F495520
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1735 | 763 | 1450 | 149 |
Family's Representative Sequence
| Representative Sequence | 3300005456|Ga0070678_101021335|Ga0070678_1010213351 |
| Length | 172 |
| Sequence | MNAAIAPQAGAHSTGRALKVRVLDPRIGAEFPLPAYATAGSAGLDLLAAIDAEMILVPGARTAVPTGIAIELPLGVEAQIRPRSGLALNHGITCLNAPGTIDSDYRGEIKAILINHGDKTFNISRGAKIAQMVIARHEQAELVEVEALSESERGAGGFGSTGMNSGVMKVKA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2124908027 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 2511231004 | Pseudomonas sp. GM102 | Isolate | Nodule |
| 4 | 2511231006 | Pseudomonas sp. GM17 | Isolate | Nodule |
| 5 | 2511231007 | Pseudomonas sp. GM18 | Isolate | Nodule |
| 6 | 2511231008 | Pseudomonas sp. GM21 | Isolate | Nodule |
| 7 | 2511231010 | Pseudomonas sp. GM25 | Isolate | Nodule |
| 8 | 2511231011 | Pseudomonas sp. GM30 | Isolate | Nodule |
| 9 | 2511231012 | Pseudomonas sp. GM33 | Isolate | Nodule |
| 10 | 2511231014 | Pseudomonas sp. GM48 | Isolate | Nodule |
| 11 | 2511231015 | Pseudomonas sp. GM49 | Isolate | Nodule |
| 12 | 2511231016 | Pseudomonas sp. GM50 | Isolate | Nodule |
| 13 | 2511231017 | Pseudomonas sp. GM55 | Isolate | Nodule |
| 14 | 2511231018 | Pseudomonas sp. GM60 | Isolate | Nodule |
| 15 | 2511231019 | Pseudomonas sp. GM67 | Isolate | Nodule |
| 16 | 2511231020 | Pseudomonas sp. GM74 | Isolate | Nodule |
| 17 | 2511231021 | Pseudomonas sp. GM78 | Isolate | Nodule |
| 18 | 2511231022 | Pseudomonas sp. GM79 | Isolate | Nodule |
| 19 | 2511231023 | Pseudomonas sp. GM80 | Isolate | Nodule |
| 20 | 2511231024 | Pseudomonas sp. GM84 | Isolate | Nodule |
| 21 | 2511231031 | Pseudomonas sp. GM16 | Isolate | Nodule |
| 22 | 2511231156 | Pseudomonas ogarae F113 | Isolate | Rhizosphere |
| 23 | 2512047018 | Pseudomonas chlororaphis chlororaphis GP72 | Isolate | Rhizosphere |
| 24 | 2513020051 | Variovorax sp. CF313 | Isolate | Rhizosphere |
| 25 | 2554235132 | Pseudomonas aeruginosa PGPR2 | Isolate | Unclassified |
| 26 | 2554235231 | Pseudomonas putida MTCC 5279 | Isolate | Unclassified |
| 27 | 2554235341 | Pseudomonas protegens CHA0 | Isolate | Rhizosphere |
| 28 | 2582580891 | Pseudomonas chlororaphis YL-1 | Isolate | Unclassified |
| 29 | 2597489887 | Pseudomonas chlororaphis aureofaciens 30-84 | Isolate | Rhizosphere |
| 30 | 2597489888 | Pseudomonas fluorescens SS101 | Isolate | Rhizosphere |
| 31 | 2597489889 | Pseudomonas synxantha BG33R | Isolate | Rhizosphere |
| 32 | 2599185155 | Pseudomonas sp. NFACC10-1 | Isolate | Rhizoplane |
| 33 | 2599185160 | Pseudomonas sp. NFPP25 | Isolate | Rhizoplane |
| 34 | 2599185161 | Pseudomonas sp. NFPP09 | Isolate | Rhizoplane |
| 35 | 2599185162 | Pseudomonas sp. NFPP10 | Isolate | Rhizoplane |
| 36 | 2599185163 | Pseudomonas sp. NFPP12 | Isolate | Rhizoplane |
| 37 | 2599185164 | Pseudomonas sp. NFPP13 | Isolate | Rhizoplane |
| 38 | 2599185165 | Pseudomonas sp. NFPP18 | Isolate | Rhizoplane |
| 39 | 2599185166 | Pseudomonas sp. NFPP08 | Isolate | Rhizoplane |
| 40 | 2599185167 | Pseudomonas sp. NFPP28 | Isolate | Rhizoplane |
| 41 | 2599185168 | Pseudomonas sp. NFPP05 | Isolate | Rhizoplane |
| 42 | 2599185179 | Pseudomonas sp. NFR09 | Isolate | Rhizoplane |
| 43 | 2599185181 | Pseudomonas sp. NFPP17 | Isolate | Rhizoplane |
| 44 | 2599185182 | Pseudomonas sp. NFPP19 | Isolate | Rhizoplane |
| 45 | 2599185185 | Pseudomonas sp. NFPP07 | Isolate | Rhizoplane |
| 46 | 2599185186 | Pseudomonas sp. NFPP15 | Isolate | Rhizoplane |
| 47 | 2599185188 | Pseudomonas sp. NFACC45 | Isolate | Rhizoplane |
| 48 | 2599185189 | Pseudomonas sp. NFPP02 | Isolate | Rhizoplane |
| 49 | 2599185190 | Pseudomonas sp. NFPP04 | Isolate | Rhizoplane |
| 50 | 2599185191 | Pseudomonas sp. NFPP24 | Isolate | Rhizoplane |
| 51 | 2599185212 | Pseudomonas sp. NFACC15-1 | Isolate | Rhizoplane |
| 52 | 2599185214 | Variovorax sp. NFACC26 | Isolate | Rhizoplane |
| 53 | 2599185226 | Variovorax sp. NFACC27 | Isolate | Rhizoplane |
| 54 | 2599185227 | Variovorax sp. NFACC28 | Isolate | Rhizoplane |
| 55 | 2599185229 | Variovorax sp. NFACC29 | Isolate | Endosphere |
| 56 | 2599185248 | Pseudomonas sp. NFACC08-1 | Isolate | Rhizoplane |
| 57 | 2599185257 | Pseudomonas sp. NFACC41-3 | Isolate | Rhizoplane |
| 58 | 2599185288 | Pseudomonas sp. NFACC25 | Isolate | Rhizoplane |
| 59 | 2599185289 | Pseudomonas sp. NFACC51 | Isolate | Rhizoplane |
| 60 | 2599185290 | Pseudomonas sp. NFPP11 | Isolate | Rhizoplane |
| 61 | 2599185291 | Pseudomonas sp. NFACC48-1 | Isolate | Rhizoplane |
| 62 | 2599185300 | Pseudomonas sp. NFACC39-1 | Isolate | Rhizoplane |
| 63 | 2599185302 | Pseudomonas sp. NFACC43 | Isolate | Rhizoplane |
| 64 | 2599185303 | Pseudomonas sp. NFACC42-2 | Isolate | Rhizoplane |
| 65 | 2599185304 | Pseudomonas sp. NFACC47-1 | Isolate | Rhizoplane |
| 66 | 2599185305 | Pseudomonas sp. NFACC07-1 | Isolate | Rhizoplane |
| 67 | 2599185306 | Pseudomonas sp. NFACC16-2 | Isolate | Rhizoplane |
| 68 | 2599185308 | Pseudomonas sp. NFACC17-2 | Isolate | Rhizoplane |
| 69 | 2599185309 | Pseudomonas sp. NFACC49-2 | Isolate | Rhizoplane |
| 70 | 2599185310 | Pseudomonas sp. NFACC09-4 | Isolate | Rhizoplane |
| 71 | 2599185311 | Pseudomonas sp. NFACC04-2 | Isolate | Rhizoplane |
| 72 | 2599185312 | Pseudomonas sp. NFACC32-1 | Isolate | Rhizoplane |
| 73 | 2599185313 | Pseudomonas sp. NFACC05-1 | Isolate | Rhizoplane |
| 74 | 2599185314 | Pseudomonas sp. NFACC23-1 | Isolate | Rhizoplane |
| 75 | 2599185315 | Pseudomonas sp. NFACC44-2 | Isolate | Rhizoplane |
| 76 | 2599185316 | Pseudomonas sp. NFACC52 | Isolate | Rhizoplane |
| 77 | 2599185317 | Pseudomonas sp. NFACC06-1 | Isolate | Rhizoplane |
| 78 | 2599185318 | Pseudomonas sp. NFACC13-1 | Isolate | Rhizoplane |
| 79 | 2599185319 | Pseudomonas sp. NFACC24-1 | Isolate | Rhizoplane |
| 80 | 2599185320 | Pseudomonas sp. NFACC36 | Isolate | Rhizoplane |
| 81 | 2599185321 | Pseudomonas sp. NFACC54 | Isolate | Rhizoplane |
| 82 | 2599185322 | Pseudomonas sp. NFACC14 | Isolate | Rhizoplane |
| 83 | 2599185323 | Pseudomonas sp. NFACC37-1 | Isolate | Rhizoplane |
| 84 | 2599185324 | Pseudomonas sp. NFACC46-3 | Isolate | Rhizoplane |
| 85 | 2599185325 | Pseudomonas sp. NFACC56-3 | Isolate | Rhizoplane |
| 86 | 2599185356 | Pseudomonas sp. NFPP14 | Isolate | Rhizoplane |
| 87 | 2600254930 | Pseudomonas sp. NFIX10 | Isolate | Rhizoplane |
| 88 | 2600254931 | Pseudomonas sp. NFIX28 | Isolate | Rhizoplane |
| 89 | 2600254954 | Pseudomonas sp. NFACC19-2 | Isolate | Rhizoplane |
| 90 | 2600255283 | Pseudomonas sp. NFR16 | Isolate | Rhizoplane |
| 91 | 2600255296 | Pseudomonas sp. NFR02 | Isolate | Rhizoplane |
| 92 | 2600255313 | Pseudomonas sp. NFPP16 | Isolate | Rhizoplane |
| 93 | 2600255318 | Pseudomonas putida NFIX47 | Isolate | Rhizoplane |
| 94 | 2600255389 | Pseudomonas sp. NFPP33 | Isolate | Rhizoplane |
| 95 | 2603880185 | Pseudomonas sp. NFIX46 | Isolate | Rhizoplane |
| 96 | 2603880199 | Pseudomonas sp. NFIX49 | Isolate | Rhizoplane |
| 97 | 2606217733 | Pseudomonas aeruginosa NFHH01 | Isolate | Rhizoplane |
| 98 | 2619619299 | Pseudomonas veronii R4 Genome sequencing | Isolate | Unclassified |
| 99 | 2623620443 | Pseudomonas sp. DR 5-09 | Isolate | Unclassified |
| 100 | 2623620446 | Pseudomonas sp. GR 6-02 | Isolate | Unclassified |
| 101 | 2643221565 | Pseudomonas sp. Root562 | Isolate | Unclassified |
| 102 | 2643221571 | Pseudomonas sp. Root569 | Isolate | Unclassified |
| 103 | 2643221589 | Pseudomonas sp. Root68 | Isolate | Unclassified |
| 104 | 2643221602 | Pseudomonas sp. Root71 | Isolate | Unclassified |
| 105 | 2643221628 | Variovorax sp. Root318D1 | Isolate | Unclassified |
| 106 | 2643221633 | Pseudomonas sp. Root329 | Isolate | Unclassified |
| 107 | 2643221650 | Pseudomonas sp. Root401 | Isolate | Unclassified |
| 108 | 2643221658 | Variovorax sp. Root411 | Isolate | Unclassified |
| 109 | 2643221672 | Variovorax sp. Root434 | Isolate | Unclassified |
| 110 | 2643221683 | Variovorax sp. Root473 | Isolate | Unclassified |
| 111 | 2643221713 | Pseudomonas sp. Root9 | Isolate | Unclassified |
| 112 | 2667528170 | Pseudomonas sp. NFACC50-1 | Isolate | Rhizoplane |
| 113 | 2667528171 | Pseudomonas sp. NFPP22 | Isolate | Rhizoplane |
| 114 | 2667528176 | Pseudomonas sp. NFACC11-2 | Isolate | Rhizoplane |
| 115 | 2671180172 | Pseudomonas sp. NFIX51 | Isolate | Rhizoplane |
| 116 | 2675903420 | Pseudomonas fluorescens Ps006 | Isolate | Unclassified |
| 117 | 2675903515 | Pseudomonas thivervalensis DSM 13194 | Isolate | Unclassified |
| 118 | 2690315857 | Rheinheimera sp. EpRS3 | Isolate | Unclassified |
| 119 | 2713897148 | Pseudomonas fluorescens SF39a | Isolate | Rhizosphere |
| 120 | 2713897149 | Pseudomonas fluorescens SF4c | Isolate | Rhizosphere |
| 121 | 2718217725 | Pseudomonas fluorescens CREA-C16 | Isolate | Rhizosphere |
| 122 | 2721755607 | Pseudomonas fluorescens Pt14 | Isolate | Rhizosphere |
| 123 | 2738541265 | Pseudomonas sp. GV077 | Isolate | Unclassified |
| 124 | 2738541271 | Pseudomonas sp. GV021 | Isolate | Unclassified |
| 125 | 2738541277 | Variovorax sp. GV051 | Isolate | Unclassified |
| 126 | 2738541282 | Pseudomonas sp. GV058 | Isolate | Unclassified |
| 127 | 2738541294 | Pseudomonas sp. GV087 | Isolate | Unclassified |
| 128 | 2738541303 | Pseudomonas sp. GV105 | Isolate | Unclassified |
| 129 | 2738541307 | Variovorax sp. GV008 | Isolate | Unclassified |
| 130 | 2738541309 | Pseudomonas sp. GV047 | Isolate | Unclassified |
| 131 | 2738543004 | Pseudomonas sp. GV085 | Isolate | Unclassified |
| 132 | 2738543013 | Variovorax sp. BT01 | Isolate | Unclassified |
| 133 | 2738543015 | Pseudomonas sp. GV041 | Isolate | Unclassified |
| 134 | 2738543016 | Pseudomonas sp. GV012 | Isolate | Unclassified |
| 135 | 2738543019 | Variovorax sp. GV040 | Isolate | Unclassified |
| 136 | 2738543020 | Pseudomonas sp. GV054 | Isolate | Unclassified |
| 137 | 2738543021 | Pseudomonas sp. GV071 | Isolate | Unclassified |
| 138 | 2738543025 | Pseudomonas sp. GV091 | Isolate | Unclassified |
