c1 3300050515 Bacteria 2818
1690 Ga0495601_0020058 3300053077 Bacteria 4079
1691 Ga0495601_0028098 3300053077 Bacteria 3482
1692 Ga0495601_0045737 3300053077 Bacteria 2753
1693 Ga0495601_0051205 3300053077 Bacteria 2606
1694 Ga0495601_0125400 3300053077 Bacteria 1670
1695 Ga0495612_0017122 3300053078 Bacteria 2903
1696 Ga0495612_0128100 3300053078 Bacteria 1095
1697 Ga0495595_0019166 3300053084 Unclassified 2966
1698 Ga0495595_0032162 3300053084 Bacteria 2361
1699 Ga0495595_0164755 3300053084 Bacteria 1095
1700 Ga0495619_0014992 3300053085 Bacteria 4897
1701 Ga0495619_0034422 3300053085 Bacteria 3293
1702 Ga0495619_0058661 3300053085 Bacteria 2555
1703 Ga0495619_0071902 3300053085 Bacteria 2315
1704 Ga0501084_0005692 3300054114 Bacteria 10238
1705 Ga0501084_0015481 3300054114 Bacteria 6325
1706 Ga0501084_0024209 3300054114 Bacteria 5064
1707 Ga0501084_0031104 3300054114 Bacteria 4464
1708 Ga0501084_0031839 3300054114 Bacteria 4410
1709 Ga0501084_0034448 3300054114 Bacteria 4234
1710 Ga0501084_0040892 3300054114 Bacteria 3879
1711 Ga0501084_0068454 3300054114 Bacteria 2972
1712 Ga0501084_0074550 3300054114 Bacteria 2842
1713 Ga0501084_0163222 3300054114 Unclassified 1879
1714 Ga0501084_0172197 3300054114 Unclassified 1827
1715 Ga0501084_0180909 3300054114 Bacteria 1780
1716 Ga0501084_0203114 3300054114 Unclassified 1672
1717 Ga0501084_0496632 3300054114 Bacteria 1031
1718 Ga0501084_0563734 3300054114 Bacteria 962
1719 Ga0590071_008630 3300059421 Bacteria 2397
1720 Ga0590071_021250 3300059421 Bacteria 1530
1721 Ga0590075_007204 3300059424 Bacteria 2641
1722 Ga0590075_012428 3300059424 Bacteria 2068
1723 Ga0590077_023368 3300059426 Unclassified 1323
1724 Ga0501082_0001765 3300060353 Bacteria 19028
1725 Ga0501082_0003599 3300060353 Bacteria 13536
1726 Ga0501082_0003644 3300060353 Bacteria 13450
1727 Ga0501082_0027247 3300060353 Bacteria 4920
1728 Ga0501082_0036967 3300060353 Bacteria 4207
1729 Ga0501082_0088482 3300060353 Bacteria 2672
1730 Ga0501082_0098416 3300060353 Unclassified 2529
1731 Ga0501082_0120479 3300060353 Bacteria 2274
1732 Ga0501082_0202593 3300060353 Bacteria 1727
1733 Ga0501082_0445868 3300060353 Unclassified 1131
1734 Ga0501082_0676243 3300060353 Unclassified 903
1735 Ga0466962_0001252 3300061719 Bacteria 11717
1736 Ga0466962_0006223 3300061719 Bacteria 5732
1737 Ga0466962_0061799 3300061719 Bacteria 1788
1738 Ga0530510_0004557 3300061734 Bacteria 9589
1739 Ga0530510_0012442 3300061734 Bacteria 5977
1740 Ga0530510_0070661 3300061734 Bacteria 2533
1741 Ga0530510_0076791 3300061734 Bacteria 2427
1742 Ga0530510_0078804 3300061734 Bacteria 2396
1743 Ga0530510_0089484 3300061734 Bacteria 2244
1744 Ga0530510_0116728 3300061734 Bacteria 1957
1745 Ga0530510_0147421 3300061734 Bacteria 1736
1746 Ga0530510_0148541 3300061734 Unclassified 1729
1747 Ga0530510_0252217 3300061734 Unclassified 1315
1748 Ga0530510_0320316 3300061734 Bacteria 1162
1749 Ga0530510_0397015 3300061734 Bacteria 1039
1750 Ga0530510_0454625 3300061734 Bacteria 968
1751 Ga0501076_0187137
1752 JGI24752J21851_1021037
1753 JGI24746J21847_1008797
1754 JGI24747J21853_1005673
1755 JGI24739J22299_10023322
1756 JGI24743J22301_10002240
1757 JGI24743J22301_10002607
1758 JGI24743J22301_10003655
1759 JGI24745J21846_1004648
1760 JGI24738J21930_10004033
1761 JGI24738J21930_10014493
1762 JGI24749J21850_1025441
1763 JGI24744J21845_10010971
1764 JGI24033J26618_1002043
1765 JGI24742J22300_10006233
1766 JGI25406J46586_10019731
1767 JGI25407J50210_10008378
1768 JGI25407J50210_10009726
1769 JGI25407J50210_10014112
1770 Ga0058862_12831764
1771 Ga0070658_10015054
1772 Ga0070658_10109397
1773 Ga0070658_10120539
1774 Ga0070658_10300504
1775 Ga0070658_10546937
1776 Ga0070683_100005201
1777 Ga0070683_100062646
1778 Ga0070683_100104634
1779 Ga0070683_100108866
1780 Ga0070683_100111274
1781 Ga0070683_100117347
1782 Ga0070683_100128256
1783 Ga0070683_100196314
1784 Ga0070683_100249141
1785 Ga0070683_100426171
1786 Ga0070683_100443193
1787 Ga0070683_100445597
1788 Ga0070670_100005716
1789 Ga0070670_100030695
1790 Ga0070670_100183745
1791 Ga0070677_10134271
1792 Ga0068869_100108886
1793 Ga0068869_100115911
1794 Ga0070680_100008148
1795 Ga0070680_100047408
1796 Ga0070680_100071038
1797 Ga0070680_100095265
1798 Ga0070680_100174114
1799 Ga0070680_100257630
1800 Ga0070682_100002738
1801 Ga0070682_100031525
1802 Ga0070682_100100688
1803 Ga0070682_100271625
1804 Ga0068868_100004372
1805 Ga0068868_100170304
1806 Ga0070660_100003874
1807 Ga0070660_100004655
1808 Ga0070660_100007596
1809 Ga0070660_100008326
1810 Ga0070660_100038835
1811 Ga0070660_100264926
1812 Ga0070689_100013807
1813 Ga0070689_100315260
1814 Ga0070689_100452693
1815 Ga0070689_100479721
1816 Ga0070691_10006093
1817 Ga0070691_10017595
1818 Ga0070687_100160404
1819 Ga0070661_100015521
1820 Ga0070661_100029869
1821 Ga0070661_100067320
1822 Ga0070661_100082044
1823 Ga0070661_100180127
1824 Ga0070661_100247230
1825 Ga0070692_10002026
1826 Ga0070692_10104946
1827 Ga0070668_100008587
1828 Ga0070668_100085170
1829 Ga0070668_100104067
1830 Ga0070669_100350257
1831 Ga0070675_100014084
1832 Ga0070675_100016698
1833 Ga0070675_100114665
1834 Ga0070675_100322462
1835 Ga0070671_100108632
1836 Ga0070671_100271744
1837 Ga0070671_100300141
1838 Ga0070674_100031128
1839 Ga0070674_100034195
1840 Ga0070674_100034478
1841 Ga0070674_100114708
1842 Ga0070674_100223944
1843 Ga0070674_100226548
1844 Ga0070674_100237668
1845 Ga0070674_100319660
1846 Ga0070673_100011553
1847 Ga0070673_100639350
1848 Ga0070688_100002663
1849 Ga0070659_100023844
1850 Ga0070659_100072492
1851 Ga0070659_100149492
1852 Ga0070659_100200187
1853 Ga0070659_100261591
1854 Ga0070659_100269761
1855 Ga0070659_100322311
1856 Ga0070659_100323522
1857 Ga0070659_100399550
1858 Ga0070667_100012127
1859 Ga0070709_10009338
1860 Ga0070714_100050153
1861 Ga0070714_100098935
1862 Ga0070714_100136522
1863 Ga0070714_100391044
1864 Ga0070714_100397285
1865 Ga0070713_100005892
1866 Ga0070713_100281646
1867 Ga0070713_100334099
1868 Ga0070713_100665190
1869 Ga0070710_10002302
1870 Ga0070710_10030936
1871 Ga0070710_10080242
1872 Ga0070710_10099831
1873 Ga0070701_10022094
1874 Ga0070701_10183836
1875 Ga0070711_100023268
1876 Ga0070711_100119492
1877 Ga0070711_100124518
1878 Ga0070705_100071440
1879 Ga0070705_100089979
1880 Ga0070705_100145677
1881 Ga0070700_100004141
1882 Ga0070700_100101635
1883 Ga0070700_100261277
1884 Ga0070700_100280609
