F495520

General Info

Members Datasets Scaffolds Average Seq Length
1735 763 1450 149

Family's Representative Sequence

Representative Sequence 3300005456|Ga0070678_101021335|Ga0070678_1010213351
Length 172
Sequence MNAAIAPQAGAHSTGRALKVRVLDPRIGAEFPLPAYATAGSAGLDLLAAIDAEMILVPGARTAVPTGIAIELPLGVEAQIRPRSGLALNHGITCLNAPGTIDSDYRGEIKAILINHGDKTFNISRGAKIAQMVIARHEQAELVEVEALSESERGAGGFGSTGMNSGVMKVKA

Samples

Sample ID Description Type Environment
1 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2511231004 Pseudomonas sp. GM102 Isolate Nodule
4 2511231006 Pseudomonas sp. GM17 Isolate Nodule
5 2511231007 Pseudomonas sp. GM18 Isolate Nodule
6 2511231008 Pseudomonas sp. GM21 Isolate Nodule
7 2511231010 Pseudomonas sp. GM25 Isolate Nodule
8 2511231011 Pseudomonas sp. GM30 Isolate Nodule
9 2511231012 Pseudomonas sp. GM33 Isolate Nodule
10 2511231014 Pseudomonas sp. GM48 Isolate Nodule
11 2511231015 Pseudomonas sp. GM49 Isolate Nodule
12 2511231016 Pseudomonas sp. GM50 Isolate Nodule
13 2511231017 Pseudomonas sp. GM55 Isolate Nodule
14 2511231018 Pseudomonas sp. GM60 Isolate Nodule
15 2511231019 Pseudomonas sp. GM67 Isolate Nodule
16 2511231020 Pseudomonas sp. GM74 Isolate Nodule
17 2511231021 Pseudomonas sp. GM78 Isolate Nodule
18 2511231022 Pseudomonas sp. GM79 Isolate Nodule
19 2511231023 Pseudomonas sp. GM80 Isolate Nodule
20 2511231024 Pseudomonas sp. GM84 Isolate Nodule
21 2511231031 Pseudomonas sp. GM16 Isolate Nodule
22 2511231156 Pseudomonas ogarae F113 Isolate Rhizosphere
23 2512047018 Pseudomonas chlororaphis chlororaphis GP72 Isolate Rhizosphere
24 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
25 2554235132 Pseudomonas aeruginosa PGPR2 Isolate Unclassified
26 2554235231 Pseudomonas putida MTCC 5279 Isolate Unclassified
27 2554235341 Pseudomonas protegens CHA0 Isolate Rhizosphere
28 2582580891 Pseudomonas chlororaphis YL-1 Isolate Unclassified
29 2597489887 Pseudomonas chlororaphis aureofaciens 30-84 Isolate Rhizosphere
30 2597489888 Pseudomonas fluorescens SS101 Isolate Rhizosphere
31 2597489889 Pseudomonas synxantha BG33R Isolate Rhizosphere
32 2599185155 Pseudomonas sp. NFACC10-1 Isolate Rhizoplane
33 2599185160 Pseudomonas sp. NFPP25 Isolate Rhizoplane
34 2599185161 Pseudomonas sp. NFPP09 Isolate Rhizoplane
35 2599185162 Pseudomonas sp. NFPP10 Isolate Rhizoplane
36 2599185163 Pseudomonas sp. NFPP12 Isolate Rhizoplane
37 2599185164 Pseudomonas sp. NFPP13 Isolate Rhizoplane
38 2599185165 Pseudomonas sp. NFPP18 Isolate Rhizoplane
39 2599185166 Pseudomonas sp. NFPP08 Isolate Rhizoplane
40 2599185167 Pseudomonas sp. NFPP28 Isolate Rhizoplane
41 2599185168 Pseudomonas sp. NFPP05 Isolate Rhizoplane
42 2599185179 Pseudomonas sp. NFR09 Isolate Rhizoplane
43 2599185181 Pseudomonas sp. NFPP17 Isolate Rhizoplane
44 2599185182 Pseudomonas sp. NFPP19 Isolate Rhizoplane
45 2599185185 Pseudomonas sp. NFPP07 Isolate Rhizoplane
46 2599185186 Pseudomonas sp. NFPP15 Isolate Rhizoplane
47 2599185188 Pseudomonas sp. NFACC45 Isolate Rhizoplane
48 2599185189 Pseudomonas sp. NFPP02 Isolate Rhizoplane
49 2599185190 Pseudomonas sp. NFPP04 Isolate Rhizoplane
50 2599185191 Pseudomonas sp. NFPP24 Isolate Rhizoplane
51 2599185212 Pseudomonas sp. NFACC15-1 Isolate Rhizoplane
52 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
53 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
54 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
55 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
56 2599185248 Pseudomonas sp. NFACC08-1 Isolate Rhizoplane
57 2599185257 Pseudomonas sp. NFACC41-3 Isolate Rhizoplane
58 2599185288 Pseudomonas sp. NFACC25 Isolate Rhizoplane
59 2599185289 Pseudomonas sp. NFACC51 Isolate Rhizoplane
60 2599185290 Pseudomonas sp. NFPP11 Isolate Rhizoplane
61 2599185291 Pseudomonas sp. NFACC48-1 Isolate Rhizoplane
62 2599185300 Pseudomonas sp. NFACC39-1 Isolate Rhizoplane
63 2599185302 Pseudomonas sp. NFACC43 Isolate Rhizoplane
64 2599185303 Pseudomonas sp. NFACC42-2 Isolate Rhizoplane
65 2599185304 Pseudomonas sp. NFACC47-1 Isolate Rhizoplane
66 2599185305 Pseudomonas sp. NFACC07-1 Isolate Rhizoplane
67 2599185306 Pseudomonas sp. NFACC16-2 Isolate Rhizoplane
68 2599185308 Pseudomonas sp. NFACC17-2 Isolate Rhizoplane
69 2599185309 Pseudomonas sp. NFACC49-2 Isolate Rhizoplane
70 2599185310 Pseudomonas sp. NFACC09-4 Isolate Rhizoplane
71 2599185311 Pseudomonas sp. NFACC04-2 Isolate Rhizoplane
72 2599185312 Pseudomonas sp. NFACC32-1 Isolate Rhizoplane
73 2599185313 Pseudomonas sp. NFACC05-1 Isolate Rhizoplane
74 2599185314 Pseudomonas sp. NFACC23-1 Isolate Rhizoplane
75 2599185315 Pseudomonas sp. NFACC44-2 Isolate Rhizoplane
76 2599185316 Pseudomonas sp. NFACC52 Isolate Rhizoplane
77 2599185317 Pseudomonas sp. NFACC06-1 Isolate Rhizoplane
78 2599185318 Pseudomonas sp. NFACC13-1 Isolate Rhizoplane
79 2599185319 Pseudomonas sp. NFACC24-1 Isolate Rhizoplane
80 2599185320 Pseudomonas sp. NFACC36 Isolate Rhizoplane
81 2599185321 Pseudomonas sp. NFACC54 Isolate Rhizoplane
82 2599185322 Pseudomonas sp. NFACC14 Isolate Rhizoplane
83 2599185323 Pseudomonas sp. NFACC37-1 Isolate Rhizoplane
84 2599185324 Pseudomonas sp. NFACC46-3 Isolate Rhizoplane
85 2599185325 Pseudomonas sp. NFACC56-3 Isolate Rhizoplane
86 2599185356 Pseudomonas sp. NFPP14 Isolate Rhizoplane
87 2600254930 Pseudomonas sp. NFIX10 Isolate Rhizoplane
88 2600254931 Pseudomonas sp. NFIX28 Isolate Rhizoplane
89 2600254954 Pseudomonas sp. NFACC19-2 Isolate Rhizoplane
90 2600255283 Pseudomonas sp. NFR16 Isolate Rhizoplane
91 2600255296 Pseudomonas sp. NFR02 Isolate Rhizoplane
92 2600255313 Pseudomonas sp. NFPP16 Isolate Rhizoplane
93 2600255318 Pseudomonas putida NFIX47 Isolate Rhizoplane
94 2600255389 Pseudomonas sp. NFPP33 Isolate Rhizoplane
95 2603880185 Pseudomonas sp. NFIX46 Isolate Rhizoplane
96 2603880199 Pseudomonas sp. NFIX49 Isolate Rhizoplane
97 2606217733 Pseudomonas aeruginosa NFHH01 Isolate Rhizoplane
98 2619619299 Pseudomonas veronii R4 Genome sequencing Isolate Unclassified
99 2623620443 Pseudomonas sp. DR 5-09 Isolate Unclassified
100 2623620446 Pseudomonas sp. GR 6-02 Isolate Unclassified
101 2643221565 Pseudomonas sp. Root562 Isolate Unclassified
102 2643221571 Pseudomonas sp. Root569 Isolate Unclassified
103 2643221589 Pseudomonas sp. Root68 Isolate Unclassified
104 2643221602 Pseudomonas sp. Root71 Isolate Unclassified
105 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
106 2643221633 Pseudomonas sp. Root329 Isolate Unclassified
107 2643221650 Pseudomonas sp. Root401 Isolate Unclassified
108 2643221658 Variovorax sp. Root411 Isolate Unclassified
109 2643221672 Variovorax sp. Root434 Isolate Unclassified
110 2643221683 Variovorax sp. Root473 Isolate Unclassified
111 2643221713 Pseudomonas sp. Root9 Isolate Unclassified
112 2667528170 Pseudomonas sp. NFACC50-1 Isolate Rhizoplane
113 2667528171 Pseudomonas sp. NFPP22 Isolate Rhizoplane
114 2667528176 Pseudomonas sp. NFACC11-2 Isolate Rhizoplane
115 2671180172 Pseudomonas sp. NFIX51 Isolate Rhizoplane
116 2675903420 Pseudomonas fluorescens Ps006 Isolate Unclassified
117 2675903515 Pseudomonas thivervalensis DSM 13194 Isolate Unclassified
118 2690315857 Rheinheimera sp. EpRS3 Isolate Unclassified
119 2713897148 Pseudomonas fluorescens SF39a Isolate Rhizosphere
120 2713897149 Pseudomonas fluorescens SF4c Isolate Rhizosphere
121 2718217725 Pseudomonas fluorescens CREA-C16 Isolate Rhizosphere
122 2721755607 Pseudomonas fluorescens Pt14 Isolate Rhizosphere
123 2738541265 Pseudomonas sp. GV077 Isolate Unclassified
124 2738541271 Pseudomonas sp. GV021 Isolate Unclassified
125 2738541277 Variovorax sp. GV051 Isolate Unclassified
126 2738541282 Pseudomonas sp. GV058 Isolate Unclassified
127 2738541294 Pseudomonas sp. GV087 Isolate Unclassified
128 2738541303 Pseudomonas sp. GV105 Isolate Unclassified
129 2738541307 Variovorax sp. GV008 Isolate Unclassified
130 2738541309 Pseudomonas sp. GV047 Isolate Unclassified
131 2738543004 Pseudomonas sp. GV085 Isolate Unclassified
132 2738543013 Variovorax sp. BT01 Isolate Unclassified
133 2738543015 Pseudomonas sp. GV041 Isolate Unclassified
134 2738543016 Pseudomonas sp. GV012 Isolate Unclassified
135 2738543019 Variovorax sp. GV040 Isolate Unclassified
136 2738543020 Pseudomonas sp. GV054 Isolate Unclassified
137 2738543021 Pseudomonas sp. GV071 Isolate Unclassified
138 2738543025 Pseudomonas sp. GV091 Isolate Unclassified
139 2740892503 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
140 2744054620 Pseudomonas thivervalensis LMG 21626 Isolate Unclassified
141 2773857670 Pseudomonas sp. 478 Isolate Unclassified
142 2773857673 Pseudomonas sp. 443 Isolate Unclassified
143 2784132063 Pseudomonas sp. 424 Isolate Unclassified
144 2784132072 Pseudomonas sp. 460 Isolate Unclassified
145 2791355520 Pseudomonas sp. s211(2017) Isolate Unclassified
146 2806310737 Pseudomonas mosselii BS011 Isolate Unclassified
147 2806310745 Pseudomonas mosselii PtA1 Isolate Unclassified
148 2808606361 Pseudomonas sp. SJZ075 Isolate Rhizosphere
149 2808606373 Pseudomonas sp. SLBN-2 Isolate Unclassified
150 2808606376 Pseudomonas sp. SJZ074 Isolate Rhizosphere
151 2808606377 Pseudomonas sp. SJZ083 Isolate Rhizosphere
152 2808606378 Pseudomonas sp. SJZ078 Isolate Rhizosphere
153 2808606379 Pseudomonas sp. SJZ079 Isolate Rhizosphere
154 2808606380 Pseudomonas sp. SJZ085 Isolate Rhizosphere
155 2808606381 Pseudomonas sp. SJZ077 Isolate Rhizosphere
156 2808606382 Pseudomonas sp. SJZ080 Isolate Rhizosphere
157 2808606383 Pseudomonas sp. SJZ124 Isolate Rhizosphere
158 2808606385 Pseudomonas sp. SJZ103 Isolate Rhizosphere
159 2808606388 Pseudomonas sp. SJZ094 Isolate Rhizosphere
160 2808606389 Pseudomonas sp. SJZ101 Isolate Rhizosphere
161 2808606445 Pseudomonas sp. SJZ131 Isolate Rhizosphere
162 2816332298 Pseudomonas veronii R02 Isolate Rhizosphere
163 2818991446 Variovorax sp. 1180 Isolate Unclassified
164 2818991456 Pseudomonas koreensis 3286 Isolate Rhizosphere
165 2818991464 Pseudomonas protegens 3295 Isolate Rhizosphere
166 2823421272 Pseudomonas mendocina S5.2 Isolate Rhizoplane
167 2825651385 Pseudomonas brassicacearum L13-6-12 Isolate Rhizosphere
168 2826581358 Pseudomonas viridiflava CDRTc14 Isolate Unclassified
169 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
170 2834028612 Pseudomonas fluorescens 513 Isolate Unclassified
171 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
172 2842677519 Variovorax sp. R-72495 Isolate Unclassified
173 2842733646 Variovorax sp. R-72446 Isolate Unclassified
174 2842747753 Variovorax sp. R-72060 Isolate Unclassified
175 2842805378 Pseudomonas sp. R-72599 Isolate Unclassified
176 2842815866 Pseudomonas sp. R-72210 Isolate Unclassified
177 2842826826 Pseudomonas sp. R-72172 Isolate Unclassified
178 2842832357 Pseudomonas sp. R-72164 Isolate Unclassified
179 2842837860 Pseudomonas sp. R-72102 Isolate Unclassified
180 2842843487 Pseudomonas sp. R-72074 Isolate Unclassified
181 2842849001 Pseudomonas sp. R-72008 Isolate Unclassified
182 2842854478 Pseudomonas sp. R-71998 Isolate Unclassified
183 2844665904 Pseudomonas protegens H1F10C Isolate Unclassified
184 2852612431 Pseudomonas sp. SJZ073 Isolate Rhizosphere
185 2852657418 Pseudomonas sp. JAI115 Isolate Rhizosphere
186 2852667396 Pseudomonas sp. JAI120 Isolate Rhizosphere
187 2860339153 Pseudomonas sp. JAI111 Isolate Rhizosphere
188 2860867994 Pseudomonas sp. R1-43-08 Isolate Rhizosphere
189 2878029506 Pseudomonas fluorescens DR397 Isolate Rhizosphere
190 2880230671 Pseudomonas fluorescens LBUM677 Isolate Unclassified
191 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
192 2885198086 Variovorax sp. 679 Isolate Unclassified
193 2885211737 Variovorax sp. 553 Isolate Unclassified
194 2899924645 Variovorax sp. 369 Isolate Unclassified
195 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
196 2904456579 Variovorax sp. 2002 Isolate Unclassified
197 2904518522 Pseudomonas fluorescens 4488 Isolate Rhizosphere
198 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
199 2904550169 Stutzerimonas stutzeri 1099 Isolate Rhizosphere
200 2908446538 Pseudomonas sp. R76 Isolate Rhizosphere
201 2912963787 Pseudomonas sp. R32 Isolate Rhizosphere
202 2913036834 Pseudomonas viciae 11K1 Isolate Rhizosphere
203 2917070673 Pseudomonas protegens CHA0 Isolate Rhizosphere
204 2919063839 Pseudomonas pharyngis 1098 Isolate Rhizosphere
205 2919385768 Pseudomonas sp. 2957 Isolate Unclassified
206 2919456309 Pseudomonas sp. 3296 Isolate Rhizosphere
207 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
208 2919481497 Pseudomonas brassicacearum 3432 Isolate Unclassified
209 2919487758 Pseudomonas koreensis 3441 Isolate Unclassified
210 2919493220 Aeromonas salmonicida salmonicida 3466 Isolate Unclassified
211 2919501602 Pseudomonas alcaliphila 3512 Isolate Unclassified
212 2919534386 Rheinheimera pacifica 3879 Isolate Unclassified
213 2919543075 Aeromonas salmonicida masoucida 4076 Isolate Unclassified
214 2919688452 Pararheinheimera soli 4138 Isolate Unclassified
215 2919697872 Pseudomonas frederiksbergensis 4169 Isolate Unclassified
216 2923153595 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
217 2923525760 Aeromonas caviae SLBN-129 Isolate Rhizosphere
218 2923586266 Pseudomonas fluorescens 1550 Isolate Rhizosphere
219 2926063275 Pseudomonas sp. 3400 Isolate Unclassified
220 2928037797 Variovorax sp. 1126 Isolate Unclassified
221 2928044640 Variovorax sp. 1128 Isolate Unclassified
222 2928051484 Variovorax sp. 1133 Isolate Unclassified
223 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
224 2928070936 Variovorax gossypii 1167 Isolate Unclassified
225 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
226 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
227 2929144301 Pseudomonas sp. R-71838 Hybrid assembly Isolate Unclassified
228 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
229 2929189879 Pseudomonas sp. R-71842 Hybrid assembly Isolate Unclassified
230 2929520902 Variovorax beijingensis 502 Isolate Unclassified
231 2931369376 Pseudomonas fluorescens DR133 Isolate Rhizosphere
232 2931390751 Pseudomonas sp. DR208 Isolate Rhizosphere
233 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
234 2935353572 Pseudomonas protegens TECH19 Isolate Unclassified
235 2939636861 Pseudomonas sp. 2725 Isolate Rhizosphere
236 2939651529 Pseudomonas sp. 2835 Isolate Rhizosphere
237 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
238 2945928738 Pseudomonas cedrina W1I11 Isolate Rhizosphere
239 2945961074 Pseudomonas sp. W2I6 Isolate Rhizosphere
240 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
241 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
242 2946006987 Pseudomonas sp. W3I7 Isolate Rhizosphere
243 2946027586 Pseudomonas sp. W4I3 Isolate Rhizosphere
244 2947233263 Pseudomonas synxantha W2I4 Isolate Rhizosphere
245 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
246 2974289157 Pseudomonas fluorescens SORGH_AS 191 Isolate Unclassified
247 2984286254 Pseudomonas chlororaphis aurantiaca JD37 Isolate Rhizosphere
248 2988728565 Pseudomonas corrugata RM1-1-4 Isolate Rhizosphere
249 2998139840 Pseudomonas iranensis SWRI54 Isolate Rhizosphere
250 3007315729 Pseudomonas argentinensis SA190 Isolate Unclassified
251 3007419365 Pseudomonas vanderleydeniana RW8P3 Isolate Unclassified
252 3007511990 Pseudomonas fluorescens G20-18 Isolate Rhizosphere
253 3007614139 Pseudomonas sp. PB106 Isolate Unclassified
254 3007619802 Pseudomonas sp. PB120 Isolate Unclassified
255 3007718800 Pseudomonas fluorescens BW11P2 Isolate Rhizosphere
256 3007803356 Pseudomonas sp. CM27 Isolate Unclassified
257 3007855910 Pseudomonas khorasanensis SWRI153 Isolate Rhizosphere
258 3007861166 Pseudomonas hamedanensis SWRI65 Isolate Rhizosphere
259 3007866637 Pseudomonas marvdashtae SWRI102 Isolate Rhizosphere
260 3007872151 Pseudomonas sp. SWRI51 Isolate Rhizosphere
261 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
262 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
263 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
264 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
265 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
266 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
267 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
268 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
269 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
270 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
271 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
272 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
273 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
274 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
275 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
276 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
277 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
278 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
279 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
280 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
281 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
282 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
283 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
284 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
285 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
286 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
287 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
288 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
289 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
290 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
291 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
292 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
293 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
294 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
295 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
296 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
297 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
298 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
299 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
300 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
301 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
302 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
303 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
304 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
305 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
306 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
307 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
308 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
309 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
310 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
311 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
312 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
313 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
314 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
315 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
316 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
317 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
318 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
319 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
320 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
321 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
322 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
323 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
324 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
325 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
326 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
327 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
328 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
329 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
330 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
331 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
332 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
333 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
334 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
335 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
336 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
337 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
338 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
339 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
340 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
341 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
342 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
343 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
344 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
345 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
346 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
347 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
348 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
349 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
350 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
351 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
352 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
353 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
354 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
355 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
356 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
357 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
358 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
359 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
360 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
361 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
362 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
363 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
364 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
365 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
366 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
367 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
368 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
369 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
370 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
371 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
372 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
373 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
374 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
375 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
376 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
377 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
378 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
379 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
380 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
381 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
382 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
383 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
384 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
385 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
386 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
387 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
388 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
389 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
390 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
391 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
392 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
393 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
394 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
395 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
396 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
397 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
398 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
399 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
400 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
401 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
402 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
403 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
404 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
405 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
406 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
407 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
408 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
409 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
410 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
411 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
412 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
413 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
414 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
415 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
416 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
417 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
418 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
419 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
420 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
421 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
422 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
423 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
424 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
425 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
426 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
427 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
428 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
429 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
430 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
431 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
432 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
433 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
434 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
435 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
436 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
437 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
438 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
439 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
440 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
441 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
442 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
443 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
444 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
445 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
446 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
447 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
448 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
449 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
450 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
451 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
452 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
453 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
454 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
455 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
456 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
457 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
458 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
459 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
460 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
461 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
462 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
463 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
464 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
465 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
466 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
467 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
468 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
469 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
470 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
471 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
472 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
473 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
474 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
475 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
476 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
477 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
478 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
479 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
480 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
481 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
482 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
483 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
484 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
485 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
486 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
487 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
488 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
489 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
490 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
491 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
492 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
493 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
494 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
495 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
496 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
497 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
498 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
499 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
500 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
501 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
502 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
503 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
504 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
505 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
506 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
507 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
508 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
509 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
510 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
511 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
512 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
513 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
514 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
515 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
516 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
517 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
518 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
519 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
520 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
521 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
522 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
523 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
524 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
525 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
526 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
527 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
528 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
529 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
530 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
531 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
532 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
533 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
534 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
535 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
536 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
537 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
538 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
539 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
540 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
541 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
542 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
543 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
544 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
545 3300042132 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 Metagenome Rhizosphere
546 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
547 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
548 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
549 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
550 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
551 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
552 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
553 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
554 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
555 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
556 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
557 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
558 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
559 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
560 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
561 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
562 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
563 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
564 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
565 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
566 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
567 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
568 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
569 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
570 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
571 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
572 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
573 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
574 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
575 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
576 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
577 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
578 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
579 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
580 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
581 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
582 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
583 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
584 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
585 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
586 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
587 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
588 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
589 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
590 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
591 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
592 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
593 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
594 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
595 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
596 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
597 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
598 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
599 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
600 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
601 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
602 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
603 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
604 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
605 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
606 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
607 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
608 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
609 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
610 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
611 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
612 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
613 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
614 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
615 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
616 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
617 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
618 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
619 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
620 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
621 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
622 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
623 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
624 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
625 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
626 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
627 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
628 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
629 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
630 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
631 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
632 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
633 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
634 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
635 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
636 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
637 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
638 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
639 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
640 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
641 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
642 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
643 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
644 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
645 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
646 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
647 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
648 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
649 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
650 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
651 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
652 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
653 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
654 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
655 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
656 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
657 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
658 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
659 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
660 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
661 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
662 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
663 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
664 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
665 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
666 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
667 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
668 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
669 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
670 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
671 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
672 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
673 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
674 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
675 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
676 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
677 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
678 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
679 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
680 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
681 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
682 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
683 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
684 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
685 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
686 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
687 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
688 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
689 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
690 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
691 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
692 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
693 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
694 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
695 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
696 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
697 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
698 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
699 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
700 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
701 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
702 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
703 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
704 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
705 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
706 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
707 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
708 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
709 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
710 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
711 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
712 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
713 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
714 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
715 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
716 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
717 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
718 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
719 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
720 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
721 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
722 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
723 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
724 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
725 3300053135 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere Metagenome Endosphere
726 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
727 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
728 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
729 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
730 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
731 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
732 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
733 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
734 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
735 3300053734 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 endosphere Metagenome Endosphere
736 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
737 637000220 Pseudomonas protegens Pf-5 Isolate Rhizoplane
738 8002745576 Marinomonas spartinae USM8 Isolate Rhizosphere
739 8015687852 Pseudomonas chlororaphis aurantiaca RP4 Isolate Rhizosphere
740 8019769354 Pseudomonas sp. MSSRFD41 Isolate Rhizosphere
741 8019775933 Pseudomonas sp. PvR083 Isolate Rhizosphere
742 8029995093 Pseudomonas atacamensis SM1 Isolate Rhizosphere
743 8034962539 Pseudomonas sediminis PI11 Isolate Rhizosphere
744 8052494512 Pseudomonas putida LD6 Isolate Unclassified
745 8054285046 Pseudomonas petroselini MAFF 311096 Isolate Nodule
746 8054347763 Pseudomonas carnis NWU Be30 Isolate Unclassified
747 8054503363 Pseudomonas sivasensis BsEB-1 Isolate Unclassified
748 8054929484 Pseudomonas vlassakiae RW4S1 Isolate Rhizosphere
749 8055770955 Pseudomonas chlororaphis qlu-1 Isolate Rhizosphere
750 8055817908 Pseudomonas pergaminensis 1008 Isolate Rhizosphere
751 8056115690 Pseudomonas muyukensis COW39 Isolate Rhizosphere
752 8056120720 Pseudomonas maumuensis COW77 Isolate Rhizosphere
753 8056125926 Pseudomonas azerbaijanorientalis SWRI123 Isolate Rhizosphere
754 8056131705 Pseudomonas asgharzadehiana SWRI132 Isolate Rhizosphere
755 8056137416 Pseudomonas fakonensis COW40 Isolate Rhizosphere
756 8056143049 Pseudomonas alvandae SWRI17 Isolate Rhizosphere
757 8056148874 Pseudomonas khavaziana SWRI124 Isolate Rhizosphere
758 8056155041 Pseudomonas farris SWRI79 Isolate Rhizosphere
759 8056166840 Pseudomonas triticicola SWRI88 Isolate Rhizosphere
760 8056172158 Pseudomonas ekonensis COR58 Isolate Rhizosphere
761 8056177738 Pseudomonas azerbaijanoccidentalis SWRI74 Isolate Rhizosphere
762 8056569372 Pseudomonas serboccidentalis IT-P374 Isolate Rhizosphere
763 8057798959 Pseudomonas piscis BW16M1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 83.46
Metatranscriptomes 0.12
Isolates 16.43

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.74
Nodule 2.07
Rhizoplane 5.94
Rhizosphere 67.72
Stem 0
Stem Tuber 0
Unclassified 11.53