| 139 | 2740892503 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 140 | 2744054620 | Pseudomonas thivervalensis LMG 21626 | Isolate | Unclassified |
| 141 | 2773857670 | Pseudomonas sp. 478 | Isolate | Unclassified |
| 142 | 2773857673 | Pseudomonas sp. 443 | Isolate | Unclassified |
| 143 | 2784132063 | Pseudomonas sp. 424 | Isolate | Unclassified |
| 144 | 2784132072 | Pseudomonas sp. 460 | Isolate | Unclassified |
| 145 | 2791355520 | Pseudomonas sp. s211(2017) | Isolate | Unclassified |
| 146 | 2806310737 | Pseudomonas mosselii BS011 | Isolate | Unclassified |
| 147 | 2806310745 | Pseudomonas mosselii PtA1 | Isolate | Unclassified |
| 148 | 2808606361 | Pseudomonas sp. SJZ075 | Isolate | Rhizosphere |
| 149 | 2808606373 | Pseudomonas sp. SLBN-2 | Isolate | Unclassified |
| 150 | 2808606376 | Pseudomonas sp. SJZ074 | Isolate | Rhizosphere |
| 151 | 2808606377 | Pseudomonas sp. SJZ083 | Isolate | Rhizosphere |
| 152 | 2808606378 | Pseudomonas sp. SJZ078 | Isolate | Rhizosphere |
| 153 | 2808606379 | Pseudomonas sp. SJZ079 | Isolate | Rhizosphere |
| 154 | 2808606380 | Pseudomonas sp. SJZ085 | Isolate | Rhizosphere |
| 155 | 2808606381 | Pseudomonas sp. SJZ077 | Isolate | Rhizosphere |
| 156 | 2808606382 | Pseudomonas sp. SJZ080 | Isolate | Rhizosphere |
| 157 | 2808606383 | Pseudomonas sp. SJZ124 | Isolate | Rhizosphere |
| 158 | 2808606385 | Pseudomonas sp. SJZ103 | Isolate | Rhizosphere |
| 159 | 2808606388 | Pseudomonas sp. SJZ094 | Isolate | Rhizosphere |
| 160 | 2808606389 | Pseudomonas sp. SJZ101 | Isolate | Rhizosphere |
| 161 | 2808606445 | Pseudomonas sp. SJZ131 | Isolate | Rhizosphere |
| 162 | 2816332298 | Pseudomonas veronii R02 | Isolate | Rhizosphere |
| 163 | 2818991446 | Variovorax sp. 1180 | Isolate | Unclassified |
| 164 | 2818991456 | Pseudomonas koreensis 3286 | Isolate | Rhizosphere |
| 165 | 2818991464 | Pseudomonas protegens 3295 | Isolate | Rhizosphere |
| 166 | 2823421272 | Pseudomonas mendocina S5.2 | Isolate | Rhizoplane |
| 167 | 2825651385 | Pseudomonas brassicacearum L13-6-12 | Isolate | Rhizosphere |
| 168 | 2826581358 | Pseudomonas viridiflava CDRTc14 | Isolate | Unclassified |
| 169 | 2831265667 | Variovorax guangxiensis DSM 27352 | Isolate | Rhizosphere |
| 170 | 2834028612 | Pseudomonas fluorescens 513 | Isolate | Unclassified |
| 171 | 2838054893 | Variovorax guangxiensis 34/80 | Isolate | Nodule |
| 172 | 2842677519 | Variovorax sp. R-72495 | Isolate | Unclassified |
| 173 | 2842733646 | Variovorax sp. R-72446 | Isolate | Unclassified |
| 174 | 2842747753 | Variovorax sp. R-72060 | Isolate | Unclassified |
| 175 | 2842805378 | Pseudomonas sp. R-72599 | Isolate | Unclassified |
| 176 | 2842815866 | Pseudomonas sp. R-72210 | Isolate | Unclassified |
| 177 | 2842826826 | Pseudomonas sp. R-72172 | Isolate | Unclassified |
| 178 | 2842832357 | Pseudomonas sp. R-72164 | Isolate | Unclassified |
| 179 | 2842837860 | Pseudomonas sp. R-72102 | Isolate | Unclassified |
| 180 | 2842843487 | Pseudomonas sp. R-72074 | Isolate | Unclassified |
| 181 | 2842849001 | Pseudomonas sp. R-72008 | Isolate | Unclassified |
| 182 | 2842854478 | Pseudomonas sp. R-71998 | Isolate | Unclassified |
| 183 | 2844665904 | Pseudomonas protegens H1F10C | Isolate | Unclassified |
| 184 | 2852612431 | Pseudomonas sp. SJZ073 | Isolate | Rhizosphere |
| 185 | 2852657418 | Pseudomonas sp. JAI115 | Isolate | Rhizosphere |
| 186 | 2852667396 | Pseudomonas sp. JAI120 | Isolate | Rhizosphere |
| 187 | 2860339153 | Pseudomonas sp. JAI111 | Isolate | Rhizosphere |
| 188 | 2860867994 | Pseudomonas sp. R1-43-08 | Isolate | Rhizosphere |
| 189 | 2878029506 | Pseudomonas fluorescens DR397 | Isolate | Rhizosphere |
| 190 | 2880230671 | Pseudomonas fluorescens LBUM677 | Isolate | Unclassified |
| 191 | 2885192300 | Variovorax sp. MHTC-1 | Isolate | Rhizosphere |
| 192 | 2885198086 | Variovorax sp. 679 | Isolate | Unclassified |
| 193 | 2885211737 | Variovorax sp. 553 | Isolate | Unclassified |
| 194 | 2899924645 | Variovorax sp. 369 | Isolate | Unclassified |
| 195 | 2904449895 | Variovorax sp. 1763 | Isolate | Rhizosphere |
| 196 | 2904456579 | Variovorax sp. 2002 | Isolate | Unclassified |
| 197 | 2904518522 | Pseudomonas fluorescens 4488 | Isolate | Rhizosphere |
| 198 | 2904541872 | Variovorax sp. 1615 | Isolate | Rhizosphere |
| 199 | 2904550169 | Stutzerimonas stutzeri 1099 | Isolate | Rhizosphere |
| 200 | 2908446538 | Pseudomonas sp. R76 | Isolate | Rhizosphere |
| 201 | 2912963787 | Pseudomonas sp. R32 | Isolate | Rhizosphere |
| 202 | 2913036834 | Pseudomonas viciae 11K1 | Isolate | Rhizosphere |
| 203 | 2917070673 | Pseudomonas protegens CHA0 | Isolate | Rhizosphere |
| 204 | 2919063839 | Pseudomonas pharyngis 1098 | Isolate | Rhizosphere |
| 205 | 2919385768 | Pseudomonas sp. 2957 | Isolate | Unclassified |
| 206 | 2919456309 | Pseudomonas sp. 3296 | Isolate | Rhizosphere |
| 207 | 2919462493 | Variovorax sp. 3319 | Isolate | Rhizosphere |
| 208 | 2919481497 | Pseudomonas brassicacearum 3432 | Isolate | Unclassified |
| 209 | 2919487758 | Pseudomonas koreensis 3441 | Isolate | Unclassified |
| 210 | 2919493220 | Aeromonas salmonicida salmonicida 3466 | Isolate | Unclassified |
| 211 | 2919501602 | Pseudomonas alcaliphila 3512 | Isolate | Unclassified |
| 212 | 2919534386 | Rheinheimera pacifica 3879 | Isolate | Unclassified |
| 213 | 2919543075 | Aeromonas salmonicida masoucida 4076 | Isolate | Unclassified |
| 214 | 2919688452 | Pararheinheimera soli 4138 | Isolate | Unclassified |
| 215 | 2919697872 | Pseudomonas frederiksbergensis 4169 | Isolate | Unclassified |
| 216 | 2923153595 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 217 | 2923525760 | Aeromonas caviae SLBN-129 | Isolate | Rhizosphere |
| 218 | 2923586266 | Pseudomonas fluorescens 1550 | Isolate | Rhizosphere |
| 219 | 2926063275 | Pseudomonas sp. 3400 | Isolate | Unclassified |
| 220 | 2928037797 | Variovorax sp. 1126 | Isolate | Unclassified |
| 221 | 2928044640 | Variovorax sp. 1128 | Isolate | Unclassified |
| 222 | 2928051484 | Variovorax sp. 1133 | Isolate | Unclassified |
| 223 | 2928064002 | Variovorax sp. 1140 | Isolate | Rhizosphere |
| 224 | 2928070936 | Variovorax gossypii 1167 | Isolate | Unclassified |
| 225 | 2928084124 | Variovorax paradoxus 1218 | Isolate | Unclassified |
| 226 | 2928115317 | Pseudacidovorax sp. 1753 | Isolate | Rhizosphere |
| 227 | 2929144301 | Pseudomonas sp. R-71838 Hybrid assembly | Isolate | Unclassified |
| 228 | 2929160207 | Variovorax sp. R-72349 Hybrid assembly | Isolate | Unclassified |
| 229 | 2929189879 | Pseudomonas sp. R-71842 Hybrid assembly | Isolate | Unclassified |
| 230 | 2929520902 | Variovorax beijingensis 502 | Isolate | Unclassified |
| 231 | 2931369376 | Pseudomonas fluorescens DR133 | Isolate | Rhizosphere |
| 232 | 2931390751 | Pseudomonas sp. DR208 | Isolate | Rhizosphere |
| 233 | 2931396565 | Pseudomonas sp. DR48 | Isolate | Rhizosphere |
| 234 | 2935353572 | Pseudomonas protegens TECH19 | Isolate | Unclassified |
| 235 | 2939636861 | Pseudomonas sp. 2725 | Isolate | Rhizosphere |
| 236 | 2939651529 | Pseudomonas sp. 2835 | Isolate | Rhizosphere |
| 237 | 2945909444 | Variovorax sp. CRF3-Va-1 W1I1 | Isolate | Rhizosphere |
| 238 | 2945928738 | Pseudomonas cedrina W1I11 | Isolate | Rhizosphere |
| 239 | 2945961074 | Pseudomonas sp. W2I6 | Isolate | Rhizosphere |
| 240 | 2945972063 | Variovorax paradoxus W2I8 | Isolate | Rhizosphere |
| 241 | 2945984333 | Variovorax sp. W2I14 | Isolate | Rhizosphere |
| 242 | 2946006987 | Pseudomonas sp. W3I7 | Isolate | Rhizosphere |
| 243 | 2946027586 | Pseudomonas sp. W4I3 | Isolate | Rhizosphere |
| 244 | 2947233263 | Pseudomonas synxantha W2I4 | Isolate | Rhizosphere |
| 245 | 2954767861 | Variovorax sp. TBS-050B | Isolate | Rhizosphere |
| 246 | 2974289157 | Pseudomonas fluorescens SORGH_AS 191 | Isolate | Unclassified |
| 247 | 2984286254 | Pseudomonas chlororaphis aurantiaca JD37 | Isolate | Rhizosphere |
| 248 | 2988728565 | Pseudomonas corrugata RM1-1-4 | Isolate | Rhizosphere |
| 249 | 2998139840 | Pseudomonas iranensis SWRI54 | Isolate | Rhizosphere |
| 250 | 3007315729 | Pseudomonas argentinensis SA190 | Isolate | Unclassified |
| 251 | 3007419365 | Pseudomonas vanderleydeniana RW8P3 | Isolate | Unclassified |
| 252 | 3007511990 | Pseudomonas fluorescens G20-18 | Isolate | Rhizosphere |
| 253 | 3007614139 | Pseudomonas sp. PB106 | Isolate | Unclassified |
| 254 | 3007619802 | Pseudomonas sp. PB120 | Isolate | Unclassified |
| 255 | 3007718800 | Pseudomonas fluorescens BW11P2 | Isolate | Rhizosphere |
| 256 | 3007803356 | Pseudomonas sp. CM27 | Isolate | Unclassified |
| 257 | 3007855910 | Pseudomonas khorasanensis SWRI153 | Isolate | Rhizosphere |
| 258 | 3007861166 | Pseudomonas hamedanensis SWRI65 | Isolate | Rhizosphere |
| 259 | 3007866637 | Pseudomonas marvdashtae SWRI102 | Isolate | Rhizosphere |
| 260 | 3007872151 | Pseudomonas sp. SWRI51 | Isolate | Rhizosphere |