1885 Ga0070694_100029605
1886 Ga0070694_100359545
1887 Ga0070708_100029579
1888 Ga0070708_100029675
1889 Ga0070708_100041886
1890 Ga0070708_100119944
1891 Ga0070708_100216222
1892 Ga0070708_100301140
1893 Ga0070708_100386036
1894 Ga0070663_100082044
1895 Ga0070663_100167993
1896 Ga0070663_100184665
1897 Ga0070678_100030384
1898 Ga0070678_100036526
1899 Ga0070678_100069856
1900 Ga0070662_100002025
1901 Ga0070662_100014195
1902 Ga0070662_100273845
1903 Ga0070662_100293119
1904 Ga0070681_10001955
1905 Ga0070681_10005851
1906 Ga0070681_10020993
1907 Ga0070681_10050117
1908 Ga0070681_10066022
1909 Ga0070681_10067851
1910 Ga0070681_10081715
1911 Ga0070681_10148830
1912 Ga0070681_10174626
1913 Ga0070681_10263669
1914 Ga0070681_10461483
1915 Ga0068867_100012414
1916 Ga0068867_100180479
1917 Ga0070685_10004001
1918 Ga0070685_10064574
1919 Ga0070706_100035448
1920 Ga0070706_100038867
1921 Ga0070707_100000328
1922 Ga0070707_100004648
1923 Ga0070707_100049962
1924 Ga0070707_100119199
1925 Ga0070707_100188723
1926 Ga0070707_100742184
1927 Ga0070698_100006381
1928 Ga0070698_100009026
1929 Ga0070698_100013953
1930 Ga0070698_100084311
1931 Ga0070699_100042793
1932 Ga0070699_100107430
1933 Ga0070699_100139293
1934 Ga0070679_100027946
1935 Ga0070679_100073439
1936 Ga0070679_100100235
1937 Ga0070679_100139436
1938 Ga0070679_100340229
1939 Ga0070684_100000801
1940 Ga0070684_100006669
1941 Ga0070684_100008131
1942 Ga0070684_100014243
1943 Ga0070684_100015491
1944 Ga0070684_100016404
1945 Ga0070684_100020628
1946 Ga0070684_100024219
1947 Ga0070684_100033105
1948 Ga0070684_100034687
1949 Ga0070684_100042990
1950 Ga0070684_100061787
1951 Ga0070684_100113209
1952 Ga0070684_100115172
1953 Ga0070684_100203107
1954 Ga0070684_100456391
1955 Ga0070684_100522290
1956 Ga0070697_100357913
1957 Ga0070697_100485149
1958 Ga0068853_100007300
1959 Ga0068853_100204098
1960 Ga0068853_100386066
1961 Ga0070672_100016488
1962 Ga0070672_100026858
1963 Ga0070672_100174020
1964 Ga0070672_100259602
1965 Ga0070672_100334533
1966 Ga0070686_100017245
1967 Ga0070686_100038215
1968 Ga0070686_100044652
1969 Ga0070686_100333561
1970 Ga0070695_100002777
1971 Ga0070695_100173012
1972 Ga0070696_100095770
1973 Ga0070696_100106667
1974 Ga0070693_100048706
1975 Ga0070693_100132002
1976 Ga0070665_100005968
1977 Ga0070704_100005014
1978 Ga0070704_100400247
1979 Ga0068855_100006817
1980 Ga0068855_100012747
1981 Ga0068855_100036661
1982 Ga0068855_100071313
1983 Ga0068855_100142482
1984 Ga0068855_100236353
1985 Ga0068855_100257970
1986 Ga0068855_100300503
1987 Ga0068855_100319362
1988 Ga0068855_100475799
1989 Ga0070664_100044398
1990 Ga0070664_100055547
1991 Ga0070664_100204197
1992 Ga0068857_100009172
1993 Ga0068857_100011172
1994 Ga0068857_100167832
1995 Ga0068854_100002899
1996 Ga0068854_100098513
1997 Ga0068854_100202147
1998 Ga0068856_100006885
1999 Ga0068856_100025554
2000 Ga0068856_100047859
2001 Ga0068856_100086852
2002 Ga0068856_100129422
2003 Ga0070702_100011161
2004 Ga0070702_100011796
2005 Ga0070702_100032003
2006 Ga0070702_100057411
2007 Ga0070702_100190505
2008 Ga0068852_100002688
2009 Ga0068852_100058846
2010 Ga0068852_100335281
2011 Ga0068852_100575411
2012 Ga0068859_100045563
2013 Ga0068864_100048354
2014 Ga0068861_100003381
2015 Ga0068861_100051190
2016 Ga0068870_10004426
2017 Ga0068870_10018231
2018 Ga0068870_10225711
2019 Ga0068863_100014802
2020 Ga0068863_100874871
2021 Ga0068858_100016953
2022 Ga0068858_100043753
2023 Ga0068860_100048020
2024 Ga0068860_100323053
2025 Ga0068862_100091213
2026 Ga0068862_100271902
2027 Ga0068862_100732158
2028 Ga0081455_10015398
2029 Ga0081455_10025233
2030 Ga0081455_10038614
2031 Ga0081455_10045221
2032 Ga0081455_10079373
2033 Ga0081455_10120011
2034 Ga0081455_10143496
2035 Ga0081455_10184175
2036 Ga0081455_10185613
2037 Ga0081538_10000035
2038 Ga0081538_10000152
2039 Ga0081538_10000696
2040 Ga0081538_10004814
2041 Ga0081538_10007205
2042 Ga0081538_10007559
2043 Ga0081538_10017792
2044 Ga0081538_10019711
2045 Ga0081538_10023770
2046 Ga0081538_10067111
2047 Ga0081538_10089409
2048 Ga0081538_10154437
2049 Ga0081540_1003561
2050 Ga0081539_10000866
2051 Ga0070717_10010696
2052 Ga0070717_10059005
2053 Ga0070717_10062245
2054 Ga0070717_10069828
2055 Ga0070717_10239093
2056 Ga0070717_10424003
2057 Ga0075365_10022967
2058 Ga0075365_10075872
2059 Ga0075365_10077318
2060 Ga0075363_100147218
2061 Ga0075364_10212198
2062 Ga0075432_10025925
2063 Ga0070715_10000913
2064 Ga0070715_10034552
2065 Ga0070715_10058699
2066 Ga0070716_100009358
2067 Ga0070716_100193774
2068 Ga0070716_100364919
2069 Ga0070712_100047801
2070 Ga0070712_100307085
2071 Ga0097621_100188436
2072 Ga0097621_100193422
2073 Ga0097621_100210300
2074 Ga0097621_100243759
2075 Ga0097621_100336906
2076 Ga0068871_100047256
2077 Ga0068871_100051770
2078 Ga0068871_100113713
2079 Ga0068871_100189530
2080 Ga0068871_100242454
2081 Ga0075428_100000308
2082 Ga0075428_100016622
2083 Ga0075428_100031695
2084 Ga0075428_100057000
2085 Ga0075428_100143498
2086 Ga0075428_100201563
2087 Ga0075428_100576163
2088 Ga0075430_100014948
2089 Ga0075430_100079063
2090 Ga0075430_100124588
2091 Ga0075431_100001086
2092 Ga0075431_100213838
2093 Ga0075433_10004225
2094 Ga0075433_10008511
2095 Ga0075433_10018044
2096 Ga0075433_10020180
2097 Ga0075433_10026335
2098 Ga0075433_10102791
2099 Ga0075433_10220254
2100 Ga0075433_10340825
2101 Ga0075434_100034316
2102 Ga0075434_100042923
2103 Ga0075434_100071698
2104 Ga0075434_100100842
2105 Ga0075434_100145973
2106 Ga0075434_100190125
2107 Ga0075434_100222390
2108 Ga0075434_100462362
2109 Ga0075429_100009919
2110 Ga0075429_100063627
2111 Ga0068865_100005196
2112 Ga0068865_100006771
2113 Ga0068865_100021067
2114 Ga0075436_100012016
2115 Ga0075436_100020780
2116 Ga0075436_100025190
2117 Ga0075436_100041263
2118 Ga0075436_100058124
2119 Ga0097620_100045562
2120 Ga0075435_100001303
2121 Ga0075435_100001673
2122 Ga0075435_100019419
2123 Ga0075435_100059776
2124 Ga0075435_100089967
2125 Ga0105250_10103406
2126 Ga0105240_10091363
2127 Ga0105240_10153525
2128 Ga0105240_10207907
2129 Ga0105240_10402632
2130 Ga0105240_10414550
2131 Ga0111539_10025162
2132 Ga0111539_10036454
2133 Ga0111539_10046564
2134 Ga0111539_10053903
2135 Ga0111539_10348473
2136 Ga0111539_10674745
2137 Ga0111539_10735108
2138 Ga0105245_10023554
2139 Ga0105245_10034621
2140 Ga0105245_10040300
2141 Ga0105245_10050235
2142 Ga0105245_10064068