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS2a_Contig_1014 2124908027 Bacteria 1541
2 MRS2a_Contig_772 2124908027 Bacteria 25215
3 SwRhRL2b_contig_3165809 2162886007 Bacteria 1433
4 JGI24741J21665_1001298 3300001915 Bacteria 7319
5 JGI24737J22298_10060107 3300001990 Bacteria 1144
6 JGI25162J39368_1002064 3300002737 Bacteria 8705
7 JGI25154J39366_1006179 3300002738 Bacteria 1789
8 JGI25158J39367_1019037 3300002739 Bacteria 847
9 JGI25163J39215_1005917 3300002771 Bacteria 748
10 JGI25164J39214_1001004 3300002772 Bacteria 8816
11 JGI25164J39214_1001279 3300002772 Bacteria 6465
12 JGI25152J39213_1022211 3300002773 Bacteria 1101
13 JGI25151J46595_10004639 3300003187 Bacteria 7230
14 JGI25151J46595_10020532 3300003187 Bacteria 2783
15 JGI25151J46595_10132605 3300003187 Bacteria 618
16 JGI25165J46597_1001843 3300003214 Bacteria 8801
17 JGI25165J46597_1001871 3300003214 Bacteria 8639
18 JGI25161J50226_1004834 3300003374 Bacteria 2750
19 Ga0006562J51391_1029315 3300003578 Bacteria 2816
20 Ga0006562J51391_1029316 3300003578 Bacteria 2690
21 Ga0055538_1000012 3300003751 Bacteria 353826
22 Ga0055539_1000017 3300003752 Bacteria 353873
23 Ga0055533_1000021 3300003756 Bacteria 353826
24 Ga0055532_1000119 3300003758 Bacteria 83382
25 Ga0055525_1000078 3300003759 Bacteria 165788
26 Ga0055535_1000849 3300003761 Bacteria 21724
27 Ga0055542_1000033 3300003762 Bacteria 233997
28 Ga0055537_1000490 3300003773 Bacteria 24227
29 Ga0055536_1001878 3300003781 Bacteria 12222
30 Ga0055536_1004465 3300003781 Bacteria 7143
31 Ga0055536_1015428 3300003781 Bacteria 2615
32 Ga0055536_1015916 3300003781 Bacteria 2544
33 Ga0055536_1016356 3300003781 Bacteria 2485
34 Ga0055536_1018125 3300003781 Bacteria 2270
35 Ga0055536_1030978 3300003781 Bacteria 1407
36 Ga0055534_1000042 3300003784 Bacteria 99433
37 Ga0055528_1000242 3300003790 Bacteria 45905
38 Ga0055530_10002438 3300003791 Bacteria 11991
39 Ga0055530_10004784 3300003791 Bacteria 6800
40 Ga0055530_10005023 3300003791 Bacteria 6521
41 Ga0055530_10013632 3300003791 Bacteria 2761
42 Ga0055530_10020556 3300003791 Bacteria 1969
43 Ga0055540_1002002 3300003792 Bacteria 11371
44 Ga0055540_1004056 3300003792 Bacteria 6800
45 Ga0055540_1004284 3300003792 Bacteria 6521
46 Ga0055540_1005786 3300003792 Bacteria 5081
47 Ga0055540_1006621 3300003792 Bacteria 4552
48 Ga0055540_1008764 3300003792 Bacteria 3591
49 Ga0055540_1012754 3300003792 Bacteria 2615
50 Ga0055531_10001137 3300003794 Bacteria 20591
51 Ga0055531_10020084 3300003794 Bacteria 2663
52 Ga0055531_10033391 3300003794 Bacteria 1659
53 Ga0055541_1000012 3300003841 Bacteria 353826
54 Ga0058692_1010460 3300003856 Bacteria 2291
55 Ga0065714_10003175 3300005288 Bacteria 8557
56 Ga0065714_10004868 3300005288 Bacteria 4380
57 Ga0065714_10005207 3300005288 Bacteria 5038
58 Ga0065714_10009160 3300005288 Bacteria 2379
59 Ga0065714_10009607 3300005288 Bacteria 6555
60 Ga0065714_10011643 3300005288 Bacteria 2115
61 Ga0065714_10015892 3300005288 Bacteria 1857
62 Ga0065714_10023761 3300005288 Bacteria 1834
63 Ga0065714_10098776 3300005288 Bacteria 1697
64 Ga0065714_10131594 3300005288 Bacteria 1245
65 Ga0065714_10243308 3300005288 Bacteria 780
66 Ga0065714_10287392 3300005288 Bacteria 713
67 Ga0065704_10005330 3300005289 Bacteria 3480
68 Ga0065704_10026003 3300005289 Bacteria 2247
69 Ga0065704_10141314 3300005289 Bacteria 1515
70 Ga0065704_10240311 3300005289 Bacteria 1013
71 Ga0065704_10309346 3300005289 Bacteria 863
72 Ga0065704_10717670 3300005289 Bacteria 554
73 Ga0065712_10000996 3300005290 Bacteria 7599
74 Ga0065712_10067862 3300005290 Bacteria 24733
75 Ga0065715_10009373 3300005293 Bacteria 2932
76 Ga0070658_10071426 3300005327 Bacteria 2843
77 Ga0070658_10093094 3300005327 Bacteria 2486
78 Ga0070658_11909505 3300005327 Bacteria 513
79 Ga0070683_102276832 3300005329 Bacteria 520
80 Ga0070670_100016361 3300005331 Bacteria 6370
81 Ga0070670_100088585 3300005331 Bacteria 2660
82 Ga0068869_100636661 3300005334 Bacteria 904
83 Ga0070666_10396438 3300005335 Bacteria 992
84 Ga0070680_100149304 3300005336 Bacteria 1962
85 Ga0070660_100236784 3300005339 Bacteria 1486
86 Ga0070660_100476071 3300005339 Bacteria 1037
87 Ga0070660_101296214 3300005339 Bacteria 618
88 Ga0070661_100001250 3300005344 Bacteria 17835
89 Ga0070661_100105889 3300005344 Bacteria 2097
90 Ga0070661_100375478 3300005344 Bacteria 1120
91 Ga0070661_101175700 3300005344 Bacteria 641
92 Ga0070668_100466150 3300005347 Bacteria 1089
93 Ga0070669_100002433 3300005353 Bacteria 13484
94 Ga0070669_100003104 3300005353 Bacteria 11955
95 Ga0070669_100022656 3300005353 Bacteria 4492
96 Ga0070659_100142285 3300005366 Bacteria 1953
97 Ga0070659_101583069 3300005366 Bacteria 585
98 Ga0070667_100039195 3300005367 Bacteria 3971
99 Ga0070667_102125694 3300005367 Bacteria 529
100 Ga0070709_10011208 3300005434 Bacteria 4987
101 Ga0070713_100222930 3300005436 Bacteria 1711
102 Ga0070713_100297250 3300005436 Bacteria 1486
103 Ga0070710_10706905 3300005437 Bacteria 712
104 Ga0070678_100110197 3300005456 Bacteria 2152
105 Ga0070678_101021335 3300005456 Bacteria 761
106 Ga0070662_100000829 3300005457 Bacteria 19038
107 Ga0070662_100013692 3300005457 Bacteria 5401
108 Ga0070662_100053572 3300005457 Bacteria 2921
109 Ga0070662_100268482 3300005457 Bacteria 1377
110 Ga0070662_100927868 3300005457 Bacteria 744
111 Ga0070681_10076285 3300005458 Bacteria 3311
112 Ga0070681_10155002 3300005458 Bacteria 2216
113 Ga0068867_100157834 3300005459 Bacteria 1787
114 Ga0068867_100238418 3300005459 Bacteria 1474
115 Ga0070679_100060117 3300005530 Bacteria 3787
116 Ga0070679_100076853 3300005530 Bacteria 3327
117 Ga0070679_100342252 3300005530 Bacteria 1444
118 Ga0068853_100000031 3300005539 Bacteria 116269
119 Ga0068853_100221057 3300005539 Bacteria 1730
120 Ga0068853_100882267 3300005539 Bacteria 859
121 Ga0068853_101824436 3300005539 Bacteria 590
122 Ga0070672_100469195 3300005543 Bacteria 1086
123 Ga0070665_100000571 3300005548 Bacteria 51504
124 Ga0070665_100013698 3300005548 Bacteria 8159
125 Ga0070665_100059460 3300005548 Bacteria 3831
126 Ga0070665_100065852 3300005548 Bacteria 3634
127 Ga0070665_100124423 3300005548 Bacteria 2580
128 Ga0070665_100244621 3300005548 Bacteria 1794
129 Ga0070665_100291021 3300005548 Bacteria 1636
130 Ga0070665_100675342 3300005548 Bacteria 1046
131 Ga0070665_101020082 3300005548 Bacteria 839
132 Ga0068855_100025725 3300005563 Bacteria 7038
133 Ga0068855_100029751 3300005563 Bacteria 6530
134 Ga0068855_100077352 3300005563 Bacteria 3861
135 Ga0068855_100381117 3300005563 Bacteria 1548
136 Ga0068855_100910186 3300005563 Bacteria 929
137 Ga0070664_100001524 3300005564 Bacteria 18496
138 Ga0068857_100247199 3300005577 Bacteria 1634
139 Ga0068857_100851124 3300005577 Bacteria 873
140 Ga0068854_100013592 3300005578 Bacteria 5348
141 Ga0068856_100045082 3300005614 Bacteria 4340
142 Ga0068856_101061333 3300005614 Bacteria 828
143 Ga0068856_101622280 3300005614 Bacteria 660
144 Ga0068852_100016998 3300005616 Bacteria 5695
145 Ga0068852_100764704 3300005616 Bacteria 979
146 Ga0068859_100018254 3300005617 Bacteria 7053
147 Ga0068851_10000007 3300005834 Bacteria 244101
148 Ga0068863_100025309 3300005841 Bacteria 5658
149 Ga0068863_100671152 3300005841 Bacteria 1029
150 Ga0068862_100076069 3300005844 Bacteria 2905
151 Ga0081455_10409371 3300005937 Bacteria 939
152 Ga0075365_10000743 3300006038 Bacteria 13196
153 Ga0075365_10029846 3300006038 Bacteria 3488
154 Ga0075365_10106132 3300006038 Bacteria 1927
155 Ga0075365_10490777 3300006038 Bacteria 868
156 Ga0075363_100011892 3300006048 Bacteria 4180
157 Ga0075363_100023389 3300006048 Bacteria 3131
158 Ga0075363_100045017 3300006048 Bacteria 2339
159 Ga0075363_100184208 3300006048 Bacteria 1189
160 Ga0075363_100239570 3300006048 Bacteria 1043
161 Ga0075364_10017430 3300006051 Bacteria 4487
162 Ga0075364_10038491 3300006051 Bacteria 3098
163 Ga0075364_10124551 3300006051 Bacteria 1727
164 Ga0075364_10138651 3300006051 Bacteria 1635
165 Ga0075364_10349567 3300006051 Bacteria 1008
166 Ga0075364_10498566 3300006051 Bacteria 832
167 Ga0075364_10816516 3300006051 Bacteria 635
168 Ga0075432_10015325 3300006058 Bacteria 2613
169 Ga0075432_10028921 3300006058 Bacteria 1912
170 Ga0075432_10029537 3300006058 Bacteria 1893
171 Ga0075432_10033375 3300006058 Bacteria 1785
172 Ga0075432_10067101 3300006058 Bacteria 1285
173 Ga0075432_10191120 3300006058 Bacteria 806
174 Ga0075432_10294525 3300006058 Bacteria 672
175 Ga0075362_10025103 3300006177 Bacteria 2533
176 Ga0075362_10027254 3300006177 Bacteria 2445
177 Ga0075362_10069996 3300006177 Bacteria 1601
178 Ga0075362_10165140 3300006177 Bacteria 1067
179 Ga0075367_10002366 3300006178 Bacteria 8576
180 Ga0075367_10072090 3300006178 Bacteria 2079
181 Ga0075367_10119723 3300006178 Bacteria 1622
182 Ga0075367_10286879 3300006178 Bacteria 1035
183 Ga0075367_10451170 3300006178 Bacteria 815
184 Ga0075369_10001094 3300006186 Bacteria 9087
185 Ga0075369_10184425 3300006186 Bacteria 960
186 Ga0075427_10000019 3300006194 Bacteria 10650
187 Ga0075366_10023437 3300006195 Bacteria 3595
188 Ga0075366_10034240 3300006195 Bacteria 2991
189 Ga0075366_10298341 3300006195 Bacteria 986
190 Ga0097621_100003551 3300006237 Bacteria 10769
191 Ga0097621_100472123 3300006237 Bacteria 1133
192 Ga0097621_101038863 3300006237 Bacteria 767
193 Ga0075370_10017763 3300006353 Bacteria 3847
194 Ga0075370_10018167 3300006353 Bacteria 3811
195 Ga0075370_10019251 3300006353 Bacteria 3716
196 Ga0075370_10021275 3300006353 Bacteria 3554
197 Ga0075370_10023017 3300006353 Bacteria 3427
198 Ga0075370_10075336 3300006353 Bacteria 1934
199 Ga0068871_100107957 3300006358 Bacteria 2338
200 Ga0075434_101843405 3300006871 Unclassified 611
201 Ga0075429_100010636 3300006880 Bacteria 7960
202 Ga0068865_100786334 3300006881 Bacteria 820
203 Ga0075436_100188367 3300006914 Bacteria 1459
204 Ga0075436_101095196 3300006914 Bacteria 599
205 Ga0097620_100018254 3300006931 Bacteria 7053
206 Ga0099823_1020334 3300006944 Bacteria 6279
207 Ga0079104_1000886 3300006946 Bacteria 24528
208 Ga0079104_1002975 3300006946 Bacteria 8349
209 Ga0079104_1087561 3300006946 Bacteria 635
210 Ga0079104_1104169 3300006946 Bacteria 565
211 Ga0099826_10008314 3300006948 Bacteria 7709
212 Ga0099826_10009833 3300006948 Bacteria 7146
213 Ga0099826_10075199 3300006948 Bacteria 2127
214 Ga0075435_101277415 3300007076 Bacteria 643
215 Ga0105251_10000089 3300009011 Bacteria 88101
216 Ga0105251_10006466 3300009011 Bacteria 7458
217 Ga0105251_10008076 3300009011 Bacteria 6375
218 Ga0105251_10014857 3300009011 Bacteria 4280
219 Ga0105251_10017646 3300009011 Bacteria 3818
220 Ga0105251_10033069 3300009011 Bacteria 2571
221 Ga0105251_10035071 3300009011 Bacteria 2477
222 Ga0105251_10059218 3300009011 Bacteria 1807
223 Ga0105251_10336160 3300009011 Bacteria 688
224 Ga0105251_10378634 3300009011 Bacteria 648
225 Ga0105251_10430314 3300009011 Bacteria 609
226 Ga0105244_10000196 3300009036 Bacteria 61364
227 Ga0105244_10003747 3300009036 Bacteria 10736
228 Ga0105244_10005963 3300009036 Bacteria 7987
229 Ga0105244_10011172 3300009036 Bacteria 5405
230 Ga0105244_10027606 3300009036 Bacteria 3057
231 Ga0105244_10041570 3300009036 Bacteria 2381
232 Ga0105244_10060997 3300009036 Bacteria 1899
233 Ga0105244_10061037 3300009036 Bacteria 1899
234 Ga0105244_10065517 3300009036 Bacteria 1820
235 Ga0105244_10097606 3300009036 Bacteria 1440
236 Ga0105244_10144840 3300009036 Bacteria 1141
237 Ga0105244_10187125 3300009036 Bacteria 980
238 Ga0105244_10246856 3300009036 Bacteria 833
239 Ga0105250_10001996 3300009092 Bacteria 10567
240 Ga0105250_10004445 3300009092 Bacteria 6453
241 Ga0105250_10024530 3300009092 Bacteria 2430
242 Ga0105250_10033320 3300009092 Bacteria 2068
243 Ga0105250_10042488 3300009092 Bacteria 1822
244 Ga0105250_10085431 3300009092 Bacteria 1281
245 Ga0105250_10129468 3300009092 Bacteria 1041
246 Ga0105250_10145565 3300009092 Bacteria 984
247 Ga0105250_10357028 3300009092 Bacteria 641
248 Ga0105240_10000196 3300009093 Bacteria 123276
249 Ga0105240_10026474 3300009093 Bacteria 7610
250 Ga0105240_10030705 3300009093 Bacteria 6980
251 Ga0105240_10059229 3300009093 Bacteria 4780
252 Ga0105240_10163963 3300009093 Bacteria 2637
253 Ga0105240_10172079 3300009093 Bacteria 2564
254 Ga0105240_10441892 3300009093 Bacteria 1457
255 Ga0105240_10794417 3300009093 Bacteria 1025
256 Ga0105240_10815851 3300009093 Bacteria 1010
257 Ga0105240_10874246 3300009093 Bacteria 969
258 Ga0111539_11074799 3300009094 Bacteria 935
259 Ga0105245_10275295 3300009098 Bacteria 1643
260 Ga0105245_10763192 3300009098 Bacteria 1003
261 Ga0105243_10001894 3300009148 Bacteria 17846
262 Ga0105243_10003861 3300009148 Bacteria 11970
263 Ga0105243_10006988 3300009148 Bacteria 8690
264 Ga0105243_10010063 3300009148 Bacteria 7191
265 Ga0105243_10016847 3300009148 Bacteria 5524
266 Ga0105243_10019997 3300009148 Bacteria 5076
267 Ga0105243_10029768 3300009148 Bacteria 4201
268 Ga0105243_10066246 3300009148 Bacteria 2904
269 Ga0105243_10117165 3300009148 Bacteria 2238
270 Ga0105243_10161863 3300009148 Bacteria 1930
271 Ga0105243_10275276 3300009148 Bacteria 1513
272 Ga0105241_10411683 3300009174 Bacteria 1188
273 Ga0105241_11885326 3300009174 Bacteria 585
274 Ga0105241_11950070 3300009174 Bacteria 577
275 Ga0105242_10000836 3300009176 Bacteria 23975
276 Ga0105242_10238879 3300009176 Bacteria 1632
277 Ga0105242_10273086 3300009176 Bacteria 1532
278 Ga0105242_10315112 3300009176 Bacteria 1433
279 Ga0105242_10447245 3300009176 Bacteria 1217
280 Ga0105242_11602830 3300009176 Bacteria 685
281 Ga0105248_10001345 3300009177 Bacteria 27389
282 Ga0105237_10012953 3300009545 Bacteria 8758
283 Ga0105237_10020421 3300009545 Bacteria 6828
284 Ga0105237_10035344 3300009545 Bacteria 5057
285 Ga0105237_10331750 3300009545 Bacteria 1525
286 Ga0105237_10372931 3300009545 Bacteria 1432
287 Ga0105237_10645582 3300009545 Bacteria 1065
288 Ga0105237_12468941 3300009545 Bacteria 530
289 Ga0105238_10006772 3300009551 Bacteria 11448
290 Ga0105238_10041466 3300009551 Bacteria 4662
291 Ga0105238_10045275 3300009551 Bacteria 4445
292 Ga0105238_10096688 3300009551 Bacteria 2939
293 Ga0105238_10128726 3300009551 Bacteria 2510
294 Ga0105238_10408404 3300009551 Bacteria 1352
295 Ga0105238_10606979 3300009551 Bacteria 1102
296 Ga0105238_11536362 3300009551 Bacteria 695
297 Ga0105239_10003927 3300010375 Bacteria 18014
298 Ga0105239_10013020 3300010375 Bacteria 9249
299 Ga0105239_10144596 3300010375 Bacteria 2651
300 Ga0105239_10208649 3300010375 Bacteria 2189
301 Ga0105239_10374025 3300010375 Bacteria 1610
302 Ga0105239_10649836 3300010375 Bacteria 1205
303 Ga0105239_10685003 3300010375 Bacteria 1172
304 Ga0105239_11930690 3300010375 Bacteria 685
305 Ga0105246_10005173 3300011119 Bacteria 7927
306 Ga0105246_10011634 3300011119 Bacteria 5465
307 Ga0105246_10014367 3300011119 Bacteria 4979
308 Ga0105246_10018086 3300011119 Bacteria 4489
309 Ga0105246_10088711 3300011119 Bacteria 2223
310 Ga0105246_10371024 3300011119 Bacteria 1179
311 Ga0157345_1032913 3300012498 Bacteria 590
312 Ga0157347_1001430 3300012502 Bacteria 1871
313 Ga0157373_10008319 3300013100 Bacteria 7709
314 Ga0157373_10018807 3300013100 Bacteria 5027
315 Ga0157373_10066274 3300013100 Bacteria 2555
316 Ga0157373_10088195 3300013100 Bacteria 2186
317 Ga0157373_10430524 3300013100 Bacteria 948
318 Ga0157373_10505974 3300013100 Bacteria 873
319 Ga0157373_10576649 3300013100 Bacteria 817
320 Ga0157371_10000109 3300013102 Bacteria 124990
321 Ga0157371_10008603 3300013102 Bacteria 8107
322 Ga0157371_10045024 3300013102 Bacteria 3141
323 Ga0157371_10234453 3300013102 Bacteria 1319
324 Ga0157370_10007852 3300013104 Bacteria 11562
325 Ga0157370_10017421 3300013104 Bacteria 7248
326 Ga0157370_10040646 3300013104 Bacteria 4490
327 Ga0157370_10116418 3300013104 Bacteria 2497
328 Ga0157370_10134274 3300013104 Bacteria 2307
329 Ga0157370_10210777 3300013104 Bacteria 1801
330 Ga0157370_10323710 3300013104 Bacteria 1422
331 Ga0157370_10359664 3300013104 Bacteria 1341
332 Ga0157370_10371228 3300013104 Bacteria 1318
333 Ga0157370_10563491 3300013104 Bacteria 1044
334 Ga0157370_10953585 3300013104 Bacteria 778
335 Ga0157370_11569551 3300013104 Bacteria 591
336 Ga0157369_10041845 3300013105 Bacteria 5000
337 Ga0157369_10407945 3300013105 Bacteria 1409
338 Ga0157369_10414656 3300013105 Bacteria 1396
339 Ga0157369_10478494 3300013105 Bacteria 1289
340 Ga0157369_10703299 3300013105 Bacteria 1041
341 Ga0157378_10000149 3300013297 Bacteria 65310
342 Ga0157378_10370848 3300013297 Bacteria 1403
343 Ga0157378_10461464 3300013297 Bacteria 1262
344 Ga0157378_11139984 3300013297 Bacteria 818
345 Ga0163162_10013294 3300013306 Bacteria 8042
346 Ga0163162_10600889 3300013306 Bacteria 1226
347 Ga0163162_10608873 3300013306 Bacteria 1218
348 Ga0157372_10124073 3300013307 Bacteria 2969
349 Ga0157372_11817603 3300013307 Bacteria 701
350 Ga0157375_10780112 3300013308 Bacteria 1105
351 Ga0157375_11677046 3300013308 Bacteria 752
352 Ga0182008_10003873 3300014497 Bacteria 8884
353 Ga0182008_10004134 3300014497 Bacteria 8546
354 Ga0182008_10004162 3300014497 Bacteria 8511
355 Ga0182008_10006124 3300014497 Bacteria 6759
356 Ga0182008_10007331 3300014497 Bacteria 6100
357 Ga0182008_10039089 3300014497 Bacteria 2372
358 Ga0182008_10059379 3300014497 Bacteria 1887
359 Ga0182008_10109911 3300014497 Bacteria 1366
360 Ga0182008_10156555 3300014497 Bacteria 1145
361 Ga0182008_10484950 3300014497 Bacteria 677
362 Ga0157376_10094787 3300014969 Bacteria 2594
363 Ga0157376_10243875 3300014969 Bacteria 1675
364 Ga0157376_11013557 3300014969 Bacteria 853
365 Ga0182006_1002216 3300015261 Bacteria 10773
366 Ga0182006_1002773 3300015261 Bacteria 9367
367 Ga0182006_1005056 3300015261 Bacteria 6341
368 Ga0182006_1006299 3300015261 Bacteria 5530
369 Ga0182006_1009996 3300015261 Bacteria 4235
370 Ga0182006_1017980 3300015261 Bacteria 2993
371 Ga0182006_1029087 3300015261 Bacteria 2241
372 Ga0182006_1033525 3300015261 Bacteria 2058
373 Ga0182006_1046029 3300015261 Bacteria 1696
374 Ga0182006_1064534 3300015261 Bacteria 1373
375 Ga0182006_1083909 3300015261 Bacteria 1158
376 Ga0182006_1084670 3300015261 Bacteria 1151
377 Ga0182007_10000601 3300015262 Bacteria 21082
378 Ga0182007_10000825 3300015262 Bacteria 17267
379 Ga0182007_10003930 3300015262 Bacteria 6878
380 Ga0182007_10050733 3300015262 Bacteria 1369
381 Ga0182007_10418662 3300015262 Bacteria 512
382 Ga0182005_1002649 3300015265 Bacteria 6304
383 Ga0182005_1044755 3300015265 Bacteria 1202
384 Ga0182005_1045196 3300015265 Bacteria 1196
385 Ga0163161_10000166 3300017792 Bacteria 60327
386 Ga0163161_10007380 3300017792 Bacteria 7592
387 Ga0163161_10021628 3300017792 Bacteria 4520
388 Ga0163161_10029422 3300017792 Bacteria 3906
389 Ga0163161_10034169 3300017792 Bacteria 3636
390 Ga0163161_10065983 3300017792 Bacteria 2642
391 Ga0163161_11676332 3300017792 Bacteria 563
392 Ga0163161_11770748 3300017792 Bacteria 549
393 Ga0213874_10001191 3300021377 Bacteria 5330
394 Ga0213876_10017706 3300021384 Bacteria 3759
395 Ga0213876_10161765 3300021384 Bacteria 1191
396 Ga0209435_102395 3300025206 Bacteria 2202
397 Ga0209760_100253 3300025207 Bacteria 21542
398 Ga0209760_100420 3300025207 Bacteria 10149
399 Ga0209436_122849 3300025208 Bacteria 797
400 Ga0209784_100007 3300025224 Bacteria 747715
401 Ga0209566_100009 3300025225 Bacteria 554018
402 Ga0209674_100021 3300025226 Bacteria 629811
403 Ga0209672_101630 3300025228 Bacteria 7422
404 Ga0209147_100009 3300025229 Bacteria 747409
405 Ga0209147_100783 3300025229 Bacteria 15459
406 Ga0209563_100018 3300025230 Bacteria 747850
407 Ga0207427_100005 3300025231 Bacteria 797999
408 Ga0207427_100006 3300025231 Bacteria 785415
409 Ga0207427_116162 3300025231 Bacteria 700
410 Ga0209437_100013 3300025233 Bacteria 785457
411 Ga0209437_100018 3300025233 Bacteria 694400
412 Ga0209258_100089 3300025242 Bacteria 234040
413 Ga0209258_100249 3300025242 Bacteria 98135
414 Ga0209646_1000298 3300025246 Bacteria 41044
415 Ga0209677_100012 3300025253 Bacteria 554018
416 Ga0209148_1000097 3300025254 Bacteria 234049
417 Ga0209759_1014362 3300025256 Bacteria 2098
418 Ga0209759_1015841 3300025256 Bacteria 1929
419 Ga0209129_1000071 3300025258 Bacteria 210729
420 Ga0209129_1005062 3300025258 Bacteria 4839
421 Ga0209129_1005094 3300025258 Bacteria 4818
422 Ga0209233_1000013 3300025261 Bacteria 1013785
423 Ga0209233_1000021 3300025261 Bacteria 798078
424 Ga0209233_1000022 3300025261 Bacteria 785415
425 Ga0209565_1000083 3300025263 Bacteria 154007
426 Ga0209565_1000334 3300025263 Bacteria 41939
427 Ga0209565_1002220 3300025263 Bacteria 7260
428 Ga0209455_1013798 3300025272 Bacteria 1860
429 Ga0209673_1000323 3300025273 Bacteria 87588
430 Ga0209673_1001906 3300025273 Bacteria 16707
431 Ga0209673_1022389 3300025273 Bacteria 2181
432 Ga0209130_1003240 3300025284 Bacteria 7142
433 Ga0209130_1003577 3300025284 Bacteria 6499
434 Ga0209675_1000081 3300025291 Bacteria 154007
435 Ga0209675_1003063 3300025291 Bacteria 8197
436 Ga0209675_1007159 3300025291 Bacteria 4326
437 Ga0209675_1032780 3300025291 Bacteria 1212
438 Ga0209676_1000005 3300025292 Bacteria 1076001
439 Ga0209676_1000015 3300025292 Bacteria 784458
440 Ga0209676_1000030 3300025292 Bacteria 506421
441 Ga0209676_1000041 3300025292 Bacteria 424583
442 Ga0209676_1001510 3300025292 Bacteria 21204
443 Ga0209676_1005014 3300025292 Bacteria 7091
444 Ga0209676_1009214 3300025292 Bacteria 4289
445 Ga0209676_1021084 3300025292 Bacteria 2197
446 Ga0209676_1073271 3300025292 Bacteria 806
447 Ga0209025_1000544 3300025294 Bacteria 70638
448 Ga0209025_1000854 3300025294 Bacteria 48260
449 Ga0209025_1001296 3300025294 Bacteria 34134
450 Ga0209025_1012749 3300025294 Bacteria 5355
451 Ga0209025_1015457 3300025294 Bacteria 4602
452 Ga0209564_1000239 3300025295 Bacteria 119761
453 Ga0209758_1000027 3300025297 Bacteria 549650
454 Ga0209758_1000185 3300025297 Bacteria 139330
455 Ga0209758_1003037 3300025297 Bacteria 15990
456 Ga0209050_1000007 3300025298 Bacteria 1187891
457 Ga0209050_1000024 3300025298 Bacteria 533389
458 Ga0209050_1000030 3300025298 Bacteria 463381
459 Ga0209050_1000332 3300025298 Bacteria 94224
460 Ga0209050_1002018 3300025298 Bacteria 18917
461 Ga0209050_1006114 3300025298 Bacteria 7263
462 Ga0209256_1000081 3300025299 Bacteria 222908
463 Ga0207426_1000027 3300025302 Bacteria 513176
464 Ga0207426_1000614 3300025302 Bacteria 45951
465 Ga0209051_1000009 3300025303 Bacteria 706778
466 Ga0209051_1000012 3300025303 Bacteria 595474
467 Ga0209051_1000373 3300025303 Bacteria 64348
468 Ga0209051_1000426 3300025303 Bacteria 57797
469 Ga0209051_1000719 3300025303 Bacteria 36150
470 Ga0209051_1002063 3300025303 Bacteria 15237
471 Ga0209051_1020630 3300025303 Bacteria 2830
472 Ga0209051_1137235 3300025303 Bacteria 594
473 Ga0209257_1000011 3300025304 Bacteria 1112630
474 Ga0209257_1000262 3300025304 Bacteria 121021
475 Ga0209257_1000449 3300025304 Bacteria 77522
476 Ga0209257_1004152 3300025304 Bacteria 11519
477 Ga0207656_10000015 3300025321 Bacteria 125447
478 Ga0207696_1000055 3300025711 Bacteria 258289
479 Ga0207696_1000078 3300025711 Bacteria 207623
480 Ga0207696_1000080 3300025711 Bacteria 199217
481 Ga0207696_1000204 3300025711 Bacteria 90602
482 Ga0207696_1003242 3300025711 Bacteria 7507
483 Ga0207696_1003560 3300025711 Bacteria 7037
484 Ga0207696_1004230 3300025711 Bacteria 6236
485 Ga0207696_1006665 3300025711 Bacteria 4617
486 Ga0207696_1009586 3300025711 Bacteria 3603
487 Ga0207696_1022512 3300025711 Bacteria 2001
488 Ga0207696_1026800 3300025711 Bacteria 1780
489 Ga0207655_1000033 3300025728 Bacteria 377066
490 Ga0207655_1000747 3300025728 Bacteria 36428
491 Ga0207655_1001006 3300025728 Bacteria 28697
492 Ga0207655_1001169 3300025728 Bacteria 25503
493 Ga0207655_1001731 3300025728 Bacteria 19151
494 Ga0207655_1002470 3300025728 Bacteria 14982
495 Ga0207655_1004567 3300025728 Bacteria 9754
496 Ga0207655_1010154 3300025728 Bacteria 5749
497 Ga0207655_1013075 3300025728 Bacteria 4790
498 Ga0207655_1015746 3300025728 Bacteria 4182
499 Ga0207655_1030164 3300025728 Bacteria 2527
500 Ga0207655_1030991 3300025728 Bacteria 2474
501 Ga0207655_1033456 3300025728 Bacteria 2329
502 Ga0207655_1043386 3300025728 Bacteria 1902
503 Ga0207655_1060285 3300025728 Bacteria 1472
504 Ga0207655_1158180 3300025728 Bacteria 711
505 Ga0207713_1000010 3300025735 Bacteria 528374
506 Ga0207713_1000079 3300025735 Bacteria 172274
507 Ga0207713_1000249 3300025735 Bacteria 68771
508 Ga0207713_1000835 3300025735 Bacteria 28378
509 Ga0207713_1001826 3300025735 Bacteria 16267
510 Ga0207713_1004136 3300025735 Bacteria 9547
511 Ga0207713_1006432 3300025735 Bacteria 7154
512 Ga0207713_1009068 3300025735 Bacteria 5651
513 Ga0207713_1011139 3300025735 Bacteria 4918
514 Ga0207713_1013995 3300025735 Bacteria 4193
515 Ga0207713_1015441 3300025735 Bacteria 3920
516 Ga0207713_1025592 3300025735 Bacteria 2721
517 Ga0207713_1028855 3300025735 Bacteria 2495
518 Ga0207713_1041623 3300025735 Bacteria 1915
519 Ga0207713_1043475 3300025735 Bacteria 1856
520 Ga0207680_10584086 3300025903 Bacteria 799
521 Ga0207705_10001989 3300025909 Bacteria 15885
522 Ga0207705_10467378 3300025909 Bacteria 979
523 Ga0207705_10469421 3300025909 Bacteria 976
524 Ga0207654_10880263 3300025911 Bacteria 649
525 Ga0207654_10990518 3300025911 Bacteria 611
526 Ga0207707_11252320 3300025912 Bacteria 598
527 Ga0207695_10001140 3300025913 Bacteria 46086
528 Ga0207695_10014959 3300025913 Bacteria 9158
529 Ga0207695_10028087 3300025913 Bacteria 6247
530 Ga0207695_10040636 3300025913 Bacteria 4984
531 Ga0207695_10044897 3300025913 Bacteria 4696
532 Ga0207695_10136673 3300025913 Bacteria 2404
533 Ga0207695_10188981 3300025913 Bacteria 1978
534 Ga0207671_10000027 3300025914 Bacteria 264907
535 Ga0207671_10283787 3300025914 Bacteria 1306
536 Ga0207671_10393346 3300025914 Bacteria 1102
537 Ga0207663_10622138 3300025916 Bacteria 850
538 Ga0207660_10630904 3300025917 Bacteria 873
539 Ga0207657_10038470 3300025919 Bacteria 4258
540 Ga0207657_10124060 3300025919 Bacteria 2122
541 Ga0207657_10302518 3300025919 Unclassified 1267
542 Ga0207657_11066929 3300025919 Bacteria 618
543 Ga0207649_10000012 3300025920 Bacteria 265674
544 Ga0207649_10028271 3300025920 Bacteria 3301
545 Ga0207649_10487847 3300025920 Bacteria 935
546 Ga0207649_11046695 3300025920 Bacteria 643
547 Ga0207652_10092949 3300025921 Bacteria 2654
548 Ga0207652_10129967 3300025921 Bacteria 2246
549 Ga0207681_10000138 3300025923 Bacteria 60354
550 Ga0207681_10000600 3300025923 Bacteria 24430
551 Ga0207694_10009484 3300025924 Bacteria 7338
552 Ga0207694_10141519 3300025924 Bacteria 1935
553 Ga0207694_10283409 3300025924 Bacteria 1361
554 Ga0207694_10833486 3300025924 Bacteria 779
555 Ga0207694_11362370 3300025924 Bacteria 600
556 Ga0207650_10002879 3300025925 Bacteria 11883
557 Ga0207650_10006459 3300025925 Bacteria 7984
558 Ga0207687_10074432 3300025927 Bacteria 2434
559 Ga0207700_10141254 3300025928 Bacteria 1979
560 Ga0207664_10961499 3300025929 Bacteria 766
561 Ga0207690_10116716 3300025932 Bacteria 1931
562 Ga0207706_10000212 3300025933 Bacteria 63975
563 Ga0207706_10006469 3300025933 Bacteria 10879
564 Ga0207706_10021663 3300025933 Bacteria 5769
565 Ga0207706_10053060 3300025933 Bacteria 3579
566 Ga0207686_10002895 3300025934 Bacteria 9252
567 Ga0207686_10050269 3300025934 Bacteria 2592
568 Ga0207709_10000061 3300025935 Bacteria 199097
569 Ga0207709_10000063 3300025935 Bacteria 191397
570 Ga0207709_10001584 3300025935 Bacteria 15523
571 Ga0207709_10007877 3300025935 Bacteria 5904
572 Ga0207709_10009197 3300025935 Bacteria 5443
573 Ga0207709_10196712 3300025935 Bacteria 1437
574 Ga0207709_10397646 3300025935 Bacteria 1052
575 Ga0207709_10731814 3300025935 Bacteria 794
576 Ga0207669_10077464 3300025937 Bacteria 2115
577 Ga0207691_10350749 3300025940 Bacteria 1262
578 Ga0207711_10004604 3300025941 Bacteria 11726
579 Ga0207689_10158293 3300025942 Bacteria 1867
580 Ga0207661_10077134 3300025944 Bacteria 2739
581 Ga0207679_10000015 3300025945 Bacteria 265674
582 Ga0207667_10012143 3300025949 Bacteria 9948
583 Ga0207667_10044273 3300025949 Bacteria 4717
584 Ga0207667_10494966 3300025949 Bacteria 1240
585 Ga0207667_11138887 3300025949 Bacteria 762
586 Ga0207651_10249953 3300025960 Bacteria 1450
587 Ga0207640_10005762 3300025981 Bacteria 6754
588 Ga0207640_10332363 3300025981 Bacteria 1214
589 Ga0207658_10111520 3300025986 Bacteria 2163
590 Ga0207703_10444713 3300026035 Bacteria 1210
591 Ga0207639_10000157 3300026041 Bacteria 51718
592 Ga0207639_10199256 3300026041 Bacteria 1716
593 Ga0207639_10308538 3300026041 Bacteria 1401
594 Ga0207639_10314612 3300026041 Bacteria 1388
595 Ga0207639_10631735 3300026041 Bacteria 989
596 Ga0207678_10069855 3300026067 Bacteria 3011
597 Ga0207678_10524829 3300026067 Bacteria 1034
598 Ga0207702_10077491 3300026078 Bacteria 2875
599 Ga0207702_10799081 3300026078 Bacteria 932
600 Ga0207702_10923794 3300026078 Bacteria 865
601 Ga0207641_10019492 3300026088 Bacteria 5569
602 Ga0207648_10277149 3300026089 Bacteria 1499
603 Ga0207648_10364162 3300026089 Bacteria 1305
604 Ga0207674_10120183 3300026116 Bacteria 2595
605 Ga0207683_10078444 3300026121 Bacteria 2926
606 Ga0207683_10133624 3300026121 Bacteria 2232
607 Ga0207683_10626202 3300026121 Bacteria 996
608 Ga0207698_10065350 3300026142 Bacteria 2856
609 Ga0207698_11975219 3300026142 Bacteria 598
610 Ga0209281_1000016 3300027111 Bacteria 588107
611 Ga0209281_1000019 3300027111 Bacteria 576164
612 Ga0209389_1000036 3300027296 Bacteria 126146
613 Ga0209389_1053487 3300027296 Bacteria 2713
614 Ga0209371_1000066 3300027312 Bacteria 212660
615 Ga0209371_1000176 3300027312 Bacteria 95739
616 Ga0209371_1050371 3300027312 Bacteria 802
617 Ga0209981_1057055 3300027378 Bacteria 596
618 Ga0209982_1025188 3300027552 Bacteria 924
619 Ga0209282_1007822 3300027666 Bacteria 6715
620 Ga0209282_1041143 3300027666 Bacteria 2738
621 Ga0209282_1104538 3300027666 Bacteria 1451
622 Ga0207428_10043067 3300027907 Bacteria 3648
623 Ga0207428_10081024 3300027907 Bacteria 2535
624 Ga0207428_10112702 3300027907 Bacteria 2092
625 Ga0207428_10114852 3300027907 Bacteria 2069
626 Ga0207428_10119106 3300027907 Bacteria 2026
627 Ga0207428_10123955 3300027907 Bacteria 1980
628 Ga0207428_10291376 3300027907 Bacteria 1209
629 Ga0207428_10569920 3300027907 Bacteria 818
630 Ga0268266_10002571 3300028379 Bacteria 19245
631 Ga0268266_10020327 3300028379 Bacteria 5659
632 Ga0268266_10038288 3300028379 Bacteria 4082
633 Ga0268266_10123433 3300028379 Bacteria 2307
634 Ga0268266_10242278 3300028379 Bacteria 1665
635 Ga0268266_10490046 3300028379 Bacteria 1172
636 Ga0268265_10251286 3300028380 Bacteria 1566
637 Ga0268264_11175002 3300028381 Bacteria 776
638 Ga0265318_10009718 3300028577 Bacteria 4216
639 Ga0307515_10550453 3300028794 Bacteria 764
640 Ga0265338_10245937 3300028800 Bacteria 1322
641 Ga0268256_1000063 3300030500 Bacteria 212660
642 Ga0268256_1000146 3300030500 Bacteria 95753
643 Ga0268256_1056659 3300030500 Bacteria 802
644 Ga0316177_1070524 3300030731 Bacteria 1038
645 Ga0316177_1180876 3300030731 Bacteria 5496
646 Ga0316176_1043162 3300030732 Bacteria 3052
647 Ga0314311_1040284 3300030733 Bacteria 3274
648 Ga0314311_1105640 3300030733 Bacteria 2956
649 Ga0316179_1011771 3300030734 Bacteria 1469
650 Ga0316179_1026376 3300030734 Bacteria 3015
651 Ga0316178_1047147 3300030735 Bacteria 102800
652 Ga0316178_1120720 3300030735 Bacteria 1148
653 Ga0316180_1058975 3300030736 Bacteria 3706
654 Ga0316183_1077170 3300030742 Bacteria 6687
655 Ga0316183_1205730 3300030742 Bacteria 3038
656 Ga0316181_1009360 3300030744 Bacteria 2030
657 Ga0316181_1063849 3300030744 Bacteria 1287
658 Ga0316181_1124265 3300030744 Bacteria 765
659 Ga0316181_1144972 3300030744 Bacteria 7327
660 Ga0316182_1043997 3300030745 Bacteria 1271
661 Ga0316182_1106649 3300030745 Bacteria 522
662 Ga0316182_1234756 3300030745 Bacteria 5444
663 Ga0316182_1390187 3300030745 Bacteria 563
664 Ga0265330_10133814 3300031235 Bacteria 1055
665 Ga0265332_10023082 3300031238 Bacteria 2744
666 Ga0265320_10072850 3300031240 Bacteria 1615
667 Ga0265325_10002800 3300031241 Bacteria 11641
668 Ga0265325_10186974 3300031241 Bacteria 962
669 Ga0265325_10354307 3300031241 Bacteria 648
670 Ga0265329_10204041 3300031242 Bacteria 651
671 Ga0265340_10012156 3300031247 Bacteria 4550
672 Ga0265340_10192936 3300031247 Bacteria 918
673 Ga0265339_10056109 3300031249 Bacteria 2134
674 Ga0265339_10176300 3300031249 Bacteria 1067
675 Ga0265331_10008993 3300031250 Bacteria 5644
676 Ga0265331_10042787 3300031250 Bacteria 2196
677 Ga0265327_10033411 3300031251 Bacteria 2866
678 Ga0265316_10204375 3300031344 Bacteria 1463
679 Ga0307509_10221193 3300031507 Bacteria 1706
680 Ga0307509_10671613 3300031507 Bacteria 704
681 Ga0307408_100000019 3300031548 Bacteria 344502
682 Ga0307408_100007215 3300031548 Bacteria 7350
683 Ga0307408_100015060 3300031548 Bacteria 5146
684 Ga0307408_100020747 3300031548 Bacteria 4438
685 Ga0307408_100043218 3300031548 Bacteria 3206
686 Ga0307408_100103834 3300031548 Bacteria 2170
687 Ga0307408_100302681 3300031548 Bacteria 1340
688 Ga0307408_100448109 3300031548 Bacteria 1119
689 Ga0307408_100782252 3300031548 Bacteria 864
690 Ga0265313_10002996 3300031595 Bacteria 14059
691 Ga0265313_10018280 3300031595 Bacteria 3942
692 Ga0307514_10048005 3300031649 Bacteria 3329
693 Ga0316575_10007778 3300031665 Bacteria 3887
694 Ga0265314_10011318 3300031711 Bacteria 7375
695 Ga0265314_10041344 3300031711 Bacteria 3301
696 Ga0265314_10212841 3300031711 Bacteria 1134
697 Ga0265342_10040406 3300031712 Bacteria 2829
698 Ga0316576_10092090 3300031727 Bacteria 2259
699 Ga0316576_10229401 3300031727 Bacteria 1396
700 Ga0307516_10003211 3300031730 Bacteria 21220
701 Ga0307516_10014174 3300031730 Bacteria 8447
702 Ga0307516_10029985 3300031730 Bacteria 5494
703 Ga0307405_10055662 3300031731 Bacteria 2477
704 Ga0307405_10103490 3300031731 Bacteria 1914
705 Ga0307405_10183573 3300031731 Bacteria 1504
706 Ga0307405_10215311 3300031731 Bacteria 1405
707 Ga0307405_10286704 3300031731 Bacteria 1242
708 Ga0307405_10305287 3300031731 Bacteria 1209
709 Ga0307405_10399412 3300031731 Bacteria 1075
710 Ga0307413_10018385 3300031824 Bacteria 3666
711 Ga0307413_10087511 3300031824 Bacteria 2018
712 Ga0307413_10481950 3300031824 Bacteria 992
713 Ga0307413_10744791 3300031824 Bacteria 818
714 Ga0307410_10159004 3300031852 Bacteria 1691
715 Ga0307406_10011531 3300031901 Bacteria 5022
716 Ga0307406_10028572 3300031901 Bacteria 3370
717 Ga0307407_10218346 3300031903 Bacteria 1288
718 Ga0307407_10242384 3300031903 Bacteria 1230
719 Ga0307412_10011436 3300031911 Bacteria 5143
720 Ga0307412_10015679 3300031911 Bacteria 4498
721 Ga0307412_10076892 3300031911 Bacteria 2294
722 Ga0307412_10101173 3300031911 Bacteria 2038
723 Ga0307412_10106150 3300031911 Bacteria 1996