| 261 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 262 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 263 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 264 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 265 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 266 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 267 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 268 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 269 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 270 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 271 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 272 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 273 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 274 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 275 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 276 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 277 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 278 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 279 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 280 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 281 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 282 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 283 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 284 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 285 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 286 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 287 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 288 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 289 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 290 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 291 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 292 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 293 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 294 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 295 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 296 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 297 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 298 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 299 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 300 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 301 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 302 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 303 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 304 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 305 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 306 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 307 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 308 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 309 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 310 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 311 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 312 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 313 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 314 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 315 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 316 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 317 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 318 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 319 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 320 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 321 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 322 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 323 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 324 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 325 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 326 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 327 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 328 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 329 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 330 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 331 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 332 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 333 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 334 | 3300006194 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Metagenome | Rhizosphere |
| 335 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 336 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 337 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 338 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 339 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 340 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 341 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 342 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 343 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 344 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 345 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 346 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 347 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 348 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 349 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 350 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 351 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 352 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 353 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 354 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 355 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 356 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 357 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 358 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 359 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 360 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 361 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 362 | 3300012498 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 | Metagenome | Rhizosphere |
| 363 | 3300012502 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 | Metagenome | Rhizosphere |
| 364 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 365 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 366 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 367 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 368 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 369 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 370 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 371 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 372 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 373 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 374 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 375 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 376 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 377 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 378 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 379 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 380 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 381 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 382 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 383 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 384 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 385 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 386 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 387 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 388 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 389 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 390 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 391 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 392 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 393 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 394 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 395 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 396 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 397 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 398 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 399 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 400 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 401 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 402 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 403 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 404 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 405 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 406 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 407 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 408 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 409 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 410 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 411 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 412 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 413 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 414 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 415 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 416 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 417 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 418 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 419 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 420 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 421 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 422 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 423 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 424 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 425 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 426 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 427 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 428 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 429 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 430 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 431 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 432 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 433 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 434 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 435 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 436 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 437 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 438 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 439 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 440 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 441 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 442 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 443 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 444 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 445 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 446 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 447 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 448 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 