2143 Ga0105245_10275728
2144 Ga0105245_10405202
2145 Ga0105245_10548773
2146 Ga0105247_10058614
2147 Ga0105247_10121100
2148 Ga0105247_10350767
2149 Ga0114129_10001167
2150 Ga0114129_10015322
2151 Ga0114129_10035977
2152 Ga0114129_10047971
2153 Ga0114129_10058348
2154 Ga0114129_10068265
2155 Ga0114129_10083350
2156 Ga0114129_10106333
2157 Ga0114129_10110043
2158 Ga0114129_10986670
2159 Ga0114129_11321501
2160 Ga0105243_10005881
2161 Ga0105243_10011846
2162 Ga0105243_10012988
2163 Ga0105243_10014105
2164 Ga0105243_10031726
2165 Ga0105241_10120527
2166 Ga0105241_10124678
2167 Ga0105241_10252848
2168 Ga0105241_10289956
2169 Ga0105242_10032279
2170 Ga0105242_10044066
2171 Ga0105242_10177159
2172 Ga0105242_10305139
2173 Ga0105242_10317261
2174 Ga0105242_10416309
2175 Ga0105242_10519777
2176 Ga0105248_10004837
2177 Ga0105248_10097147
2178 Ga0105248_10115249
2179 Ga0105237_10104549
2180 Ga0105238_10033649
2181 Ga0105238_10035597
2182 Ga0105238_10699398
2183 Ga0105249_10233914
2184 Ga0105249_10445292
2185 Ga0105249_10609334
2186 Ga0105239_10003394
2187 Ga0105239_10044245
2188 Ga0105239_10056507
2189 Ga0105239_10069567
2190 Ga0105239_10144698
2191 Ga0105239_10321666
2192 Ga0105239_10457383
2193 Ga0105239_10492084
2194 Ga0105239_10607300
2195 Ga0105239_10741254
2196 Ga0105246_10022509
2197 Ga0105246_10024629
2198 Ga0105246_10149778
2199 Ga0105246_10224083
2200 Ga0157373_10032117
2201 Ga0157373_10354263
2202 Ga0157371_10004355
2203 Ga0157371_10115418
2204 Ga0157371_10436756
2205 Ga0157370_10018791
2206 Ga0157370_10028361
2207 Ga0157370_10031019
2208 Ga0157370_10196259
2209 Ga0157370_10286411
2210 Ga0157369_10002497
2211 Ga0157369_10023069
2212 Ga0157369_10029987
2213 Ga0157369_10046466
2214 Ga0157369_10086575
2215 Ga0157369_10116737
2216 Ga0157369_10204935
2217 Ga0157369_10397992
2218 Ga0157374_10029179
2219 Ga0157374_10047966
2220 Ga0157374_10201556
2221 Ga0157374_10336403
2222 Ga0157378_10131447
2223 Ga0157378_10243868
2224 Ga0157378_10365848
2225 Ga0157378_10699694
2226 Ga0163162_10072172
2227 Ga0163162_10136557
2228 Ga0163162_10197617
2229 Ga0157372_10006332
2230 Ga0157372_10026486
2231 Ga0157372_10055345
2232 Ga0157372_10072372
2233 Ga0157372_10085452
2234 Ga0157372_10316757
2235 Ga0157372_10450680
2236 Ga0157372_10846308
2237 Ga0157375_10001779
2238 Ga0157375_10025998
2239 Ga0157375_10130854
2240 Ga0157375_10151600
2241 Ga0157375_10171846
2242 Ga0157375_10504055
2243 Ga0157375_10767236
2244 Ga0163163_10003453
2245 Ga0163163_10107381
2246 Ga0163163_10203191
2247 Ga0163163_10570985
2248 Ga0157380_10009901
2249 Ga0157380_10031821
2250 Ga0157380_10061307
2251 Ga0157380_10086324
2252 Ga0157380_10198097
2253 Ga0182008_10200898
2254 Ga0157377_10002578
2255 Ga0157377_10008386
2256 Ga0157377_10139382
2257 Ga0157379_10079000
2258 Ga0157379_10116988
2259 Ga0157379_10237982
2260 Ga0157376_10001398
2261 Ga0157376_10299931
2262 Ga0157376_10388814
2263 Ga0182006_1075373
2264 Ga0197907_10103628
2265 Ga0197907_10204941
2266 Ga0197907_10404823
2267 Ga0197907_10875030
2268 Ga0206356_10494061
2269 Ga0206356_10694969
2270 Ga0206356_11740764
2271 Ga0206356_11755174
2272 Ga0206351_10370816
2273 Ga0206352_10571842
2274 Ga0206352_10799947
2275 Ga0206350_10458094
2276 Ga0206354_10093548
2277 Ga0206353_10839899
2278 Ga0206353_11387566
2279 Ga0224712_10020529
2280 Ga0224712_10025783
2281 Ga0224712_10041489
2282 Ga0224712_10209000
2283 Ga0207697_10087404
2284 Ga0207656_10083391
2285 Ga0207653_10001160
2286 Ga0207682_10068153
2287 Ga0207692_10069347
2288 Ga0207692_10117514
2289 Ga0207710_10175983
2290 Ga0207688_10000295
2291 Ga0207688_10196776
2292 Ga0207647_10178812
2293 Ga0207685_10000585
2294 Ga0207685_10148711
2295 Ga0207699_10060867
2296 Ga0207699_10095704
2297 Ga0207645_10049494
2298 Ga0207643_10003093
2299 Ga0207643_10070389
2300 Ga0207705_10019484
2301 Ga0207705_10020119
2302 Ga0207705_10090345
2303 Ga0207705_10153742
2304 Ga0207684_10075284
2305 Ga0207684_10093531
2306 Ga0207654_10139839
2307 Ga0207654_10258070
2308 Ga0207707_10006792
2309 Ga0207707_10008124
2310 Ga0207707_10043146
2311 Ga0207707_10078554
2312 Ga0207707_10103694
2313 Ga0207707_10134715
2314 Ga0207707_10135647
2315 Ga0207707_10174541
2316 Ga0207707_10278409
2317 Ga0207707_10288078
2318 Ga0207707_10424055
2319 Ga0207695_10083465
2320 Ga0207695_10345702
2321 Ga0207695_10712186
2322 Ga0207693_10002991
2323 Ga0207693_10004428
2324 Ga0207693_10006759
2325 Ga0207693_10008709
2326 Ga0207693_10022035
2327 Ga0207693_10041523
2328 Ga0207663_10010865
2329 Ga0207663_10025121
2330 Ga0207663_10033479
2331 Ga0207663_10201736
2332 Ga0207663_10386693
2333 Ga0207660_10016370
2334 Ga0207660_10035726
2335 Ga0207660_10100927
2336 Ga0207660_10236601
2337 Ga0207660_10440763
2338 Ga0207662_10118327
2339 Ga0207657_10000046
2340 Ga0207657_10002149
2341 Ga0207657_10002359
2342 Ga0207657_10007745
2343 Ga0207657_10007972
2344 Ga0207657_10099989
2345 Ga0207657_10176801
2346 Ga0207657_10219350
2347 Ga0207657_10221056
2348 Ga0207649_10008800
2349 Ga0207649_10119557
2350 Ga0207649_10168041
2351 Ga0207649_10217118
2352 Ga0207649_10363486
2353 Ga0207652_10015699
2354 Ga0207652_10027233
2355 Ga0207652_10028459
2356 Ga0207652_10038654
2357 Ga0207652_10153591
2358 Ga0207652_10290157
2359 Ga0207652_10300993
2360 Ga0207652_10507859
2361 Ga0207646_10000835
2362 Ga0207646_10001503
2363 Ga0207646_10045537
2364 Ga0207646_10210908
2365 Ga0207681_10016252
2366 Ga0207681_10091249
2367 Ga0207694_10017573
2368 Ga0207694_10045933
2369 Ga0207694_10179638
2370 Ga0207650_10003626
2371 Ga0207650_10017795
2372 Ga0207650_10128800
2373 Ga0207659_10079846
2374 Ga0207659_10095799
2375 Ga0207687_10035439
2376 Ga0207687_10047111
2377 Ga0207687_10079516
2378 Ga0207687_10098003
2379 Ga0207687_10270241
2380 Ga0207687_10314883
2381 Ga0207687_10371949
2382 Ga0207687_10647647
2383 Ga0207700_10013428
2384 Ga0207700_10029054
2385 Ga0207700_10245582
2386 Ga0207664_10006174
2387 Ga0207664_10016830
2388 Ga0207664_10023674
2389 Ga0207664_10030636
2390 Ga0207664_10163985
2391 Ga0207664_10240129
2392 Ga0207664_10463437
2393 Ga0207664_10661246
2394 Ga0207644_10057035
2395 Ga0207644_10444752
2396 Ga0207690_10013980
2397 Ga0207690_10060399
2398 Ga0207690_10088629
2399 Ga0207690_10104351
2400 Ga0207690_10310119
2401 Ga0207690_10487808
2402 Ga0207690_10497624
2403 Ga0207706_10009744
2404 Ga0207706_10027954
2405 Ga0207706_10050444
2406 Ga0207706_10295927
2407 Ga0207686_10031586
2408 Ga0207686_10032319