724 Ga0307412_10138218 3300031911 Bacteria 1780
725 Ga0307412_10154122 3300031911 Bacteria 1699
726 Ga0307412_10208085 3300031911 Bacteria 1491
727 Ga0307412_10298891 3300031911 Bacteria 1271
728 Ga0307412_10413954 3300031911 Bacteria 1101
729 Ga0307412_10748402 3300031911 Bacteria 843
730 Ga0307416_100012594 3300032002 Bacteria 5708
731 Ga0307416_100076068 3300032002 Bacteria 2812
732 Ga0307416_100241853 3300032002 Bacteria 1750
733 Ga0307416_100525906 3300032002 Bacteria 1252
734 Ga0307416_102159512 3300032002 Bacteria 658
735 Ga0307414_10037403 3300032004 Bacteria 3249
736 Ga0307414_10811857 3300032004 Bacteria 853
737 Ga0307411_10055706 3300032005 Bacteria 2602
738 Ga0307411_10156555 3300032005 Bacteria 1700
739 Ga0307411_10373702 3300032005 Bacteria 1170
740 Ga0307411_10614129 3300032005 Bacteria 936
741 Ga0307411_11150651 3300032005 Bacteria 701
742 Ga0316574_0016948 3300035398 Bacteria 4254
743 Ga0316574_0240813 3300035398 Bacteria 1156
744 Ga0373931_0147009 3300035691 Bacteria 1371
745 Ga0395898_0366228 3300037466 Bacteria 1374
746 Ga0395901_0433110 3300038443 Bacteria 1347
747 Ga0400483_049425 3300039062 Bacteria 2712
748 Ga0400483_289198 3300039062 Bacteria 1660
749 Ga0436365_0255272 3300039437 Bacteria 725
750 Ga0436365_0472641 3300039437 Bacteria 2166
751 Ga0436360_0707346 3300039438 Bacteria 1146
752 Ga0436363_0026702 3300039450 Bacteria 5368
753 Ga0436362_1045686 3300039453 Bacteria 1148
754 Ga0439436_0000393 3300041404 Bacteria 10904
755 Ga0439436_0001705 3300041404 Bacteria 6427
756 Ga0439438_009014 3300041405 Bacteria 3256
757 Ga0439438_010619 3300041405 Bacteria 2901
758 Ga0439438_014427 3300041405 Bacteria 2352
759 Ga0439438_022379 3300041405 Bacteria 1753
760 Ga0439438_029248 3300041405 Bacteria 1475
761 Ga0439438_032917 3300041405 Bacteria 1371
762 Ga0439438_052485 3300041405 Bacteria 1033
763 Ga0439447_003796 3300041407 Bacteria 5304
764 Ga0439447_003942 3300041407 Bacteria 5200
765 Ga0439447_005384 3300041407 Bacteria 4264
766 Ga0439447_007884 3300041407 Bacteria 3336
767 Ga0439447_008473 3300041407 Bacteria 3178
768 Ga0439447_010053 3300041407 Bacteria 2828
769 Ga0439447_017695 3300041407 Bacteria 1937
770 Ga0439447_029161 3300041407 Bacteria 1398
771 Ga0439461_0023165 3300041410 Bacteria 1248
772 Ga0439466_0003240 3300041411 Bacteria 6343
773 Ga0439466_0004304 3300041411 Bacteria 5496
774 Ga0439466_0012701 3300041411 Bacteria 3096
775 Ga0439466_0012798 3300041411 Bacteria 3079
776 Ga0439466_0013020 3300041411 Bacteria 3051
777 Ga0439466_0032523 3300041411 Bacteria 1777
778 Ga0439466_0033462 3300041411 Bacteria 1746
779 Ga0439466_0057805 3300041411 Bacteria 1256
780 Ga0439465_0004543 3300041413 Bacteria 4484
781 Ga0439465_0006272 3300041413 Bacteria 3775
782 Ga0451789_0759931 3300041443 Bacteria 533
783 Ga0451802_2039099 3300041460 Bacteria 1405
784 Ga0451853_3468156 3300041512 Bacteria 799
785 Ga0451853_3963367 3300041512 Bacteria 999
786 Ga0439431_0004440 3300041997 Bacteria 3085
787 Ga0439431_0008002 3300041997 Bacteria 2368
788 Ga0439431_0036530 3300041997 Bacteria 1237
789 Ga0439433_0005132 3300041999 Bacteria 2813
790 Ga0439437_000037 3300042000 Bacteria 9377
791 Ga0439442_005424 3300042002 Bacteria 2550
792 Ga0439445_0009266 3300042004 Bacteria 2317
793 Ga0439445_0087885 3300042004 Bacteria 873
794 Ga0439445_0108898 3300042004 Bacteria 789
795 Ga0439445_0258874 3300042004 Bacteria 520
796 Ga0439432_000677 3300042006 Bacteria 12757
797 Ga0439432_001648 3300042006 Bacteria 8369
798 Ga0439432_004015 3300042006 Bacteria 5399
799 Ga0439432_010565 3300042006 Bacteria 3192
800 Ga0439432_016837 3300042006 Bacteria 2458
801 Ga0439432_027276 3300042006 Bacteria 1865
802 Ga0439432_080105 3300042006 Bacteria 989
803 Ga0439432_099946 3300042006 Bacteria 868
804 Ga0439449_0000720 3300042007 Bacteria 12664
805 Ga0439451_008918 3300042009 Bacteria 2032
806 Ga0439451_011530 3300042009 Bacteria 1783
807 Ga0439451_014175 3300042009 Bacteria 1608
808 Ga0439451_018064 3300042009 Bacteria 1422
809 Ga0439451_024145 3300042009 Bacteria 1224
810 Ga0439451_051377 3300042009 Bacteria 825
811 Ga0439452_000645 3300042010 Bacteria 17507
812 Ga0439452_003726 3300042010 Bacteria 5260
813 Ga0439452_004217 3300042010 Bacteria 4871
814 Ga0439452_005024 3300042010 Bacteria 4323
815 Ga0439452_012662 3300042010 Bacteria 2390
816 Ga0439452_016934 3300042010 Bacteria 1970
817 Ga0439452_021055 3300042010 Bacteria 1703
818 Ga0439452_039019 3300042010 Bacteria 1125
819 Ga0439452_039530 3300042010 Bacteria 1116
820 Ga0439452_047649 3300042010 Bacteria 990
821 Ga0439456_000220 3300042013 Bacteria 15563
822 Ga0439456_026056 3300042013 Bacteria 1242
823 Ga0439456_029960 3300042013 Bacteria 1163
824 Ga0439456_041550 3300042013 Bacteria 996
825 Ga0439457_001445 3300042014 Bacteria 7140
826 Ga0439457_061008 3300042014 Bacteria 854
827 Ga0439462_0008900 3300042015 Bacteria 2538
828 Ga0439463_003695 3300042016 Bacteria 3857
829 Ga0439463_021653 3300042016 Bacteria 1605
830 Ga0439463_078827 3300042016 Bacteria 846
831 Ga0450911_000011 3300042115 Bacteria 130739
832 Ga0450911_005568 3300042115 Bacteria 1938
833 Ga0450919_002799 3300042121 Bacteria 2239
834 Ga0450919_019199 3300042121 Bacteria 772
835 Ga0450922_001722 3300042124 Bacteria 2123
836 Ga0450923_051094 3300042125 Bacteria 888
837 Ga0450890_009580 3300042127 Bacteria 1242
838 Ga0450892_019568 3300042130 Bacteria 657
839 Ga0450894_022440 3300042131 Bacteria 855
840 Ga0450895_018695 3300042132 Bacteria 634
841 Ga0450898_078339 3300042134 Bacteria 669
842 Ga0450900_002826 3300042136 Bacteria 1875
843 Ga0450900_024938 3300042136 Bacteria 850
844 Ga0450902_004902 3300042137 Bacteria 2005
845 Ga0450902_026388 3300042137 Bacteria 971
846 Ga0450904_000254 3300042139 Bacteria 11505
847 Ga0450904_004804 3300042139 Bacteria 1390
848 Ga0450904_011718 3300042139 Bacteria 868
849 Ga0450905_000418 3300042142 Bacteria 5188
850 Ga0450905_002843 3300042142 Bacteria 2245
851 Ga0450905_012866 3300042142 Bacteria 1182
852 Ga0450905_016150 3300042142 Bacteria 1075
853 Ga0450906_003305 3300042145 Bacteria 3481
854 Ga0450906_003770 3300042145 Bacteria 3225
855 Ga0450907_001318 3300042146 Bacteria 5516
856 Ga0450907_002543 3300042146 Bacteria 3445
857 Ga0450907_008997 3300042146 Bacteria 1656
858 Ga0450910_005072 3300042147 Bacteria 1790
859 Ga0450910_020673 3300042147 Bacteria 993
860 Ga0439446_0000772 3300042156 Bacteria 6754
861 Ga0439446_0014612 3300042156 Bacteria 2169
862 Ga0439446_0017035 3300042156 Bacteria 2028
863 Ga0439446_0025556 3300042156 Bacteria 1688
864 Ga0439446_0028447 3300042156 Bacteria 1609
865 Ga0439446_0034841 3300042156 Bacteria 1466
866 Ga0439446_0073482 3300042156 Bacteria 1049
867 Ga0450908_004670 3300042184 Bacteria 2639
868 Ga0450908_008357 3300042184 Bacteria 1941
869 Ga0450909_000439 3300042185 Bacteria 5374
870 Ga0450909_002156 3300042185 Bacteria 2780
871 Ga0450909_011026 3300042185 Bacteria 1323
872 Ga0439434_0000506 3300042435 Bacteria 11109
873 Ga0439434_0002566 3300042435 Bacteria 5287
874 Ga0439459_0002782 3300042438 Bacteria 2726
875 Ga0439464_0000312 3300042439 Bacteria 9273
876 Ga0439464_0003589 3300042439 Bacteria 3930
877 Ga0439464_0008110 3300042439 Bacteria 2754
878 Ga0439460_0001605 3300042461 Bacteria 5351
879 Ga0439460_0003802 3300042461 Bacteria 3653
880 Ga0450916_003515 3300042530 Bacteria 1722
881 Ga0450918_000856 3300042531 Bacteria 6418
882 Ga0450893_0031055 3300042532 Bacteria 953
883 Ga0450901_018910 3300042533 Bacteria 733
884 Ga0451577_0039597 3300042876 Bacteria 4235
885 Ga0439440_0015179 3300042993 Bacteria 1672
886 Ga0439440_0030834 3300042993 Bacteria 1264
887 Ga0466965_0023451 3300044683 Bacteria 2980
888 Ga0466957_0345110 3300044842 Bacteria 1009
889 Ga0466960_0443712 3300044901 Bacteria 753
890 Ga0495617_004617 3300046452 Bacteria 4987
891 Ga0495617_019844 3300046452 Bacteria 2272
892 Ga0495617_078835 3300046452 Bacteria 1079
893 Ga0495627_000095 3300046453 Bacteria 108094
894 Ga0495627_003716 3300046453 Bacteria 6601
895 Ga0495627_011272 3300046453 Bacteria 3212
896 Ga0495627_013285 3300046453 Bacteria 2899
897 Ga0495627_014354 3300046453 Bacteria 2765
898 Ga0495627_120091 3300046453 Bacteria 742
899 Ga0495603_0031080 3300046455 Bacteria 3214
900 Ga0495603_0037741 3300046455 Bacteria 2898
901 Ga0495603_0897726 3300046455 Bacteria 503
902 Ga0495590_0070662 3300046457 Bacteria 1224
903 Ga0495591_000198 3300046458 Bacteria 61546
904 Ga0495591_003674 3300046458 Bacteria 7802
905 Ga0495591_003881 3300046458 Bacteria 7537
906 Ga0495591_004039 3300046458 Bacteria 7332
907 Ga0495591_007055 3300046458 Bacteria 4841
908 Ga0495591_039195 3300046458 Bacteria 1359
909 Ga0495591_061314 3300046458 Bacteria 998
910 Ga0495629_0016371 3300046459 Bacteria 5322
911 Ga0495638_0014264 3300046460 Bacteria 5378
912 Ga0495638_0034509 3300046460 Bacteria 3229
913 Ga0495638_0053799 3300046460 Bacteria 2504
914 Ga0495638_0164658 3300046460 Bacteria 1276
915 Ga0495638_0165468 3300046460 Bacteria 1272
916 Ga0495638_0197824 3300046460 Bacteria 1136
917 Ga0495638_0287268 3300046460 Bacteria 891
918 Ga0495653_0024315 3300046463 Bacteria 4883
919 Ga0495653_0385859 3300046463 Bacteria 893
920 Ga0495650_0000938 3300046471 Bacteria 33877
921 Ga0495650_0005982 3300046471 Bacteria 7707
922 Ga0495650_0008522 3300046471 Bacteria 5966
923 Ga0495650_0009607 3300046471 Bacteria 5484
924 Ga0495650_0079874 3300046471 Bacteria 1263
925 Ga0495582_0025469 3300046473 Bacteria 3240
926 Ga0495605_0000019 3300046474 Bacteria 270010
927 Ga0495605_0000570 3300046474 Bacteria 29915
928 Ga0495605_0003684 3300046474 Bacteria 9102
929 Ga0495605_0007838 3300046474 Bacteria 6049
930 Ga0495605_0068028 3300046474 Bacteria 1688
931 Ga0495605_0095670 3300046474 Bacteria 1370
932 Ga0495605_0124855 3300046474 Bacteria 1164
933 Ga0495605_0232126 3300046474 Bacteria 794
934 Ga0495639_0003531 3300046475 Bacteria 6752
935 Ga0495639_0107934 3300046475 Bacteria 1318
936 Ga0495584_0015687 3300046491 Bacteria 3863
937 Ga0495584_0027889 3300046491 Bacteria 2860
938 Ga0495584_0124579 3300046491 Bacteria 1305
939 Ga0495584_0241461 3300046491 Bacteria 918
940 Ga0495584_0264405 3300046491 Bacteria 874
941 Ga0495585_0006926 3300046492 Bacteria 6986
942 Ga0495585_0018550 3300046492 Bacteria 4012
943 Ga0495585_0048303 3300046492 Bacteria 2366
944 Ga0495594_0003155 3300046499 Bacteria 8524
945 Ga0495594_0164034 3300046499 Bacteria 1263
946 Ga0495596_0000889 3300046500 Bacteria 18026
947 Ga0495607_0003674 3300046501 Bacteria 11642
948 Ga0495607_0004336 3300046501 Bacteria 10464
949 Ga0495607_0004339 3300046501 Bacteria 10463
950 Ga0495607_0005115 3300046501 Bacteria 9484
951 Ga0495607_0008664 3300046501 Bacteria 6934
952 Ga0495607_0016353 3300046501 Bacteria 4787
953 Ga0495607_0064442 3300046501 Bacteria 2069
954 Ga0495607_0071439 3300046501 Bacteria 1935
955 Ga0495607_0081022 3300046501 Bacteria 1783
956 Ga0495607_0092082 3300046501 Bacteria 1640
957 Ga0495607_0102972 3300046501 Bacteria 1525
958 Ga0495607_0140959 3300046501 Bacteria 1243
959 Ga0495607_0305913 3300046501 Bacteria 746
960 Ga0495583_0000146 3300046506 Bacteria 119793
961 Ga0495583_0004677 3300046506 Bacteria 9649
962 Ga0495583_0004736 3300046506 Bacteria 9566
963 Ga0495583_0006804 3300046506 Bacteria 7383
964 Ga0495583_0084237 3300046506 Bacteria 1377
965 Ga0495583_0237850 3300046506 Bacteria 732
966 Ga0495583_0300230 3300046506 Bacteria 638
967 Ga0495606_0000204 3300046507 Bacteria 103880
968 Ga0495606_0005284 3300046507 Bacteria 12446
969 Ga0495606_0155809 3300046507 Bacteria 1336
970 Ga0495606_0557283 3300046507 Bacteria 569
971 Ga0495606_0630603 3300046507 Bacteria 521
972 Ga0495610_0006827 3300046512 Bacteria 7737
973 Ga0495610_0012418 3300046512 Bacteria 5130
974 Ga0495610_0027938 3300046512 Bacteria 2990
975 Ga0495610_0042218 3300046512 Bacteria 2283
976 Ga0495610_0107327 3300046512 Bacteria 1241
977 Ga0495610_0123868 3300046512 Bacteria 1129
978 Ga0495616_0013956 3300046513 Bacteria 4513
979 Ga0495616_0032800 3300046513 Bacteria 2710
980 Ga0495616_0037580 3300046513 Bacteria 2490
981 Ga0495616_0111920 3300046513 Bacteria 1267
982 Ga0495616_0143857 3300046513 Bacteria 1083
983 Ga0495616_0330987 3300046513 Bacteria 637
984 Ga0495620_0000032 3300046515 Bacteria 119164
985 Ga0495620_0000108 3300046515 Bacteria 66218
986 Ga0495620_0002361 3300046515 Bacteria 10939
987 Ga0495620_0077923 3300046515 Bacteria 1344
988 Ga0495620_0144397 3300046515 Bacteria 929
989 Ga0495620_0160595 3300046515 Bacteria 873
990 Ga0495630_0098873 3300046517 Bacteria 2207
991 Ga0495630_0355872 3300046517 Bacteria 1120
992 Ga0495631_0002010 3300046518 Bacteria 11851
993 Ga0495631_0009636 3300046518 Bacteria 4816
994 Ga0495631_0016529 3300046518 Bacteria 3515
995 Ga0495631_0050623 3300046518 Bacteria 1816
996 Ga0495631_0313435 3300046518 Bacteria 667
997 Ga0495632_0001812 3300046519 Bacteria 17207
998 Ga0495632_0004345 3300046519 Bacteria 9654
999 Ga0495632_0095293 3300046519 Bacteria 1406
1000 Ga0495632_0111449 3300046519 Bacteria 1284
1001 Ga0495632_0122792 3300046519 Bacteria 1212
1002 Ga0495632_0257871 3300046519 Bacteria 780
1003 Ga0495637_0003861 3300046520 Bacteria 7862
1004 Ga0495637_0004201 3300046520 Bacteria 7479
1005 Ga0495637_0004356 3300046520 Bacteria 7347
1006 Ga0495637_0005898 3300046520 Bacteria 6191
1007 Ga0495637_0010699 3300046520 Bacteria 4427
1008 Ga0495637_0012776 3300046520 Bacteria 4007
1009 Ga0495637_0026764 3300046520 Bacteria 2585
1010 Ga0495637_0030808 3300046520 Bacteria 2376
1011 Ga0495637_0072585 3300046520 Bacteria 1385
1012 Ga0495637_0074567 3300046520 Bacteria 1362
1013 Ga0495637_0076287 3300046520 Bacteria 1343
1014 Ga0495637_0079406 3300046520 Bacteria 1310
1015 Ga0495637_0170974 3300046520 Bacteria 810
1016 Ga0495637_0278279 3300046520 Bacteria 597
1017 Ga0495643_0000084 3300046522 Bacteria 158427
1018 Ga0495643_0001486 3300046522 Bacteria 21343
1019 Ga0495643_0002761 3300046522 Bacteria 13432
1020 Ga0495643_0014980 3300046522 Bacteria 4595
1021 Ga0495643_0016737 3300046522 Bacteria 4303
1022 Ga0495643_0020764 3300046522 Bacteria 3779
1023 Ga0495643_0100420 3300046522 Bacteria 1483
1024 Ga0495643_0153683 3300046522 Bacteria 1137
1025 Ga0495644_0269979 3300046523 Bacteria 662
1026 Ga0495648_0001464 3300046524 Bacteria 23091
1027 Ga0495648_0014109 3300046524 Bacteria 5869
1028 Ga0495648_0020872 3300046524 Bacteria 4555
1029 Ga0495648_0023122 3300046524 Bacteria 4263
1030 Ga0495648_0053541 3300046524 Bacteria 2444
1031 Ga0495648_0136151 3300046524 Bacteria 1298
1032 Ga0495648_0151296 3300046524 Bacteria 1210
1033 Ga0495663_0289514 3300046525 Bacteria 588
1034 Ga0495666_0008469 3300046526 Bacteria 5158
1035 Ga0495666_0277867 3300046526 Bacteria 759
1036 Ga0495642_0020860 3300046528 Bacteria 2576
1037 Ga0495642_0036150 3300046528 Bacteria 1996
1038 Ga0495642_0085577 3300046528 Bacteria 1331
1039 Ga0495654_0006676 3300046530 Bacteria 6531
1040 Ga0495654_0006980 3300046530 Bacteria 6362
1041 Ga0495654_0011839 3300046530 Bacteria 4707
1042 Ga0495654_0020203 3300046530 Bacteria 3473
1043 Ga0495654_0040352 3300046530 Bacteria 2326
1044 Ga0495654_0076875 3300046530 Bacteria 1572
1045 Ga0495654_0111249 3300046530 Bacteria 1249
1046 Ga0495654_0271266 3300046530 Bacteria 700
1047 Ga0495654_0306917 3300046530 Bacteria 646
1048 Ga0495586_0007706 3300046535 Bacteria 5739
1049 Ga0495587_0019133 3300046536 Bacteria 4241
1050 Ga0495587_0156788 3300046536 Bacteria 1296
1051 Ga0495609_0000098 3300046538 Bacteria 103106
1052 Ga0495609_0000101 3300046538 Bacteria 100818
1053 Ga0495609_0003114 3300046538 Bacteria 9706
1054 Ga0495609_0071160 3300046538 Bacteria 1528
1055 Ga0495609_0106506 3300046538 Bacteria 1212
1056 Ga0495609_0217313 3300046538 Bacteria 794
1057 Ga0495609_0234257 3300046538 Bacteria 759
1058 Ga0495621_0016061 3300046539 Bacteria 2396
1059 Ga0495621_0054585 3300046539 Bacteria 1436
1060 Ga0495597_0000033 3300046542 Bacteria 126661
1061 Ga0495597_0007497 3300046542 Bacteria 5533
1062 Ga0495597_0007724 3300046542 Bacteria 5437
1063 Ga0495597_0010129 3300046542 Bacteria 4618
1064 Ga0495597_0027103 3300046542 Bacteria 2628
1065 Ga0495597_0032004 3300046542 Bacteria 2389
1066 Ga0495597_0112951 3300046542 Bacteria 1137
1067 Ga0495597_0168212 3300046542 Bacteria 891
1068 Ga0495645_0059966 3300046543 Bacteria 2758
1069 Ga0495622_0002902 3300046557 Bacteria 8180
1070 Ga0495622_0006825 3300046557 Bacteria 5298
1071 Ga0495622_0191153 3300046557 Bacteria 915
1072 Ga0495633_0000129 3300046558 Bacteria 100833
1073 Ga0495633_0319920 3300046558 Bacteria 704
1074 Ga0495656_0000202 3300046615 Bacteria 21338
1075 Ga0495656_0012623 3300046615 Bacteria 3122
1076 Ga0495656_0250217 3300046615 Bacteria 895
1077 Ga0495668_0010805 3300046616 Bacteria 5507
1078 Ga0495668_0049935 3300046616 Bacteria 2320
1079 Ga0495668_0070832 3300046616 Bacteria 1916
1080 Ga0495668_0099059 3300046616 Bacteria 1595
1081 Ga0495668_0196039 3300046616 Bacteria 1106
1082 Ga0495634_0074625 3300046642 Bacteria 2228
1083 Ga0495611_0000619 3300046648 Bacteria 20516
1084 Ga0495611_0021168 3300046648 Bacteria 2806
1085 Ga0495611_0055983 3300046648 Bacteria 1785
1086 Ga0495625_0000113 3300046660 Bacteria 124185
1087 Ga0495625_0013990 3300046660 Bacteria 6426
1088 Ga0495625_0043722 3300046660 Bacteria 3247
1089 Ga0495625_0045004 3300046660 Bacteria 3192
1090 Ga0495625_0176303 3300046660 Bacteria 1424
1091 Ga0495625_0188310 3300046660 Bacteria 1368
1092 Ga0495625_0423463 3300046660 Bacteria 827
1093 Ga0495625_0523918 3300046660 Bacteria 721
1094 Ga0495635_0032290 3300046663 Bacteria 3632
1095 Ga0495635_0158202 3300046663 Bacteria 1542
1096 Ga0495635_0212289 3300046663 Bacteria 1310
1097 Ga0495659_0007458 3300046664 Bacteria 3471
1098 Ga0495661_0000050 3300046665 Bacteria 143435
1099 Ga0495661_0000196 3300046665 Bacteria 69840
1100 Ga0495661_0000237 3300046665 Bacteria 63564
1101 Ga0495661_0000791 3300046665 Bacteria 30044
1102 Ga0495661_0039015 3300046665 Bacteria 2953
1103 Ga0495661_0102259 3300046665 Bacteria 1611
1104 Ga0495661_0143880 3300046665 Bacteria 1294
1105 Ga0495588_0006320 3300046674 Bacteria 5333
1106 Ga0495588_0029331 3300046674 Bacteria 2759
1107 Ga0495588_0220866 3300046674 Bacteria 1000
1108 Ga0495646_0134234 3300046680 Bacteria 1390
1109 Ga0495646_0211047 3300046680 Bacteria 1053
1110 Ga0495658_0325399 3300046683 Bacteria 975
1111 Ga0495669_0006747 3300046684 Bacteria 4803
1112 Ga0495613_0019320 3300046689 Bacteria 5080
1113 Ga0495670_0004611 3300046691 Bacteria 6758
1114 Ga0495670_0029549 3300046691 Bacteria 2720
1115 Ga0495670_0033258 3300046691 Bacteria 2565
1116 Ga0495670_0074612 3300046691 Bacteria 1721
1117 Ga0495670_0091940 3300046691 Bacteria 1553
1118 Ga0495670_0146646 3300046691 Bacteria 1236
1119 Ga0495670_0149990 3300046691 Bacteria 1222
1120 Ga0495671_0002273 3300046692 Bacteria 12221
1121 Ga0495671_0003386 3300046692 Bacteria 9816
1122 Ga0495671_0009251 3300046692 Bacteria 5507
1123 Ga0495671_0011351 3300046692 Bacteria 4906
1124 Ga0495671_0014255 3300046692 Bacteria 4283
1125 Ga0495671_0063231 3300046692 Bacteria 1823
1126 Ga0495671_0123705 3300046692 Bacteria 1261
1127 Ga0495671_0252737 3300046692 Bacteria 850
1128 Ga0495671_0348240 3300046692 Bacteria 710
1129 Ga0495649_0000559 3300046694 Bacteria 31486
1130 Ga0495649_0004109 3300046694 Bacteria 9562
1131 Ga0495649_0005576 3300046694 Bacteria 7967
1132 Ga0495649_0011664 3300046694 Bacteria 5146
1133 Ga0495649_0026139 3300046694 Bacteria 3249
1134 Ga0495649_0067043 3300046694 Bacteria 1925
1135 Ga0495649_0100412 3300046694 Bacteria 1538
1136 Ga0495649_0152725 3300046694 Bacteria 1212
1137 Ga0495649_0209165 3300046694 Bacteria 1011
1138 Ga0495589_0004366 3300046794 Bacteria 7540
1139 Ga0495589_0019045 3300046794 Bacteria 3520
1140 Ga0495589_0022667 3300046794 Bacteria 3203
1141 Ga0495589_0111778 3300046794 Bacteria 1318
1142 Ga0495600_0029762 3300046809 Bacteria 3536
1143 Ga0495660_0002195 3300046810 Bacteria 12561
1144 Ga0495660_0004003 3300046810 Bacteria 8991
1145 Ga0495660_0009901 3300046810 Bacteria 5546
1146 Ga0495660_0011258 3300046810 Bacteria 5193
1147 Ga0495660_0015775 3300046810 Bacteria 4362
1148 Ga0495660_0036962 3300046810 Bacteria 2722
1149 Ga0495660_0081717 3300046810 Bacteria 1693
1150 Ga0495660_0096203 3300046810 Bacteria 1530
1151 Ga0495660_0113277 3300046810 Bacteria 1381
1152 Ga0495660_0158337 3300046810 Bacteria 1112
1153 Ga0495660_0236010 3300046810 Bacteria 854
1154 Ga0495581_0747091 3300047315 Bacteria 563
1155 Ga0495604_0224792 3300047317 Bacteria 1290
1156 Ga0495604_0594284 3300047317 Bacteria 710
1157 Ga0495636_0469873 3300047318 Bacteria 605
1158 Ga0495674_0367443 3300047319 Bacteria 1166
1159 Ga0495674_0692370 3300047319 Bacteria 800
1160 Ga0495672_0008685 3300047320 Bacteria 7457
1161 Ga0495672_0017665 3300047320 Bacteria 4764
1162 Ga0495672_0032448 3300047320 Bacteria 3248
1163 Ga0495672_0036714 3300047320 Bacteria 3006
1164 Ga0495672_0036760 3300047320 Bacteria 3004
1165 Ga0495672_0061709 3300047320 Bacteria 2159
1166 Ga0495672_0069020 3300047320 Bacteria 2007
1167 Ga0495672_0077165 3300047320 Bacteria 1869
1168 Ga0495672_0104839 3300047320 Bacteria 1527
1169 Ga0495672_0108826 3300047320 Bacteria 1490
1170 Ga0495672_0122707 3300047320 Bacteria 1378
1171 Ga0495672_0126392 3300047320 Bacteria 1351
1172 Ga0495676_0000032 3300047321 Bacteria 131215
1173 Ga0495676_0040988 3300047321 Bacteria 3816
1174 Ga0495676_0041046 3300047321 Bacteria 3812
1175 Ga0495680_0008846 3300047322 Bacteria 9108
1176 Ga0495680_0158307 3300047322 Bacteria 1646
1177 Ga0495680_0491239 3300047322 Bacteria 834
1178 Ga0495680_0723396 3300047322 Bacteria 656
1179 Ga0495683_0000055 3300047323 Bacteria 119199
1180 Ga0495683_0000075 3300047323 Bacteria 100715
1181 Ga0495683_0013729 3300047323 Bacteria 4231
1182 Ga0495683_0034418 3300047323 Bacteria 2576
1183 Ga0495683_0079854 3300047323 Bacteria 1597
1184 Ga0495683_0132110 3300047323 Bacteria 1176
1185 Ga0495683_0249969 3300047323 Bacteria 778
1186 Ga0495687_024590 3300047443 Bacteria 2860
1187 Ga0495687_060119 3300047443 Bacteria 1568
1188 Ga0495675_0060903 3300047444 Bacteria 2391
1189 Ga0495677_0096017 3300047445 Bacteria 1119
1190 Ga0495677_0101945 3300047445 Bacteria 1087
1191 Ga0495679_000495 3300047446 Bacteria 27885
1192 Ga0495679_027905 3300047446 Bacteria 1856
1193 Ga0495679_064991 3300047446 Bacteria 1062
1194 Ga0495679_105866 3300047446 Bacteria 777
1195 Ga0495673_0004043 3300047469 Bacteria 9346
1196 Ga0495673_0005552 3300047469 Bacteria 7601
1197 Ga0495673_0006295 3300047469 Bacteria 6992
1198 Ga0495673_0011348 3300047469 Bacteria 4796
1199 Ga0495673_0028651 3300047469 Bacteria 2635
1200 Ga0495673_0035666 3300047469 Bacteria 2288
1201 Ga0495673_0054911 3300047469 Bacteria 1730
1202 Ga0495673_0068619 3300047469 Bacteria 1497
1203 Ga0495673_0070498 3300047469 Bacteria 1471
1204 Ga0495673_0080658 3300047469 Bacteria 1348
1205 Ga0495673_0080788 3300047469 Bacteria 1347
1206 Ga0495673_0107488 3300047469 Bacteria 1119
1207 Ga0495673_0315656 3300047469 Bacteria 558
1208 Ga0495681_0003330 3300047470 Bacteria 11177
1209 Ga0495681_0009290 3300047470 Bacteria 6071
1210 Ga0495681_0010491 3300047470 Bacteria 5604
1211 Ga0495681_0026799 3300047470 Bacteria 2992
1212 Ga0495681_0046902 3300047470 Bacteria 2057
1213 Ga0495681_0094003 3300047470 Bacteria 1320
1214 Ga0495681_0208313 3300047470 Bacteria 789
1215 Ga0495686_0057742 3300047472 Bacteria 2421
1216 Ga0495686_0188888 3300047472 Bacteria 1189
1217 Ga0495593_0021928 3300047673 Bacteria 3563
1218 Ga0495593_0034350 3300047673 Bacteria 2758
1219 Ga0495593_0493703 3300047673 Bacteria 614
1220 Ga0495614_0018096 3300048089 Bacteria 3053
1221 Ga0495615_0223300 3300048090 Bacteria 589
1222 Ga0495626_0000024 3300048091 Bacteria 214179
1223 Ga0495626_0006021 3300048091 Bacteria 6972
1224 Ga0495626_0007440 3300048091 Bacteria 6097
1225 Ga0495626_0030264 3300048091 Bacteria 2611
1226 Ga0495626_0091432 3300048091 Bacteria 1337
1227 Ga0495626_0092114 3300048091 Bacteria 1331
1228 Ga0495626_0229073 3300048091 Bacteria 752
1229 Ga0496100_0007462 3300048903 Bacteria 6035
1230 Ga0496100_1266712 3300048903 Bacteria 582
1231 Ga0496101_0001014 3300048904 Bacteria 16554
1232 Ga0496102_0021686 3300048905 Bacteria 5682
1233 Ga0496102_0022497 3300048905 Bacteria 5586
1234 Ga0496102_1913148 3300048905 Bacteria 510
1235 Ga0496103_0156800 3300048906 Bacteria 1459
1236 Ga0496104_0007646 3300048907 Bacteria 9569
1237 Ga0496105_0025015 3300048908 Bacteria 4854
1238 Ga0496105_0541806 3300048908 Bacteria 909
1239 Ga0496106_0419181 3300048909 Bacteria 1076
1240 Ga0496107_0070855 3300048910 Bacteria 2532
1241 Ga0496108_0140948 3300048911 Bacteria 2077
1242 Ga0496108_0505068 3300048911 Bacteria 1056
1243 Ga0496109_0095304 3300048912 Bacteria 2755
1244 Ga0496110_0012658 3300048913 Bacteria 6941
1245 Ga0496110_0057839 3300048913 Bacteria 3414
1246 Ga0496110_0215624 3300048913 Bacteria 1745
1247 Ga0496110_0479361 3300048913 Bacteria 1133
1248 Ga0496110_0532282 3300048913 Bacteria 1068
1249 Ga0496111_0008593 3300048914 Bacteria 6769
1250 Ga0496111_0127973 3300048914 Bacteria 1878
1251 Ga0496111_0332160 3300048914 Bacteria 1126
1252 Ga0496111_0597354 3300048914 Bacteria 808
1253 Ga0496112_1876480 3300048915 Bacteria 511
1254 Ga0496113_0210462 3300048916 Bacteria 1548
1255 Ga0496113_0373904 3300048916 Bacteria 1144
1256 Ga0496114_0033938 3300048917 Bacteria 4207
1257 Ga0496114_0058158 3300048917 Bacteria 3228
1258 Ga0496114_0090573 3300048917 Bacteria 2596
1259 Ga0496116_0000008 3300048919 Bacteria 726753
1260 Ga0496116_0000553 3300048919 Bacteria 50128
1261 Ga0496116_0013021 3300048919 Bacteria 6746
1262 Ga0496116_0018645 3300048919 Bacteria 5338
1263 Ga0496116_0019155 3300048919 Bacteria 5248
1264 Ga0496116_0038119 3300048919 Bacteria 3342
1265 Ga0496116_0049986 3300048919 Bacteria 2790
1266 Ga0496116_0170552 3300048919 Bacteria 1179
1267 Ga0496116_0199457 3300048919 Bacteria 1049
1268 Ga0496117_0006615 3300048920 Bacteria 11648
1269 Ga0496117_0006932 3300048920 Bacteria 11230
1270 Ga0496117_0024953 3300048920 Bacteria 4709
1271 Ga0496117_0025916 3300048920 Bacteria 4597
1272 Ga0496117_0026843 3300048920 Bacteria 4498
1273 Ga0496117_0031455 3300048920 Bacteria 4050
1274 Ga0496117_0032865 3300048920 Bacteria 3933
1275 Ga0496117_0154774 3300048920 Bacteria 1351
1276 Ga0496117_0158249 3300048920 Bacteria 1330
1277 Ga0496117_0365643 3300048920 Bacteria 739
1278 Ga0496118_0007748 3300048921 Bacteria 11275
1279 Ga0496118_0015717 3300048921 Bacteria 6988
1280 Ga0496118_0020580 3300048921 Bacteria 5844
1281 Ga0496118_0088388 3300048921 Bacteria 2143
1282 Ga0496118_0099858 3300048921 Bacteria 1965
1283 Ga0496118_0116427 3300048921 Bacteria 1756
1284 Ga0496118_0125720 3300048921 Bacteria 1660
1285 Ga0496118_0263243 3300048921 Bacteria 971
1286 Ga0496119_0125748 3300048922 Bacteria 1403
1287 Ga0496121_0000012 3300048924 Bacteria 653131
1288 Ga0496121_0008919 3300048924 Bacteria 11641
1289 Ga0496121_0011761 3300048924 Bacteria 9653
1290 Ga0496121_0101509 3300048924 Bacteria 2218
1291 Ga0496121_0115362 3300048924 Bacteria 2039
1292 Ga0496121_0169638 3300048924 Bacteria 1587
1293 Ga0496121_0216973 3300048924 Bacteria 1350
1294 Ga0496121_0218219 3300048924 Bacteria 1345
1295 Ga0496121_0281425 3300048924 Bacteria 1137
1296 Ga0496121_0508017 3300048924 Bacteria 763
1297 Ga0496122_0007258 3300048925 Bacteria 12395
1298 Ga0496122_0018013 3300048925 Bacteria 6550
1299 Ga0496122_0021634 3300048925 Bacteria 5749
1300 Ga0496122_0034642 3300048925 Bacteria 4128
1301 Ga0496122_0061280 3300048925 Bacteria 2762
1302 Ga0496122_0078839 3300048925 Bacteria 2305
1303 Ga0496122_0140241 3300048925 Bacteria 1514
1304 Ga0496122_0190174 3300048925 Bacteria 1213
1305 Ga0496122_0371410 3300048925 Bacteria 738
1306 Ga0496123_0000178 3300048926 Bacteria 128587
1307 Ga0496123_0007242 3300048926 Bacteria 10533
1308 Ga0496123_0010680 3300048926 Bacteria 8080
1309 Ga0496123_0023248 3300048926 Bacteria 4748
1310 Ga0496123_0027433 3300048926 Bacteria 4241
1311 Ga0496123_0113888 3300048926 Bacteria 1539
1312 Ga0496123_0170119 3300048926 Bacteria 1150
1313 Ga0496123_0304831 3300048926 Bacteria 758
1314 Ga0496123_0307071 3300048926 Bacteria 754
1315 Ga0496124_0004321 3300048927 Bacteria 16654
1316 Ga0496124_0006372 3300048927 Bacteria 12872
1317 Ga0496124_0023502 3300048927 Bacteria 5625
1318 Ga0496124_0053909 3300048927 Bacteria 3406
1319 Ga0496124_0057238 3300048927 Bacteria 3286
1320 Ga0496124_0099855 3300048927 Bacteria 2353
1321 Ga0496124_0137724 3300048927 Bacteria 1930
1322 Ga0496124_0145590 3300048927 Bacteria 1864
1323 Ga0496124_0150009 3300048927 Bacteria 1830
1324 Ga0496124_0220964 3300048927 Bacteria 1425
1325 Ga0496124_0240376 3300048927 Bacteria 1347
1326 Ga0496124_0329605 3300048927 Bacteria 1089
1327 Ga0496125_0001493 3300048928 Bacteria 33555
1328 Ga0496125_0007042 3300048928 Bacteria 12020
1329 Ga0496125_0019719 3300048928 Bacteria 6347
1330 Ga0496125_0030847 3300048928 Bacteria 4787
1331 Ga0496125_0069620 3300048928 Bacteria 2760
1332 Ga0496125_0111577 3300048928 Bacteria 1978
1333 Ga0496125_0143002 3300048928 Bacteria 1659
1334 Ga0496125_0191586 3300048928 Bacteria 1349
1335 Ga0496125_0191943 3300048928 Bacteria 1348
1336 Ga0496126_0081568 3300048929 Bacteria 2859
1337 Ga0496126_0148335 3300048929 Bacteria 2012
1338 Ga0496126_0343497 3300048929 Bacteria 1222
1339 Ga0495678_000106 3300049459 Bacteria 100780
1340 Ga0495678_016396 3300049459 Bacteria 3388
1341 Ga0495678_033178 3300049459 Bacteria 2133
1342 Ga0495678_173455 3300049459 Bacteria 680
1343 Ga0495682_0000573 3300049460 Bacteria 24941
1344 Ga0495682_0088795 3300049460 Bacteria 1110
1345 Ga0501031_0118073 3300049568 Bacteria 1733
1346 Ga0501032_0086582 3300049569 Bacteria 2082
1347 Ga0501033_0007721 3300049570 Bacteria 8344
1348 Ga0501033_0145409 3300049570 Bacteria 1712
1349 Ga0501033_0304465 3300049570 Bacteria 1121
1350 Ga0501034_0000143 3300049571 Bacteria 133317
1351 Ga0501034_0030982 3300049571 Bacteria 5435
1352 Ga0501037_0032838 3300049573 Bacteria 3835
1353 Ga0501037_0339358 3300049573 Bacteria 1038
1354 Ga0501037_0440011 3300049573 Bacteria 890
1355 Ga0501038_0105642 3300049574 Bacteria 2339
1356 Ga0501038_0221714 3300049574 Bacteria 1508
1357 Ga0501039_0851823 3300049575 Bacteria 710
1358 Ga0501043_0554477 3300049579 Bacteria 853
1359 Ga0501043_0636961 3300049579 Bacteria 784
1360 Ga0501046_0122247 3300049580 Bacteria 1980
1361 Ga0501046_0139837 3300049580 Bacteria 1833
1362 Ga0501047_0016472 3300049581 Bacteria 7056
1363 Ga0501047_0021113 3300049581 Bacteria 6252
1364 Ga0501047_0149829 3300049581 Bacteria 2209
1365 Ga0501047_0231916 3300049581 Bacteria 1699
1366 Ga0501048_0182176 3300049582 Bacteria 1489
1367 Ga0501070_0452375 3300049586 Bacteria 1035
1368 Ga0501238_044073 3300049671 Bacteria 661
1369 Ga0501249_036362 3300049679 Bacteria 1109
1370 Ga0501249_169889 3300049679 Bacteria 558
1371 Ga0501252_030271 3300049682 Bacteria 747
1372 Ga0501225_0111583 3300049705 Bacteria 806
1373 Ga0501080_0152059 3300049742 Bacteria 2139
1374 Ga0501241_023838 3300049758 Bacteria 1134
1375 Ga0501241_155203 3300049758 Bacteria 530
1376 Ga0501035_0008231 3300049822 Bacteria 9715
1377 Ga0501035_0020102 3300049822 Bacteria 6133
1378 Ga0501035_0028649 3300049822 Bacteria 5083
1379 Ga0501035_0077655 3300049822 Bacteria 2934
1380 Ga0501035_0107461 3300049822 Bacteria 2446
1381 Ga0501044_0001123 3300049823 Bacteria 31793
1382 Ga0501044_0015234 3300049823 Bacteria 8282
1383 Ga0501044_0030699 3300049823 Bacteria 5662
1384 Ga0501044_0263494 3300049823 Bacteria 1661
1385 Ga0501226_000049 3300049853 Bacteria 53390
1386 nmdc:mga03683_12567_c1 3300050489 Bacteria 3097
1387 nmdc:mga03683_25008_c1 3300050489 Bacteria 1336
1388 nmdc:mga03n38_113886_c1 3300050490 Bacteria 1321
1389 nmdc:mga03n38_148938_c1 3300050490 Bacteria 1176
1390 nmdc:mga03n38_30830_c1 3300050490 Bacteria 2258
1391 nmdc:mga00v17_1492_c1 3300050491 Bacteria 12236
1392 nmdc:mga00v17_436110_c1 3300050491 Bacteria 851
1393 nmdc:mga00v17_571_c1 3300050491 Bacteria 20580
1394 nmdc:mga00v17_94841_c1 3300050491 Bacteria 1878
1395 nmdc:mga0yw44_217_c1 3300050492 Bacteria 20338
1396 nmdc:mga0yw44_34070_c1 3300050492 Bacteria 2981
1397 nmdc:mga0yw44_37482_c1 3300050492 Bacteria 2863
1398 nmdc:mga0yw44_935410_c1 3300050492 Bacteria 587
1399 nmdc:mga0k408_108860_c1 3300050493 Bacteria 1637
1400 nmdc:mga0k408_11346_c1 3300050493 Bacteria 2757
1401 nmdc:mga0k408_17545_c1 3300050493 Bacteria 3990
1402 nmdc:mga06z11_174630_c1 3300050494 Bacteria 1236
1403 nmdc:mga06z11_1852_c1 3300050494 Bacteria 7981
1404 nmdc:mga06z11_46024_c1 3300050494 Bacteria 2208
1405 nmdc:mga06z11_49970_c1 3300050494 Bacteria 2135
1406 nmdc:mga07m45_1061_c1 3300050496 Bacteria 12249
1407 nmdc:mga07m45_16790_c1 3300050496 Bacteria 3922
1408 nmdc:mga07m45_1912_c1 3300050496 Bacteria 9618
1409 nmdc:mga07m45_75127_c1 3300050496 Bacteria 1925
1410 nmdc:mga07m45_7984_c1 3300050496 Bacteria 5423
1411 nmdc:mga07m45_8240_c1 3300050496 Bacteria 5347
1412 nmdc:mga07m45_898_c1 3300050496 Bacteria 12980
1413 nmdc:mga05p37_1439989_c1 3300050507 Bacteria 691
1414 nmdc:mga09592_3652_c1 3300050508 Bacteria 12406
1415 nmdc:mga0n895_1547153_c1 3300050512 Unclassified 629
1416 nmdc:mga0sz30_137975_c1 3300050516 Bacteria 1076
1417 nmdc:mga0sz30_320_c2 3300050516 Bacteria 9066
1418 Ga0500610_0027879 3300053079 Bacteria 2840
1419 Ga0500610_0037753 3300053079 Bacteria 2487
1420 Ga0500610_0042155 3300053079 Bacteria 2361
1421 Ga0500643_003702 3300053087 Bacteria 7204
1422 Ga0500647_0255319 3300053091 Bacteria 768
1423 Ga0500651_0000029 3300053093 Bacteria 113528
1424 Ga0500566_0096020 3300053094 Bacteria 1632
1425 Ga0500641_0249275 3300053096 Bacteria 745
1426 Ga0500562_077614 3300053108 Bacteria 898
1427 Ga0500569_057735 3300053109 Bacteria 1190
1428 Ga0500571_001234 3300053110 Bacteria 11738
1429 Ga0500572_030735 3300053111 Bacteria 1495
1430 Ga0500592_007013 3300053116 Bacteria 1792
1431 Ga0500593_001548 3300053117 Bacteria 8259
1432 Ga0500595_002496 3300053119 Bacteria 9097
1433 Ga0500595_042249 3300053119 Bacteria 1460
1434 Ga0500608_019691 3300053122 Bacteria 3098
1435 Ga0500626_051154 3300053128 Bacteria 1858
1436 Ga0500655_000253 3300053133 Bacteria 12573
1437 Ga0500658_0001930 3300053134 Bacteria 8115
1438 Ga0500658_0002544 3300053134 Bacteria 7063
1439 Ga0500659_0005549 3300053135 Bacteria 7057
1440 Ga0500564_005374 3300053138 Bacteria 5236
1441 Ga0500568_0006729 3300053139 Bacteria 5744
1442 Ga0500574_004090 3300053141 Bacteria 2676
1443 Ga0500577_0009905 3300053142 Bacteria 2784
1444 Ga0500616_0042382 3300053153 Bacteria 2437
1445 Ga0500627_0001507 3300053158 Bacteria 6546
1446 Ga0500634_0010416 3300053161 Bacteria 4751
1447 Ga0500638_166502 3300053162 Bacteria 964
1448 Ga0500645_014949 3300053730 Bacteria 2467
1449 Ga0500565_000623 3300053734 Bacteria 2022
1450 Ga0500596_019858 3300053735 Bacteria 1010