449 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 450 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 451 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 452 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 453 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 454 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 455 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 456 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 457 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 458 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 459 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 460 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 461 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 462 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 463 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 464 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 465 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 466 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 467 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 468 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 469 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 470 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 471 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 472 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 473 | 3300030734 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 | Metagenome | Rhizosphere |
| 474 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 475 | 3300030736 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 | Metagenome | Rhizosphere |
| 476 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 477 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 478 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 479 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 480 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 481 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 482 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 483 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 484 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 485 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 486 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 487 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 488 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 489 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 490 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 491 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 492 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 493 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 494 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 495 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 496 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 497 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 498 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 499 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 500 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 501 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 502 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 503 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 504 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 505 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 506 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 507 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 508 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 509 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 510 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 511 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 512 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 513 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 514 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 515 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 516 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 517 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 518 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 519 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 520 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 521 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 522 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 523 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 524 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 525 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 526 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 527 | 3300042000 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 | Metagenome | Rhizosphere |
| 528 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 529 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 530 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 531 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 532 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 533 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 534 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 535 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 536 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 537 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 538 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 539 | 3300042121 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 | Metagenome | Rhizosphere |
| 540 | 3300042124 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 | Metagenome | Rhizosphere |
| 541 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 542 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 543 | 3300042130 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 | Metagenome | Rhizosphere |
| 544 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 545 | 3300042132 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 | Metagenome | Rhizosphere |
| 546 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 547 | 3300042136 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 | Metagenome | Rhizosphere |
| 548 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 549 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 550 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 551 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 552 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 553 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 554 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 555 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 556 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 557 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 558 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 559 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 560 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 561 | 3300042530 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 | Metagenome | Rhizosphere |
| 562 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 563 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 564 | 3300042533 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 | Metagenome | Rhizosphere |
| 565 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 566 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 567 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 568 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 569 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 570 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 571 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 572 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 573 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 574 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 575 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 576 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 577 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 578 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 579 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 580 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 581 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 582 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 583 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 584 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 585 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 586 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 587 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 588 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 589 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 590 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 591 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 592 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 593 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 594 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 595 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 596 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 597 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 598 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 599 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 600 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 601 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 602 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 603 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 604 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 605 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 606 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 607 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 608 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 609 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 610 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 611 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 612 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 