2409 Ga0207686_10103308
2410 Ga0207686_10108315
2411 Ga0207686_10181187
2412 Ga0207686_10280341
2413 Ga0207709_10030813
2414 Ga0207709_10079412
2415 Ga0207709_10130382
2416 Ga0207670_10003061
2417 Ga0207669_10008057
2418 Ga0207669_10021197
2419 Ga0207669_10061864
2420 Ga0207669_10104068
2421 Ga0207704_10002504
2422 Ga0207704_10150272
2423 Ga0207704_10193957
2424 Ga0207704_10426384
2425 Ga0207665_10000336
2426 Ga0207665_10009424
2427 Ga0207665_10305111
2428 Ga0207691_10014333
2429 Ga0207691_10042275
2430 Ga0207691_10142905
2431 Ga0207691_10474730
2432 Ga0207691_10587835
2433 Ga0207711_10559826
2434 Ga0207689_10020194
2435 Ga0207689_10232023
2436 Ga0207661_10035507
2437 Ga0207661_10040814
2438 Ga0207661_10052608
2439 Ga0207661_10058519
2440 Ga0207661_10059188
2441 Ga0207661_10094976
2442 Ga0207661_10148807
2443 Ga0207661_10150765
2444 Ga0207661_10231300
2445 Ga0207661_10396730
2446 Ga0207661_10829156
2447 Ga0207679_10048143
2448 Ga0207679_10415651
2449 Ga0207679_10662016
2450 Ga0207667_10049523
2451 Ga0207667_10052443
2452 Ga0207667_10071362
2453 Ga0207667_10109111
2454 Ga0207667_10154405
2455 Ga0207667_10214420
2456 Ga0207667_10277037
2457 Ga0207667_10397603
2458 Ga0207667_10500751
2459 Ga0207651_10009014
2460 Ga0207651_10230977
2461 Ga0207668_10008754
2462 Ga0207668_10074890
2463 Ga0207668_10637961
2464 Ga0207640_10010996
2465 Ga0207640_10172003
2466 Ga0207640_10211804
2467 Ga0207658_10004838
2468 Ga0207658_10114119
2469 Ga0207677_10078690
2470 Ga0207677_10433651
2471 Ga0207703_10014085
2472 Ga0207703_10152853
2473 Ga0207639_10067705
2474 Ga0207639_10316350
2475 Ga0207639_10332069
2476 Ga0207639_10363730
2477 Ga0207639_10552061
2478 Ga0207678_10008584
2479 Ga0207678_10083870
2480 Ga0207678_10330939
2481 Ga0207708_10013763
2482 Ga0207708_10028141
2483 Ga0207702_10005093
2484 Ga0207702_10016688
2485 Ga0207702_10030487
2486 Ga0207702_10081441
2487 Ga0207702_10107262
2488 Ga0207702_10496304
2489 Ga0207641_10575921
2490 Ga0207648_10017489
2491 Ga0207648_10069092
2492 Ga0207676_10704504
2493 Ga0207676_11241681
2494 Ga0207674_10002821
2495 Ga0207674_10041842
2496 Ga0207674_10139150
2497 Ga0207674_10153418
2498 Ga0207674_10550577
2499 Ga0207675_100002655
2500 Ga0207675_100002688
2501 Ga0207675_100224847
2502 Ga0207683_10018336
2503 Ga0207683_10019988
2504 Ga0207683_10030783
2505 Ga0207683_10032768
2506 Ga0207683_10041263
2507 Ga0207698_10007523
2508 Ga0207698_10229384
2509 Ga0207698_10693616
2510 Ga0207698_10840846
2511 Ga0207428_10024156
2512 Ga0207428_10031019
2513 Ga0207428_10038452
2514 Ga0207428_10125373
2515 Ga0207428_10142811
2516 Ga0207428_10230413
2517 Ga0268266_10020487
2518 Ga0268266_10270108
2519 Ga0268266_10816926
2520 Ga0268265_10117659
2521 Ga0268265_10135980
2522 Ga0268264_10082317
2523 Ga0265334_10010096
2524 Ga0265318_10010050
2525 Ga0265318_10037064
2526 Ga0265336_10002579
2527 Ga0265336_10057096
2528 Ga0265338_10007091
2529 Ga0265338_10010810
2530 Ga0265338_10017185
2531 Ga0265338_10082217
2532 Ga0265338_10136375
2533 Ga0265324_10018729
2534 Ga0265320_10060231
2535 Ga0265339_10009216
2536 Ga0265331_10043314
2537 Ga0265327_10042865
2538 Ga0265327_10074306
2539 Ga0307408_100192265
2540 Ga0265313_10011904
2541 Ga0265314_10011431
2542 Ga0307405_10140772
2543 Ga0307410_10248392
2544 Ga0307406_10170663
2545 Ga0307412_10285345
2546 Ga0307409_100013556
2547 Ga0307409_100080100
2548 Ga0307409_100154478
2549 Ga0307409_100688980
2550 Ga0307415_100072492
2551 Ga0316583_10053325
2552 Ga0373958_0004712
2553 Ga0373928_0005179
2554 Ga0373940_0020246
2555 Ga0373944_0047146
2556 Ga0373949_0031541
2557 Ga0373951_0003334
2558 Ga0373952_0001629
2559 Ga0373932_0002933
2560 Ga0373936_0017166
2561 Ga0373939_0014676
2562 Ga0373945_0003618
2563 Ga0373945_0030800
2564 Ga0373953_0117933
2565 Ga0373960_0005893
2566 Ga0373960_0006215
2567 Ga0373943_0006431
2568 Ga0373946_0017378
2569 Ga0373946_0050585
2570 Ga0373955_0224463
2571 Ga0373955_0287626
2572 Ga0373942_0013065
2573 Ga0373942_0073200
2574 Ga0373961_0008338
2575 Ga0373961_0008521
2576 Ga0373962_0003210
2577 Ga0316574_0013253
2578 Ga0373924_0098938
2579 Ga0373931_0008030
2580 Ga0373931_0023902
2581 Ga0373931_0064143
2582 Ga0373935_0024832
2583 Ga0373935_0198469
2584 Ga0373947_0000590
2585 Ga0373947_0002156
2586 Ga0373947_0009289
2587 Ga0373947_0038227
2588 Ga0373937_0078598
2589 Ga0373937_0079049
2590 Ga0373925_0008041
2591 Ga0373925_0019221
2592 Ga0395899_0001492
2593 Ga0395899_0005009
2594 Ga0395899_0005435
2595 Ga0395899_0007004
2596 Ga0395899_0019451
2597 Ga0395899_0021446
2598 Ga0395899_0031033
2599 Ga0395899_0032696
2600 Ga0395899_0054157
2601 Ga0395899_0141336
2602 Ga0395899_0212757
2603 Ga0395899_0264261
2604 Ga0395900_0002249
2605 Ga0395900_0002962
2606 Ga0395900_0005184
2607 Ga0395900_0008768
2608 Ga0395900_0011825
2609 Ga0395900_0015152
2610 Ga0395900_0021106
2611 Ga0395900_0031804
2612 Ga0395900_0050359
2613 Ga0395900_0060273
2614 Ga0395900_0072551
2615 Ga0395900_0074483
2616 Ga0395900_0079316
2617 Ga0395900_0081382
2618 Ga0395900_0086757
2619 Ga0395900_0105591
2620 Ga0395900_0109750
2621 Ga0395900_0143504
2622 Ga0395900_0150702
2623 Ga0395900_0171524
2624 Ga0395900_0186308
2625 Ga0395900_0234107
2626 Ga0395900_0235434
2627 Ga0395900_0408815
2628 Ga0395900_0622298
2629 Ga0395900_0745970
2630 Ga0395898_0001213
2631 Ga0395898_0001862
2632 Ga0395898_0010024
2633 Ga0395898_0012117
2634 Ga0395898_0012770
2635 Ga0395898_0016061
2636 Ga0395898_0017469
2637 Ga0395898_0018501
2638 Ga0395898_0020827
2639 Ga0395898_0034509
2640 Ga0395898_0043430
2641 Ga0395898_0047102
2642 Ga0395898_0057630
2643 Ga0395898_0079296
2644 Ga0395898_0086795
2645 Ga0395898_0119142
2646 Ga0395898_0563873
2647 Ga0395898_0578377
2648 Ga0395905_0004021
2649 Ga0395905_0007290
2650 Ga0395905_0018249
2651 Ga0395905_0018594
2652 Ga0395905_0048739
2653 Ga0395905_0052112
2654 Ga0395905_0113171
2655 Ga0395905_0171590
2656 Ga0395905_0194856
2657 Ga0395905_0413410
2658 Ga0395905_0459555
2659 Ga0395901_0000809
2660 Ga0395901_0001901
2661 Ga0395901_0002490
2662 Ga0395901_0008659
2663 Ga0395901_0009351
2664 Ga0395901_0032973
2665 Ga0395901_0039132
2666 Ga0395901_0041742
2667 Ga0395901_0050752
2668 Ga0395901_0051027
2669 Ga0395901_0059937
2670 Ga0395901_0066313
2671 Ga0395901_0106747
2672 Ga0395901_0116948
2673 Ga0395901_0128039
2674 Ga0395901_0263567
2675 Ga0395901_0277743
2676 Ga0395901_0282952
2677 Ga0395901_0359150
2678 Ga0395901_0461644
2679 Ga0395901_0483924