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035398 Ga0316574_0240813 Ga0316574_0240813_34_402 122
2 3300049460 Ga0495682_0088795 Ga0495682_0088795_709_1077 122
3 3300049569 Ga0501032_0086582 Ga0501032_0086582_22_495 131
4 3300049570 Ga0501033_0007721 Ga0501033_0007721_1453_1926 131
5 3300049573 Ga0501037_0032838 Ga0501037_0032838_2127_2600 131
6 3300049574 Ga0501038_0221714 Ga0501038_0221714_753_1226 131
7 3300049581 Ga0501047_0016472 Ga0501047_0016472_5508_5981 131
8 3300049822 Ga0501035_0008231 Ga0501035_0008231_4018_4491 131
9 3300049823 Ga0501044_0001123 Ga0501044_0001123_29903_30376 131
10 3300046526 Ga0495666_0277867 Ga0495666_0277867_27_428 133
11 3300047319 Ga0495674_0692370 Ga0495674_0692370_369_770 133
12 3300049570 Ga0501033_0304465 Ga0501033_0304465_87_554 133
13 3300049582 Ga0501048_0182176 Ga0501048_0182176_1001_1468 133
14 3300049822 Ga0501035_0107461 Ga0501035_0107461_425_892 133
15 3300049823 Ga0501044_0015234 Ga0501044_0015234_470_937 133
16 iso_pu_bacteria 2643221683 2644469196 133
17 iso_pu_bacteria 2842733646 2842735306 133
18 3300026078 Ga0207702_10799081 Ga0207702_107990811 136
19 3300003761 Ga0055535_1000849 Ga0055535_100084910 137
20 3300003773 Ga0055537_1000490 Ga0055537_100049014 137
21 3300003781 Ga0055536_1004465 Ga0055536_10044653 137
22 3300003790 Ga0055528_1000242 Ga0055528_100024238 137
23 3300003792 Ga0055540_1002002 Ga0055540_10020029 137
24 3300003792 Ga0055540_1006621 Ga0055540_10066215 137
25 3300005288 Ga0065714_10243308 Ga0065714_102433081 137
26 3300005289 Ga0065704_10240311 Ga0065704_102403112 137
27 3300005366 Ga0070659_101583069 Ga0070659_1015830691 137
28 3300005367 Ga0070667_100039195 Ga0070667_1000391952 137
29 3300005459 Ga0068867_100157834 Ga0068867_1001578342 137
30 3300005543 Ga0070672_100469195 Ga0070672_1004691952 137
31 3300005577 Ga0068857_100247199 Ga0068857_1002471993 137
32 3300005577 Ga0068857_100851124 Ga0068857_1008511241 137
33 3300005841 Ga0068863_100671152 Ga0068863_1006711522 137
34 3300006038 Ga0075365_10029846 Ga0075365_100298463 137
35 3300006038 Ga0075365_10490777 Ga0075365_104907771 137
36 3300006048 Ga0075363_100011892 Ga0075363_1000118923 137
37 3300006048 Ga0075363_100023389 Ga0075363_1000233892 137
38 3300006048 Ga0075363_100045017 Ga0075363_1000450173 137
39 3300006051 Ga0075364_10138651 Ga0075364_101386512 137
40 3300006051 Ga0075364_10349567 Ga0075364_103495672 137
41 3300006058 Ga0075432_10028921 Ga0075432_100289213 137
42 3300006177 Ga0075362_10025103 Ga0075362_100251033 137
43 3300006177 Ga0075362_10027254 Ga0075362_100272543 137
44 3300006178 Ga0075367_10072090 Ga0075367_100720903 137
45 3300006178 Ga0075367_10119723 Ga0075367_101197232 137
46 3300006195 Ga0075366_10023437 Ga0075366_100234372 137
47 3300006237 Ga0097621_100472123 Ga0097621_1004721233 137
48 3300006353 Ga0075370_10018167 Ga0075370_100181674 137
49 3300006353 Ga0075370_10019251 Ga0075370_100192513 137
50 3300006353 Ga0075370_10021275 Ga0075370_100212755 137
51 3300006353 Ga0075370_10023017 Ga0075370_100230174 137
52 3300006353 Ga0075370_10075336 Ga0075370_100753363 137
53 3300006948 Ga0099826_10075199 Ga0099826_100751993 137
54 3300009148 Ga0105243_10010063 Ga0105243_100100634 137
55 3300013100 Ga0157373_10008319 Ga0157373_100083194 137
56 3300013104 Ga0157370_10563491 Ga0157370_105634912 137
57 3300014497 Ga0182008_10109911 Ga0182008_101099112 137
58 3300015261 Ga0182006_1017980 Ga0182006_10179802 137
59 3300015261 Ga0182006_1084670 Ga0182006_10846701 137
60 3300015262 Ga0182007_10050733 Ga0182007_100507332 137
61 3300017792 Ga0163161_10000166 Ga0163161_1000016656 137
62 3300017792 Ga0163161_10007380 Ga0163161_100073803 137
63 3300017792 Ga0163161_10021628 Ga0163161_100216284 137
64 3300017792 Ga0163161_10029422 Ga0163161_100294222 137
65 3300025228 Ga0209672_101630 Ga0209672_1016302 137
66 3300025242 Ga0209258_100089 Ga0209258_10008925 137
67 3300025254 Ga0209148_1000097 Ga0209148_100009725 137
68 3300025263 Ga0209565_1000083 Ga0209565_100008384 137
69 3300025273 Ga0209673_1000323 Ga0209673_100032381 137
70 3300025273 Ga0209673_1022389 Ga0209673_10223893 137
71 3300025291 Ga0209675_1000081 Ga0209675_100008184 137
72 3300025291 Ga0209675_1007159 Ga0209675_10071593 137
73 3300025292 Ga0209676_1005014 Ga0209676_10050148 137
74 3300025292 Ga0209676_1073271 Ga0209676_10732711 137
75 3300025294 Ga0209025_1015457 Ga0209025_10154575 137
76 3300025298 Ga0209050_1006114 Ga0209050_10061144 137
77 3300025303 Ga0209051_1000373 Ga0209051_100037329 137
78 3300025303 Ga0209051_1002063 Ga0209051_10020638 137
79 3300025304 Ga0209257_1000449 Ga0209257_100044965 137
80 3300025728 Ga0207655_1001731 Ga0207655_10017316 137
81 3300025920 Ga0207649_10028271 Ga0207649_100282712 137
82 3300025924 Ga0207694_10141519 Ga0207694_101415193 137
83 3300025932 Ga0207690_10116716 Ga0207690_101167161 137
84 3300025933 Ga0207706_10006469 Ga0207706_100064694 137
85 3300025933 Ga0207706_10053060 Ga0207706_100530603 137
86 3300025935 Ga0207709_10001584 Ga0207709_100015844 137
87 3300025935 Ga0207709_10007877 Ga0207709_100078778 137
88 3300025940 Ga0207691_10350749 Ga0207691_103507492 137
89 3300025960 Ga0207651_10249953 Ga0207651_102499532 137
90 3300025981 Ga0207640_10332363 Ga0207640_103323632 137
91 3300025986 Ga0207658_10111520 Ga0207658_101115202 137
92 3300026041 Ga0207639_10308538 Ga0207639_103085382 137
93 3300026067 Ga0207678_10069855 Ga0207678_100698553 137
94 3300026089 Ga0207648_10277149 Ga0207648_102771492 137
95 3300026116 Ga0207674_10120183 Ga0207674_101201833 137
96 3300026121 Ga0207683_10133624 Ga0207683_101336241 137
97 3300027666 Ga0209282_1007822 Ga0209282_10078228 137
98 3300027666 Ga0209282_1104538 Ga0209282_11045381 137
99 3300027907 Ga0207428_10119106 Ga0207428_101191063 137
100 3300028381 Ga0268264_11175002 Ga0268264_111750021 137
101 3300030732 Ga0316176_1043162 Ga0316176_10431624 137
102 3300030733 Ga0314311_1040284 Ga0314311_10402842 137
103 3300030734 Ga0316179_1026376 Ga0316179_10263763 137
104 3300030735 Ga0316178_1120720 Ga0316178_11207202 137
105 3300030736 Ga0316180_1058975 Ga0316180_10589753 137
106 3300030742 Ga0316183_1077170 Ga0316183_10771707 137
107 3300030744 Ga0316181_1144972 Ga0316181_11449723 137
108 3300030745 Ga0316182_1234756 Ga0316182_12347567 137
109 3300030745 Ga0316182_1390187 Ga0316182_13901872 137
110 3300031548 Ga0307408_100007215 Ga0307408_1000072157 137
111 3300031548 Ga0307408_100043218 Ga0307408_1000432183 137
112 3300031548 Ga0307408_100782252 Ga0307408_1007822522 137
113 3300031649 Ga0307514_10048005 Ga0307514_100480054 137
114 3300031731 Ga0307405_10103490 Ga0307405_101034902 137
115 3300031731 Ga0307405_10215311 Ga0307405_102153111 137
116 3300031731 Ga0307405_10286704 Ga0307405_102867042 137
117 3300031731 Ga0307405_10305287 Ga0307405_103052872 137
118 3300031824 Ga0307413_10087511 Ga0307413_100875112 137
119 3300031824 Ga0307413_10481950 Ga0307413_104819502 137
120 3300031824 Ga0307413_10744791 Ga0307413_107447911 137
121 3300031852 Ga0307410_10159004 Ga0307410_101590043 137
122 3300031901 Ga0307406_10028572 Ga0307406_100285723 137
123 3300031903 Ga0307407_10218346 Ga0307407_102183462 137
124 3300031903 Ga0307407_10242384 Ga0307407_102423841 137
125 3300031911 Ga0307412_10015679 Ga0307412_100156796 137
126 3300031911 Ga0307412_10076892 Ga0307412_100768923 137
127 3300031911 Ga0307412_10138218 Ga0307412_101382183 137
128 3300031911 Ga0307412_10298891 Ga0307412_102988913 137
129 3300032002 Ga0307416_100012594 Ga0307416_1000125943 137
130 3300032002 Ga0307416_100076068 Ga0307416_1000760683 137
131 3300032002 Ga0307416_100241853 Ga0307416_1002418533 137
132 3300032002 Ga0307416_102159512 Ga0307416_1021595121 137
133 3300032005 Ga0307411_10156555 Ga0307411_101565551 137
134 3300032005 Ga0307411_10373702 Ga0307411_103737022 137
135 3300032005 Ga0307411_10614129 Ga0307411_106141291 137
136 3300032005 Ga0307411_11150651 Ga0307411_111506512 137
137 3300041404 Ga0439436_0001705 Ga0439436_0001705_483_896 137
138 3300041407 Ga0439447_007884 Ga0439447_007884_911_1324 137
139 3300041410 Ga0439461_0023165 Ga0439461_0023165_21_434 137
140 3300041411 Ga0439466_0013020 Ga0439466_0013020_1287_1700 137
141 3300041413 Ga0439465_0004543 Ga0439465_0004543_1477_1890 137
142 3300041413 Ga0439465_0006272 Ga0439465_0006272_1119_1532 137
143 3300041997 Ga0439431_0004440 Ga0439431_0004440_700_1113 137
144 3300041999 Ga0439433_0005132 Ga0439433_0005132_12_425 137
145 3300042002 Ga0439442_005424 Ga0439442_005424_1991_2404 137
146 3300042004 Ga0439445_0009266 Ga0439445_0009266_1477_1890 137
147 3300042004 Ga0439445_0258874 Ga0439445_0258874_91_504 137
148 3300042006 Ga0439432_000677 Ga0439432_000677_2770_3183 137
149 3300042007 Ga0439449_0000720 Ga0439449_0000720_2644_3057 137
150 3300042014 Ga0439457_001445 Ga0439457_001445_5768_6181 137
151 3300042014 Ga0439457_061008 Ga0439457_061008_254_667 137
152 3300042015 Ga0439462_0008900 Ga0439462_0008900_813_1226 137
153 3300042121 Ga0450919_019199 Ga0450919_019199_323_736 137
154 3300042125 Ga0450923_051094 Ga0450923_051094_125_538 137
155 3300042131 Ga0450894_022440 Ga0450894_022440_132_545 137
156 3300042132 Ga0450895_018695 Ga0450895_018695_205_618 137
157 3300042134 Ga0450898_078339 Ga0450898_078339_105_518 137
158 3300042145 Ga0450906_003305 Ga0450906_003305_2350_2763 137
159 3300042156 Ga0439446_0000772 Ga0439446_0000772_5595_6008 137
160 3300042156 Ga0439446_0014612 Ga0439446_0014612_1727_2140 137
161 3300042156 Ga0439446_0028447 Ga0439446_0028447_1078_1491 137
162 3300042184 Ga0450908_004670 Ga0450908_004670_207_620 137
163 3300042531 Ga0450918_000856 Ga0450918_000856_3541_3954 137
164 3300042532 Ga0450893_0031055 Ga0450893_0031055_64_477 137
165 3300046528 Ga0495642_0085577 Ga0495642_0085577_862_1275 137
166 3300046539 Ga0495621_0054585 Ga0495621_0054585_864_1277 137
167 3300046558 Ga0495633_0319920 Ga0495633_0319920_211_624 137
168 3300046615 Ga0495656_0000202 Ga0495656_0000202_9571_9984 137
169 3300046660 Ga0495625_0013990 Ga0495625_0013990_5174_5587 137
170 3300048903 Ga0496100_1266712 Ga0496100_1266712_151_564 137
171 3300049671 Ga0501238_044073 Ga0501238_044073_56_469 137
172 3300049679 Ga0501249_036362 Ga0501249_036362_181_594 137
173 3300049679 Ga0501249_169889 Ga0501249_169889_77_490 137
174 3300049682 Ga0501252_030271 Ga0501252_030271_169_582 137
175 3300049705 Ga0501225_0111583 Ga0501225_0111583_260_673 137
176 3300049758 Ga0501241_155203 Ga0501241_155203_88_501 137
177 3300050489 nmdc:mga03683_12567_c1 nmdc:mga03683_12567_c1_1247_1660 137
178 3300050490 nmdc:mga03n38_113886_c1 nmdc:mga03n38_113886_c1_734_1147 137
179 3300050490 nmdc:mga03n38_148938_c1 nmdc:mga03n38_148938_c1_704_1117 137
180 3300050491 nmdc:mga00v17_94841_c1 nmdc:mga00v17_94841_c1_378_791 137
181 3300050492 nmdc:mga0yw44_37482_c1 nmdc:mga0yw44_37482_c1_2411_2824 137
182 3300050493 nmdc:mga0k408_17545_c1 nmdc:mga0k408_17545_c1_2511_2924 137
183 3300050494 nmdc:mga06z11_49970_c1 nmdc:mga06z11_49970_c1_1497_1910 137
184 3300050516 nmdc:mga0sz30_137975_c1 nmdc:mga0sz30_137975_c1_270_683 137
185 3300005327 Ga0070658_11909505 Ga0070658_119095051 139
186 3300005456 Ga0070678_100110197 Ga0070678_1001101972 139
187 3300044842 Ga0466957_0345110 Ga0466957_0345110_259_726 139
188 3300031711 Ga0265314_10041344 Ga0265314_100413444 140
189 3300005548 Ga0070665_100065852 Ga0070665_1000658524 141
190 3300050496 nmdc:mga07m45_75127_c1 nmdc:mga07m45_75127_c1_191_637 142
191 3300035691 Ga0373931_0147009 Ga0373931_0147009_565_1011 143
192 iso_pu_bacteria 2513020051 2513230272 144
193 iso_pu_bacteria 2599185214 2599624013 144
194 iso_pu_bacteria 2599185226 2599672024 144
195 iso_pu_bacteria 2599185227 2599681894 144
196 iso_pu_bacteria 2599185229 2599693907 144
197 iso_pu_bacteria 2643221628 2644162807 144
198 iso_pu_bacteria 2643221658 2644328774 144
199 iso_pu_bacteria 2643221672 2644398007 144
200 iso_pu_bacteria 2738541277 2738719979 144
201 iso_pu_bacteria 2738541307 2738881480 144
202 iso_pu_bacteria 2738543013 2739249863 144
203 iso_pu_bacteria 2738543019 2739279178 144
204 iso_pu_bacteria 2818991446 2819596465 144
205 iso_pu_bacteria 2831265667 2831270204 144
206 iso_pu_bacteria 2838054893 2838059991 144
207 iso_pu_bacteria 2842677519 2842682377 144
208 iso_pu_bacteria 2842747753 2842749075 144
209 iso_pu_bacteria 2885192300 2885196180 144
210 iso_pu_bacteria 2885198086 2885199599 144
211 iso_pu_bacteria 2885211737 2885213128 144
212 iso_pu_bacteria 2899924645 2899931178 144
213 iso_pu_bacteria 2904449895 2904454837 144
214 iso_pu_bacteria 2904456579 2904462590 144
215 iso_pu_bacteria 2904541872 2904546819 144
216 iso_pu_bacteria 2919462493 2919464031 144
217 iso_pu_bacteria 2928037797 2928038045 144
218 iso_pu_bacteria 2928044640 2928046349 144
219 iso_pu_bacteria 2928051484 2928054041 144
220 iso_pu_bacteria 2928064002 2928065794 144
221 iso_pu_bacteria 2928070936 2928077883 144
222 iso_pu_bacteria 2928084124 2928090826 144
223 iso_pu_bacteria 2928115317 2928119239 144
224 iso_pu_bacteria 2929160207 2929164292 144
225 iso_pu_bacteria 2929520902 2929523872 144
226 iso_pu_bacteria 2945909444 2945913054 144
227 iso_pu_bacteria 2945972063 2945976560 144
228 iso_pu_bacteria 2945984333 2945984662 144
229 iso_pu_bacteria 2954767861 2954771593 144
230 3300005327 Ga0070658_10071426 Ga0070658_100714262 145
231 3300005327 Ga0070658_10093094 Ga0070658_100930942 145
232 3300005335 Ga0070666_10396438 Ga0070666_103964381 145
233 3300005336 Ga0070680_100149304 Ga0070680_1001493042 145
234 3300005339 Ga0070660_100476071 Ga0070660_1004760712 145
235 3300005339 Ga0070660_101296214 Ga0070660_1012962142 145
236 3300005344 Ga0070661_100375478 Ga0070661_1003754782 145
237 3300005367 Ga0070667_102125694 Ga0070667_1021256941 145
238 3300005436 Ga0070713_100222930 Ga0070713_1002229302 145
239 3300005436 Ga0070713_100297250 Ga0070713_1002972502 145
240 3300005437 Ga0070710_10706905 Ga0070710_107069052 145
241 3300005458 Ga0070681_10076285 Ga0070681_100762853 145
242 3300005458 Ga0070681_10155002 Ga0070681_101550022 145
243 3300005530 Ga0070679_100060117 Ga0070679_1000601175 145
244 3300005530 Ga0070679_100076853 Ga0070679_1000768532 145
245 3300005539 Ga0068853_100221057 Ga0068853_1002210572 145
246 3300005539 Ga0068853_101824436 Ga0068853_1018244361 145
247 3300005548 Ga0070665_100000571 Ga0070665_10000057121 145
248 3300005548 Ga0070665_100013698 Ga0070665_1000136989 145
249 3300005548 Ga0070665_100244621 Ga0070665_1002446212 145
250 3300005563 Ga0068855_100025725 Ga0068855_1000257252 145
251 3300005563 Ga0068855_100029751 Ga0068855_1000297515 145
252 3300005563 Ga0068855_100381117 Ga0068855_1003811172 145
253 3300005563 Ga0068855_100910186 Ga0068855_1009101862 145
254 3300005614 Ga0068856_101061333 Ga0068856_1010613332 145
255 3300005614 Ga0068856_101622280 Ga0068856_1016222802 145
256 3300005937 Ga0081455_10409371 Ga0081455_104093713 145
257 3300006237 Ga0097621_100003551 Ga0097621_1000035519 145
258 3300009093 Ga0105240_10026474 Ga0105240_100264747 145
259 3300009093 Ga0105240_10030705 Ga0105240_100307056 145
260 3300009093 Ga0105240_10059229 Ga0105240_100592294 145
261 3300009093 Ga0105240_10163963 Ga0105240_101639633 145
262 3300009093 Ga0105240_10441892 Ga0105240_104418921 145
263 3300009093 Ga0105240_10794417 Ga0105240_107944172 145
264 3300009093 Ga0105240_10815851 Ga0105240_108158512 145
265 3300009093 Ga0105240_10874246 Ga0105240_108742462 145
266 3300009174 Ga0105241_10411683 Ga0105241_104116832 145
267 3300009174 Ga0105241_11885326 Ga0105241_118853262 145
268 3300009174 Ga0105241_11950070 Ga0105241_119500701 145
269 3300009176 Ga0105242_10273086 Ga0105242_102730863 145
270 3300009545 Ga0105237_10035344 Ga0105237_100353442 145
271 3300009545 Ga0105237_10645582 Ga0105237_106455822 145
272 3300009545 Ga0105237_12468941 Ga0105237_124689411 145
273 3300009551 Ga0105238_10041466 Ga0105238_100414665 145
274 3300009551 Ga0105238_10045275 Ga0105238_100452755 145
275 3300009551 Ga0105238_10096688 Ga0105238_100966882 145
276 3300009551 Ga0105238_10408404 Ga0105238_104084042 145
277 3300009551 Ga0105238_10606979 Ga0105238_106069792 145
278 3300010375 Ga0105239_10013020 Ga0105239_100130205 145
279 3300010375 Ga0105239_10208649 Ga0105239_102086492 145
280 3300010375 Ga0105239_10374025 Ga0105239_103740253 145
281 3300010375 Ga0105239_10685003 Ga0105239_106850032 145
282 3300013104 Ga0157370_10040646 Ga0157370_100406466 145
283 3300013104 Ga0157370_10210777 Ga0157370_102107772 145
284 3300013105 Ga0157369_10407945 Ga0157369_104079452 145
285 3300013105 Ga0157369_10414656 Ga0157369_104146562 145
286 3300013307 Ga0157372_11817603 Ga0157372_118176032 145
287 3300021377 Ga0213874_10001191 Ga0213874_100011918 145
288 3300025231 Ga0207427_116162 Ga0207427_1161621 145
289 3300025261 Ga0209233_1000013 Ga0209233_1000013661 145
290 3300025272 Ga0209455_1013798 Ga0209455_10137982 145
291 3300025297 Ga0209758_1000185 Ga0209758_1000185105 145
292 3300025903 Ga0207680_10584086 Ga0207680_105840862 145
293 3300025909 Ga0207705_10001989 Ga0207705_1000198911 145
294 3300025909 Ga0207705_10467378 Ga0207705_104673782 145
295 3300025909 Ga0207705_10469421 Ga0207705_104694212 145
296 3300025911 Ga0207654_10990518 Ga0207654_109905182 145
297 3300025912 Ga0207707_11252320 Ga0207707_112523202 145
298 3300025913 Ga0207695_10014959 Ga0207695_100149598 145
299 3300025913 Ga0207695_10028087 Ga0207695_100280876 145
300 3300025913 Ga0207695_10040636 Ga0207695_100406364 145
301 3300025913 Ga0207695_10044897 Ga0207695_100448976 145
302 3300025913 Ga0207695_10136673 Ga0207695_101366732 145
303 3300025913 Ga0207695_10188981 Ga0207695_101889813 145
304 3300025914 Ga0207671_10283787 Ga0207671_102837872 145
305 3300025916 Ga0207663_10622138 Ga0207663_106221382 145
306 3300025917 Ga0207660_10630904 Ga0207660_106309042 145
307 3300025919 Ga0207657_10038470 Ga0207657_100384702 145
308 3300025919 Ga0207657_10124060 Ga0207657_101240602 145
309 3300025919 Ga0207657_10302518 Ga0207657_103025182 145
310 3300025919 Ga0207657_11066929 Ga0207657_110669291 145
311 3300025920 Ga0207649_10487847 Ga0207649_104878472 145
312 3300025921 Ga0207652_10092949 Ga0207652_100929492 145
313 3300025921 Ga0207652_10129967 Ga0207652_101299673 145
314 3300025924 Ga0207694_10833486 Ga0207694_108334862 145
315 3300025928 Ga0207700_10141254 Ga0207700_101412544 145
316 3300025944 Ga0207661_10077134 Ga0207661_100771342 145
317 3300025949 Ga0207667_10012143 Ga0207667_100121439 145
318 3300025949 Ga0207667_10044273 Ga0207667_100442736 145
319 3300025949 Ga0207667_10494966 Ga0207667_104949662 145
320 3300025949 Ga0207667_11138887 Ga0207667_111388872 145
321 3300026041 Ga0207639_10199256 Ga0207639_101992563 145
322 3300026041 Ga0207639_10631735 Ga0207639_106317352 145
323 3300026067 Ga0207678_10524829 Ga0207678_105248293 145
324 3300026078 Ga0207702_10923794 Ga0207702_109237942 145
325 3300026121 Ga0207683_10078444 Ga0207683_100784442 145
326 3300028379 Ga0268266_10002571 Ga0268266_1000257116 145
327 3300028379 Ga0268266_10020327 Ga0268266_100203272 145
328 3300028379 Ga0268266_10490046 Ga0268266_104900462 145
329 3300028577 Ga0265318_10009718 Ga0265318_100097182 145
330 3300028800 Ga0265338_10245937 Ga0265338_102459372 145
331 3300031235 Ga0265330_10133814 Ga0265330_101338142 145
332 3300031238 Ga0265332_10023082 Ga0265332_100230822 145
333 3300031240 Ga0265320_10072850 Ga0265320_100728502 145
334 3300031241 Ga0265325_10002800 Ga0265325_100028005 145
335 3300031241 Ga0265325_10186974 Ga0265325_101869742 145
336 3300031241 Ga0265325_10354307 Ga0265325_103543071 145
337 3300031242 Ga0265329_10204041 Ga0265329_102040412 145
338 3300031247 Ga0265340_10012156 Ga0265340_100121567 145
339 3300031247 Ga0265340_10192936 Ga0265340_101929362 145
340 3300031249 Ga0265339_10056109 Ga0265339_100561092 145
341 3300031249 Ga0265339_10176300 Ga0265339_101763001 145
342 3300031250 Ga0265331_10008993 Ga0265331_100089933 145
343 3300031250 Ga0265331_10042787 Ga0265331_100427873 145
344 3300031344 Ga0265316_10204375 Ga0265316_102043752 145
345 3300031595 Ga0265313_10002996 Ga0265313_1000299612 145
346 3300031595 Ga0265313_10018280 Ga0265313_100182804 145
347 3300031711 Ga0265314_10011318 Ga0265314_100113182 145
348 3300031712 Ga0265342_10040406 Ga0265342_100404062 145
349 3300031730 Ga0307516_10029985 Ga0307516_100299853 145
350 3300037466 Ga0395898_0366228 Ga0395898_0366228_439_894 145
351 3300038443 Ga0395901_0433110 Ga0395901_0433110_268_723 145
352 3300039437 Ga0436365_0255272 Ga0436365_0255272_165_617 145
353 3300039438 Ga0436360_0707346 Ga0436360_0707346_224_676 145
354 3300039450 Ga0436363_0026702 Ga0436363_0026702_94_543 145
355 3300039453 Ga0436362_1045686 Ga0436362_1045686_623_1075 145
356 3300047317 Ga0495604_0594284 Ga0495604_0594284_181_636 145
357 3300047319 Ga0495674_0367443 Ga0495674_0367443_394_849 145
358 3300049570 Ga0501033_0145409 Ga0501033_0145409_713_1168 145
359 3300049573 Ga0501037_0339358 Ga0501037_0339358_454_921 145
360 3300049573 Ga0501037_0440011 Ga0501037_0440011_409_864 145
361 3300049575 Ga0501039_0851823 Ga0501039_0851823_188_640 145
362 3300049579 Ga0501043_0554477 Ga0501043_0554477_123_578 145
363 3300049580 Ga0501046_0122247 Ga0501046_0122247_1438_1890 145
364 3300049580 Ga0501046_0139837 Ga0501046_0139837_1081_1536 145
365 3300049581 Ga0501047_0149829 Ga0501047_0149829_962_1429 145
366 3300049581 Ga0501047_0231916 Ga0501047_0231916_763_1218 145
367 3300049586 Ga0501070_0452375 Ga0501070_0452375_457_912 145
368 3300049742 Ga0501080_0152059 Ga0501080_0152059_355_810 145
369 3300049822 Ga0501035_0020102 Ga0501035_0020102_2650_3105 145
370 3300049822 Ga0501035_0077655 Ga0501035_0077655_1223_1675 145
371 3300049823 Ga0501044_0030699 Ga0501044_0030699_497_952 145
372 3300050492 nmdc:mga0yw44_935410_c1 nmdc:mga0yw44_935410_c1_49_501 145
373 3300053119 Ga0500595_042249 Ga0500595_042249_378_833 145
374 3300053730 Ga0500645_014949 Ga0500645_014949_618_1070 145
375 3300025942 Ga0207689_10158293 Ga0207689_101582933 146
376 3300026035 Ga0207703_10444713 Ga0207703_104447132 146
377 3300050507 nmdc:mga05p37_1439989_c1 nmdc:mga05p37_1439989_c1_241_681 146
378 3300009098 Ga0105245_10763192 Ga0105245_107631922 147
379 3300009148 Ga0105243_10117165 Ga0105243_101171652 147
380 3300013297 Ga0157378_10461464 Ga0157378_104614642 147
381 3300025911 Ga0207654_10880263 Ga0207654_108802632 147
382 3300026121 Ga0207683_10626202 Ga0207683_106262022 147
383 3300031711 Ga0265314_10212841 Ga0265314_102128412 147
384 3300046648 Ga0495611_0055983 Ga0495611_0055983_138_605 147
385 3300048924 Ga0496121_0169638 Ga0496121_0169638_774_1241 147
386 3300049579 Ga0501043_0636961 Ga0501043_0636961_178_648 147
387 3300049581 Ga0501047_0021113 Ga0501047_0021113_1273_1743 147
388 3300049822 Ga0501035_0028649 Ga0501035_0028649_1344_1814 147
389 3300049823 Ga0501044_0263494 Ga0501044_0263494_1071_1541 147
390 3300053119 Ga0500595_002496 Ga0500595_002496_1727_2194 147
391 iso_pu_bacteria 2511231004 2511252667 147
392 iso_pu_bacteria 2511231006 2511263238 147
393 iso_pu_bacteria 2511231007 2511269974 147
394 iso_pu_bacteria 2511231008 2511275627 147
395 iso_pu_bacteria 2511231010 2511289889 147
396 iso_pu_bacteria 2511231011 2511294393 147
397 iso_pu_bacteria 2511231012 2511302014 147
398 iso_pu_bacteria 2511231014 2511315352 147
399 iso_pu_bacteria 2511231015 2511319358 147
400 iso_pu_bacteria 2511231016 2511325023 147
401 iso_pu_bacteria 2511231017 2511332083 147
402 iso_pu_bacteria 2511231018 2511339152 147
403 iso_pu_bacteria 2511231019 2511343144 147
404 iso_pu_bacteria 2511231020 2511348657 147
405 iso_pu_bacteria 2511231021 2511353637 147
406 iso_pu_bacteria 2511231022 2511364211 147
407 iso_pu_bacteria 2511231023 2511371552 147
408 iso_pu_bacteria 2511231024 2511373865 147
409 iso_pu_bacteria 2511231031 2511416519 147
410 iso_pu_bacteria 2511231156 2511827764 147
411 iso_pu_bacteria 2512047018 2512326550 147
412 iso_pu_bacteria 2554235132 2554818426 147
413 iso_pu_bacteria 2554235231 2555247981 147
414 iso_pu_bacteria 2554235341 2555672956 147
415 iso_pu_bacteria 2582580891 2583795599 147
416 iso_pu_bacteria 2597489887 2597861007 147
417 iso_pu_bacteria 2597489888 2597866747 147
418 iso_pu_bacteria 2597489889 2597872608 147
419 iso_pu_bacteria 2599185155 2599327629 147
420 iso_pu_bacteria 2599185160 2599355837 147
421 iso_pu_bacteria 2599185161 2599362761 147
422 iso_pu_bacteria 2599185162 2599368933 147
423 iso_pu_bacteria 2599185163 2599375870 147
424 iso_pu_bacteria 2599185164 2599380943 147
425 iso_pu_bacteria 2599185165 2599387541 147
426 iso_pu_bacteria 2599185166 2599394728 147
427 iso_pu_bacteria 2599185167 2599400913 147
428 iso_pu_bacteria 2599185168 2599406493 147
429 iso_pu_bacteria 2599185179 2599449742 147
430 iso_pu_bacteria 2599185181 2599462671 147
431 iso_pu_bacteria 2599185182 2599467907 147
432 iso_pu_bacteria 2599185185 2599485759 147
433 iso_pu_bacteria 2599185186 2599491688 147
434 iso_pu_bacteria 2599185188 2599500381 147
435 iso_pu_bacteria 2599185189 2599505870 147
436 iso_pu_bacteria 2599185190 2599511816 147
437 iso_pu_bacteria 2599185191 2599516800 147
438 iso_pu_bacteria 2599185212 2599615963 147
439 iso_pu_bacteria 2599185248 2599768025 147
440 iso_pu_bacteria 2599185257 2599804538 147
441 iso_pu_bacteria 2599185288 2599879160 147
442 iso_pu_bacteria 2599185289 2599885461 147
443 iso_pu_bacteria 2599185290 2599893319 147
444 iso_pu_bacteria 2599185291 2599897175 147
445 iso_pu_bacteria 2599185300 2599930596 147
446 iso_pu_bacteria 2599185302 2599942236 147
447 iso_pu_bacteria 2599185303 2599948893 147
448 iso_pu_bacteria 2599185304 2599954350 147
449 iso_pu_bacteria 2599185305 2599963043 147
450 iso_pu_bacteria 2599185306 2599966067 147
451 iso_pu_bacteria 2599185308 2599977883 147