613 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 614 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 615 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 616 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 617 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 618 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 619 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 620 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 621 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 622 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 623 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 624 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 625 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 626 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 627 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 628 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 629 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 630 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 631 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 632 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 633 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 634 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 635 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 636 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 637 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 638 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 639 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 640 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 641 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 642 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 643 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 644 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 645 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 646 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 647 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 648 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 649 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 650 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 651 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 652 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 653 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 654 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 655 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 656 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 657 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 658 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 659 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 660 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 661 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 662 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 663 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 664 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 665 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 666 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 667 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 668 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 669 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 670 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 671 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 672 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 673 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 674 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 675 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 676 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 677 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 678 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 679 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 680 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 681 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 682 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 683 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 684 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 685 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 686 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 687 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 688 | 3300049671 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought | Metagenome | Rhizosphere |
| 689 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 690 | 3300049682 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought | Metagenome | Rhizosphere |
| 691 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 692 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 693 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 694 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 695 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 696 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 697 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 698 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 699 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 700 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 701 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 702 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 703 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 704 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 705 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 706 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 707 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 708 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 709 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 710 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 711 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 712 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 713 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 714 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 715 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 716 | 3300053110 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere | Metagenome | Endosphere |
| 717 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 718 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 719 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 720 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 721 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 722 | 3300053128 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere | Metagenome | Endosphere |
| 723 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 724 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 725 | 3300053135 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere | Metagenome | Endosphere |
| 726 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 727 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 728 | 3300053141 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere | Metagenome | Endosphere |
| 729 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 730 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 731 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 732 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 733 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 734 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 735 | 3300053734 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 endosphere | Metagenome | Endosphere |
| 736 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 737 | 637000220 | Pseudomonas protegens Pf-5 | Isolate | Rhizoplane |
| 738 | 8002745576 | Marinomonas spartinae USM8 | Isolate | Rhizosphere |
| 739 | 8015687852 | Pseudomonas chlororaphis aurantiaca RP4 | Isolate | Rhizosphere |
| 740 | 8019769354 | Pseudomonas sp. MSSRFD41 | Isolate | Rhizosphere |
| 741 | 8019775933 | Pseudomonas sp. PvR083 | Isolate | Rhizosphere |
| 742 | 8029995093 | Pseudomonas atacamensis SM1 | Isolate | Rhizosphere |
| 743 | 8034962539 | Pseudomonas sediminis PI11 | Isolate | Rhizosphere |
| 744 | 8052494512 | Pseudomonas putida LD6 | Isolate | Unclassified |
| 745 | 8054285046 | Pseudomonas petroselini MAFF 311096 | Isolate | Nodule |
| 746 | 8054347763 | Pseudomonas carnis NWU Be30 | Isolate | Unclassified |
| 747 | 8054503363 | Pseudomonas sivasensis BsEB-1 | Isolate | Unclassified |
| 748 | 8054929484 | Pseudomonas vlassakiae RW4S1 | Isolate | Rhizosphere |
| 749 | 8055770955 | Pseudomonas chlororaphis qlu-1 | Isolate | Rhizosphere |
| 750 | 8055817908 | Pseudomonas pergaminensis 1008 | Isolate | Rhizosphere |
| 751 | 8056115690 | Pseudomonas muyukensis COW39 | Isolate | Rhizosphere |
| 752 | 8056120720 | Pseudomonas maumuensis COW77 | Isolate | Rhizosphere |
| 753 | 8056125926 | Pseudomonas azerbaijanorientalis SWRI123 | Isolate | Rhizosphere |
| 754 | 8056131705 | Pseudomonas asgharzadehiana SWRI132 | Isolate | Rhizosphere |
| 755 | 8056137416 | Pseudomonas fakonensis COW40 | Isolate | Rhizosphere |
| 756 | 8056143049 | Pseudomonas alvandae SWRI17 | Isolate | Rhizosphere |
| 757 | 8056148874 | Pseudomonas khavaziana SWRI124 | Isolate | Rhizosphere |
| 758 | 8056155041 | Pseudomonas farris SWRI79 | Isolate | Rhizosphere |
| 759 | 8056166840 | Pseudomonas triticicola SWRI88 | Isolate | Rhizosphere |
| 760 | 8056172158 | Pseudomonas ekonensis COR58 | Isolate | Rhizosphere |
| 761 | 8056177738 | Pseudomonas azerbaijanoccidentalis SWRI74 | Isolate | Rhizosphere |
| 762 | 8056569372 | Pseudomonas serboccidentalis IT-P374 | Isolate | Rhizosphere |
| 763 | 8057798959 | Pseudomonas piscis BW16M1 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 83.46 |
| Metatranscriptomes | 0.12 |
| Isolates | 16.43 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 12.74 |
| Nodule | 2.07 |
| Rhizoplane | 5.94 |
| Rhizosphere | 67.72 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 11.53 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MRS2a_Contig_1014 | 2124908027 | Bacteria | 1541 |