2680 Ga0395901_0609890
2681 Ga0242420_004502
2682 Ga0436365_1254107
2683 Ga0436360_0528570
2684 Ga0436363_0737093
2685 Ga0439439_0005013
2686 Ga0439461_0003668
2687 Ga0439461_0004257
2688 Ga0451793_0630142
2689 Ga0451800_1364113
2690 Ga0451807_1292183
2691 Ga0451839_1137856
2692 Ga0451847_0357059
2693 Ga0451853_0212631
2694 Ga0451853_0402185
2695 Ga0451853_2653982
2696 Ga0450905_011737
2697 Ga0450907_004083
2698 Ga0450907_020314
2699 Ga0450910_011683
2700 Ga0439446_0000185
2701 Ga0439434_0016341
2702 Ga0439460_0031843
2703 Ga0466969_0000388
2704 Ga0466969_0044191
2705 Ga0466969_0116144
2706 Ga0466972_0128669
2707 Ga0466965_0046401
2708 Ga0466965_0152181
2709 Ga0466965_0158190
2710 Ga0466965_0228553
2711 Ga0466966_0002834
2712 Ga0466966_0057272
2713 Ga0466966_0085742
2714 Ga0466966_0138822
2715 Ga0466966_0172378
2716 Ga0466961_0007905
2717 Ga0466961_0023641
2718 Ga0466961_0037806
2719 Ga0466961_0189443
2720 Ga0466963_0011013
2721 Ga0466963_0018103
2722 Ga0466963_0031898
2723 Ga0466963_0033265
2724 Ga0466963_0042077
2725 Ga0466963_0073846
2726 Ga0466963_0100887
2727 Ga0466963_0112053
2728 Ga0466963_0165973
2729 Ga0466963_0184360
2730 Ga0466964_0004468
2731 Ga0466964_0005246
2732 Ga0466964_0012091
2733 Ga0466964_0088629
2734 Ga0466964_0134568
2735 Ga0466964_0210372
2736 Ga0466971_0015252
2737 Ga0466971_0020720
2738 Ga0466968_0004580
2739 Ga0466968_0006008
2740 Ga0466968_0010497
2741 Ga0466968_0122035
2742 Ga0466968_0142788
2743 Ga0466970_0015670
2744 Ga0466970_0077391
2745 Ga0466957_0004248
2746 Ga0466957_0007431
2747 Ga0466957_0024815
2748 Ga0466957_0101147
2749 Ga0466957_0139420
2750 Ga0466957_0283966
2751 Ga0466957_0360383
2752 Ga0466960_0097361
2753 Ga0466960_0152349
2754 Ga0466960_0156814
2755 Ga0466959_0016642
2756 Ga0466959_0022152
2757 Ga0466959_0023743
2758 Ga0466959_0142155
2759 Ga0466959_0160187
2760 Ga0466959_0348847
2761 Ga0466958_0003870
2762 Ga0466958_0005189
2763 Ga0466958_0015930
2764 Ga0466958_0017408
2765 Ga0466958_0123610
2766 Ga0466958_0375681
2767 Ga0466967_0000179
2768 Ga0466967_0000656
2769 Ga0466967_0001283
2770 Ga0466967_0004521
2771 Ga0466967_0004681
2772 Ga0466967_0028066
2773 Ga0466967_0030515
2774 Ga0466967_0034259
2775 Ga0466967_0044519
2776 Ga0466967_0050109
2777 Ga0466967_0063731
2778 Ga0466967_0102426
2779 Ga0466967_0127577
2780 Ga0466967_0202110
2781 Ga0466967_0229568
2782 Ga0466967_0248872
2783 Ga0466967_0320110
2784 Ga0466967_0333892
2785 Ga0466967_0422071
2786 Ga0466967_0454692
2787 Ga0466967_0464655
2788 Ga0466967_0526083
2789 Ga0466967_0540734
2790 Ga0466967_0641939
2791 Ga0466967_0687005
2792 Ga0495592_0004809
2793 Ga0495592_0139641
2794 Ga0495592_0226588
2795 Ga0495603_0009387
2796 Ga0495603_0011343
2797 Ga0495603_0024368
2798 Ga0495603_0099225
2799 Ga0495603_0198893
2800 Ga0495629_0029124
2801 Ga0495629_0053152
2802 Ga0495629_0075375
2803 Ga0495629_0362804
2804 Ga0495641_0004261
2805 Ga0495641_0004552
2806 Ga0495641_0034632
2807 Ga0495641_0041124
2808 Ga0495641_0107765
2809 Ga0495641_0117542
2810 Ga0495641_0209208
2811 Ga0495651_0048218
2812 Ga0495651_0062960
2813 Ga0495651_0132325
2814 Ga0495651_0212894
2815 Ga0495653_0032638
2816 Ga0495653_0052203
2817 Ga0495653_0362986
2818 Ga0495580_0021561
2819 Ga0495582_0016397
2820 Ga0495582_0020921
2821 Ga0495582_0115484
2822 Ga0495582_0240061
2823 Ga0495605_0030222
2824 Ga0495605_0092944
2825 Ga0495662_0051678
2826 Ga0495664_0136923
2827 Ga0495664_0250254
2828 Ga0495584_0019339
2829 Ga0495584_0101788
2830 Ga0495584_0170043
2831 Ga0495585_0198884
2832 Ga0495594_0006747
2833 Ga0495596_0028494
2834 Ga0495596_0071261
2835 Ga0495607_0057044
2836 Ga0495608_0009760
2837 Ga0495608_0016338
2838 Ga0495608_0027278
2839 Ga0495608_0032676
2840 Ga0495608_0091243
2841 Ga0495608_0097849
2842 Ga0495618_0020745
2843 Ga0495618_0021960
2844 Ga0495618_0174993
2845 Ga0495618_0236200
2846 Ga0495618_0254979
2847 Ga0495628_0018631
2848 Ga0495628_0021733
2849 Ga0495628_0043819
2850 Ga0495628_0235254
2851 Ga0495628_0430949
2852 Ga0495630_0002368
2853 Ga0495630_0025512
2854 Ga0495630_0026574
2855 Ga0495630_0046074
2856 Ga0495630_0064270
2857 Ga0495630_0121028
2858 Ga0495630_0161302
2859 Ga0495644_0069197
2860 Ga0495644_0071726
2861 Ga0495663_0008382
2862 Ga0495666_0023225
2863 Ga0495652_0050425
2864 Ga0495652_0053385
2865 Ga0495652_0220663
2866 Ga0495652_0352895
2867 Ga0495640_0003223
2868 Ga0495587_0101164
2869 Ga0495598_0050459
2870 Ga0495609_0038387
2871 Ga0495645_0026587
2872 Ga0495645_0263870
2873 Ga0495667_0005166
2874 Ga0495667_0005794
2875 Ga0495667_0015042
2876 Ga0495667_0047038
2877 Ga0495667_0064462
2878 Ga0495667_0072299
2879 Ga0495667_0090116
2880 Ga0495656_0018093
2881 Ga0495656_0074891
2882 Ga0495656_0306226
2883 Ga0495634_0029419
2884 Ga0495634_0140823
2885 Ga0495634_0214500
2886 Ga0495635_0063485
2887 Ga0495635_0102663
2888 Ga0495635_0142434
2889 Ga0495659_0040113
2890 Ga0495588_0001498
2891 Ga0495588_0059613
2892 Ga0495588_0112700
2893 Ga0495588_0162451
2894 Ga0495657_0014645
2895 Ga0495657_0021973
2896 Ga0495657_0029620
2897 Ga0495657_0077532
2898 Ga0495657_0163961
2899 Ga0495599_0035987
2900 Ga0495599_0040203
2901 Ga0495599_0230653
2902 Ga0495646_0065653
2903 Ga0495647_0062961
2904 Ga0495647_0225809
2905 Ga0495658_0038859
2906 Ga0495658_0082123
2907 Ga0495658_0131448
2908 Ga0495669_0053379
2909 Ga0495613_0013348
2910 Ga0495613_0060400
2911 Ga0495613_0076521
2912 Ga0495613_0251403
2913 Ga0495613_0397206
2914 Ga0495613_0465385
2915 Ga0495613_0506700
2916 Ga0495624_0028280
2917 Ga0495624_0238841
2918 Ga0495589_0007869
2919 Ga0495589_0030930
2920 Ga0495600_0059332
2921 Ga0495581_0098473
2922 Ga0495581_0376020
2923 Ga0495604_0034480
2924 Ga0495604_0042806
2925 Ga0495604_0043274
2926 Ga0495604_0187013
2927 Ga0495604_0203778
2928 Ga0495674_0004451
2929 Ga0495674_0025185
2930 Ga0495674_0043481
2931 Ga0495674_0055289
2932 Ga0495674_0094283
2933 Ga0495674_0255651
2934 Ga0495676_0003895
2935 Ga0495676_0032039
2936 Ga0495676_0039920
2937 Ga0495676_0072884
2938 Ga0495676_0137106
2939 Ga0495676_0178386
2940 Ga0495676_0225777
2941 Ga0495680_0005919
2942 Ga0495680_0006645
2943 Ga0495680_0019953
2944 Ga0495680_0280071
2945 Ga0495680_0384996
2946 Ga0495675_0029801
2947 Ga0495675_0034489
2948 Ga0495675_0223398
2949 Ga0495675_0293943
2950 Ga0495684_0008847
2951 Ga0495684_0049103
2952 Ga0495593_0231269
2953 Ga0495602_0058823
2954 Ga0495602_0107769
2955 Ga0495602_0198738
2956 Ga0495602_0213287
2957 Ga0495602_0215437