452 iso_pu_bacteria 2599185309 2599982806 147
453 iso_pu_bacteria 2599185310 2599988443 147
454 iso_pu_bacteria 2599185311 2599994107 147
455 iso_pu_bacteria 2599185312 2599999239 147
456 iso_pu_bacteria 2599185313 2600004188 147
457 iso_pu_bacteria 2599185314 2600012050 147
458 iso_pu_bacteria 2599185315 2600019884 147
459 iso_pu_bacteria 2599185316 2600026186 147
460 iso_pu_bacteria 2599185317 2600031257 147
461 iso_pu_bacteria 2599185318 2600036099 147
462 iso_pu_bacteria 2599185319 2600044318 147
463 iso_pu_bacteria 2599185320 2600046769 147
464 iso_pu_bacteria 2599185321 2600054482 147
465 iso_pu_bacteria 2599185322 2600062224 147
466 iso_pu_bacteria 2599185323 2600067905 147
467 iso_pu_bacteria 2599185324 2600071988 147
468 iso_pu_bacteria 2599185325 2600076422 147
469 iso_pu_bacteria 2599185356 2600215295 147
470 iso_pu_bacteria 2600254930 2600359518 147
471 iso_pu_bacteria 2600254931 2600363428 147
472 iso_pu_bacteria 2600254954 2600442645 147
473 iso_pu_bacteria 2600255283 2601627564 147
474 iso_pu_bacteria 2600255296 2601693106 147
475 iso_pu_bacteria 2600255313 2601775461 147
476 iso_pu_bacteria 2600255318 2601798429 147
477 iso_pu_bacteria 2600255389 2602011020 147
478 iso_pu_bacteria 2603880185 2606077323 147
479 iso_pu_bacteria 2603880199 2606129431 147
480 iso_pu_bacteria 2606217733 2608385079 147
481 iso_pu_bacteria 2619619299 2621296726 147
482 iso_pu_bacteria 2623620443 2624483535 147
483 iso_pu_bacteria 2623620446 2624495084 147
484 iso_pu_bacteria 2643221565 2643843082 147
485 iso_pu_bacteria 2643221571 2643873330 147
486 iso_pu_bacteria 2643221589 2643956191 147
487 iso_pu_bacteria 2643221602 2644020311 147
488 iso_pu_bacteria 2643221633 2644184353 147
489 iso_pu_bacteria 2643221650 2644283108 147
490 iso_pu_bacteria 2643221713 2644624611 147
491 iso_pu_bacteria 2667528170 2671089676 147
492 iso_pu_bacteria 2667528171 2671099402 147
493 iso_pu_bacteria 2667528176 2671129514 147
494 iso_pu_bacteria 2671180172 2671771545 147
495 iso_pu_bacteria 2675903420 2677897274 147
496 iso_pu_bacteria 2675903515 2678266267 147
497 iso_pu_bacteria 2713897148 2715749716 147
498 iso_pu_bacteria 2713897149 2715754720 147
499 iso_pu_bacteria 2718217725 2718636738 147
500 iso_pu_bacteria 2721755607 2723251483 147
501 iso_pu_bacteria 2738541265 2738675379 147
502 iso_pu_bacteria 2738541271 2738690463 147
503 iso_pu_bacteria 2738541282 2738753782 147
504 iso_pu_bacteria 2738541294 2738807376 147
505 iso_pu_bacteria 2738541303 2738862771 147
506 iso_pu_bacteria 2738541309 2738894736 147
507 iso_pu_bacteria 2738543004 2739199174 147
508 iso_pu_bacteria 2738543015 2739260528 147
509 iso_pu_bacteria 2738543016 2739266237 147
510 iso_pu_bacteria 2738543020 2739285790 147
511 iso_pu_bacteria 2738543021 2739291103 147
512 iso_pu_bacteria 2738543025 2739312385 147
513 iso_pu_bacteria 2740892503 2743740547 147
514 iso_pu_bacteria 2744054620 2745007499 147
515 iso_pu_bacteria 2773857670 2774118227 147
516 iso_pu_bacteria 2773857673 2774136313 147
517 iso_pu_bacteria 2784132063 2784261690 147
518 iso_pu_bacteria 2784132072 2784313719 147
519 iso_pu_bacteria 2791355520 2794593721 147
520 iso_pu_bacteria 2806310737 2807410881 147
521 iso_pu_bacteria 2806310745 2807459222 147
522 iso_pu_bacteria 2808606361 2808855576 147
523 iso_pu_bacteria 2808606373 2808906145 147
524 iso_pu_bacteria 2808606376 2808926094 147
525 iso_pu_bacteria 2808606377 2808928314 147
526 iso_pu_bacteria 2808606378 2808935587 147
527 iso_pu_bacteria 2808606379 2808942195 147
528 iso_pu_bacteria 2808606380 2808948195 147
529 iso_pu_bacteria 2808606381 2808950503 147
530 iso_pu_bacteria 2808606382 2808959953 147
531 iso_pu_bacteria 2808606383 2808964195 147
532 iso_pu_bacteria 2808606385 2808976273 147
533 iso_pu_bacteria 2808606388 2808994265 147
534 iso_pu_bacteria 2808606389 2808998969 147
535 iso_pu_bacteria 2808606445 2809217327 147
536 iso_pu_bacteria 2816332298 2817494161 147
537 iso_pu_bacteria 2818991456 2819655256 147
538 iso_pu_bacteria 2818991464 2819704548 147
539 iso_pu_bacteria 2823421272 2823421517 147
540 iso_pu_bacteria 2825651385 2825654948 147
541 iso_pu_bacteria 2826581358 2826582373 147
542 iso_pu_bacteria 2834028612 2834031072 147
543 iso_pu_bacteria 2842805378 2842807724 147
544 iso_pu_bacteria 2842815866 2842816975 147
545 iso_pu_bacteria 2842826826 2842828650 147
546 iso_pu_bacteria 2842832357 2842833580 147
547 iso_pu_bacteria 2842837860 2842838017 147
548 iso_pu_bacteria 2842843487 2842845804 147
549 iso_pu_bacteria 2842849001 2842852146 147
550 iso_pu_bacteria 2842854478 2842855745 147
551 iso_pu_bacteria 2844665904 2844667220 147
552 iso_pu_bacteria 2852612431 2852616473 147
553 iso_pu_bacteria 2852657418 2852659937 147
554 iso_pu_bacteria 2852667396 2852671441 147
555 iso_pu_bacteria 2860339153 2860341852 147
556 iso_pu_bacteria 2860867994 2860873142 147
557 iso_pu_bacteria 2878029506 2878029542 147
558 iso_pu_bacteria 2880230671 2880236121 147
559 iso_pu_bacteria 2904518522 2904518828 147
560 iso_pu_bacteria 2904550169 2904551477 147
561 iso_pu_bacteria 2908446538 2908452736 147
562 iso_pu_bacteria 2912963787 2912969000 147
563 iso_pu_bacteria 2913036834 2913042648 147
564 iso_pu_bacteria 2917070673 2917076857 147
565 iso_pu_bacteria 2919063839 2919065387 147
566 iso_pu_bacteria 2919385768 2919389074 147
567 iso_pu_bacteria 2919456309 2919457705 147
568 iso_pu_bacteria 2919481497 2919485776 147
569 iso_pu_bacteria 2919487758 2919488001 147
570 iso_pu_bacteria 2919501602 2919505921 147
571 iso_pu_bacteria 2919697872 2919700453 147
572 iso_pu_bacteria 2923153595 2923159640 147
573 iso_pu_bacteria 2923586266 2923589118 147
574 iso_pu_bacteria 2926063275 2926067802 147
575 iso_pu_bacteria 2929144301 2929150042 147
576 iso_pu_bacteria 2929189879 2929195267 147
577 iso_pu_bacteria 2931369376 2931372517 147
578 iso_pu_bacteria 2931390751 2931390773 147
579 iso_pu_bacteria 2931396565 2931398238 147
580 iso_pu_bacteria 2935353572 2935358176 147
581 iso_pu_bacteria 2939636861 2939640681 147
582 iso_pu_bacteria 2939651529 2939654260 147
583 iso_pu_bacteria 2945928738 2945930796 147
584 iso_pu_bacteria 2945961074 2945966989 147
585 iso_pu_bacteria 2946006987 2946013145 147
586 iso_pu_bacteria 2946027586 2946028020 147
587 iso_pu_bacteria 2947233263 2947234547 147
588 iso_pu_bacteria 2974289157 2974293962 147
589 iso_pu_bacteria 2984286254 2984286474 147
590 iso_pu_bacteria 2988728565 2988731581 147
591 iso_pu_bacteria 2998139840 2998139865 147
592 iso_pu_bacteria 3007315729 3007316432 147
593 iso_pu_bacteria 3007419365 3007419396 147
594 iso_pu_bacteria 3007511990 3007517301 147
595 iso_pu_bacteria 3007614139 3007619654 147
596 iso_pu_bacteria 3007619802 3007624589 147
597 iso_pu_bacteria 3007718800 3007719561 147
598 iso_pu_bacteria 3007803356 3007806260 147
599 iso_pu_bacteria 3007855910 3007859315 147
600 iso_pu_bacteria 3007861166 3007864981 147
601 iso_pu_bacteria 3007866637 3007866662 147
602 iso_pu_bacteria 3007872151 3007873372 147
603 iso_pu_bacteria 637000220 637323388 147
604 iso_pu_bacteria 8015687852 8015693738 147
605 iso_pu_bacteria 8019769354 8019769649 147
606 iso_pu_bacteria 8019775933 8019781403 147
607 iso_pu_bacteria 8029995093 8029995389 147
608 iso_pu_bacteria 8034962539 8034964385 147
609 iso_pu_bacteria 8052494512 8052494734 147
610 iso_pu_bacteria 8054285046 8054290405 147
611 iso_pu_bacteria 8054347763 8054349465 147
612 iso_pu_bacteria 8054503363 8054503386 147
613 iso_pu_bacteria 8054929484 8054931211 147
614 iso_pu_bacteria 8055770955 8055776996 147
615 iso_pu_bacteria 8055817908 8055824030 147
616 iso_pu_bacteria 8056115690 8056116435 147
617 iso_pu_bacteria 8056120720 8056125795 147
618 iso_pu_bacteria 8056125926 8056125948 147
619 iso_pu_bacteria 8056131705 8056131727 147
620 iso_pu_bacteria 8056137416 8056142914 147
621 iso_pu_bacteria 8056143049 8056143075 147
622 iso_pu_bacteria 8056148874 8056151372 147
623 iso_pu_bacteria 8056155041 8056159829 147
624 iso_pu_bacteria 8056166840 8056171189 147
625 iso_pu_bacteria 8056172158 8056177295 147
626 iso_pu_bacteria 8056177738 8056182117 147
627 iso_pu_bacteria 8056569372 8056570590 147
628 iso_pu_bacteria 8057798959 8057802064 147
629 3300002739 JGI25158J39367_1019037 JGI25158J39367_10190371 148
630 3300002773 JGI25152J39213_1022211 JGI25152J39213_10222111 148
631 3300003187 JGI25151J46595_10004639 JGI25151J46595_100046398 148
632 3300003187 JGI25151J46595_10020532 JGI25151J46595_100205322 148
633 3300003187 JGI25151J46595_10132605 JGI25151J46595_101326051 148
634 3300003374 JGI25161J50226_1004834 JGI25161J50226_10048343 148
635 3300003578 Ga0006562J51391_1029315 Ga0006562J51391_10293153 148
636 3300003578 Ga0006562J51391_1029316 Ga0006562J51391_10293162 148
637 3300003762 Ga0055542_1000033 Ga0055542_100003326 148
638 3300003781 Ga0055536_1015428 Ga0055536_10154281 148
639 3300003781 Ga0055536_1030978 Ga0055536_10309781 148
640 3300003784 Ga0055534_1000042 Ga0055534_100004283 148
641 3300003791 Ga0055530_10013632 Ga0055530_100136321 148
642 3300003792 Ga0055540_1008764 Ga0055540_10087643 148
643 3300003792 Ga0055540_1012754 Ga0055540_10127541 148
644 3300003794 Ga0055531_10020084 Ga0055531_100200844 148
645 3300005344 Ga0070661_100105889 Ga0070661_1001058893 148
646 3300005344 Ga0070661_101175700 Ga0070661_1011757001 148
647 3300005457 Ga0070662_100053572 Ga0070662_1000535723 148
648 3300005457 Ga0070662_100268482 Ga0070662_1002684822 148
649 3300005459 Ga0068867_100238418 Ga0068867_1002384183 148
650 3300005539 Ga0068853_100882267 Ga0068853_1008822672 148
651 3300005616 Ga0068852_100764704 Ga0068852_1007647042 148
652 3300005844 Ga0068862_100076069 Ga0068862_1000760693 148
653 3300006048 Ga0075363_100239570 Ga0075363_1002395702 148
654 3300006177 Ga0075362_10165140 Ga0075362_101651402 148
655 3300006195 Ga0075366_10034240 Ga0075366_100342404 148
656 3300006946 Ga0079104_1087561 Ga0079104_10875612 148
657 3300006948 Ga0099826_10009833 Ga0099826_100098334 148
658 3300007076 Ga0075435_101277415 Ga0075435_1012774152 148
659 3300009036 Ga0105244_10003747 Ga0105244_100037478 148
660 3300009036 Ga0105244_10187125 Ga0105244_101871251 148
661 3300009093 Ga0105240_10172079 Ga0105240_101720793 148
662 3300009098 Ga0105245_10275295 Ga0105245_102752952 148
663 3300009148 Ga0105243_10019997 Ga0105243_100199973 148
664 3300009148 Ga0105243_10029768 Ga0105243_100297683 148
665 3300009176 Ga0105242_10447245 Ga0105242_104472452 148
666 3300009545 Ga0105237_10012953 Ga0105237_100129534 148
667 3300009551 Ga0105238_10128726 Ga0105238_101287264 148
668 3300010375 Ga0105239_10144596 Ga0105239_101445963 148
669 3300010375 Ga0105239_11930690 Ga0105239_119306901 148
670 3300011119 Ga0105246_10088711 Ga0105246_100887113 148
671 3300012502 Ga0157347_1001430 Ga0157347_10014303 148
672 3300013104 Ga0157370_10017421 Ga0157370_100174218 148
673 3300013104 Ga0157370_11569551 Ga0157370_115695511 148
674 3300013105 Ga0157369_10041845 Ga0157369_100418453 148
675 3300013306 Ga0163162_10600889 Ga0163162_106008892 148
676 3300013307 Ga0157372_10124073 Ga0157372_101240732 148
677 3300014497 Ga0182008_10003873 Ga0182008_1000387310 148
678 3300014497 Ga0182008_10004162 Ga0182008_100041629 148
679 3300014969 Ga0157376_11013557 Ga0157376_110135572 148
680 3300015261 Ga0182006_1002216 Ga0182006_100221612 148
681 3300015262 Ga0182007_10000825 Ga0182007_100008258 148
682 3300015265 Ga0182005_1045196 Ga0182005_10451961 148
683 3300025208 Ga0209436_122849 Ga0209436_1228492 148
684 3300025229 Ga0209147_100783 Ga0209147_10078329 148
685 3300025258 Ga0209129_1000071 Ga0209129_1000071134 148
686 3300025258 Ga0209129_1005062 Ga0209129_10050623 148
687 3300025258 Ga0209129_1005094 Ga0209129_10050944 148
688 3300025263 Ga0209565_1000334 Ga0209565_10003347 148
689 3300025263 Ga0209565_1002220 Ga0209565_10022203 148
690 3300025273 Ga0209673_1001906 Ga0209673_100190613 148
691 3300025284 Ga0209130_1003240 Ga0209130_10032405 148
692 3300025284 Ga0209130_1003577 Ga0209130_10035777 148
693 3300025291 Ga0209675_1003063 Ga0209675_10030639 148
694 3300025292 Ga0209676_1000005 Ga0209676_100000549 148
695 3300025294 Ga0209025_1000544 Ga0209025_10005443 148
696 3300025294 Ga0209025_1000854 Ga0209025_100085445 148
697 3300025294 Ga0209025_1001296 Ga0209025_10012962 148
698 3300025294 Ga0209025_1012749 Ga0209025_10127493 148
699 3300025295 Ga0209564_1000239 Ga0209564_100023957 148
700 3300025297 Ga0209758_1000027 Ga0209758_1000027375 148
701 3300025297 Ga0209758_1003037 Ga0209758_100303714 148
702 3300025298 Ga0209050_1000007 Ga0209050_10000071049 148
703 3300025299 Ga0209256_1000081 Ga0209256_1000081134 148
704 3300025302 Ga0207426_1000027 Ga0207426_1000027340 148
705 3300025302 Ga0207426_1000614 Ga0207426_100061442 148
706 3300025303 Ga0209051_1000009 Ga0209051_100000949 148
707 3300025303 Ga0209051_1020630 Ga0209051_10206302 148
708 3300025303 Ga0209051_1137235 Ga0209051_11372351 148
709 3300025304 Ga0209257_1000011 Ga0209257_100001123 148
710 3300025920 Ga0207649_11046695 Ga0207649_110466951 148
711 3300025924 Ga0207694_10283409 Ga0207694_102834092 148
712 3300025927 Ga0207687_10074432 Ga0207687_100744324 148
713 3300025937 Ga0207669_10077464 Ga0207669_100774641 148
714 3300026041 Ga0207639_10314612 Ga0207639_103146122 148
715 3300026089 Ga0207648_10364162 Ga0207648_103641622 148
716 3300028380 Ga0268265_10251286 Ga0268265_102512863 148
717 3300030731 Ga0316177_1070524 Ga0316177_10705242 148
718 3300030744 Ga0316181_1124265 Ga0316181_11242652 148
719 3300031251 Ga0265327_10033411 Ga0265327_100334112 148
720 3300031507 Ga0307509_10671613 Ga0307509_106716132 148
721 3300031730 Ga0307516_10003211 Ga0307516_100032119 148
722 3300031731 Ga0307405_10183573 Ga0307405_101835731 148
723 3300031911 Ga0307412_10748402 Ga0307412_107484021 148
724 3300041443 Ga0451789_0759931 Ga0451789_0759931_48_494 148
725 3300041460 Ga0451802_2039099 Ga0451802_2039099_706_1155 148
726 3300044683 Ga0466965_0023451 Ga0466965_0023451_1557_2003 148
727 3300044901 Ga0466960_0443712 Ga0466960_0443712_53_499 148
728 3300046453 Ga0495627_003716 Ga0495627_003716_5439_5885 148
729 3300046453 Ga0495627_011272 Ga0495627_011272_162_608 148
730 3300046463 Ga0495653_0385859 Ga0495653_0385859_422_868 148
731 3300046506 Ga0495583_0300230 Ga0495583_0300230_139_585 148
732 3300046512 Ga0495610_0042218 Ga0495610_0042218_43_489 148
733 3300046512 Ga0495610_0123868 Ga0495610_0123868_344_790 148
734 3300046515 Ga0495620_0160595 Ga0495620_0160595_369_815 148
735 3300046518 Ga0495631_0002010 Ga0495631_0002010_2314_2760 148
736 3300046520 Ga0495637_0004201 Ga0495637_0004201_2275_2721 148
737 3300046520 Ga0495637_0012776 Ga0495637_0012776_1872_2318 148
738 3300046525 Ga0495663_0289514 Ga0495663_0289514_132_578 148
739 3300046528 Ga0495642_0036150 Ga0495642_0036150_1508_1954 148
740 3300046530 Ga0495654_0020203 Ga0495654_0020203_268_714 148
741 3300046539 Ga0495621_0016061 Ga0495621_0016061_603_1049 148
742 3300046557 Ga0495622_0191153 Ga0495622_0191153_49_495 148
743 3300046615 Ga0495656_0250217 Ga0495656_0250217_437_883 148
744 3300046616 Ga0495668_0099059 Ga0495668_0099059_655_1101 148
745 3300046616 Ga0495668_0196039 Ga0495668_0196039_74_520 148
746 3300046660 Ga0495625_0043722 Ga0495625_0043722_35_481 148
747 3300046660 Ga0495625_0423463 Ga0495625_0423463_271_717 148
748 3300046663 Ga0495635_0158202 Ga0495635_0158202_605_1051 148
749 3300046674 Ga0495588_0029331 Ga0495588_0029331_1407_1853 148
750 3300046683 Ga0495658_0325399 Ga0495658_0325399_358_804 148
751 3300046691 Ga0495670_0149990 Ga0495670_0149990_747_1193 148
752 3300046692 Ga0495671_0014255 Ga0495671_0014255_2474_2920 148
753 3300047315 Ga0495581_0747091 Ga0495581_0747091_101_547 148
754 3300047321 Ga0495676_0040988 Ga0495676_0040988_2722_3168 148
755 3300047323 Ga0495683_0079854 Ga0495683_0079854_245_691 148
756 3300047673 Ga0495593_0021928 Ga0495593_0021928_770_1216 148
757 3300047673 Ga0495593_0493703 Ga0495593_0493703_152_598 148
758 3300048089 Ga0495614_0018096 Ga0495614_0018096_133_579 148
759 3300048090 Ga0495615_0223300 Ga0495615_0223300_12_458 148
760 3300048903 Ga0496100_0007462 Ga0496100_0007462_1956_2402 148
761 3300048912 Ga0496109_0095304 Ga0496109_0095304_670_1116 148
762 3300048913 Ga0496110_0057839 Ga0496110_0057839_1397_1843 148
763 3300048914 Ga0496111_0127973 Ga0496111_0127973_185_631 148
764 3300048916 Ga0496113_0210462 Ga0496113_0210462_459_905 148
765 3300048919 Ga0496116_0000008 Ga0496116_0000008_266968_267471 148
766 3300048919 Ga0496116_0038119 Ga0496116_0038119_999_1445 148
767 3300048919 Ga0496116_0049986 Ga0496116_0049986_894_1340 148
768 3300048919 Ga0496116_0199457 Ga0496116_0199457_66_512 148
769 3300048920 Ga0496117_0025916 Ga0496117_0025916_1529_1975 148
770 3300048920 Ga0496117_0032865 Ga0496117_0032865_2325_2771 148
771 3300048921 Ga0496118_0015717 Ga0496118_0015717_4619_5065 148
772 3300048921 Ga0496118_0020580 Ga0496118_0020580_3425_3871 148
773 3300048924 Ga0496121_0000012 Ga0496121_0000012_448259_448762 148
774 3300048924 Ga0496121_0101509 Ga0496121_0101509_1195_1641 148
775 3300048925 Ga0496122_0078839 Ga0496122_0078839_1110_1556 148
776 3300048925 Ga0496122_0140241 Ga0496122_0140241_908_1354 148
777 3300048925 Ga0496122_0190174 Ga0496122_0190174_248_694 148
778 3300048926 Ga0496123_0023248 Ga0496123_0023248_4204_4650 148
779 3300048926 Ga0496123_0113888 Ga0496123_0113888_203_649 148
780 3300048926 Ga0496123_0307071 Ga0496123_0307071_85_531 148
781 3300048927 Ga0496124_0053909 Ga0496124_0053909_2159_2605 148
782 3300048927 Ga0496124_0099855 Ga0496124_0099855_1011_1457 148
783 3300048927 Ga0496124_0240376 Ga0496124_0240376_751_1197 148
784 3300048928 Ga0496125_0019719 Ga0496125_0019719_1214_1660 148
785 3300048928 Ga0496125_0030847 Ga0496125_0030847_2326_2772 148
786 3300048928 Ga0496125_0143002 Ga0496125_0143002_643_1089 148
787 3300048929 Ga0496126_0081568 Ga0496126_0081568_1920_2366 148
788 3300050493 nmdc:mga0k408_108860_c1 nmdc:mga0k408_108860_c1_401_847 148
789 3300050493 nmdc:mga0k408_11346_c1 nmdc:mga0k408_11346_c1_501_947 148
790 3300050494 nmdc:mga06z11_46024_c1 nmdc:mga06z11_46024_c1_1293_1739 148
791 3300050496 nmdc:mga07m45_16790_c1 nmdc:mga07m45_16790_c1_3160_3606 148
792 3300050496 nmdc:mga07m45_1912_c1 nmdc:mga07m45_1912_c1_7935_8381 148
793 3300050496 nmdc:mga07m45_8240_c1 nmdc:mga07m45_8240_c1_2673_3119 148
794 3300050496 nmdc:mga07m45_898_c1 nmdc:mga07m45_898_c1_7746_8192 148
795 3300053079 Ga0500610_0027879 Ga0500610_0027879_554_1000 148
796 3300053079 Ga0500610_0037753 Ga0500610_0037753_966_1412 148
797 3300053079 Ga0500610_0042155 Ga0500610_0042155_78_524 148
798 3300053087 Ga0500643_003702 Ga0500643_003702_5827_6273 148
799 3300053091 Ga0500647_0255319 Ga0500647_0255319_220_666 148
800 3300053093 Ga0500651_0000029 Ga0500651_0000029_79068_79514 148
801 3300053094 Ga0500566_0096020 Ga0500566_0096020_293_739 148
802 3300053096 Ga0500641_0249275 Ga0500641_0249275_169_615 148
803 3300053108 Ga0500562_077614 Ga0500562_077614_400_846 148
804 3300053109 Ga0500569_057735 Ga0500569_057735_82_528 148
805 3300053110 Ga0500571_001234 Ga0500571_001234_9141_9587 148
806 3300053111 Ga0500572_030735 Ga0500572_030735_653_1099 148
807 3300053116 Ga0500592_007013 Ga0500592_007013_1029_1475 148
808 3300053117 Ga0500593_001548 Ga0500593_001548_2056_2502 148
809 3300053122 Ga0500608_019691 Ga0500608_019691_771_1217 148
810 3300053128 Ga0500626_051154 Ga0500626_051154_845_1291 148
811 3300053133 Ga0500655_000253 Ga0500655_000253_9957_10403 148
812 3300053134 Ga0500658_0001930 Ga0500658_0001930_2104_2550 148
813 3300053134 Ga0500658_0002544 Ga0500658_0002544_2391_2837 148
814 3300053138 Ga0500564_005374 Ga0500564_005374_3543_3989 148
815 3300053139 Ga0500568_0006729 Ga0500568_0006729_3218_3664 148
816 3300053141 Ga0500574_004090 Ga0500574_004090_2199_2645 148
817 3300053153 Ga0500616_0042382 Ga0500616_0042382_1880_2326 148
818 3300053158 Ga0500627_0001507 Ga0500627_0001507_1133_1579 148
819 3300053161 Ga0500634_0010416 Ga0500634_0010416_1269_1715 148
820 3300053162 Ga0500638_166502 Ga0500638_166502_133_579 148
821 3300053734 Ga0500565_000623 Ga0500565_000623_497_943 148
822 3300053735 Ga0500596_019858 Ga0500596_019858_163_609 148
823 iso_pu_bacteria 2690315857 2691329318 148
824 iso_pu_bacteria 2919493220 2919497315 148
825 iso_pu_bacteria 2919534386 2919537504 148
826 iso_pu_bacteria 2919543075 2919547460 148
827 iso_pu_bacteria 2919688452 2919690135 148
828 iso_pu_bacteria 2923525760 2923526287 148
829 iso_pu_bacteria 8002745576 8002746110 148
830 3300009176 Ga0105242_10315112 Ga0105242_103151122 149
831 3300013308 Ga0157375_11677046 Ga0157375_116770461 149
832 3300014497 Ga0182008_10007331 Ga0182008_100073317 149
833 3300014969 Ga0157376_10243875 Ga0157376_102438752 149
834 3300015262 Ga0182007_10000601 Ga0182007_1000060119 149
835 3300031911 Ga0307412_10413954 Ga0307412_104139542 149
836 3300046665 Ga0495661_0102259 Ga0495661_0102259_996_1445 149
837 3300046674 Ga0495588_0220866 Ga0495588_0220866_462_950 149
838 3300048904 Ga0496101_0001014 Ga0496101_0001014_6520_7008 149
839 3300048905 Ga0496102_0022497 Ga0496102_0022497_2312_2800 149
840 3300048907 Ga0496104_0007646 Ga0496104_0007646_6126_6614 149
841 3300048908 Ga0496105_0025015 Ga0496105_0025015_2006_2494 149
842 3300048910 Ga0496107_0070855 Ga0496107_0070855_1473_1961 149
843 3300048911 Ga0496108_0140948 Ga0496108_0140948_333_821 149
844 3300048913 Ga0496110_0012658 Ga0496110_0012658_1663_2151 149
845 3300048914 Ga0496111_0008593 Ga0496111_0008593_4596_5084 149
846 3300048917 Ga0496114_0058158 Ga0496114_0058158_1374_1862 149
847 3300005434 Ga0070709_10011208 Ga0070709_100112085 150
848 3300005456 Ga0070678_101021335 Ga0070678_1010213351 150
849 2124908027 MRS2a_Contig_1014 MRS2a_00040110 151
850 2124908027 MRS2a_Contig_772 MRS2a_00629170 151
851 2162886007 SwRhRL2b_contig_3165809 SwRhRL2b_0271.00002100 151
852 3300001915 JGI24741J21665_1001298 JGI24741J21665_10012983 151
853 3300001990 JGI24737J22298_10060107 JGI24737J22298_100601073 151
854 3300002737 JGI25162J39368_1002064 JGI25162J39368_10020645 151
855 3300002738 JGI25154J39366_1006179 JGI25154J39366_10061792 151
856 3300002771 JGI25163J39215_1005917 JGI25163J39215_10059172 151
857 3300002772 JGI25164J39214_1001004 JGI25164J39214_10010045 151
858 3300002772 JGI25164J39214_1001279 JGI25164J39214_10012796 151
859 3300003214 JGI25165J46597_1001843 JGI25165J46597_10018435 151
860 3300003214 JGI25165J46597_1001871 JGI25165J46597_10018714 151
861 3300003751 Ga0055538_1000012 Ga0055538_1000012268 151
862 3300003752 Ga0055539_1000017 Ga0055539_1000017268 151
863 3300003756 Ga0055533_1000021 Ga0055533_1000021268 151
864 3300003758 Ga0055532_1000119 Ga0055532_100011958 151
865 3300003759 Ga0055525_1000078 Ga0055525_1000078140 151
866 3300003781 Ga0055536_1001878 Ga0055536_10018784 151
867 3300003781 Ga0055536_1015916 Ga0055536_10159162 151
868 3300003781 Ga0055536_1016356 Ga0055536_10163562 151
869 3300003781 Ga0055536_1018125 Ga0055536_10181253 151
870 3300003791 Ga0055530_10002438 Ga0055530_100024389 151
871 3300003791 Ga0055530_10004784 Ga0055530_100047846 151
872 3300003791 Ga0055530_10005023 Ga0055530_100050233 151
873 3300003791 Ga0055530_10020556 Ga0055530_100205562 151
874 3300003792 Ga0055540_1004056 Ga0055540_10040566 151
875 3300003792 Ga0055540_1004284 Ga0055540_10042843 151
876 3300003792 Ga0055540_1005786 Ga0055540_10057862 151
877 3300003794 Ga0055531_10001137 Ga0055531_1000113719 151
878 3300003794 Ga0055531_10033391 Ga0055531_100333912 151
879 3300003841 Ga0055541_1000012 Ga0055541_1000012268 151
880 3300003856 Ga0058692_1010460 Ga0058692_10104603 151
881 3300005288 Ga0065714_10003175 Ga0065714_100031755 151
882 3300005288 Ga0065714_10004868 Ga0065714_100048684 151
883 3300005288 Ga0065714_10005207 Ga0065714_100052072 151
884 3300005288 Ga0065714_10009160 Ga0065714_100091601 151
885 3300005288 Ga0065714_10009607 Ga0065714_100096074 151
886 3300005288 Ga0065714_10011643 Ga0065714_100116432 151
887 3300005288 Ga0065714_10015892 Ga0065714_100158921 151
888 3300005288 Ga0065714_10023761 Ga0065714_100237611 151
889 3300005288 Ga0065714_10098776 Ga0065714_100987761 151
890 3300005288 Ga0065714_10131594 Ga0065714_101315941 151
891 3300005288 Ga0065714_10287392 Ga0065714_102873921 151
892 3300005289 Ga0065704_10005330 Ga0065704_100053303 151
893 3300005289 Ga0065704_10026003 Ga0065704_100260032 151
894 3300005289 Ga0065704_10141314 Ga0065704_101413142 151
895 3300005289 Ga0065704_10309346 Ga0065704_103093461 151
896 3300005289 Ga0065704_10717670 Ga0065704_107176701 151
897 3300005290 Ga0065712_10000996 Ga0065712_100009963 151
898 3300005290 Ga0065712_10067862 Ga0065712_100678624 151
899 3300005293 Ga0065715_10009373 Ga0065715_100093733 151
900 3300005329 Ga0070683_102276832 Ga0070683_1022768321 151
901 3300005331 Ga0070670_100016361 Ga0070670_1000163614 151
902 3300005331 Ga0070670_100088585 Ga0070670_1000885854 151
903 3300005334 Ga0068869_100636661 Ga0068869_1006366612 151
904 3300005339 Ga0070660_100236784 Ga0070660_1002367842 151
905 3300005344 Ga0070661_100001250 Ga0070661_10000125016 151
906 3300005347 Ga0070668_100466150 Ga0070668_1004661502 151
907 3300005353 Ga0070669_100002433 Ga0070669_1000024331 151
908 3300005353 Ga0070669_100003104 Ga0070669_1000031044 151
909 3300005353 Ga0070669_100022656 Ga0070669_1000226562 151
910 3300005366 Ga0070659_100142285 Ga0070659_1001422852 151
911 3300005457 Ga0070662_100000829 Ga0070662_1000008294 151
912 3300005457 Ga0070662_100013692 Ga0070662_1000136924 151
913 3300005457 Ga0070662_100927868 Ga0070662_1009278682 151
914 3300005530 Ga0070679_100342252 Ga0070679_1003422522 151
915 3300005539 Ga0068853_100000031 Ga0068853_10000003150 151
916 3300005548 Ga0070665_100059460 Ga0070665_1000594602 151