| 2 | MRS2a_Contig_772 | 2124908027 | Bacteria | 25215 |
| 3 | SwRhRL2b_contig_3165809 | 2162886007 | Bacteria | 1433 |
| 4 | JGI24741J21665_1001298 | 3300001915 | Bacteria | 7319 |
| 5 | JGI24737J22298_10060107 | 3300001990 | Bacteria | 1144 |
| 6 | JGI25162J39368_1002064 | 3300002737 | Bacteria | 8705 |
| 7 | JGI25154J39366_1006179 | 3300002738 | Bacteria | 1789 |
| 8 | JGI25158J39367_1019037 | 3300002739 | Bacteria | 847 |
| 9 | JGI25163J39215_1005917 | 3300002771 | Bacteria | 748 |
| 10 | JGI25164J39214_1001004 | 3300002772 | Bacteria | 8816 |
| 11 | JGI25164J39214_1001279 | 3300002772 | Bacteria | 6465 |
| 12 | JGI25152J39213_1022211 | 3300002773 | Bacteria | 1101 |
| 13 | JGI25151J46595_10004639 | 3300003187 | Bacteria | 7230 |
| 14 | JGI25151J46595_10020532 | 3300003187 | Bacteria | 2783 |
| 15 | JGI25151J46595_10132605 | 3300003187 | Bacteria | 618 |
| 16 | JGI25165J46597_1001843 | 3300003214 | Bacteria | 8801 |
| 17 | JGI25165J46597_1001871 | 3300003214 | Bacteria | 8639 |
| 18 | JGI25161J50226_1004834 | 3300003374 | Bacteria | 2750 |
| 19 | Ga0006562J51391_1029315 | 3300003578 | Bacteria | 2816 |
| 20 | Ga0006562J51391_1029316 | 3300003578 | Bacteria | 2690 |
| 21 | Ga0055538_1000012 | 3300003751 | Bacteria | 353826 |
| 22 | Ga0055539_1000017 | 3300003752 | Bacteria | 353873 |
| 23 | Ga0055533_1000021 | 3300003756 | Bacteria | 353826 |
| 24 | Ga0055532_1000119 | 3300003758 | Bacteria | 83382 |
| 25 | Ga0055525_1000078 | 3300003759 | Bacteria | 165788 |
| 26 | Ga0055535_1000849 | 3300003761 | Bacteria | 21724 |
| 27 | Ga0055542_1000033 | 3300003762 | Bacteria | 233997 |
| 28 | Ga0055537_1000490 | 3300003773 | Bacteria | 24227 |
| 29 | Ga0055536_1001878 | 3300003781 | Bacteria | 12222 |
| 30 | Ga0055536_1004465 | 3300003781 | Bacteria | 7143 |
| 31 | Ga0055536_1015428 | 3300003781 | Bacteria | 2615 |
| 32 | Ga0055536_1015916 | 3300003781 | Bacteria | 2544 |
| 33 | Ga0055536_1016356 | 3300003781 | Bacteria | 2485 |
| 34 | Ga0055536_1018125 | 3300003781 | Bacteria | 2270 |
| 35 | Ga0055536_1030978 | 3300003781 | Bacteria | 1407 |
| 36 | Ga0055534_1000042 | 3300003784 | Bacteria | 99433 |
| 37 | Ga0055528_1000242 | 3300003790 | Bacteria | 45905 |
| 38 | Ga0055530_10002438 | 3300003791 | Bacteria | 11991 |
| 39 | Ga0055530_10004784 | 3300003791 | Bacteria | 6800 |
| 40 | Ga0055530_10005023 | 3300003791 | Bacteria | 6521 |
| 41 | Ga0055530_10013632 | 3300003791 | Bacteria | 2761 |
| 42 | Ga0055530_10020556 | 3300003791 | Bacteria | 1969 |
| 43 | Ga0055540_1002002 | 3300003792 | Bacteria | 11371 |
| 44 | Ga0055540_1004056 | 3300003792 | Bacteria | 6800 |
| 45 | Ga0055540_1004284 | 3300003792 | Bacteria | 6521 |
| 46 | Ga0055540_1005786 | 3300003792 | Bacteria | 5081 |
| 47 | Ga0055540_1006621 | 3300003792 | Bacteria | 4552 |
| 48 | Ga0055540_1008764 | 3300003792 | Bacteria | 3591 |
| 49 | Ga0055540_1012754 | 3300003792 | Bacteria | 2615 |
| 50 | Ga0055531_10001137 | 3300003794 | Bacteria | 20591 |
| 51 | Ga0055531_10020084 | 3300003794 | Bacteria | 2663 |
| 52 | Ga0055531_10033391 | 3300003794 | Bacteria | 1659 |
| 53 | Ga0055541_1000012 | 3300003841 | Bacteria | 353826 |
| 54 | Ga0058692_1010460 | 3300003856 | Bacteria | 2291 |
| 55 | Ga0065714_10003175 | 3300005288 | Bacteria | 8557 |
| 56 | Ga0065714_10004868 | 3300005288 | Bacteria | 4380 |
| 57 | Ga0065714_10005207 | 3300005288 | Bacteria | 5038 |
| 58 | Ga0065714_10009160 | 3300005288 | Bacteria | 2379 |
| 59 | Ga0065714_10009607 | 3300005288 | Bacteria | 6555 |
| 60 | Ga0065714_10011643 | 3300005288 | Bacteria | 2115 |
| 61 | Ga0065714_10015892 | 3300005288 | Bacteria | 1857 |
| 62 | Ga0065714_10023761 | 3300005288 | Bacteria | 1834 |
| 63 | Ga0065714_10098776 | 3300005288 | Bacteria | 1697 |
| 64 | Ga0065714_10131594 | 3300005288 | Bacteria | 1245 |
| 65 | Ga0065714_10243308 | 3300005288 | Bacteria | 780 |
| 66 | Ga0065714_10287392 | 3300005288 | Bacteria | 713 |
| 67 | Ga0065704_10005330 | 3300005289 | Bacteria | 3480 |
| 68 | Ga0065704_10026003 | 3300005289 | Bacteria | 2247 |
| 69 | Ga0065704_10141314 | 3300005289 | Bacteria | 1515 |
| 70 | Ga0065704_10240311 | 3300005289 | Bacteria | 1013 |
| 71 | Ga0065704_10309346 | 3300005289 | Bacteria | 863 |
| 72 | Ga0065704_10717670 | 3300005289 | Bacteria | 554 |
| 73 | Ga0065712_10000996 | 3300005290 | Bacteria | 7599 |
| 74 | Ga0065712_10067862 | 3300005290 | Bacteria | 24733 |
| 75 | Ga0065715_10009373 | 3300005293 | Bacteria | 2932 |
| 76 | Ga0070658_10071426 | 3300005327 | Bacteria | 2843 |
| 77 | Ga0070658_10093094 | 3300005327 | Bacteria | 2486 |
| 78 | Ga0070658_11909505 | 3300005327 | Bacteria | 513 |
| 79 | Ga0070683_102276832 | 3300005329 | Bacteria | 520 |
| 80 | Ga0070670_100016361 | 3300005331 | Bacteria | 6370 |
| 81 | Ga0070670_100088585 | 3300005331 | Bacteria | 2660 |
| 82 | Ga0068869_100636661 | 3300005334 | Bacteria | 904 |
| 83 | Ga0070666_10396438 | 3300005335 | Bacteria | 992 |
| 84 | Ga0070680_100149304 | 3300005336 | Bacteria | 1962 |
| 85 | Ga0070660_100236784 | 3300005339 | Bacteria | 1486 |
| 86 | Ga0070660_100476071 | 3300005339 | Bacteria | 1037 |
| 87 | Ga0070660_101296214 | 3300005339 | Bacteria | 618 |
| 88 | Ga0070661_100001250 | 3300005344 | Bacteria | 17835 |
| 89 | Ga0070661_100105889 | 3300005344 | Bacteria | 2097 |
| 90 | Ga0070661_100375478 | 3300005344 | Bacteria | 1120 |
| 91 | Ga0070661_101175700 | 3300005344 | Bacteria | 641 |
| 92 | Ga0070668_100466150 | 3300005347 | Bacteria | 1089 |
| 93 | Ga0070669_100002433 | 3300005353 | Bacteria | 13484 |
| 94 | Ga0070669_100003104 | 3300005353 | Bacteria | 11955 |
| 95 | Ga0070669_100022656 | 3300005353 | Bacteria | 4492 |
| 96 | Ga0070659_100142285 | 3300005366 | Bacteria | 1953 |
| 97 | Ga0070659_101583069 | 3300005366 | Bacteria | 585 |
| 98 | Ga0070667_100039195 | 3300005367 | Bacteria | 3971 |
| 99 | Ga0070667_102125694 | 3300005367 | Bacteria | 529 |
| 100 | Ga0070709_10011208 | 3300005434 | Bacteria | 4987 |
| 101 | Ga0070713_100222930 | 3300005436 | Bacteria | 1711 |
| 102 | Ga0070713_100297250 | 3300005436 | Bacteria | 1486 |
| 103 | Ga0070710_10706905 | 3300005437 | Bacteria | 712 |
| 104 | Ga0070678_100110197 | 3300005456 | Bacteria | 2152 |
| 105 | Ga0070678_101021335 | 3300005456 | Bacteria | 761 |
| 106 | Ga0070662_100000829 | 3300005457 | Bacteria | 19038 |
| 107 | Ga0070662_100013692 | 3300005457 | Bacteria | 5401 |
| 108 | Ga0070662_100053572 | 3300005457 | Bacteria | 2921 |
| 109 | Ga0070662_100268482 | 3300005457 | Bacteria | 1377 |
| 110 | Ga0070662_100927868 | 3300005457 | Bacteria | 744 |
| 111 | Ga0070681_10076285 | 3300005458 | Bacteria | 3311 |
| 112 | Ga0070681_10155002 | 3300005458 | Bacteria | 2216 |
| 113 | Ga0068867_100157834 | 3300005459 | Bacteria | 1787 |
| 114 | Ga0068867_100238418 | 3300005459 | Bacteria | 1474 |
| 115 | Ga0070679_100060117 | 3300005530 | Bacteria | 3787 |
| 116 | Ga0070679_100076853 | 3300005530 | Bacteria | 3327 |
| 117 | Ga0070679_100342252 | 3300005530 | Bacteria | 1444 |
| 118 | Ga0068853_100000031 | 3300005539 | Bacteria | 116269 |
| 119 | Ga0068853_100221057 | 3300005539 | Bacteria | 1730 |
| 120 | Ga0068853_100882267 | 3300005539 | Bacteria | 859 |
| 121 | Ga0068853_101824436 | 3300005539 | Bacteria | 590 |
| 122 | Ga0070672_100469195 | 3300005543 | Bacteria | 1086 |
| 123 | Ga0070665_100000571 | 3300005548 | Bacteria | 51504 |
| 124 | Ga0070665_100013698 | 3300005548 | Bacteria | 8159 |
| 125 | Ga0070665_100059460 | 3300005548 | Bacteria | 3831 |
| 126 | Ga0070665_100065852 | 3300005548 | Bacteria | 3634 |
| 127 | Ga0070665_100124423 | 3300005548 | Bacteria | 2580 |
| 128 | Ga0070665_100244621 | 3300005548 | Bacteria | 1794 |
| 129 | Ga0070665_100291021 | 3300005548 | Bacteria | 1636 |
| 130 | Ga0070665_100675342 | 3300005548 | Bacteria | 1046 |
| 131 | Ga0070665_101020082 | 3300005548 | Bacteria | 839 |
| 132 | Ga0068855_100025725 | 3300005563 | Bacteria | 7038 |
| 133 | Ga0068855_100029751 | 3300005563 | Bacteria | 6530 |
| 134 | Ga0068855_100077352 | 3300005563 | Bacteria | 3861 |
| 135 | Ga0068855_100381117 | 3300005563 | Bacteria | 1548 |
| 136 | Ga0068855_100910186 | 3300005563 | Bacteria | 929 |
| 137 | Ga0070664_100001524 | 3300005564 | Bacteria | 18496 |
| 138 | Ga0068857_100247199 | 3300005577 | Bacteria | 1634 |
| 139 | Ga0068857_100851124 | 3300005577 | Bacteria | 873 |
| 140 | Ga0068854_100013592 | 3300005578 | Bacteria | 5348 |
| 141 | Ga0068856_100045082 | 3300005614 | Bacteria | 4340 |
| 142 | Ga0068856_101061333 | 3300005614 | Bacteria | 828 |
| 143 | Ga0068856_101622280 | 3300005614 | Bacteria | 660 |
| 144 | Ga0068852_100016998 | 3300005616 | Bacteria | 5695 |
| 145 | Ga0068852_100764704 | 3300005616 | Bacteria | 979 |
| 146 | Ga0068859_100018254 | 3300005617 | Bacteria | 7053 |
| 147 | Ga0068851_10000007 | 3300005834 | Bacteria | 244101 |
| 148 | Ga0068863_100025309 | 3300005841 | Bacteria | 5658 |
| 149 | Ga0068863_100671152 | 3300005841 | Bacteria | 1029 |
| 150 | Ga0068862_100076069 | 3300005844 | Bacteria | 2905 |
| 151 | Ga0081455_10409371 | 3300005937 | Bacteria | 939 |
| 152 | Ga0075365_10000743 | 3300006038 | Bacteria | 13196 |
| 153 | Ga0075365_10029846 | 3300006038 | Bacteria | 3488 |
| 154 | Ga0075365_10106132 | 3300006038 | Bacteria | 1927 |
| 155 | Ga0075365_10490777 | 3300006038 | Bacteria | 868 |
| 156 | Ga0075363_100011892 | 3300006048 | Bacteria | 4180 |
| 157 | Ga0075363_100023389 | 3300006048 | Bacteria | 3131 |
| 158 | Ga0075363_100045017 | 3300006048 | Bacteria | 2339 |
| 159 | Ga0075363_100184208 | 3300006048 | Bacteria | 1189 |
| 160 | Ga0075363_100239570 | 3300006048 | Bacteria | 1043 |
| 161 | Ga0075364_10017430 | 3300006051 | Bacteria | 4487 |
| 162 | Ga0075364_10038491 | 3300006051 | Bacteria | 3098 |
| 163 | Ga0075364_10124551 | 3300006051 | Bacteria | 1727 |
| 164 | Ga0075364_10138651 | 3300006051 | Bacteria | 1635 |
| 165 | Ga0075364_10349567 | 3300006051 | Bacteria | 1008 |
| 166 | Ga0075364_10498566 | 3300006051 | Bacteria | 832 |
| 167 | Ga0075364_10816516 | 3300006051 | Bacteria | 635 |