2958 Ga0496100_0005439
2959 Ga0496100_0017682
2960 Ga0496100_0019060
2961 Ga0496100_0031408
2962 Ga0496100_0066748
2963 Ga0496100_0372367
2964 Ga0496101_0005268
2965 Ga0496101_0011606
2966 Ga0496101_0017750
2967 Ga0496101_0020243
2968 Ga0496101_0021389
2969 Ga0496101_0068341
2970 Ga0496101_0122910
2971 Ga0496101_0209056
2972 Ga0496101_0264247
2973 Ga0496102_0005991
2974 Ga0496102_0019028
2975 Ga0496102_0019449
2976 Ga0496102_0029581
2977 Ga0496102_0069500
2978 Ga0496102_0096187
2979 Ga0496102_0235577
2980 Ga0496102_0257663
2981 Ga0496102_0542232
2982 Ga0496103_0013174
2983 Ga0496103_0039044
2984 Ga0496103_0066965
2985 Ga0496103_0090187
2986 Ga0496104_0001293
2987 Ga0496104_0011990
2988 Ga0496104_0015894
2989 Ga0496104_0020926
2990 Ga0496104_0039608
2991 Ga0496104_0086788
2992 Ga0496104_0087742
2993 Ga0496104_0104059
2994 Ga0496104_0191235
2995 Ga0496104_0416726
2996 Ga0496104_0421615
2997 Ga0496104_0923534
2998 Ga0496105_0001494
2999 Ga0496105_0002671
3000 Ga0496105_0008290
3001 Ga0496105_0025878
3002 Ga0496105_0039885
3003 Ga0496105_0040125
3004 Ga0496105_0044664
3005 Ga0496105_0108697
3006 Ga0496105_0113952
3007 Ga0496105_0179752
3008 Ga0496105_0351953
3009 Ga0496105_0518868
3010 Ga0496106_0003662
3011 Ga0496106_0012801
3012 Ga0496106_0031455
3013 Ga0496106_0034897
3014 Ga0496106_0042412
3015 Ga0496106_0051599
3016 Ga0496106_0131237
3017 Ga0496106_0300703
3018 Ga0496107_0005800
3019 Ga0496107_0017385
3020 Ga0496107_0019319
3021 Ga0496107_0019681
3022 Ga0496107_0024006
3023 Ga0496107_0036112
3024 Ga0496107_0109827
3025 Ga0496107_0220230
3026 Ga0496107_0226220
3027 Ga0496108_0001327
3028 Ga0496108_0006069
3029 Ga0496108_0006797
3030 Ga0496108_0008941
3031 Ga0496108_0018951
3032 Ga0496108_0027773
3033 Ga0496108_0063353
3034 Ga0496108_0128616
3035 Ga0496108_0513582
3036 Ga0496109_0002789
3037 Ga0496109_0003215
3038 Ga0496109_0004424
3039 Ga0496109_0006043
3040 Ga0496109_0013816
3041 Ga0496109_0021106
3042 Ga0496109_0027854
3043 Ga0496109_0031229
3044 Ga0496109_0037658
3045 Ga0496109_0069840
3046 Ga0496109_0076574
3047 Ga0496109_0125038
3048 Ga0496109_0144970
3049 Ga0496109_0278516
3050 Ga0496109_0311327
3051 Ga0496109_0478323
3052 Ga0496109_0497008
3053 Ga0496109_0644829
3054 Ga0496110_0000607
3055 Ga0496110_0000686
3056 Ga0496110_0001231
3057 Ga0496110_0005411
3058 Ga0496110_0015765
3059 Ga0496110_0023470
3060 Ga0496110_0047139
3061 Ga0496110_0073042
3062 Ga0496110_0098293
3063 Ga0496110_0104580
3064 Ga0496110_0179573
3065 Ga0496110_0246488
3066 Ga0496110_0255102
3067 Ga0496110_0403969
3068 Ga0496110_0409782
3069 Ga0496110_0517893
3070 Ga0496110_0750656
3071 Ga0496111_0000665
3072 Ga0496111_0003353
3073 Ga0496111_0006770
3074 Ga0496111_0015441
3075 Ga0496111_0036332
3076 Ga0496111_0043351
3077 Ga0496111_0053709
3078 Ga0496111_0076589
3079 Ga0496111_0117752
3080 Ga0496111_0146702
3081 Ga0496111_0210087
3082 Ga0496111_0247549
3083 Ga0496111_0313075
3084 Ga0496111_0323154
3085 Ga0496111_0528199
3086 Ga0496112_0002974
3087 Ga0496112_0009862
3088 Ga0496112_0039231
3089 Ga0496112_0105593
3090 Ga0496112_0141876
3091 Ga0496112_0195725
3092 Ga0496112_0220191
3093 Ga0496112_0263617
3094 Ga0496112_0279136
3095 Ga0496112_0349450
3096 Ga0496112_0501650
3097 Ga0496112_0828601
3098 Ga0496113_0030491
3099 Ga0496113_0043660
3100 Ga0496113_0102989
3101 Ga0496113_0120019
3102 Ga0496114_0001676
3103 Ga0496114_0002457
3104 Ga0496114_0003730
3105 Ga0496114_0004356
3106 Ga0496114_0007678
3107 Ga0496114_0009413
3108 Ga0496114_0012976
3109 Ga0496114_0027912
3110 Ga0496114_0038680
3111 Ga0496114_0039785
3112 Ga0496114_0057985
3113 Ga0496114_0058587
3114 Ga0496114_0063704
3115 Ga0496114_0067784
3116 Ga0496114_0116204
3117 Ga0496114_0191134
3118 Ga0496114_0321617
3119 Ga0496114_0373626
3120 Ga0496115_0000961
3121 Ga0496115_0005151
3122 Ga0496115_0018520
3123 Ga0496115_0046954
3124 Ga0496115_0086635
3125 Ga0496115_0089319
3126 Ga0496115_0113751
3127 Ga0496115_0147712
3128 Ga0496115_0160846
3129 Ga0496115_0229858
3130 Ga0496115_0232782
3131 Ga0496115_0249221
3132 Ga0496115_0255454
3133 Ga0496115_0277100
3134 Ga0501031_0000345
3135 Ga0501031_0000615
3136 Ga0501031_0012796
3137 Ga0501031_0018104
3138 Ga0501031_0065546
3139 Ga0501031_0127793
3140 Ga0501032_0016904
3141 Ga0501032_0050972
3142 Ga0501032_0077747
3143 Ga0501033_0014528
3144 Ga0501033_0021157
3145 Ga0501033_0050866
3146 Ga0501033_0072389
3147 Ga0501034_0046410
3148 Ga0501034_0079909
3149 Ga0501034_0109014
3150 Ga0501034_0319457
3151 Ga0501036_0000798
3152 Ga0501036_0005203
3153 Ga0501036_0010111
3154 Ga0501036_0012670
3155 Ga0501036_0016694
3156 Ga0501036_0071310
3157 Ga0501036_0078014
3158 Ga0501036_0100066
3159 Ga0501036_0165946
3160 Ga0501036_0197560
3161 Ga0501036_0203132
3162 Ga0501036_0269707
3163 Ga0501037_0003886
3164 Ga0501037_0036273
3165 Ga0501037_0184176
3166 Ga0501037_0279147
3167 Ga0501037_0293183
3168 Ga0501038_0013992
3169 Ga0501038_0018352
3170 Ga0501038_0018769
3171 Ga0501038_0064564
3172 Ga0501038_0214425
3173 Ga0501038_0238833
3174 Ga0501038_0361244
3175 Ga0501039_0003205
3176 Ga0501039_0011836
3177 Ga0501039_0016268
3178 Ga0501039_0017988
3179 Ga0501039_0019591
3180 Ga0501039_0034884
3181 Ga0501039_0248020
3182 Ga0501040_0001055
3183 Ga0501040_0003253
3184 Ga0501040_0004545
3185 Ga0501040_0010284
3186 Ga0501040_0022657
3187 Ga0501040_0045329
3188 Ga0501040_0095280
3189 Ga0501040_0134878
3190 Ga0501040_0170309
3191 Ga0501040_0224265
3192 Ga0501040_0270275
3193 Ga0501041_0004444
3194 Ga0501041_0006237
3195 Ga0501041_0008151
3196 Ga0501041_0009854
3197 Ga0501041_0022782
3198 Ga0501041_0095737
3199 Ga0501041_0135402
3200 Ga0501041_0144277
3201 Ga0501041_0211776
3202 Ga0501041_0215761
3203 Ga0501041_0255727
3204 Ga0501042_0007552
3205 Ga0501042_0013615
3206 Ga0501042_0020443
3207 Ga0501042_0040672
3208 Ga0501042_0098871
3209 Ga0501042_0103151
3210 Ga0501042_0247212
3211 Ga0501043_0007147
3212 Ga0501043_0024169
3213 Ga0501043_0031763
3214 Ga0501043_0118461
3215 Ga0501043_0614931
3216 Ga0501046_0000652
3217 Ga0501046_0004105
3218 Ga0501046_0013964
3219 Ga0501046_0019876
3220 Ga0501046_0115969
3221 Ga0501047_0047759
3222 Ga0501047_0094945
3223 Ga0501047_0169719
3224 Ga0501047_0446711
3225 Ga0501048_0006478
3226 Ga0501048_0007579
3227 Ga0501048_0013192
3228 Ga0501048_0028649
3229 Ga0501048_0047994
3230 Ga0501048_0071298
3231 Ga0501048_0076880
3232 Ga0501067_0019442
3233 Ga0501067_0020400
3234 Ga0501067_0024772
3235 Ga0501067_0093019