917 3300005548 Ga0070665_100124423 Ga0070665_1001244232 151
918 3300005548 Ga0070665_100291021 Ga0070665_1002910212 151
919 3300005548 Ga0070665_100675342 Ga0070665_1006753422 151
920 3300005548 Ga0070665_101020082 Ga0070665_1010200821 151
921 3300005563 Ga0068855_100077352 Ga0068855_1000773524 151
922 3300005564 Ga0070664_100001524 Ga0070664_1000015244 151
923 3300005578 Ga0068854_100013592 Ga0068854_1000135924 151
924 3300005614 Ga0068856_100045082 Ga0068856_1000450822 151
925 3300005616 Ga0068852_100016998 Ga0068852_1000169982 151
926 3300005617 Ga0068859_100018254 Ga0068859_1000182546 151
927 3300005834 Ga0068851_10000007 Ga0068851_10000007179 151
928 3300005841 Ga0068863_100025309 Ga0068863_1000253092 151
929 3300006038 Ga0075365_10000743 Ga0075365_100007433 151
930 3300006038 Ga0075365_10106132 Ga0075365_101061322 151
931 3300006048 Ga0075363_100184208 Ga0075363_1001842082 151
932 3300006051 Ga0075364_10017430 Ga0075364_100174302 151
933 3300006051 Ga0075364_10038491 Ga0075364_100384914 151
934 3300006051 Ga0075364_10124551 Ga0075364_101245512 151
935 3300006051 Ga0075364_10498566 Ga0075364_104985661 151
936 3300006051 Ga0075364_10816516 Ga0075364_108165161 151
937 3300006058 Ga0075432_10015325 Ga0075432_100153254 151
938 3300006058 Ga0075432_10029537 Ga0075432_100295372 151
939 3300006058 Ga0075432_10033375 Ga0075432_100333753 151
940 3300006058 Ga0075432_10067101 Ga0075432_100671012 151
941 3300006058 Ga0075432_10191120 Ga0075432_101911201 151
942 3300006058 Ga0075432_10294525 Ga0075432_102945251 151
943 3300006177 Ga0075362_10069996 Ga0075362_100699961 151
944 3300006178 Ga0075367_10002366 Ga0075367_100023663 151
945 3300006178 Ga0075367_10286879 Ga0075367_102868792 151
946 3300006178 Ga0075367_10451170 Ga0075367_104511701 151
947 3300006186 Ga0075369_10001094 Ga0075369_100010946 151
948 3300006186 Ga0075369_10184425 Ga0075369_101844251 151
949 3300006194 Ga0075427_10000019 Ga0075427_100000191 151
950 3300006195 Ga0075366_10298341 Ga0075366_102983412 151
951 3300006237 Ga0097621_101038863 Ga0097621_1010388632 151
952 3300006353 Ga0075370_10017763 Ga0075370_100177633 151
953 3300006358 Ga0068871_100107957 Ga0068871_1001079572 151
954 3300006871 Ga0075434_101843405 Ga0075434_1018434051 151
955 3300006880 Ga0075429_100010636 Ga0075429_1000106363 151
956 3300006881 Ga0068865_100786334 Ga0068865_1007863342 151
957 3300006914 Ga0075436_100188367 Ga0075436_1001883672 151
958 3300006914 Ga0075436_101095196 Ga0075436_1010951962 151
959 3300006931 Ga0097620_100018254 Ga0097620_1000182546 151
960 3300006944 Ga0099823_1020334 Ga0099823_10203343 151
961 3300006946 Ga0079104_1000886 Ga0079104_100088621 151
962 3300006946 Ga0079104_1002975 Ga0079104_10029754 151
963 3300006946 Ga0079104_1104169 Ga0079104_11041691 151
964 3300006948 Ga0099826_10008314 Ga0099826_100083144 151
965 3300009011 Ga0105251_10000089 Ga0105251_1000008977 151
966 3300009011 Ga0105251_10006466 Ga0105251_100064664 151
967 3300009011 Ga0105251_10008076 Ga0105251_100080764 151
968 3300009011 Ga0105251_10014857 Ga0105251_100148573 151
969 3300009011 Ga0105251_10017646 Ga0105251_100176461 151
970 3300009011 Ga0105251_10033069 Ga0105251_100330692 151
971 3300009011 Ga0105251_10035071 Ga0105251_100350712 151
972 3300009011 Ga0105251_10059218 Ga0105251_100592182 151
973 3300009011 Ga0105251_10336160 Ga0105251_103361602 151
974 3300009011 Ga0105251_10378634 Ga0105251_103786342 151
975 3300009011 Ga0105251_10430314 Ga0105251_104303142 151
976 3300009036 Ga0105244_10000196 Ga0105244_1000019660 151
977 3300009036 Ga0105244_10005963 Ga0105244_100059634 151
978 3300009036 Ga0105244_10011172 Ga0105244_100111724 151
979 3300009036 Ga0105244_10027606 Ga0105244_100276062 151
980 3300009036 Ga0105244_10041570 Ga0105244_100415702 151
981 3300009036 Ga0105244_10060997 Ga0105244_100609971 151
982 3300009036 Ga0105244_10061037 Ga0105244_100610371 151
983 3300009036 Ga0105244_10065517 Ga0105244_100655172 151
984 3300009036 Ga0105244_10097606 Ga0105244_100976062 151
985 3300009036 Ga0105244_10144840 Ga0105244_101448402 151
986 3300009036 Ga0105244_10246856 Ga0105244_102468561 151
987 3300009092 Ga0105250_10001996 Ga0105250_100019963 151
988 3300009092 Ga0105250_10004445 Ga0105250_100044453 151
989 3300009092 Ga0105250_10024530 Ga0105250_100245303 151
990 3300009092 Ga0105250_10033320 Ga0105250_100333202 151
991 3300009092 Ga0105250_10042488 Ga0105250_100424881 151
992 3300009092 Ga0105250_10085431 Ga0105250_100854312 151
993 3300009092 Ga0105250_10129468 Ga0105250_101294682 151
994 3300009092 Ga0105250_10145565 Ga0105250_101455651 151
995 3300009092 Ga0105250_10357028 Ga0105250_103570282 151
996 3300009093 Ga0105240_10000196 Ga0105240_1000019627 151
997 3300009094 Ga0111539_11074799 Ga0111539_110747991 151
998 3300009148 Ga0105243_10001894 Ga0105243_1000189416 151
999 3300009148 Ga0105243_10003861 Ga0105243_1000386110 151
1000 3300009148 Ga0105243_10006988 Ga0105243_100069888 151
1001 3300009148 Ga0105243_10016847 Ga0105243_100168474 151
1002 3300009148 Ga0105243_10066246 Ga0105243_100662462 151
1003 3300009148 Ga0105243_10161863 Ga0105243_101618632 151
1004 3300009148 Ga0105243_10275276 Ga0105243_102752762 151
1005 3300009176 Ga0105242_10000836 Ga0105242_1000083616 151
1006 3300009176 Ga0105242_10238879 Ga0105242_102388793 151
1007 3300009176 Ga0105242_11602830 Ga0105242_116028301 151
1008 3300009177 Ga0105248_10001345 Ga0105248_100013458 151
1009 3300009545 Ga0105237_10020421 Ga0105237_100204213 151
1010 3300009545 Ga0105237_10331750 Ga0105237_103317502 151
1011 3300009545 Ga0105237_10372931 Ga0105237_103729312 151
1012 3300009551 Ga0105238_10006772 Ga0105238_1000677210 151
1013 3300009551 Ga0105238_11536362 Ga0105238_115363622 151
1014 3300010375 Ga0105239_10003927 Ga0105239_100039278 151
1015 3300010375 Ga0105239_10649836 Ga0105239_106498361 151
1016 3300011119 Ga0105246_10005173 Ga0105246_100051735 151
1017 3300011119 Ga0105246_10011634 Ga0105246_100116344 151
1018 3300011119 Ga0105246_10014367 Ga0105246_100143674 151
1019 3300011119 Ga0105246_10018086 Ga0105246_100180864 151
1020 3300011119 Ga0105246_10371024 Ga0105246_103710242 151
1021 3300012498 Ga0157345_1032913 Ga0157345_10329131 151
1022 3300013100 Ga0157373_10018807 Ga0157373_100188072 151
1023 3300013100 Ga0157373_10066274 Ga0157373_100662742 151
1024 3300013100 Ga0157373_10088195 Ga0157373_100881952 151
1025 3300013100 Ga0157373_10430524 Ga0157373_104305242 151
1026 3300013100 Ga0157373_10505974 Ga0157373_105059742 151
1027 3300013100 Ga0157373_10576649 Ga0157373_105766492 151
1028 3300013102 Ga0157371_10000109 Ga0157371_1000010930 151
1029 3300013102 Ga0157371_10008603 Ga0157371_100086035 151
1030 3300013102 Ga0157371_10045024 Ga0157371_100450242 151
1031 3300013102 Ga0157371_10234453 Ga0157371_102344532 151
1032 3300013104 Ga0157370_10007852 Ga0157370_100078524 151
1033 3300013104 Ga0157370_10116418 Ga0157370_101164183 151
1034 3300013104 Ga0157370_10134274 Ga0157370_101342742 151
1035 3300013104 Ga0157370_10323710 Ga0157370_103237101 151
1036 3300013104 Ga0157370_10359664 Ga0157370_103596643 151
1037 3300013104 Ga0157370_10371228 Ga0157370_103712282 151
1038 3300013104 Ga0157370_10953585 Ga0157370_109535851 151
1039 3300013105 Ga0157369_10478494 Ga0157369_104784942 151
1040 3300013105 Ga0157369_10703299 Ga0157369_107032991 151
1041 3300013297 Ga0157378_10000149 Ga0157378_1000014952 151
1042 3300013297 Ga0157378_10370848 Ga0157378_103708482 151
1043 3300013297 Ga0157378_11139984 Ga0157378_111399841 151
1044 3300013306 Ga0163162_10013294 Ga0163162_100132945 151
1045 3300013306 Ga0163162_10608873 Ga0163162_106088731 151
1046 3300013308 Ga0157375_10780112 Ga0157375_107801122 151
1047 3300014497 Ga0182008_10004134 Ga0182008_100041344 151
1048 3300014497 Ga0182008_10006124 Ga0182008_100061244 151
1049 3300014497 Ga0182008_10039089 Ga0182008_100390892 151
1050 3300014497 Ga0182008_10059379 Ga0182008_100593793 151
1051 3300014497 Ga0182008_10156555 Ga0182008_101565552 151
1052 3300014497 Ga0182008_10484950 Ga0182008_104849502 151
1053 3300014969 Ga0157376_10094787 Ga0157376_100947872 151
1054 3300015261 Ga0182006_1002773 Ga0182006_10027734 151
1055 3300015261 Ga0182006_1005056 Ga0182006_10050563 151
1056 3300015261 Ga0182006_1006299 Ga0182006_10062994 151
1057 3300015261 Ga0182006_1009996 Ga0182006_10099963 151
1058 3300015261 Ga0182006_1029087 Ga0182006_10290872 151
1059 3300015261 Ga0182006_1033525 Ga0182006_10335253 151
1060 3300015261 Ga0182006_1046029 Ga0182006_10460292 151
1061 3300015261 Ga0182006_1064534 Ga0182006_10645341 151
1062 3300015261 Ga0182006_1083909 Ga0182006_10839092 151
1063 3300015262 Ga0182007_10003930 Ga0182007_100039305 151
1064 3300015262 Ga0182007_10418662 Ga0182007_104186621 151
1065 3300015265 Ga0182005_1002649 Ga0182005_10026493 151
1066 3300015265 Ga0182005_1044755 Ga0182005_10447552 151
1067 3300017792 Ga0163161_10034169 Ga0163161_100341693 151
1068 3300017792 Ga0163161_10065983 Ga0163161_100659832 151
1069 3300017792 Ga0163161_11676332 Ga0163161_116763322 151
1070 3300017792 Ga0163161_11770748 Ga0163161_117707482 151
1071 3300021384 Ga0213876_10017706 Ga0213876_100177062 151
1072 3300021384 Ga0213876_10161765 Ga0213876_101617652 151
1073 3300025206 Ga0209435_102395 Ga0209435_1023952 151
1074 3300025207 Ga0209760_100253 Ga0209760_1002533 151
1075 3300025207 Ga0209760_100420 Ga0209760_1004208 151
1076 3300025224 Ga0209784_100007 Ga0209784_100007266 151
1077 3300025225 Ga0209566_100009 Ga0209566_100009266 151
1078 3300025226 Ga0209674_100021 Ga0209674_100021266 151
1079 3300025229 Ga0209147_100009 Ga0209147_100009266 151
1080 3300025230 Ga0209563_100018 Ga0209563_100018266 151
1081 3300025231 Ga0207427_100005 Ga0207427_100005448 151
1082 3300025231 Ga0207427_100006 Ga0207427_100006325 151
1083 3300025233 Ga0209437_100013 Ga0209437_100013325 151
1084 3300025233 Ga0209437_100018 Ga0209437_100018358 151
1085 3300025242 Ga0209258_100249 Ga0209258_10024939 151
1086 3300025246 Ga0209646_1000298 Ga0209646_100029821 151
1087 3300025253 Ga0209677_100012 Ga0209677_100012266 151
1088 3300025256 Ga0209759_1014362 Ga0209759_10143622 151
1089 3300025256 Ga0209759_1015841 Ga0209759_10158412 151
1090 3300025261 Ga0209233_1000021 Ga0209233_1000021448 151
1091 3300025261 Ga0209233_1000022 Ga0209233_1000022325 151
1092 3300025291 Ga0209675_1032780 Ga0209675_10327802 151
1093 3300025292 Ga0209676_1000015 Ga0209676_1000015293 151
1094 3300025292 Ga0209676_1000030 Ga0209676_1000030392 151
1095 3300025292 Ga0209676_1000041 Ga0209676_100004154 151
1096 3300025292 Ga0209676_1001510 Ga0209676_100151015 151
1097 3300025292 Ga0209676_1009214 Ga0209676_10092144 151
1098 3300025292 Ga0209676_1021084 Ga0209676_10210842 151
1099 3300025298 Ga0209050_1000024 Ga0209050_100002448 151
1100 3300025298 Ga0209050_1000030 Ga0209050_1000030145 151
1101 3300025298 Ga0209050_1000332 Ga0209050_100033286 151
1102 3300025298 Ga0209050_1002018 Ga0209050_100201811 151
1103 3300025303 Ga0209051_1000012 Ga0209051_1000012386 151
1104 3300025303 Ga0209051_1000426 Ga0209051_10004264 151
1105 3300025303 Ga0209051_1000719 Ga0209051_10007194 151
1106 3300025304 Ga0209257_1000262 Ga0209257_100026240 151
1107 3300025304 Ga0209257_1004152 Ga0209257_100415211 151
1108 3300025321 Ga0207656_10000015 Ga0207656_1000001552 151
1109 3300025711 Ga0207696_1000055 Ga0207696_100005510 151
1110 3300025711 Ga0207696_1000078 Ga0207696_1000078143 151
1111 3300025711 Ga0207696_1000080 Ga0207696_100008032 151
1112 3300025711 Ga0207696_1000204 Ga0207696_100020483 151
1113 3300025711 Ga0207696_1003242 Ga0207696_10032424 151
1114 3300025711 Ga0207696_1003560 Ga0207696_10035603 151
1115 3300025711 Ga0207696_1004230 Ga0207696_10042305 151
1116 3300025711 Ga0207696_1006665 Ga0207696_10066652 151
1117 3300025711 Ga0207696_1009586 Ga0207696_10095862 151
1118 3300025711 Ga0207696_1022512 Ga0207696_10225122 151
1119 3300025711 Ga0207696_1026800 Ga0207696_10268002 151
1120 3300025728 Ga0207655_1000033 Ga0207655_1000033196 151
1121 3300025728 Ga0207655_1000747 Ga0207655_100074732 151
1122 3300025728 Ga0207655_1001006 Ga0207655_10010064 151
1123 3300025728 Ga0207655_1001169 Ga0207655_100116910 151
1124 3300025728 Ga0207655_1002470 Ga0207655_10024705 151
1125 3300025728 Ga0207655_1004567 Ga0207655_10045679 151
1126 3300025728 Ga0207655_1010154 Ga0207655_10101542 151
1127 3300025728 Ga0207655_1013075 Ga0207655_10130752 151
1128 3300025728 Ga0207655_1015746 Ga0207655_10157464 151
1129 3300025728 Ga0207655_1030164 Ga0207655_10301642 151
1130 3300025728 Ga0207655_1030991 Ga0207655_10309912 151
1131 3300025728 Ga0207655_1033456 Ga0207655_10334562 151
1132 3300025728 Ga0207655_1043386 Ga0207655_10433861 151
1133 3300025728 Ga0207655_1060285 Ga0207655_10602851 151
1134 3300025728 Ga0207655_1158180 Ga0207655_11581801 151
1135 3300025735 Ga0207713_1000010 Ga0207713_1000010362 151
1136 3300025735 Ga0207713_1000079 Ga0207713_100007931 151
1137 3300025735 Ga0207713_1000249 Ga0207713_100024915 151
1138 3300025735 Ga0207713_1000835 Ga0207713_10008352 151
1139 3300025735 Ga0207713_1001826 Ga0207713_100182614 151
1140 3300025735 Ga0207713_1004136 Ga0207713_10041369 151
1141 3300025735 Ga0207713_1006432 Ga0207713_10064327 151
1142 3300025735 Ga0207713_1009068 Ga0207713_10090684 151
1143 3300025735 Ga0207713_1011139 Ga0207713_10111392 151
1144 3300025735 Ga0207713_1013995 Ga0207713_10139952 151
1145 3300025735 Ga0207713_1015441 Ga0207713_10154411 151
1146 3300025735 Ga0207713_1025592 Ga0207713_10255922 151
1147 3300025735 Ga0207713_1028855 Ga0207713_10288553 151
1148 3300025735 Ga0207713_1041623 Ga0207713_10416232 151
1149 3300025735 Ga0207713_1043475 Ga0207713_10434752 151
1150 3300025913 Ga0207695_10001140 Ga0207695_1000114027 151
1151 3300025914 Ga0207671_10000027 Ga0207671_10000027195 151
1152 3300025914 Ga0207671_10393346 Ga0207671_103933462 151
1153 3300025920 Ga0207649_10000012 Ga0207649_10000012231 151
1154 3300025923 Ga0207681_10000138 Ga0207681_1000013858 151
1155 3300025923 Ga0207681_10000600 Ga0207681_1000060021 151
1156 3300025924 Ga0207694_10009484 Ga0207694_100094842 151
1157 3300025924 Ga0207694_11362370 Ga0207694_113623701 151
1158 3300025925 Ga0207650_10002879 Ga0207650_100028794 151
1159 3300025925 Ga0207650_10006459 Ga0207650_100064594 151
1160 3300025929 Ga0207664_10961499 Ga0207664_109614992 151
1161 3300025933 Ga0207706_10000212 Ga0207706_1000021250 151
1162 3300025933 Ga0207706_10021663 Ga0207706_100216634 151
1163 3300025934 Ga0207686_10002895 Ga0207686_100028954 151
1164 3300025934 Ga0207686_10050269 Ga0207686_100502692 151
1165 3300025935 Ga0207709_10000061 Ga0207709_10000061149 151
1166 3300025935 Ga0207709_10000063 Ga0207709_10000063169 151
1167 3300025935 Ga0207709_10009197 Ga0207709_100091974 151
1168 3300025935 Ga0207709_10196712 Ga0207709_101967122 151
1169 3300025935 Ga0207709_10397646 Ga0207709_103976462 151
1170 3300025935 Ga0207709_10731814 Ga0207709_107318142 151
1171 3300025941 Ga0207711_10004604 Ga0207711_100046042 151
1172 3300025945 Ga0207679_10000015 Ga0207679_10000015231 151
1173 3300025981 Ga0207640_10005762 Ga0207640_100057627 151
1174 3300026041 Ga0207639_10000157 Ga0207639_1000015745 151
1175 3300026078 Ga0207702_10077491 Ga0207702_100774912 151
1176 3300026088 Ga0207641_10019492 Ga0207641_100194922 151
1177 3300026142 Ga0207698_10065350 Ga0207698_100653502 151
1178 3300026142 Ga0207698_11975219 Ga0207698_119752191 151
1179 3300027111 Ga0209281_1000016 Ga0209281_1000016425 151
1180 3300027111 Ga0209281_1000019 Ga0209281_1000019103 151
1181 3300027296 Ga0209389_1000036 Ga0209389_10000367 151
1182 3300027296 Ga0209389_1053487 Ga0209389_10534872 151
1183 3300027312 Ga0209371_1000066 Ga0209371_100006684 151
1184 3300027312 Ga0209371_1000176 Ga0209371_100017612 151
1185 3300027312 Ga0209371_1050371 Ga0209371_10503712 151
1186 3300027378 Ga0209981_1057055 Ga0209981_10570552 151
1187 3300027552 Ga0209982_1025188 Ga0209982_10251882 151
1188 3300027666 Ga0209282_1041143 Ga0209282_10411432 151
1189 3300027907 Ga0207428_10043067 Ga0207428_100430673 151
1190 3300027907 Ga0207428_10081024 Ga0207428_100810242 151
1191 3300027907 Ga0207428_10112702 Ga0207428_101127021 151
1192 3300027907 Ga0207428_10114852 Ga0207428_101148522 151
1193 3300027907 Ga0207428_10123955 Ga0207428_101239552 151
1194 3300027907 Ga0207428_10291376 Ga0207428_102913763 151
1195 3300027907 Ga0207428_10569920 Ga0207428_105699201 151
1196 3300028379 Ga0268266_10038288 Ga0268266_100382884 151
1197 3300028379 Ga0268266_10123433 Ga0268266_101234332 151
1198 3300028379 Ga0268266_10242278 Ga0268266_102422782 151
1199 3300028794 Ga0307515_10550453 Ga0307515_105504532 151
1200 3300030500 Ga0268256_1000063 Ga0268256_100006384 151
1201 3300030500 Ga0268256_1000146 Ga0268256_100014688 151
1202 3300030500 Ga0268256_1056659 Ga0268256_10566592 151
1203 3300030731 Ga0316177_1180876 Ga0316177_11808762 151
1204 3300030733 Ga0314311_1105640 Ga0314311_11056402 151
1205 3300030734 Ga0316179_1011771 Ga0316179_10117712 151
1206 3300030735 Ga0316178_1047147 Ga0316178_10471476 151
1207 3300030742 Ga0316183_1205730 Ga0316183_12057302 151
1208 3300030744 Ga0316181_1009360 Ga0316181_10093602 151
1209 3300030744 Ga0316181_1063849 Ga0316181_10638492 151
1210 3300030745 Ga0316182_1043997 Ga0316182_10439972 151
1211 3300030745 Ga0316182_1106649 Ga0316182_11066491 151
1212 3300031507 Ga0307509_10221193 Ga0307509_102211931 151
1213 3300031548 Ga0307408_100000019 Ga0307408_100000019272 151
1214 3300031548 Ga0307408_100015060 Ga0307408_1000150604 151
1215 3300031548 Ga0307408_100020747 Ga0307408_1000207474 151
1216 3300031548 Ga0307408_100103834 Ga0307408_1001038342 151
1217 3300031548 Ga0307408_100302681 Ga0307408_1003026812 151
1218 3300031548 Ga0307408_100448109 Ga0307408_1004481091 151
1219 3300031665 Ga0316575_10007778 Ga0316575_100077782 151
1220 3300031727 Ga0316576_10092090 Ga0316576_100920902 151
1221 3300031727 Ga0316576_10229401 Ga0316576_102294012 151
1222 3300031730 Ga0307516_10014174 Ga0307516_100141744 151
1223 3300031731 Ga0307405_10055662 Ga0307405_100556622 151
1224 3300031731 Ga0307405_10399412 Ga0307405_103994122 151
1225 3300031824 Ga0307413_10018385 Ga0307413_100183853 151
1226 3300031901 Ga0307406_10011531 Ga0307406_100115312 151
1227 3300031911 Ga0307412_10011436 Ga0307412_100114364 151
1228 3300031911 Ga0307412_10101173 Ga0307412_101011732 151
1229 3300031911 Ga0307412_10106150 Ga0307412_101061502 151
1230 3300031911 Ga0307412_10154122 Ga0307412_101541221 151
1231 3300031911 Ga0307412_10208085 Ga0307412_102080852 151
1232 3300032002 Ga0307416_100525906 Ga0307416_1005259062 151
1233 3300032004 Ga0307414_10037403 Ga0307414_100374032 151
1234 3300032004 Ga0307414_10811857 Ga0307414_108118572 151
1235 3300032005 Ga0307411_10055706 Ga0307411_100557062 151
1236 3300035398 Ga0316574_0016948 Ga0316574_0016948_1823_2278 151
1237 3300039062 Ga0400483_049425 Ga0400483_049425_965_1420 151
1238 3300039062 Ga0400483_289198 Ga0400483_289198_1178_1633 151
1239 3300039437 Ga0436365_0472641 Ga0436365_0472641_1062_1517 151
1240 3300041404 Ga0439436_0000393 Ga0439436_0000393_10089_10544 151
1241 3300041405 Ga0439438_009014 Ga0439438_009014_778_1233 151
1242 3300041405 Ga0439438_010619 Ga0439438_010619_791_1246 151
1243 3300041405 Ga0439438_014427 Ga0439438_014427_1420_1875 151
1244 3300041405 Ga0439438_022379 Ga0439438_022379_586_1041 151
1245 3300041405 Ga0439438_029248 Ga0439438_029248_802_1257 151
1246 3300041405 Ga0439438_032917 Ga0439438_032917_643_1098 151
1247 3300041405 Ga0439438_052485 Ga0439438_052485_96_551 151
1248 3300041407 Ga0439447_003796 Ga0439447_003796_4105_4560 151
1249 3300041407 Ga0439447_003942 Ga0439447_003942_3841_4296 151
1250 3300041407 Ga0439447_005384 Ga0439447_005384_631_1086 151
1251 3300041407 Ga0439447_008473 Ga0439447_008473_2247_2702 151
1252 3300041407 Ga0439447_010053 Ga0439447_010053_101_556 151
1253 3300041407 Ga0439447_017695 Ga0439447_017695_707_1162 151
1254 3300041407 Ga0439447_029161 Ga0439447_029161_877_1332 151
1255 3300041411 Ga0439466_0003240 Ga0439466_0003240_1806_2261 151
1256 3300041411 Ga0439466_0004304 Ga0439466_0004304_921_1376 151
1257 3300041411 Ga0439466_0012701 Ga0439466_0012701_1967_2422 151
1258 3300041411 Ga0439466_0012798 Ga0439466_0012798_1847_2302 151
1259 3300041411 Ga0439466_0032523 Ga0439466_0032523_530_985 151
1260 3300041411 Ga0439466_0033462 Ga0439466_0033462_660_1115 151
1261 3300041411 Ga0439466_0057805 Ga0439466_0057805_71_526 151
1262 3300041512 Ga0451853_3468156 Ga0451853_3468156_99_554 151
1263 3300041512 Ga0451853_3963367 Ga0451853_3963367_367_822 151
1264 3300041997 Ga0439431_0008002 Ga0439431_0008002_1768_2223 151
1265 3300041997 Ga0439431_0036530 Ga0439431_0036530_651_1106 151
1266 3300042000 Ga0439437_000037 Ga0439437_000037_2205_2660 151
1267 3300042004 Ga0439445_0087885 Ga0439445_0087885_125_580 151
1268 3300042004 Ga0439445_0108898 Ga0439445_0108898_134_589 151
1269 3300042006 Ga0439432_001648 Ga0439432_001648_4651_5106 151
1270 3300042006 Ga0439432_004015 Ga0439432_004015_778_1233 151
1271 3300042006 Ga0439432_010565 Ga0439432_010565_2053_2508 151
1272 3300042006 Ga0439432_016837 Ga0439432_016837_591_1046 151
1273 3300042006 Ga0439432_027276 Ga0439432_027276_1385_1840 151
1274 3300042006 Ga0439432_080105 Ga0439432_080105_35_490 151
1275 3300042006 Ga0439432_099946 Ga0439432_099946_48_503 151
1276 3300042009 Ga0439451_008918 Ga0439451_008918_1491_1946 151
1277 3300042009 Ga0439451_011530 Ga0439451_011530_1072_1527 151
1278 3300042009 Ga0439451_014175 Ga0439451_014175_683_1138 151
1279 3300042009 Ga0439451_018064 Ga0439451_018064_935_1390 151
1280 3300042009 Ga0439451_024145 Ga0439451_024145_16_471 151
1281 3300042009 Ga0439451_051377 Ga0439451_051377_276_731 151
1282 3300042010 Ga0439452_000645 Ga0439452_000645_9977_10432 151
1283 3300042010 Ga0439452_003726 Ga0439452_003726_669_1124 151
1284 3300042010 Ga0439452_004217 Ga0439452_004217_3844_4299 151
1285 3300042010 Ga0439452_005024 Ga0439452_005024_2955_3410 151
1286 3300042010 Ga0439452_012662 Ga0439452_012662_1847_2302 151
1287 3300042010 Ga0439452_016934 Ga0439452_016934_1460_1915 151
1288 3300042010 Ga0439452_021055 Ga0439452_021055_1235_1690 151
1289 3300042010 Ga0439452_039019 Ga0439452_039019_274_729 151
1290 3300042010 Ga0439452_039530 Ga0439452_039530_109_564 151
1291 3300042010 Ga0439452_047649 Ga0439452_047649_27_482 151
1292 3300042013 Ga0439456_000220 Ga0439456_000220_6017_6472 151
1293 3300042013 Ga0439456_026056 Ga0439456_026056_28_483 151
1294 3300042013 Ga0439456_029960 Ga0439456_029960_550_1005 151
1295 3300042013 Ga0439456_041550 Ga0439456_041550_242_697 151
1296 3300042016 Ga0439463_003695 Ga0439463_003695_1129_1584 151
1297 3300042016 Ga0439463_021653 Ga0439463_021653_17_472 151
1298 3300042016 Ga0439463_078827 Ga0439463_078827_29_484 151
1299 3300042115 Ga0450911_000011 Ga0450911_000011_56694_57149 151
1300 3300042115 Ga0450911_005568 Ga0450911_005568_826_1281 151
1301 3300042121 Ga0450919_002799 Ga0450919_002799_630_1085 151
1302 3300042124 Ga0450922_001722 Ga0450922_001722_850_1305 151
1303 3300042127 Ga0450890_009580 Ga0450890_009580_626_1081 151
1304 3300042130 Ga0450892_019568 Ga0450892_019568_35_490 151
1305 3300042136 Ga0450900_002826 Ga0450900_002826_138_593 151
1306 3300042136 Ga0450900_024938 Ga0450900_024938_16_471 151
1307 3300042137 Ga0450902_004902 Ga0450902_004902_770_1225 151
1308 3300042137 Ga0450902_026388 Ga0450902_026388_258_713 151
1309 3300042139 Ga0450904_000254 Ga0450904_000254_8666_9121 151
1310 3300042139 Ga0450904_004804 Ga0450904_004804_758_1213 151
1311 3300042139 Ga0450904_011718 Ga0450904_011718_86_541 151
1312 3300042142 Ga0450905_000418 Ga0450905_000418_86_541 151
1313 3300042142 Ga0450905_002843 Ga0450905_002843_1560_2015 151
1314 3300042142 Ga0450905_012866 Ga0450905_012866_150_605 151
1315 3300042142 Ga0450905_016150 Ga0450905_016150_553_1008 151
1316 3300042145 Ga0450906_003770 Ga0450906_003770_1134_1589 151
1317 3300042146 Ga0450907_001318 Ga0450907_001318_4177_4632 151
1318 3300042146 Ga0450907_002543 Ga0450907_002543_927_1382 151
1319 3300042146 Ga0450907_008997 Ga0450907_008997_12_467 151
1320 3300042147 Ga0450910_005072 Ga0450910_005072_599_1054 151
1321 3300042147 Ga0450910_020673 Ga0450910_020673_100_555 151
1322 3300042156 Ga0439446_0017035 Ga0439446_0017035_834_1289 151
1323 3300042156 Ga0439446_0025556 Ga0439446_0025556_106_561 151
1324 3300042156 Ga0439446_0034841 Ga0439446_0034841_97_552 151
1325 3300042156 Ga0439446_0073482 Ga0439446_0073482_413_868 151
1326 3300042184 Ga0450908_008357 Ga0450908_008357_795_1250 151
1327 3300042185 Ga0450909_000439 Ga0450909_000439_784_1239 151
1328 3300042185 Ga0450909_002156 Ga0450909_002156_570_1025 151
1329 3300042185 Ga0450909_011026 Ga0450909_011026_67_522 151
1330 3300042435 Ga0439434_0000506 Ga0439434_0000506_9961_10416 151
1331 3300042435 Ga0439434_0002566 Ga0439434_0002566_4147_4602 151
1332 3300042438 Ga0439459_0002782 Ga0439459_0002782_1593_2048 151
1333 3300042439 Ga0439464_0000312 Ga0439464_0000312_1962_2417 151
1334 3300042439 Ga0439464_0003589 Ga0439464_0003589_2400_2855 151
1335 3300042439 Ga0439464_0008110 Ga0439464_0008110_1999_2454 151
1336 3300042461 Ga0439460_0001605 Ga0439460_0001605_4160_4615 151
1337 3300042461 Ga0439460_0003802 Ga0439460_0003802_2001_2456 151
1338 3300042530 Ga0450916_003515 Ga0450916_003515_372_827 151
1339 3300042533 Ga0450901_018910 Ga0450901_018910_152_607 151
1340 3300042876 Ga0451577_0039597 Ga0451577_0039597_579_1034 151
1341 3300042993 Ga0439440_0015179 Ga0439440_0015179_334_789 151
1342 3300042993 Ga0439440_0030834 Ga0439440_0030834_714_1169 151
1343 3300046452 Ga0495617_004617 Ga0495617_004617_734_1189 151
1344 3300046452 Ga0495617_019844 Ga0495617_019844_803_1258 151