| 168 | Ga0075432_10015325 | 3300006058 | Bacteria | 2613 |
| 169 | Ga0075432_10028921 | 3300006058 | Bacteria | 1912 |
| 170 | Ga0075432_10029537 | 3300006058 | Bacteria | 1893 |
| 171 | Ga0075432_10033375 | 3300006058 | Bacteria | 1785 |
| 172 | Ga0075432_10067101 | 3300006058 | Bacteria | 1285 |
| 173 | Ga0075432_10191120 | 3300006058 | Bacteria | 806 |
| 174 | Ga0075432_10294525 | 3300006058 | Bacteria | 672 |
| 175 | Ga0075362_10025103 | 3300006177 | Bacteria | 2533 |
| 176 | Ga0075362_10027254 | 3300006177 | Bacteria | 2445 |
| 177 | Ga0075362_10069996 | 3300006177 | Bacteria | 1601 |
| 178 | Ga0075362_10165140 | 3300006177 | Bacteria | 1067 |
| 179 | Ga0075367_10002366 | 3300006178 | Bacteria | 8576 |
| 180 | Ga0075367_10072090 | 3300006178 | Bacteria | 2079 |
| 181 | Ga0075367_10119723 | 3300006178 | Bacteria | 1622 |
| 182 | Ga0075367_10286879 | 3300006178 | Bacteria | 1035 |
| 183 | Ga0075367_10451170 | 3300006178 | Bacteria | 815 |
| 184 | Ga0075369_10001094 | 3300006186 | Bacteria | 9087 |
| 185 | Ga0075369_10184425 | 3300006186 | Bacteria | 960 |
| 186 | Ga0075427_10000019 | 3300006194 | Bacteria | 10650 |
| 187 | Ga0075366_10023437 | 3300006195 | Bacteria | 3595 |
| 188 | Ga0075366_10034240 | 3300006195 | Bacteria | 2991 |
| 189 | Ga0075366_10298341 | 3300006195 | Bacteria | 986 |
| 190 | Ga0097621_100003551 | 3300006237 | Bacteria | 10769 |
| 191 | Ga0097621_100472123 | 3300006237 | Bacteria | 1133 |
| 192 | Ga0097621_101038863 | 3300006237 | Bacteria | 767 |
| 193 | Ga0075370_10017763 | 3300006353 | Bacteria | 3847 |
| 194 | Ga0075370_10018167 | 3300006353 | Bacteria | 3811 |
| 195 | Ga0075370_10019251 | 3300006353 | Bacteria | 3716 |
| 196 | Ga0075370_10021275 | 3300006353 | Bacteria | 3554 |
| 197 | Ga0075370_10023017 | 3300006353 | Bacteria | 3427 |
| 198 | Ga0075370_10075336 | 3300006353 | Bacteria | 1934 |
| 199 | Ga0068871_100107957 | 3300006358 | Bacteria | 2338 |
| 200 | Ga0075434_101843405 | 3300006871 | Unclassified | 611 |
| 201 | Ga0075429_100010636 | 3300006880 | Bacteria | 7960 |
| 202 | Ga0068865_100786334 | 3300006881 | Bacteria | 820 |
| 203 | Ga0075436_100188367 | 3300006914 | Bacteria | 1459 |
| 204 | Ga0075436_101095196 | 3300006914 | Bacteria | 599 |
| 205 | Ga0097620_100018254 | 3300006931 | Bacteria | 7053 |
| 206 | Ga0099823_1020334 | 3300006944 | Bacteria | 6279 |
| 207 | Ga0079104_1000886 | 3300006946 | Bacteria | 24528 |
| 208 | Ga0079104_1002975 | 3300006946 | Bacteria | 8349 |
| 209 | Ga0079104_1087561 | 3300006946 | Bacteria | 635 |
| 210 | Ga0079104_1104169 | 3300006946 | Bacteria | 565 |
| 211 | Ga0099826_10008314 | 3300006948 | Bacteria | 7709 |
| 212 | Ga0099826_10009833 | 3300006948 | Bacteria | 7146 |
| 213 | Ga0099826_10075199 | 3300006948 | Bacteria | 2127 |
| 214 | Ga0075435_101277415 | 3300007076 | Bacteria | 643 |
| 215 | Ga0105251_10000089 | 3300009011 | Bacteria | 88101 |
| 216 | Ga0105251_10006466 | 3300009011 | Bacteria | 7458 |
| 217 | Ga0105251_10008076 | 3300009011 | Bacteria | 6375 |
| 218 | Ga0105251_10014857 | 3300009011 | Bacteria | 4280 |
| 219 | Ga0105251_10017646 | 3300009011 | Bacteria | 3818 |
| 220 | Ga0105251_10033069 | 3300009011 | Bacteria | 2571 |
| 221 | Ga0105251_10035071 | 3300009011 | Bacteria | 2477 |
| 222 | Ga0105251_10059218 | 3300009011 | Bacteria | 1807 |
| 223 | Ga0105251_10336160 | 3300009011 | Bacteria | 688 |
| 224 | Ga0105251_10378634 | 3300009011 | Bacteria | 648 |
| 225 | Ga0105251_10430314 | 3300009011 | Bacteria | 609 |
| 226 | Ga0105244_10000196 | 3300009036 | Bacteria | 61364 |
| 227 | Ga0105244_10003747 | 3300009036 | Bacteria | 10736 |
| 228 | Ga0105244_10005963 | 3300009036 | Bacteria | 7987 |
| 229 | Ga0105244_10011172 | 3300009036 | Bacteria | 5405 |
| 230 | Ga0105244_10027606 | 3300009036 | Bacteria | 3057 |
| 231 | Ga0105244_10041570 | 3300009036 | Bacteria | 2381 |
| 232 | Ga0105244_10060997 | 3300009036 | Bacteria | 1899 |
| 233 | Ga0105244_10061037 | 3300009036 | Bacteria | 1899 |
| 234 | Ga0105244_10065517 | 3300009036 | Bacteria | 1820 |
| 235 | Ga0105244_10097606 | 3300009036 | Bacteria | 1440 |
| 236 | Ga0105244_10144840 | 3300009036 | Bacteria | 1141 |
| 237 | Ga0105244_10187125 | 3300009036 | Bacteria | 980 |
| 238 | Ga0105244_10246856 | 3300009036 | Bacteria | 833 |
| 239 | Ga0105250_10001996 | 3300009092 | Bacteria | 10567 |
| 240 | Ga0105250_10004445 | 3300009092 | Bacteria | 6453 |
| 241 | Ga0105250_10024530 | 3300009092 | Bacteria | 2430 |
| 242 | Ga0105250_10033320 | 3300009092 | Bacteria | 2068 |
| 243 | Ga0105250_10042488 | 3300009092 | Bacteria | 1822 |
| 244 | Ga0105250_10085431 | 3300009092 | Bacteria | 1281 |
| 245 | Ga0105250_10129468 | 3300009092 | Bacteria | 1041 |
| 246 | Ga0105250_10145565 | 3300009092 | Bacteria | 984 |
| 247 | Ga0105250_10357028 | 3300009092 | Bacteria | 641 |
| 248 | Ga0105240_10000196 | 3300009093 | Bacteria | 123276 |
| 249 | Ga0105240_10026474 | 3300009093 | Bacteria | 7610 |
| 250 | Ga0105240_10030705 | 3300009093 | Bacteria | 6980 |
| 251 | Ga0105240_10059229 | 3300009093 | Bacteria | 4780 |
| 252 | Ga0105240_10163963 | 3300009093 | Bacteria | 2637 |
| 253 | Ga0105240_10172079 | 3300009093 | Bacteria | 2564 |
| 254 | Ga0105240_10441892 | 3300009093 | Bacteria | 1457 |
| 255 | Ga0105240_10794417 | 3300009093 | Bacteria | 1025 |
| 256 | Ga0105240_10815851 | 3300009093 | Bacteria | 1010 |
| 257 | Ga0105240_10874246 | 3300009093 | Bacteria | 969 |
| 258 | Ga0111539_11074799 | 3300009094 | Bacteria | 935 |
| 259 | Ga0105245_10275295 | 3300009098 | Bacteria | 1643 |
| 260 | Ga0105245_10763192 | 3300009098 | Bacteria | 1003 |
| 261 | Ga0105243_10001894 | 3300009148 | Bacteria | 17846 |
| 262 | Ga0105243_10003861 | 3300009148 | Bacteria | 11970 |
| 263 | Ga0105243_10006988 | 3300009148 | Bacteria | 8690 |
| 264 | Ga0105243_10010063 | 3300009148 | Bacteria | 7191 |
| 265 | Ga0105243_10016847 | 3300009148 | Bacteria | 5524 |
| 266 | Ga0105243_10019997 | 3300009148 | Bacteria | 5076 |
| 267 | Ga0105243_10029768 | 3300009148 | Bacteria | 4201 |
| 268 | Ga0105243_10066246 | 3300009148 | Bacteria | 2904 |
| 269 | Ga0105243_10117165 | 3300009148 | Bacteria | 2238 |
| 270 | Ga0105243_10161863 | 3300009148 | Bacteria | 1930 |
| 271 | Ga0105243_10275276 | 3300009148 | Bacteria | 1513 |
| 272 | Ga0105241_10411683 | 3300009174 | Bacteria | 1188 |
| 273 | Ga0105241_11885326 | 3300009174 | Bacteria | 585 |
| 274 | Ga0105241_11950070 | 3300009174 | Bacteria | 577 |
| 275 | Ga0105242_10000836 | 3300009176 | Bacteria | 23975 |
| 276 | Ga0105242_10238879 | 3300009176 | Bacteria | 1632 |
| 277 | Ga0105242_10273086 | 3300009176 | Bacteria | 1532 |
| 278 | Ga0105242_10315112 | 3300009176 | Bacteria | 1433 |
| 279 | Ga0105242_10447245 | 3300009176 | Bacteria | 1217 |
| 280 | Ga0105242_11602830 | 3300009176 | Bacteria | 685 |
| 281 | Ga0105248_10001345 | 3300009177 | Bacteria | 27389 |
| 282 | Ga0105237_10012953 | 3300009545 | Bacteria | 8758 |
| 283 | Ga0105237_10020421 | 3300009545 | Bacteria | 6828 |
| 284 | Ga0105237_10035344 | 3300009545 | Bacteria | 5057 |
| 285 | Ga0105237_10331750 | 3300009545 | Bacteria | 1525 |
| 286 | Ga0105237_10372931 | 3300009545 | Bacteria | 1432 |
| 287 | Ga0105237_10645582 | 3300009545 | Bacteria | 1065 |
| 288 | Ga0105237_12468941 | 3300009545 | Bacteria | 530 |
| 289 | Ga0105238_10006772 | 3300009551 | Bacteria | 11448 |
| 290 | Ga0105238_10041466 | 3300009551 | Bacteria | 4662 |
| 291 | Ga0105238_10045275 | 3300009551 | Bacteria | 4445 |
| 292 | Ga0105238_10096688 | 3300009551 | Bacteria | 2939 |
| 293 | Ga0105238_10128726 | 3300009551 | Bacteria | 2510 |
| 294 | Ga0105238_10408404 | 3300009551 | Bacteria | 1352 |
| 295 | Ga0105238_10606979 | 3300009551 | Bacteria | 1102 |
| 296 | Ga0105238_11536362 | 3300009551 | Bacteria | 695 |
| 297 | Ga0105239_10003927 | 3300010375 | Bacteria | 18014 |
| 298 | Ga0105239_10013020 | 3300010375 | Bacteria | 9249 |
| 299 | Ga0105239_10144596 | 3300010375 | Bacteria | 2651 |
| 300 | Ga0105239_10208649 | 3300010375 | Bacteria | 2189 |
| 301 | Ga0105239_10374025 | 3300010375 | Bacteria | 1610 |
| 302 | Ga0105239_10649836 | 3300010375 | Bacteria | 1205 |
| 303 | Ga0105239_10685003 | 3300010375 | Bacteria | 1172 |
| 304 | Ga0105239_11930690 | 3300010375 | Bacteria | 685 |
| 305 | Ga0105246_10005173 | 3300011119 | Bacteria | 7927 |
| 306 | Ga0105246_10011634 | 3300011119 | Bacteria | 5465 |
| 307 | Ga0105246_10014367 | 3300011119 | Bacteria | 4979 |
| 308 | Ga0105246_10018086 | 3300011119 | Bacteria | 4489 |
| 309 | Ga0105246_10088711 | 3300011119 | Bacteria | 2223 |
| 310 | Ga0105246_10371024 | 3300011119 | Bacteria | 1179 |
| 311 | Ga0157345_1032913 | 3300012498 | Bacteria | 590 |
| 312 | Ga0157347_1001430 | 3300012502 | Bacteria | 1871 |
| 313 | Ga0157373_10008319 | 3300013100 | Bacteria | 7709 |
| 314 | Ga0157373_10018807 | 3300013100 | Bacteria | 5027 |
| 315 | Ga0157373_10066274 | 3300013100 | Bacteria | 2555 |
| 316 | Ga0157373_10088195 | 3300013100 | Bacteria | 2186 |
| 317 | Ga0157373_10430524 | 3300013100 | Bacteria | 948 |
| 318 | Ga0157373_10505974 | 3300013100 | Bacteria | 873 |
| 319 | Ga0157373_10576649 | 3300013100 | Bacteria | 817 |
| 320 | Ga0157371_10000109 | 3300013102 | Bacteria | 124990 |
| 321 | Ga0157371_10008603 | 3300013102 | Bacteria | 8107 |
| 322 | Ga0157371_10045024 | 3300013102 | Bacteria | 3141 |
| 323 | Ga0157371_10234453 | 3300013102 | Bacteria | 1319 |
| 324 | Ga0157370_10007852 | 3300013104 | Bacteria | 11562 |
| 325 | Ga0157370_10017421 | 3300013104 | Bacteria | 7248 |
| 326 | Ga0157370_10040646 | 3300013104 | Bacteria | 4490 |
| 327 | Ga0157370_10116418 | 3300013104 | Bacteria | 2497 |
| 328 | Ga0157370_10134274 | 3300013104 | Bacteria | 2307 |
| 329 | Ga0157370_10210777 | 3300013104 | Bacteria | 1801 |
| 330 | Ga0157370_10323710 | 3300013104 | Bacteria | 1422 |
| 331 | Ga0157370_10359664 | 3300013104 | Bacteria | 1341 |
| 332 | Ga0157370_10371228 | 3300013104 | Bacteria | 1318 |
| 333 | Ga0157370_10563491 | 3300013104 | Bacteria | 1044 |