3236 Ga0501067_0136611
3237 Ga0501067_0155882
3238 Ga0501068_0001869
3239 Ga0501068_0004858
3240 Ga0501068_0022285
3241 Ga0501068_0046973
3242 Ga0501068_0058960
3243 Ga0501068_0068606
3244 Ga0501068_0072779
3245 Ga0501068_0204177
3246 Ga0501068_0208105
3247 Ga0501068_0442817
3248 Ga0501069_0001257
3249 Ga0501069_0003809
3250 Ga0501069_0007494
3251 Ga0501069_0011745
3252 Ga0501069_0024983
3253 Ga0501069_0049781
3254 Ga0501069_0052474
3255 Ga0501069_0135988
3256 Ga0501070_0001079
3257 Ga0501070_0013182
3258 Ga0501070_0016785
3259 Ga0501070_0022709
3260 Ga0501070_0030096
3261 Ga0501070_0049374
3262 Ga0501070_0077181
3263 Ga0501070_0123561
3264 Ga0501070_0142056
3265 Ga0501070_0142571
3266 Ga0501070_0309516
3267 Ga0501071_0001467
3268 Ga0501071_0009780
3269 Ga0501071_0061155
3270 Ga0501071_0062543
3271 Ga0501071_0063452
3272 Ga0501071_0079746
3273 Ga0501071_0091331
3274 Ga0501071_0098447
3275 Ga0501071_0103912
3276 Ga0501071_0123405
3277 Ga0501071_0596546
3278 Ga0501072_0001288
3279 Ga0501072_0007841
3280 Ga0501072_0015236
3281 Ga0501072_0059835
3282 Ga0501072_0169463
3283 Ga0501072_0185138
3284 Ga0501072_0257448
3285 Ga0501072_0349146
3286 Ga0501073_0006605
3287 Ga0501073_0036395
3288 Ga0501073_0157058
3289 Ga0501074_0005057
3290 Ga0501074_0012591
3291 Ga0501074_0015529
3292 Ga0501074_0016417
3293 Ga0501074_0019711
3294 Ga0501074_0032686
3295 Ga0501074_0044906
3296 Ga0501074_0170294
3297 Ga0501074_0288142
3298 Ga0501074_0301423
3299 Ga0501075_0001411
3300 Ga0501075_0007062
3301 Ga0501075_0007654
3302 Ga0501075_0017206
3303 Ga0501075_0035506
3304 Ga0501075_0041275
3305 Ga0501075_0080937
3306 Ga0501075_0106072
3307 Ga0501075_0378412
3308 Ga0501075_0467596
3309 Ga0501076_0000812
3310 Ga0501076_0002379
3311 Ga0501076_0022035
3312 Ga0501076_0024142
3313 Ga0501076_0037773
3314 Ga0501076_0044812
3315 Ga0501076_0189506
3316 Ga0501076_0204749
3317 Ga0501076_0254768
3318 Ga0501076_0267305
3319 Ga0501076_0272459
3320 Ga0501076_0342297
3321 Ga0501076_0438541
3322 Ga0501077_0000499
3323 Ga0501077_0003790
3324 Ga0501077_0004497
3325 Ga0501077_0004745
3326 Ga0501077_0014155
3327 Ga0501077_0020724
3328 Ga0501077_0052671
3329 Ga0501077_0054742
3330 Ga0501077_0078011
3331 Ga0501077_0115274
3332 Ga0501077_0286431
3333 Ga0501079_0000803
3334 Ga0501079_0010238
3335 Ga0501079_0016932
3336 Ga0501079_0018380
3337 Ga0501079_0033804
3338 Ga0501079_0045496
3339 Ga0501079_0054055
3340 Ga0501079_0074562
3341 Ga0501079_0141918
3342 Ga0501079_0247931
3343 Ga0501079_0417116
3344 Ga0501079_0545740
3345 Ga0501080_0003048
3346 Ga0501080_0005883
3347 Ga0501080_0009672
3348 Ga0501080_0010704
3349 Ga0501080_0039743
3350 Ga0501080_0046497
3351 Ga0501080_0065049
3352 Ga0501080_0081348
3353 Ga0501080_0202432
3354 Ga0501080_0360520
3355 Ga0501080_0448489
3356 Ga0501081_0010433
3357 Ga0501081_0010461
3358 Ga0501081_0134977
3359 Ga0501081_0199805
3360 Ga0501081_0250287
3361 Ga0501083_0001262
3362 Ga0501083_0008045
3363 Ga0501083_0008383
3364 Ga0501083_0013676
3365 Ga0501083_0081982
3366 Ga0501083_0093101
3367 Ga0501083_0146467
3368 Ga0501083_0165411
3369 Ga0501035_0006890
3370 Ga0501035_0014173
3371 Ga0501035_0087847
3372 Ga0501035_0109683
3373 Ga0501035_0207599
3374 Ga0501044_0043798
3375 Ga0501044_0049698
3376 Ga0501044_0067848
3377 Ga0501044_0388080
3378 Ga0501045_0004392
3379 Ga0501045_0005064
3380 Ga0501045_0018778
3381 Ga0501045_0023088
3382 Ga0501045_0032796
3383 Ga0501045_0072610
3384 Ga0501045_0126160
3385 Ga0501045_0138710
3386 nmdc:mga03n38_101905_c1
3387 nmdc:mga00v17_240143_c1
3388 nmdc:mga0yw44_257714_c1
3389 nmdc:mga06z11_284480_c1
3390 nmdc:mga05p37_101073_c1
3391 nmdc:mga05p37_1092092_c1
3392 nmdc:mga05p37_133731_c1
3393 nmdc:mga05p37_1560_c1
3394 nmdc:mga05p37_162922_c1
3395 nmdc:mga05p37_206607_c1
3396 nmdc:mga05p37_251987_c1
3397 nmdc:mga05p37_41002_c1
3398 nmdc:mga05p37_48042_c1
3399 nmdc:mga05p37_493713_c1
3400 nmdc:mga05p37_97853_c1
3401 nmdc:mga09592_49260_c1
3402 nmdc:mga09592_629_c3
3403 nmdc:mga09592_77520_c1
3404 nmdc:mga0qj67_30247_c1
3405 nmdc:mga06r32_141265_c1
3406 nmdc:mga06r32_1948_c1
3407 nmdc:mga08y16_13610_c1
3408 nmdc:mga08y16_174258_c1
3409 nmdc:mga08y16_35984_c1
3410 nmdc:mga08y16_569620_c1
3411 nmdc:mga08y16_8316_c1
3412 nmdc:mga08y16_97894_c1
3413 nmdc:mga0n895_1537_c1
3414 nmdc:mga0n895_179483_c1
3415 nmdc:mga0n895_240067_c1
3416 nmdc:mga0n895_406044_c1
3417 nmdc:mga0n895_428467_c1
3418 nmdc:mga0n895_55813_c1
3419 nmdc:mga0rr50_1170_c1
3420 nmdc:mga0rr50_180830_c1
3421 nmdc:mga0rr50_2130_c1
3422 nmdc:mga0rr50_227647_c1
3423 nmdc:mga0rr50_42090_c1
3424 nmdc:mga0rr50_74002_c1
3425 nmdc:mga08x19_101312_c1
3426 nmdc:mga08x19_135960_c1
3427 nmdc:mga08x19_4011_c1
3428 nmdc:mga08x19_6462_c1
3429 nmdc:mga08x19_69986_c1
3430 nmdc:mga08x19_72831_c1
3431 nmdc:mga0a205_108307_c1
3432 nmdc:mga0a205_12007_c1
3433 nmdc:mga0a205_120607_c1
3434 nmdc:mga0a205_143589_c1
3435 nmdc:mga0a205_202153_c1
3436 nmdc:mga0a205_22203_c1
3437 nmdc:mga0a205_321961_c1
3438 nmdc:mga0a205_734803_c1
3439 nmdc:mga0a205_98752_c1
3440 Ga0495601_0020058
3441 Ga0495601_0028098
3442 Ga0495601_0045737
3443 Ga0495601_0051205
3444 Ga0495601_0125400
3445 Ga0495612_0017122
3446 Ga0495612_0128100
3447 Ga0495595_0019166
3448 Ga0495595_0032162
3449 Ga0495595_0164755
3450 Ga0495619_0014992
3451 Ga0495619_0034422
3452 Ga0495619_0058661
3453 Ga0495619_0071902
3454 Ga0501084_0005692
3455 Ga0501084_0015481
3456 Ga0501084_0024209
3457 Ga0501084_0031104
3458 Ga0501084_0031839
3459 Ga0501084_0034448
3460 Ga0501084_0040892
3461 Ga0501084_0068454
3462 Ga0501084_0074550
3463 Ga0501084_0163222
3464 Ga0501084_0172197
3465 Ga0501084_0180909
3466 Ga0501084_0203114
3467 Ga0501084_0496632
3468 Ga0501084_0563734
3469 Ga0590071_008630
3470 Ga0590071_021250
3471 Ga0590075_007204
3472 Ga0590075_012428
3473 Ga0590077_023368
3474 Ga0501082_0001765
3475 Ga0501082_0003599
3476 Ga0501082_0003644
3477 Ga0501082_0027247
3478 Ga0501082_0036967
3479 Ga0501082_0088482
3480 Ga0501082_0098416
3481 Ga0501082_0120479
3482 Ga0501082_0202593
3483 Ga0501082_0445868
3484 Ga0501082_0676243
3485 Ga0466962_0001252
3486 Ga0466962_0006223
3487 Ga0466962_0061799
3488 Ga0530510_0004557
3489 Ga0530510_0012442
3490 Ga0530510_0070661
3491 Ga0530510_0076791
3492 Ga0530510_0078804
3493 Ga0530510_0089484
3494 Ga0530510_0116728
3495 Ga0530510_0147421
3496 Ga0530510_0148541
3497 Ga0530510_0252217
3498 Ga0530510_0320316
3499 Ga0530510_0397015
3500 Ga0530510_0454625