1345 3300046452 Ga0495617_078835 Ga0495617_078835_29_484 151
1346 3300046453 Ga0495627_000095 Ga0495627_000095_66963_67418 151
1347 3300046453 Ga0495627_013285 Ga0495627_013285_379_834 151
1348 3300046453 Ga0495627_014354 Ga0495627_014354_1588_2043 151
1349 3300046453 Ga0495627_120091 Ga0495627_120091_263_718 151
1350 3300046455 Ga0495603_0031080 Ga0495603_0031080_1923_2378 151
1351 3300046455 Ga0495603_0037741 Ga0495603_0037741_1656_2111 151
1352 3300046455 Ga0495603_0897726 Ga0495603_0897726_20_475 151
1353 3300046457 Ga0495590_0070662 Ga0495590_0070662_622_1077 151
1354 3300046458 Ga0495591_000198 Ga0495591_000198_24170_24625 151
1355 3300046458 Ga0495591_003674 Ga0495591_003674_2080_2535 151
1356 3300046458 Ga0495591_003881 Ga0495591_003881_3688_4143 151
1357 3300046458 Ga0495591_004039 Ga0495591_004039_4133_4588 151
1358 3300046458 Ga0495591_007055 Ga0495591_007055_1018_1473 151
1359 3300046458 Ga0495591_039195 Ga0495591_039195_314_769 151
1360 3300046458 Ga0495591_061314 Ga0495591_061314_14_469 151
1361 3300046459 Ga0495629_0016371 Ga0495629_0016371_4080_4535 151
1362 3300046460 Ga0495638_0014264 Ga0495638_0014264_933_1388 151
1363 3300046460 Ga0495638_0034509 Ga0495638_0034509_1356_1811 151
1364 3300046460 Ga0495638_0053799 Ga0495638_0053799_693_1148 151
1365 3300046460 Ga0495638_0164658 Ga0495638_0164658_776_1231 151
1366 3300046460 Ga0495638_0165468 Ga0495638_0165468_773_1228 151
1367 3300046460 Ga0495638_0197824 Ga0495638_0197824_21_476 151
1368 3300046460 Ga0495638_0287268 Ga0495638_0287268_410_865 151
1369 3300046463 Ga0495653_0024315 Ga0495653_0024315_4198_4653 151
1370 3300046471 Ga0495650_0000938 Ga0495650_0000938_4385_4840 151
1371 3300046471 Ga0495650_0005982 Ga0495650_0005982_3173_3628 151
1372 3300046471 Ga0495650_0008522 Ga0495650_0008522_4052_4507 151
1373 3300046471 Ga0495650_0009607 Ga0495650_0009607_4202_4657 151
1374 3300046471 Ga0495650_0079874 Ga0495650_0079874_313_768 151
1375 3300046473 Ga0495582_0025469 Ga0495582_0025469_1989_2444 151
1376 3300046474 Ga0495605_0000019 Ga0495605_0000019_265483_265938 151
1377 3300046474 Ga0495605_0000570 Ga0495605_0000570_24421_24876 151
1378 3300046474 Ga0495605_0003684 Ga0495605_0003684_6241_6696 151
1379 3300046474 Ga0495605_0007838 Ga0495605_0007838_2935_3390 151
1380 3300046474 Ga0495605_0068028 Ga0495605_0068028_125_580 151
1381 3300046474 Ga0495605_0095670 Ga0495605_0095670_765_1220 151
1382 3300046474 Ga0495605_0124855 Ga0495605_0124855_241_696 151
1383 3300046474 Ga0495605_0232126 Ga0495605_0232126_138_593 151
1384 3300046475 Ga0495639_0003531 Ga0495639_0003531_4141_4596 151
1385 3300046475 Ga0495639_0107934 Ga0495639_0107934_834_1289 151
1386 3300046491 Ga0495584_0015687 Ga0495584_0015687_2973_3428 151
1387 3300046491 Ga0495584_0027889 Ga0495584_0027889_1007_1462 151
1388 3300046491 Ga0495584_0124579 Ga0495584_0124579_159_614 151
1389 3300046491 Ga0495584_0241461 Ga0495584_0241461_403_858 151
1390 3300046491 Ga0495584_0264405 Ga0495584_0264405_319_774 151
1391 3300046492 Ga0495585_0006926 Ga0495585_0006926_4083_4538 151
1392 3300046492 Ga0495585_0018550 Ga0495585_0018550_2756_3211 151
1393 3300046492 Ga0495585_0048303 Ga0495585_0048303_803_1258 151
1394 3300046499 Ga0495594_0003155 Ga0495594_0003155_4090_4545 151
1395 3300046499 Ga0495594_0164034 Ga0495594_0164034_289_744 151
1396 3300046500 Ga0495596_0000889 Ga0495596_0000889_2747_3202 151
1397 3300046501 Ga0495607_0003674 Ga0495607_0003674_4042_4497 151
1398 3300046501 Ga0495607_0004336 Ga0495607_0004336_3501_3956 151
1399 3300046501 Ga0495607_0004339 Ga0495607_0004339_3960_4415 151
1400 3300046501 Ga0495607_0005115 Ga0495607_0005115_3940_4395 151
1401 3300046501 Ga0495607_0008664 Ga0495607_0008664_6435_6890 151
1402 3300046501 Ga0495607_0016353 Ga0495607_0016353_703_1158 151
1403 3300046501 Ga0495607_0064442 Ga0495607_0064442_677_1132 151
1404 3300046501 Ga0495607_0071439 Ga0495607_0071439_747_1202 151
1405 3300046501 Ga0495607_0081022 Ga0495607_0081022_1008_1463 151
1406 3300046501 Ga0495607_0092082 Ga0495607_0092082_768_1223 151
1407 3300046501 Ga0495607_0102972 Ga0495607_0102972_1020_1475 151
1408 3300046501 Ga0495607_0140959 Ga0495607_0140959_740_1195 151
1409 3300046501 Ga0495607_0305913 Ga0495607_0305913_263_718 151
1410 3300046506 Ga0495583_0000146 Ga0495583_0000146_4075_4530 151
1411 3300046506 Ga0495583_0004677 Ga0495583_0004677_5086_5541 151
1412 3300046506 Ga0495583_0004736 Ga0495583_0004736_5092_5547 151
1413 3300046506 Ga0495583_0006804 Ga0495583_0006804_2813_3268 151
1414 3300046506 Ga0495583_0084237 Ga0495583_0084237_29_484 151
1415 3300046506 Ga0495583_0237850 Ga0495583_0237850_36_491 151
1416 3300046507 Ga0495606_0000204 Ga0495606_0000204_29030_29485 151
1417 3300046507 Ga0495606_0005284 Ga0495606_0005284_8990_9445 151
1418 3300046507 Ga0495606_0155809 Ga0495606_0155809_861_1316 151
1419 3300046507 Ga0495606_0557283 Ga0495606_0557283_39_494 151
1420 3300046507 Ga0495606_0630603 Ga0495606_0630603_41_496 151
1421 3300046512 Ga0495610_0006827 Ga0495610_0006827_157_612 151
1422 3300046512 Ga0495610_0012418 Ga0495610_0012418_517_972 151
1423 3300046512 Ga0495610_0027938 Ga0495610_0027938_2289_2744 151
1424 3300046512 Ga0495610_0107327 Ga0495610_0107327_20_475 151
1425 3300046513 Ga0495616_0013956 Ga0495616_0013956_1062_1517 151
1426 3300046513 Ga0495616_0032800 Ga0495616_0032800_789_1244 151
1427 3300046513 Ga0495616_0037580 Ga0495616_0037580_1796_2251 151
1428 3300046513 Ga0495616_0111920 Ga0495616_0111920_657_1112 151
1429 3300046513 Ga0495616_0143857 Ga0495616_0143857_23_478 151
1430 3300046513 Ga0495616_0330987 Ga0495616_0330987_46_501 151
1431 3300046515 Ga0495620_0000032 Ga0495620_0000032_39965_40420 151
1432 3300046515 Ga0495620_0000108 Ga0495620_0000108_4098_4553 151
1433 3300046515 Ga0495620_0002361 Ga0495620_0002361_7784_8239 151
1434 3300046515 Ga0495620_0077923 Ga0495620_0077923_24_479 151
1435 3300046515 Ga0495620_0144397 Ga0495620_0144397_162_617 151
1436 3300046517 Ga0495630_0098873 Ga0495630_0098873_845_1300 151
1437 3300046517 Ga0495630_0355872 Ga0495630_0355872_24_479 151
1438 3300046518 Ga0495631_0009636 Ga0495631_0009636_4219_4674 151
1439 3300046518 Ga0495631_0016529 Ga0495631_0016529_1310_1765 151
1440 3300046518 Ga0495631_0050623 Ga0495631_0050623_848_1303 151
1441 3300046518 Ga0495631_0313435 Ga0495631_0313435_61_516 151
1442 3300046519 Ga0495632_0001812 Ga0495632_0001812_1993_2448 151
1443 3300046519 Ga0495632_0004345 Ga0495632_0004345_4097_4552 151
1444 3300046519 Ga0495632_0095293 Ga0495632_0095293_229_684 151
1445 3300046519 Ga0495632_0111449 Ga0495632_0111449_18_473 151
1446 3300046519 Ga0495632_0122792 Ga0495632_0122792_244_699 151
1447 3300046519 Ga0495632_0257871 Ga0495632_0257871_295_750 151
1448 3300046520 Ga0495637_0003861 Ga0495637_0003861_5091_5546 151
1449 3300046520 Ga0495637_0004356 Ga0495637_0004356_4062_4517 151
1450 3300046520 Ga0495637_0005898 Ga0495637_0005898_1663_2118 151
1451 3300046520 Ga0495637_0010699 Ga0495637_0010699_2988_3443 151
1452 3300046520 Ga0495637_0026764 Ga0495637_0026764_22_477 151
1453 3300046520 Ga0495637_0030808 Ga0495637_0030808_361_816 151
1454 3300046520 Ga0495637_0072585 Ga0495637_0072585_863_1318 151
1455 3300046520 Ga0495637_0074567 Ga0495637_0074567_65_520 151
1456 3300046520 Ga0495637_0076287 Ga0495637_0076287_767_1222 151
1457 3300046520 Ga0495637_0079406 Ga0495637_0079406_44_499 151
1458 3300046520 Ga0495637_0170974 Ga0495637_0170974_332_787 151
1459 3300046520 Ga0495637_0278279 Ga0495637_0278279_126_581 151
1460 3300046522 Ga0495643_0000084 Ga0495643_0000084_63296_63751 151
1461 3300046522 Ga0495643_0001486 Ga0495643_0001486_4147_4602 151
1462 3300046522 Ga0495643_0002761 Ga0495643_0002761_279_734 151
1463 3300046522 Ga0495643_0014980 Ga0495643_0014980_2244_2699 151
1464 3300046522 Ga0495643_0016737 Ga0495643_0016737_1288_1743 151
1465 3300046522 Ga0495643_0020764 Ga0495643_0020764_425_880 151
1466 3300046522 Ga0495643_0100420 Ga0495643_0100420_911_1366 151
1467 3300046522 Ga0495643_0153683 Ga0495643_0153683_109_564 151
1468 3300046523 Ga0495644_0269979 Ga0495644_0269979_113_568 151
1469 3300046524 Ga0495648_0001464 Ga0495648_0001464_7871_8326 151
1470 3300046524 Ga0495648_0014109 Ga0495648_0014109_4135_4590 151
1471 3300046524 Ga0495648_0020872 Ga0495648_0020872_121_576 151
1472 3300046524 Ga0495648_0023122 Ga0495648_0023122_914_1369 151
1473 3300046524 Ga0495648_0053541 Ga0495648_0053541_1734_2189 151
1474 3300046524 Ga0495648_0136151 Ga0495648_0136151_657_1112 151
1475 3300046524 Ga0495648_0151296 Ga0495648_0151296_683_1138 151
1476 3300046526 Ga0495666_0008469 Ga0495666_0008469_555_1010 151
1477 3300046528 Ga0495642_0020860 Ga0495642_0020860_1297_1752 151
1478 3300046530 Ga0495654_0006676 Ga0495654_0006676_4065_4520 151
1479 3300046530 Ga0495654_0006980 Ga0495654_0006980_4107_4562 151
1480 3300046530 Ga0495654_0011839 Ga0495654_0011839_4064_4519 151
1481 3300046530 Ga0495654_0040352 Ga0495654_0040352_1251_1706 151
1482 3300046530 Ga0495654_0076875 Ga0495654_0076875_27_482 151
1483 3300046530 Ga0495654_0111249 Ga0495654_0111249_124_579 151
1484 3300046530 Ga0495654_0271266 Ga0495654_0271266_225_680 151
1485 3300046530 Ga0495654_0306917 Ga0495654_0306917_124_579 151
1486 3300046535 Ga0495586_0007706 Ga0495586_0007706_1081_1536 151
1487 3300046536 Ga0495587_0019133 Ga0495587_0019133_86_541 151
1488 3300046536 Ga0495587_0156788 Ga0495587_0156788_805_1260 151
1489 3300046538 Ga0495609_0000098 Ga0495609_0000098_98679_99134 151
1490 3300046538 Ga0495609_0000101 Ga0495609_0000101_4076_4531 151
1491 3300046538 Ga0495609_0003114 Ga0495609_0003114_5128_5583 151
1492 3300046538 Ga0495609_0071160 Ga0495609_0071160_317_772 151
1493 3300046538 Ga0495609_0106506 Ga0495609_0106506_84_539 151
1494 3300046538 Ga0495609_0217313 Ga0495609_0217313_84_539 151
1495 3300046538 Ga0495609_0234257 Ga0495609_0234257_30_485 151
1496 3300046542 Ga0495597_0000033 Ga0495597_0000033_109731_110186 151
1497 3300046542 Ga0495597_0007497 Ga0495597_0007497_988_1443 151
1498 3300046542 Ga0495597_0007724 Ga0495597_0007724_3054_3509 151
1499 3300046542 Ga0495597_0010129 Ga0495597_0010129_920_1375 151
1500 3300046542 Ga0495597_0027103 Ga0495597_0027103_924_1379 151
1501 3300046542 Ga0495597_0032004 Ga0495597_0032004_395_850 151
1502 3300046542 Ga0495597_0112951 Ga0495597_0112951_23_478 151
1503 3300046542 Ga0495597_0168212 Ga0495597_0168212_180_635 151
1504 3300046543 Ga0495645_0059966 Ga0495645_0059966_1849_2304 151
1505 3300046557 Ga0495622_0002902 Ga0495622_0002902_3643_4098 151
1506 3300046557 Ga0495622_0006825 Ga0495622_0006825_3228_3683 151
1507 3300046558 Ga0495633_0000129 Ga0495633_0000129_96288_96743 151
1508 3300046615 Ga0495656_0012623 Ga0495656_0012623_1924_2379 151
1509 3300046616 Ga0495668_0010805 Ga0495668_0010805_926_1381 151
1510 3300046616 Ga0495668_0049935 Ga0495668_0049935_1228_1683 151
1511 3300046616 Ga0495668_0070832 Ga0495668_0070832_847_1302 151
1512 3300046642 Ga0495634_0074625 Ga0495634_0074625_918_1373 151
1513 3300046648 Ga0495611_0000619 Ga0495611_0000619_17105_17560 151
1514 3300046648 Ga0495611_0021168 Ga0495611_0021168_2095_2550 151
1515 3300046660 Ga0495625_0000113 Ga0495625_0000113_4123_4578 151
1516 3300046660 Ga0495625_0045004 Ga0495625_0045004_18_473 151
1517 3300046660 Ga0495625_0176303 Ga0495625_0176303_899_1354 151
1518 3300046660 Ga0495625_0188310 Ga0495625_0188310_168_623 151
1519 3300046660 Ga0495625_0523918 Ga0495625_0523918_144_599 151
1520 3300046663 Ga0495635_0032290 Ga0495635_0032290_1990_2445 151
1521 3300046663 Ga0495635_0212289 Ga0495635_0212289_760_1215 151
1522 3300046664 Ga0495659_0007458 Ga0495659_0007458_1853_2308 151
1523 3300046665 Ga0495661_0000050 Ga0495661_0000050_120807_121262 151
1524 3300046665 Ga0495661_0000196 Ga0495661_0000196_4083_4538 151
1525 3300046665 Ga0495661_0000237 Ga0495661_0000237_4089_4544 151
1526 3300046665 Ga0495661_0000791 Ga0495661_0000791_4103_4558 151
1527 3300046665 Ga0495661_0039015 Ga0495661_0039015_763_1218 151
1528 3300046665 Ga0495661_0143880 Ga0495661_0143880_756_1211 151
1529 3300046674 Ga0495588_0006320 Ga0495588_0006320_4199_4654 151
1530 3300046680 Ga0495646_0134234 Ga0495646_0134234_231_686 151
1531 3300046680 Ga0495646_0211047 Ga0495646_0211047_17_472 151
1532 3300046684 Ga0495669_0006747 Ga0495669_0006747_3913_4368 151
1533 3300046689 Ga0495613_0019320 Ga0495613_0019320_3799_4254 151
1534 3300046691 Ga0495670_0004611 Ga0495670_0004611_2595_3050 151
1535 3300046691 Ga0495670_0029549 Ga0495670_0029549_830_1285 151
1536 3300046691 Ga0495670_0033258 Ga0495670_0033258_734_1189 151
1537 3300046691 Ga0495670_0074612 Ga0495670_0074612_974_1429 151
1538 3300046691 Ga0495670_0091940 Ga0495670_0091940_1040_1495 151
1539 3300046691 Ga0495670_0146646 Ga0495670_0146646_194_649 151
1540 3300046692 Ga0495671_0002273 Ga0495671_0002273_3075_3530 151
1541 3300046692 Ga0495671_0003386 Ga0495671_0003386_5933_6388 151
1542 3300046692 Ga0495671_0009251 Ga0495671_0009251_878_1333 151
1543 3300046692 Ga0495671_0011351 Ga0495671_0011351_3711_4166 151
1544 3300046692 Ga0495671_0063231 Ga0495671_0063231_1148_1603 151
1545 3300046692 Ga0495671_0123705 Ga0495671_0123705_685_1140 151
1546 3300046692 Ga0495671_0252737 Ga0495671_0252737_313_768 151
1547 3300046692 Ga0495671_0348240 Ga0495671_0348240_134_589 151
1548 3300046694 Ga0495649_0000559 Ga0495649_0000559_22497_22952 151
1549 3300046694 Ga0495649_0004109 Ga0495649_0004109_3996_4451 151
1550 3300046694 Ga0495649_0005576 Ga0495649_0005576_6085_6540 151
1551 3300046694 Ga0495649_0011664 Ga0495649_0011664_4258_4713 151
1552 3300046694 Ga0495649_0026139 Ga0495649_0026139_2343_2798 151
1553 3300046694 Ga0495649_0067043 Ga0495649_0067043_1400_1855 151
1554 3300046694 Ga0495649_0100412 Ga0495649_0100412_672_1127 151
1555 3300046694 Ga0495649_0152725 Ga0495649_0152725_644_1099 151
1556 3300046694 Ga0495649_0209165 Ga0495649_0209165_409_864 151
1557 3300046794 Ga0495589_0004366 Ga0495589_0004366_2051_2506 151
1558 3300046794 Ga0495589_0019045 Ga0495589_0019045_2304_2759 151
1559 3300046794 Ga0495589_0022667 Ga0495589_0022667_2351_2806 151
1560 3300046794 Ga0495589_0111778 Ga0495589_0111778_835_1290 151
1561 3300046809 Ga0495600_0029762 Ga0495600_0029762_1990_2445 151
1562 3300046810 Ga0495660_0002195 Ga0495660_0002195_11045_11500 151
1563 3300046810 Ga0495660_0004003 Ga0495660_0004003_5094_5549 151
1564 3300046810 Ga0495660_0009901 Ga0495660_0009901_2097_2552 151
1565 3300046810 Ga0495660_0011258 Ga0495660_0011258_4573_5028 151
1566 3300046810 Ga0495660_0015775 Ga0495660_0015775_1685_2140 151
1567 3300046810 Ga0495660_0036962 Ga0495660_0036962_1106_1561 151
1568 3300046810 Ga0495660_0081717 Ga0495660_0081717_983_1438 151
1569 3300046810 Ga0495660_0096203 Ga0495660_0096203_920_1375 151
1570 3300046810 Ga0495660_0113277 Ga0495660_0113277_76_531 151
1571 3300046810 Ga0495660_0158337 Ga0495660_0158337_637_1092 151
1572 3300046810 Ga0495660_0236010 Ga0495660_0236010_200_655 151
1573 3300047317 Ga0495604_0224792 Ga0495604_0224792_797_1252 151
1574 3300047318 Ga0495636_0469873 Ga0495636_0469873_81_536 151
1575 3300047320 Ga0495672_0008685 Ga0495672_0008685_3121_3576 151
1576 3300047320 Ga0495672_0017665 Ga0495672_0017665_1288_1743 151
1577 3300047320 Ga0495672_0032448 Ga0495672_0032448_1316_1771 151
1578 3300047320 Ga0495672_0036714 Ga0495672_0036714_1217_1672 151
1579 3300047320 Ga0495672_0036760 Ga0495672_0036760_2465_2920 151
1580 3300047320 Ga0495672_0061709 Ga0495672_0061709_483_938 151
1581 3300047320 Ga0495672_0069020 Ga0495672_0069020_649_1104 151
1582 3300047320 Ga0495672_0077165 Ga0495672_0077165_1168_1623 151
1583 3300047320 Ga0495672_0104839 Ga0495672_0104839_495_950 151
1584 3300047320 Ga0495672_0108826 Ga0495672_0108826_21_476 151
1585 3300047320 Ga0495672_0122707 Ga0495672_0122707_27_482 151
1586 3300047320 Ga0495672_0126392 Ga0495672_0126392_750_1205 151
1587 3300047321 Ga0495676_0000032 Ga0495676_0000032_126643_127098 151
1588 3300047321 Ga0495676_0041046 Ga0495676_0041046_2474_2929 151
1589 3300047322 Ga0495680_0008846 Ga0495680_0008846_1863_2318 151
1590 3300047322 Ga0495680_0158307 Ga0495680_0158307_191_646 151
1591 3300047322 Ga0495680_0491239 Ga0495680_0491239_364_819 151
1592 3300047322 Ga0495680_0723396 Ga0495680_0723396_147_602 151
1593 3300047323 Ga0495683_0000055 Ga0495683_0000055_98323_98778 151
1594 3300047323 Ga0495683_0000075 Ga0495683_0000075_4077_4532 151
1595 3300047323 Ga0495683_0013729 Ga0495683_0013729_2973_3428 151
1596 3300047323 Ga0495683_0034418 Ga0495683_0034418_1268_1723 151
1597 3300047323 Ga0495683_0132110 Ga0495683_0132110_68_523 151
1598 3300047323 Ga0495683_0249969 Ga0495683_0249969_130_585 151
1599 3300047443 Ga0495687_024590 Ga0495687_024590_515_970 151
1600 3300047443 Ga0495687_060119 Ga0495687_060119_680_1135 151
1601 3300047444 Ga0495675_0060903 Ga0495675_0060903_1706_2161 151
1602 3300047445 Ga0495677_0096017 Ga0495677_0096017_520_975 151
1603 3300047445 Ga0495677_0101945 Ga0495677_0101945_609_1064 151
1604 3300047446 Ga0495679_000495 Ga0495679_000495_23356_23811 151
1605 3300047446 Ga0495679_027905 Ga0495679_027905_33_488 151
1606 3300047446 Ga0495679_064991 Ga0495679_064991_297_752 151
1607 3300047446 Ga0495679_105866 Ga0495679_105866_285_740 151
1608 3300047469 Ga0495673_0004043 Ga0495673_0004043_4955_5410 151
1609 3300047469 Ga0495673_0005552 Ga0495673_0005552_4041_4496 151
1610 3300047469 Ga0495673_0006295 Ga0495673_0006295_6000_6455 151
1611 3300047469 Ga0495673_0011348 Ga0495673_0011348_4091_4546 151
1612 3300047469 Ga0495673_0028651 Ga0495673_0028651_1043_1498 151
1613 3300047469 Ga0495673_0035666 Ga0495673_0035666_776_1231 151
1614 3300047469 Ga0495673_0054911 Ga0495673_0054911_1059_1514 151
1615 3300047469 Ga0495673_0068619 Ga0495673_0068619_43_498 151
1616 3300047469 Ga0495673_0070498 Ga0495673_0070498_949_1404 151
1617 3300047469 Ga0495673_0080658 Ga0495673_0080658_876_1331 151
1618 3300047469 Ga0495673_0080788 Ga0495673_0080788_808_1263 151
1619 3300047469 Ga0495673_0107488 Ga0495673_0107488_635_1090 151
1620 3300047469 Ga0495673_0315656 Ga0495673_0315656_31_486 151
1621 3300047470 Ga0495681_0003330 Ga0495681_0003330_7630_8085 151
1622 3300047470 Ga0495681_0009290 Ga0495681_0009290_4074_4529 151
1623 3300047470 Ga0495681_0010491 Ga0495681_0010491_4085_4540 151
1624 3300047470 Ga0495681_0026799 Ga0495681_0026799_1793_2248 151
1625 3300047470 Ga0495681_0046902 Ga0495681_0046902_1512_1967 151
1626 3300047470 Ga0495681_0094003 Ga0495681_0094003_31_486 151
1627 3300047470 Ga0495681_0208313 Ga0495681_0208313_245_700 151
1628 3300047472 Ga0495686_0057742 Ga0495686_0057742_1084_1539 151
1629 3300047472 Ga0495686_0188888 Ga0495686_0188888_22_477 151
1630 3300047673 Ga0495593_0034350 Ga0495593_0034350_918_1373 151
1631 3300048091 Ga0495626_0000024 Ga0495626_0000024_121951_122406 151
1632 3300048091 Ga0495626_0006021 Ga0495626_0006021_3275_3730 151
1633 3300048091 Ga0495626_0007440 Ga0495626_0007440_1557_2012 151
1634 3300048091 Ga0495626_0030264 Ga0495626_0030264_2013_2468 151
1635 3300048091 Ga0495626_0091432 Ga0495626_0091432_862_1317 151
1636 3300048091 Ga0495626_0092114 Ga0495626_0092114_31_486 151
1637 3300048091 Ga0495626_0229073 Ga0495626_0229073_53_508 151
1638 3300048905 Ga0496102_0021686 Ga0496102_0021686_1126_1581 151
1639 3300048905 Ga0496102_1913148 Ga0496102_1913148_10_465 151
1640 3300048906 Ga0496103_0156800 Ga0496103_0156800_70_525 151
1641 3300048908 Ga0496105_0541806 Ga0496105_0541806_81_536 151
1642 3300048909 Ga0496106_0419181 Ga0496106_0419181_385_840 151
1643 3300048911 Ga0496108_0505068 Ga0496108_0505068_415_870 151
1644 3300048913 Ga0496110_0215624 Ga0496110_0215624_357_812 151
1645 3300048913 Ga0496110_0479361 Ga0496110_0479361_633_1088 151
1646 3300048913 Ga0496110_0532282 Ga0496110_0532282_16_471 151
1647 3300048914 Ga0496111_0332160 Ga0496111_0332160_637_1092 151
1648 3300048914 Ga0496111_0597354 Ga0496111_0597354_284_739 151
1649 3300048915 Ga0496112_1876480 Ga0496112_1876480_44_499 151
1650 3300048916 Ga0496113_0373904 Ga0496113_0373904_525_980 151
1651 3300048917 Ga0496114_0033938 Ga0496114_0033938_1749_2204 151
1652 3300048917 Ga0496114_0090573 Ga0496114_0090573_161_616 151
1653 3300048919 Ga0496116_0000553 Ga0496116_0000553_4085_4540 151
1654 3300048919 Ga0496116_0013021 Ga0496116_0013021_4142_4597 151
1655 3300048919 Ga0496116_0018645 Ga0496116_0018645_70_525 151
1656 3300048919 Ga0496116_0019155 Ga0496116_0019155_759_1214 151
1657 3300048919 Ga0496116_0170552 Ga0496116_0170552_24_479 151
1658 3300048920 Ga0496117_0006615 Ga0496117_0006615_4080_4535 151
1659 3300048920 Ga0496117_0006932 Ga0496117_0006932_2099_2554 151
1660 3300048920 Ga0496117_0024953 Ga0496117_0024953_576_1031 151
1661 3300048920 Ga0496117_0026843 Ga0496117_0026843_683_1138 151
1662 3300048920 Ga0496117_0031455 Ga0496117_0031455_420_875 151
1663 3300048920 Ga0496117_0154774 Ga0496117_0154774_63_518 151
1664 3300048920 Ga0496117_0158249 Ga0496117_0158249_79_534 151
1665 3300048920 Ga0496117_0365643 Ga0496117_0365643_28_483 151
1666 3300048921 Ga0496118_0007748 Ga0496118_0007748_4117_4572 151
1667 3300048921 Ga0496118_0088388 Ga0496118_0088388_1345_1800 151
1668 3300048921 Ga0496118_0099858 Ga0496118_0099858_171_626 151
1669 3300048921 Ga0496118_0116427 Ga0496118_0116427_105_560 151
1670 3300048921 Ga0496118_0125720 Ga0496118_0125720_981_1436 151
1671 3300048921 Ga0496118_0263243 Ga0496118_0263243_49_504 151
1672 3300048922 Ga0496119_0125748 Ga0496119_0125748_492_947 151
1673 3300048924 Ga0496121_0008919 Ga0496121_0008919_4086_4541 151
1674 3300048924 Ga0496121_0011761 Ga0496121_0011761_4059_4514 151
1675 3300048924 Ga0496121_0115362 Ga0496121_0115362_305_760 151
1676 3300048924 Ga0496121_0216973 Ga0496121_0216973_91_546 151
1677 3300048924 Ga0496121_0218219 Ga0496121_0218219_227_682 151
1678 3300048924 Ga0496121_0281425 Ga0496121_0281425_607_1062 151
1679 3300048924 Ga0496121_0508017 Ga0496121_0508017_132_587 151
1680 3300048925 Ga0496122_0007258 Ga0496122_0007258_5706_6161 151
1681 3300048925 Ga0496122_0018013 Ga0496122_0018013_1864_2319 151
1682 3300048925 Ga0496122_0021634 Ga0496122_0021634_1162_1617 151
1683 3300048925 Ga0496122_0034642 Ga0496122_0034642_1606_2061 151
1684 3300048925 Ga0496122_0061280 Ga0496122_0061280_1408_1863 151
1685 3300048925 Ga0496122_0371410 Ga0496122_0371410_119_574 151
1686 3300048926 Ga0496123_0000178 Ga0496123_0000178_116226_116681 151
1687 3300048926 Ga0496123_0007242 Ga0496123_0007242_5995_6450 151
1688 3300048926 Ga0496123_0010680 Ga0496123_0010680_4056_4511 151
1689 3300048926 Ga0496123_0027433 Ga0496123_0027433_861_1316 151
1690 3300048926 Ga0496123_0170119 Ga0496123_0170119_670_1125 151
1691 3300048926 Ga0496123_0304831 Ga0496123_0304831_280_735 151
1692 3300048927 Ga0496124_0004321 Ga0496124_0004321_4205_4660 151
1693 3300048927 Ga0496124_0006372 Ga0496124_0006372_2160_2615 151
1694 3300048927 Ga0496124_0023502 Ga0496124_0023502_983_1438 151
1695 3300048927 Ga0496124_0057238 Ga0496124_0057238_2143_2598 151
1696 3300048927 Ga0496124_0137724 Ga0496124_0137724_1426_1881 151
1697 3300048927 Ga0496124_0145590 Ga0496124_0145590_711_1166 151
1698 3300048927 Ga0496124_0150009 Ga0496124_0150009_117_572 151
1699 3300048927 Ga0496124_0220964 Ga0496124_0220964_102_557 151
1700 3300048927 Ga0496124_0329605 Ga0496124_0329605_73_528 151
1701 3300048928 Ga0496125_0001493 Ga0496125_0001493_28680_29135 151
1702 3300048928 Ga0496125_0007042 Ga0496125_0007042_806_1261 151
1703 3300048928 Ga0496125_0069620 Ga0496125_0069620_1448_1903 151
1704 3300048928 Ga0496125_0111577 Ga0496125_0111577_1447_1908 151
1705 3300048928 Ga0496125_0191586 Ga0496125_0191586_31_486 151
1706 3300048928 Ga0496125_0191943 Ga0496125_0191943_71_526 151
1707 3300048929 Ga0496126_0148335 Ga0496126_0148335_1306_1761 151
1708 3300048929 Ga0496126_0343497 Ga0496126_0343497_486_941 151
1709 3300049459 Ga0495678_000106 Ga0495678_000106_4075_4530 151
1710 3300049459 Ga0495678_016396 Ga0495678_016396_2534_2989 151
1711 3300049459 Ga0495678_033178 Ga0495678_033178_738_1193 151
1712 3300049459 Ga0495678_173455 Ga0495678_173455_105_560 151
1713 3300049460 Ga0495682_0000573 Ga0495682_0000573_14583_15038 151
1714 3300049568 Ga0501031_0118073 Ga0501031_0118073_636_1091 151
1715 3300049571 Ga0501034_0000143 Ga0501034_0000143_2638_3093 151
1716 3300049571 Ga0501034_0030982 Ga0501034_0030982_2867_3322 151
1717 3300049574 Ga0501038_0105642 Ga0501038_0105642_1434_1889 151
1718 3300049758 Ga0501241_023838 Ga0501241_023838_656_1111 151
1719 3300049853 Ga0501226_000049 Ga0501226_000049_23607_24062 151
1720 3300050489 nmdc:mga03683_25008_c1 nmdc:mga03683_25008_c1_688_1143 151
1721 3300050490 nmdc:mga03n38_30830_c1 nmdc:mga03n38_30830_c1_624_1079 151
1722 3300050491 nmdc:mga00v17_1492_c1 nmdc:mga00v17_1492_c1_1651_2106 151
1723 3300050491 nmdc:mga00v17_436110_c1 nmdc:mga00v17_436110_c1_13_468 151
1724 3300050491 nmdc:mga00v17_571_c1 nmdc:mga00v17_571_c1_17088_17543 151
1725 3300050492 nmdc:mga0yw44_217_c1 nmdc:mga0yw44_217_c1_9186_9641 151
1726 3300050492 nmdc:mga0yw44_34070_c1 nmdc:mga0yw44_34070_c1_2010_2513 151
1727 3300050494 nmdc:mga06z11_174630_c1 nmdc:mga06z11_174630_c1_61_516 151
1728 3300050494 nmdc:mga06z11_1852_c1 nmdc:mga06z11_1852_c1_4340_4795 151
1729 3300050496 nmdc:mga07m45_1061_c1 nmdc:mga07m45_1061_c1_10017_10472 151
1730 3300050496 nmdc:mga07m45_7984_c1 nmdc:mga07m45_7984_c1_4532_5038 151
1731 3300050508 nmdc:mga09592_3652_c1 nmdc:mga09592_3652_c1_10175_10630 151
1732 3300050512 nmdc:mga0n895_1547153_c1 nmdc:mga0n895_1547153_c1_104_559 151
1733 3300050516 nmdc:mga0sz30_320_c2 nmdc:mga0sz30_320_c2_1761_2216 151
1734 3300053135 Ga0500659_0005549 Ga0500659_0005549_2250_2705 151
1735 3300053142 Ga0500577_0009905 Ga0500577_0009905_545_1000 151