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12850

Metallophos_2

Calcineurin-like phosphoesterase superfamily domain

48

267

0.79

PF00149

Metallophos

Calcineurin-like phosphoesterase

48

230

0.73

Structural Annotation

Top 5 Hits

ID Description Score Start End
2xmo-assembly2.cif.gz_B the crystal structure of lmo2642 0.832 2 229
7qjg-assembly2.cif.gz_B eed in complex with prc2 allosteric inhibitor compound 6 0.8122 211 240
7td5-assembly1.cif.gz_B structure of human prc2-ezh1 containing phosphorylated suz12 0.8103 211 240
2hyo-assembly1.cif.gz_A-2 crystal structure of rv0805 n97a mutant 0.8025 2 228
5u5t-assembly1.cif.gz_A crystal structure of eed in complex with h3k27me3 peptide and 3-(benzo[d][1,3]dioxol-4-ylmethyl)piperidine-1-carboximidamide 0.8017 211 240
ID Description Score Start End Superfamily
af_Q8IM55_21_293_3.60.21.10 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.841 1 230 3.60.21.10
af_Q4DY11_62_216_3.60.21.40 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;GpdQ, catalytic alpha/beta sandwich domain 0.8324 2 102 3.60.21.40
2dxlA02 Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;GpdQ, beta-strand dimerisation domain 0.7981 92 212 3.30.750.180
2xmoA01 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.7967 2 229 3.60.21.10
2hypA00 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.7956 2 228 3.60.21.10
ID Description Score Start End GO Terms
AF-A0A7X7SN91-F1-model_v4 Metallophosphoesterase 0.985 3 242 GO:0016787
AF-A0A7W1FSK3-F1-model_v4 Metallophosphoesterase 0.9814 2 248 GO:0016787
AF-A0A3A4V2Q8-F1-model_v4 Metallophosphoesterase 0.9801 2 240 GO:0016787
AF-A0A2M6YG29-F1-model_v4 deleted 0.9795 1 200
AF-A0A7V9R9N5-F1-model_v4 Metallophosphoesterase 0.9781 1 261 GO:0016787

Map