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00692

dUTPase

dUTPase

29

162

0.94

PF22769

DCD

dCTP deaminase-like

36

137

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
1dup-assembly1.cif.gz_A deoxyuridine 5'-triphosphate nucleotido hydrolase (d-utpase) 0.9343 1 135
1rnj-assembly1.cif.gz_A crystal structure of inactive mutant dutpase complexed with substrate analogue imido-dutp 0.9299 1 135
4lhr-assembly1.cif.gz_A crystal structure of a deoxyuridine 5'-triphosphate nucleotidohydrolase from burkholderia thailandensis 0.9295 3 135
3tqz-assembly1.cif.gz_A structure of a deoxyuridine 5'-triphosphate nucleotidohydrolase (dut) from coxiella burnetii 0.9255 1 137
6mai-assembly1.cif.gz_A crystal structure of deoxyuridine 5'-triphosphate nucleotidohydrolase from legionella pneumophila philadelphia 1 0.9236 1 137
ID Description Score Start End Superfamily
3tqzA00 Mainly Beta;Distorted Sandwich;Deoxyuridine 5'-Triphosphate Nucleotidohydrolase; Chain A;Deoxyuridine triphosphatase (dUTPase) 0.9246 1 137 2.70.40.10
3tqzA00 Mainly Beta;Distorted Sandwich;Deoxyuridine 5'-Triphosphate Nucleotidohydrolase; Chain A;Deoxyuridine triphosphatase (dUTPase) 0.9182 1 137 2.70.40.10
1snfC00 Mainly Beta;Distorted Sandwich;Deoxyuridine 5'-Triphosphate Nucleotidohydrolase; Chain A;Deoxyuridine triphosphatase (dUTPase) 0.9025 3 135 2.70.40.10
1sjnC00 Mainly Beta;Distorted Sandwich;Deoxyuridine 5'-Triphosphate Nucleotidohydrolase; Chain A;Deoxyuridine triphosphatase (dUTPase) 0.8909 3 135 2.70.40.10
1snfC00 Mainly Beta;Distorted Sandwich;Deoxyuridine 5'-Triphosphate Nucleotidohydrolase; Chain A;Deoxyuridine triphosphatase (dUTPase) 0.8829 3 135 2.70.40.10
ID Description Score Start End GO Terms
AF-A0A661CKF5-F1-model_v4 dUTP diphosphatase (EC 3.6.1.23) 0.9494 1 126 GO:0000287
GO:0004170
GO:0006226
GO:0046081
AF-A0A447QL67-F1-model_v4 dUTP diphosphatase (EC 3.6.1.23) 0.9492 1 122 GO:0000287
GO:0004170
GO:0006226
GO:0046081
AF-A0A661CKF5-F1-model_v4 dUTP diphosphatase (EC 3.6.1.23) 0.9421 1 126 GO:0000287
GO:0004170
GO:0006226
GO:0046081
AF-A0A534E2N6-F1-model_v4 deleted 0.9399 13 118
AF-A0A359GZM5-F1-model_v4 dUTP diphosphatase (EC 3.6.1.23) 0.9364 3 132 GO:0000287
GO:0004170
GO:0006226
GO:0046081

Feature Viewer

pLDDT pTM Quality
89.78 0.78 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map