| 334 | Ga0157370_10953585 | 3300013104 | Bacteria | 778 |
| 335 | Ga0157370_11569551 | 3300013104 | Bacteria | 591 |
| 336 | Ga0157369_10041845 | 3300013105 | Bacteria | 5000 |
| 337 | Ga0157369_10407945 | 3300013105 | Bacteria | 1409 |
| 338 | Ga0157369_10414656 | 3300013105 | Bacteria | 1396 |
| 339 | Ga0157369_10478494 | 3300013105 | Bacteria | 1289 |
| 340 | Ga0157369_10703299 | 3300013105 | Bacteria | 1041 |
| 341 | Ga0157378_10000149 | 3300013297 | Bacteria | 65310 |
| 342 | Ga0157378_10370848 | 3300013297 | Bacteria | 1403 |
| 343 | Ga0157378_10461464 | 3300013297 | Bacteria | 1262 |
| 344 | Ga0157378_11139984 | 3300013297 | Bacteria | 818 |
| 345 | Ga0163162_10013294 | 3300013306 | Bacteria | 8042 |
| 346 | Ga0163162_10600889 | 3300013306 | Bacteria | 1226 |
| 347 | Ga0163162_10608873 | 3300013306 | Bacteria | 1218 |
| 348 | Ga0157372_10124073 | 3300013307 | Bacteria | 2969 |
| 349 | Ga0157372_11817603 | 3300013307 | Bacteria | 701 |
| 350 | Ga0157375_10780112 | 3300013308 | Bacteria | 1105 |
| 351 | Ga0157375_11677046 | 3300013308 | Bacteria | 752 |
| 352 | Ga0182008_10003873 | 3300014497 | Bacteria | 8884 |
| 353 | Ga0182008_10004134 | 3300014497 | Bacteria | 8546 |
| 354 | Ga0182008_10004162 | 3300014497 | Bacteria | 8511 |
| 355 | Ga0182008_10006124 | 3300014497 | Bacteria | 6759 |
| 356 | Ga0182008_10007331 | 3300014497 | Bacteria | 6100 |
| 357 | Ga0182008_10039089 | 3300014497 | Bacteria | 2372 |
| 358 | Ga0182008_10059379 | 3300014497 | Bacteria | 1887 |
| 359 | Ga0182008_10109911 | 3300014497 | Bacteria | 1366 |
| 360 | Ga0182008_10156555 | 3300014497 | Bacteria | 1145 |
| 361 | Ga0182008_10484950 | 3300014497 | Bacteria | 677 |
| 362 | Ga0157376_10094787 | 3300014969 | Bacteria | 2594 |
| 363 | Ga0157376_10243875 | 3300014969 | Bacteria | 1675 |
| 364 | Ga0157376_11013557 | 3300014969 | Bacteria | 853 |
| 365 | Ga0182006_1002216 | 3300015261 | Bacteria | 10773 |
| 366 | Ga0182006_1002773 | 3300015261 | Bacteria | 9367 |
| 367 | Ga0182006_1005056 | 3300015261 | Bacteria | 6341 |
| 368 | Ga0182006_1006299 | 3300015261 | Bacteria | 5530 |
| 369 | Ga0182006_1009996 | 3300015261 | Bacteria | 4235 |
| 370 | Ga0182006_1017980 | 3300015261 | Bacteria | 2993 |
| 371 | Ga0182006_1029087 | 3300015261 | Bacteria | 2241 |
| 372 | Ga0182006_1033525 | 3300015261 | Bacteria | 2058 |
| 373 | Ga0182006_1046029 | 3300015261 | Bacteria | 1696 |
| 374 | Ga0182006_1064534 | 3300015261 | Bacteria | 1373 |
| 375 | Ga0182006_1083909 | 3300015261 | Bacteria | 1158 |
| 376 | Ga0182006_1084670 | 3300015261 | Bacteria | 1151 |
| 377 | Ga0182007_10000601 | 3300015262 | Bacteria | 21082 |
| 378 | Ga0182007_10000825 | 3300015262 | Bacteria | 17267 |
| 379 | Ga0182007_10003930 | 3300015262 | Bacteria | 6878 |
| 380 | Ga0182007_10050733 | 3300015262 | Bacteria | 1369 |
| 381 | Ga0182007_10418662 | 3300015262 | Bacteria | 512 |
| 382 | Ga0182005_1002649 | 3300015265 | Bacteria | 6304 |
| 383 | Ga0182005_1044755 | 3300015265 | Bacteria | 1202 |
| 384 | Ga0182005_1045196 | 3300015265 | Bacteria | 1196 |
| 385 | Ga0163161_10000166 | 3300017792 | Bacteria | 60327 |
| 386 | Ga0163161_10007380 | 3300017792 | Bacteria | 7592 |
| 387 | Ga0163161_10021628 | 3300017792 | Bacteria | 4520 |
| 388 | Ga0163161_10029422 | 3300017792 | Bacteria | 3906 |
| 389 | Ga0163161_10034169 | 3300017792 | Bacteria | 3636 |
| 390 | Ga0163161_10065983 | 3300017792 | Bacteria | 2642 |
| 391 | Ga0163161_11676332 | 3300017792 | Bacteria | 563 |
| 392 | Ga0163161_11770748 | 3300017792 | Bacteria | 549 |
| 393 | Ga0213874_10001191 | 3300021377 | Bacteria | 5330 |
| 394 | Ga0213876_10017706 | 3300021384 | Bacteria | 3759 |
| 395 | Ga0213876_10161765 | 3300021384 | Bacteria | 1191 |
| 396 | Ga0209435_102395 | 3300025206 | Bacteria | 2202 |
| 397 | Ga0209760_100253 | 3300025207 | Bacteria | 21542 |
| 398 | Ga0209760_100420 | 3300025207 | Bacteria | 10149 |
| 399 | Ga0209436_122849 | 3300025208 | Bacteria | 797 |
| 400 | Ga0209784_100007 | 3300025224 | Bacteria | 747715 |
| 401 | Ga0209566_100009 | 3300025225 | Bacteria | 554018 |
| 402 | Ga0209674_100021 | 3300025226 | Bacteria | 629811 |
| 403 | Ga0209672_101630 | 3300025228 | Bacteria | 7422 |
| 404 | Ga0209147_100009 | 3300025229 | Bacteria | 747409 |
| 405 | Ga0209147_100783 | 3300025229 | Bacteria | 15459 |
| 406 | Ga0209563_100018 | 3300025230 | Bacteria | 747850 |
| 407 | Ga0207427_100005 | 3300025231 | Bacteria | 797999 |
| 408 | Ga0207427_100006 | 3300025231 | Bacteria | 785415 |
| 409 | Ga0207427_116162 | 3300025231 | Bacteria | 700 |
| 410 | Ga0209437_100013 | 3300025233 | Bacteria | 785457 |
| 411 | Ga0209437_100018 | 3300025233 | Bacteria | 694400 |
| 412 | Ga0209258_100089 | 3300025242 | Bacteria | 234040 |
| 413 | Ga0209258_100249 | 3300025242 | Bacteria | 98135 |
| 414 | Ga0209646_1000298 | 3300025246 | Bacteria | 41044 |
| 415 | Ga0209677_100012 | 3300025253 | Bacteria | 554018 |
| 416 | Ga0209148_1000097 | 3300025254 | Bacteria | 234049 |
| 417 | Ga0209759_1014362 | 3300025256 | Bacteria | 2098 |
| 418 | Ga0209759_1015841 | 3300025256 | Bacteria | 1929 |
| 419 | Ga0209129_1000071 | 3300025258 | Bacteria | 210729 |
| 420 | Ga0209129_1005062 | 3300025258 | Bacteria | 4839 |
| 421 | Ga0209129_1005094 | 3300025258 | Bacteria | 4818 |
| 422 | Ga0209233_1000013 | 3300025261 | Bacteria | 1013785 |
| 423 | Ga0209233_1000021 | 3300025261 | Bacteria | 798078 |
| 424 | Ga0209233_1000022 | 3300025261 | Bacteria | 785415 |
| 425 | Ga0209565_1000083 | 3300025263 | Bacteria | 154007 |
| 426 | Ga0209565_1000334 | 3300025263 | Bacteria | 41939 |
| 427 | Ga0209565_1002220 | 3300025263 | Bacteria | 7260 |
| 428 | Ga0209455_1013798 | 3300025272 | Bacteria | 1860 |
| 429 | Ga0209673_1000323 | 3300025273 | Bacteria | 87588 |
| 430 | Ga0209673_1001906 | 3300025273 | Bacteria | 16707 |
| 431 | Ga0209673_1022389 | 3300025273 | Bacteria | 2181 |
| 432 | Ga0209130_1003240 | 3300025284 | Bacteria | 7142 |
| 433 | Ga0209130_1003577 | 3300025284 | Bacteria | 6499 |
| 434 | Ga0209675_1000081 | 3300025291 | Bacteria | 154007 |
| 435 | Ga0209675_1003063 | 3300025291 | Bacteria | 8197 |
| 436 | Ga0209675_1007159 | 3300025291 | Bacteria | 4326 |
| 437 | Ga0209675_1032780 | 3300025291 | Bacteria | 1212 |
| 438 | Ga0209676_1000005 | 3300025292 | Bacteria | 1076001 |
| 439 | Ga0209676_1000015 | 3300025292 | Bacteria | 784458 |
| 440 | Ga0209676_1000030 | 3300025292 | Bacteria | 506421 |
| 441 | Ga0209676_1000041 | 3300025292 | Bacteria | 424583 |
| 442 | Ga0209676_1001510 | 3300025292 | Bacteria | 21204 |
| 443 | Ga0209676_1005014 | 3300025292 | Bacteria | 7091 |
| 444 | Ga0209676_1009214 | 3300025292 | Bacteria | 4289 |
| 445 | Ga0209676_1021084 | 3300025292 | Bacteria | 2197 |
| 446 | Ga0209676_1073271 | 3300025292 | Bacteria | 806 |
| 447 | Ga0209025_1000544 | 3300025294 | Bacteria | 70638 |
| 448 | Ga0209025_1000854 | 3300025294 | Bacteria | 48260 |
| 449 | Ga0209025_1001296 | 3300025294 | Bacteria | 34134 |
| 450 | Ga0209025_1012749 | 3300025294 | Bacteria | 5355 |
| 451 | Ga0209025_1015457 | 3300025294 | Bacteria | 4602 |
| 452 | Ga0209564_1000239 | 3300025295 | Bacteria | 119761 |
| 453 | Ga0209758_1000027 | 3300025297 | Bacteria | 549650 |
| 454 | Ga0209758_1000185 | 3300025297 | Bacteria | 139330 |
| 455 | Ga0209758_1003037 | 3300025297 | Bacteria | 15990 |
| 456 | Ga0209050_1000007 | 3300025298 | Bacteria | 1187891 |
| 457 | Ga0209050_1000024 | 3300025298 | Bacteria | 533389 |
| 458 | Ga0209050_1000030 | 3300025298 | Bacteria | 463381 |
| 459 | Ga0209050_1000332 | 3300025298 | Bacteria | 94224 |
| 460 | Ga0209050_1002018 | 3300025298 | Bacteria | 18917 |
| 461 | Ga0209050_1006114 | 3300025298 | Bacteria | 7263 |
| 462 | Ga0209256_1000081 | 3300025299 | Bacteria | 222908 |
| 463 | Ga0207426_1000027 | 3300025302 | Bacteria | 513176 |
| 464 | Ga0207426_1000614 | 3300025302 | Bacteria | 45951 |
| 465 | Ga0209051_1000009 | 3300025303 | Bacteria | 706778 |
| 466 | Ga0209051_1000012 | 3300025303 | Bacteria | 595474 |
| 467 | Ga0209051_1000373 | 3300025303 | Bacteria | 64348 |
| 468 | Ga0209051_1000426 | 3300025303 | Bacteria | 57797 |
| 469 | Ga0209051_1000719 | 3300025303 | Bacteria | 36150 |
| 470 | Ga0209051_1002063 | 3300025303 | Bacteria | 15237 |
| 471 | Ga0209051_1020630 | 3300025303 | Bacteria | 2830 |
| 472 | Ga0209051_1137235 | 3300025303 | Bacteria | 594 |
| 473 | Ga0209257_1000011 | 3300025304 | Bacteria | 1112630 |
| 474 | Ga0209257_1000262 | 3300025304 | Bacteria | 121021 |
| 475 | Ga0209257_1000449 | 3300025304 | Bacteria | 77522 |
| 476 | Ga0209257_1004152 | 3300025304 | Bacteria | 11519 |
| 477 | Ga0207656_10000015 | 3300025321 | Bacteria | 125447 |
| 478 | Ga0207696_1000055 | 3300025711 | Bacteria | 258289 |
| 479 | Ga0207696_1000078 | 3300025711 | Bacteria | 207623 |
| 480 | Ga0207696_1000080 | 3300025711 | Bacteria | 199217 |
| 481 | Ga0207696_1000204 | 3300025711 | Bacteria | 90602 |
| 482 | Ga0207696_1003242 | 3300025711 | Bacteria | 7507 |
| 483 | Ga0207696_1003560 | 3300025711 | Bacteria | 7037 |
| 484 | Ga0207696_1004230 | 3300025711 | Bacteria | 6236 |
| 485 | Ga0207696_1006665 | 3300025711 | Bacteria | 4617 |
| 486 | Ga0207696_1009586 | 3300025711 | Bacteria | 3603 |
| 487 | Ga0207696_1022512 | 3300025711 | Bacteria | 2001 |
| 488 | Ga0207696_1026800 | 3300025711 | Bacteria | 1780 |
| 489 | Ga0207655_1000033 | 3300025728 | Bacteria | 377066 |
| 490 | Ga0207655_1000747 | 3300025728 | Bacteria | 36428 |
| 491 | Ga0207655_1001006 | 3300025728 | Bacteria | 28697 |
| 492 | Ga0207655_1001169 | 3300025728 | Bacteria | 25503 |
| 493 | Ga0207655_1001731 | 3300025728 | Bacteria | 19151 |
| 494 | Ga0207655_1002470 | 3300025728 | Bacteria | 14982 |
| 495 | Ga0207655_1004567 | 3300025728 | Bacteria | 9754 |
| 496 | Ga0207655_1010154 | 3300025728 | Bacteria | 5749 |
| 497 | Ga0207655_1013075 | 3300025728 | Bacteria | 4790 |
| 498 | Ga0207655_1015746 | 3300025728 | Bacteria | 4182 |
| 499 | Ga0207655_1030164 | 3300025728 | Bacteria | 2527 |
| 500 | Ga0207655_1030991 | 3300025728 | Bacteria | 2474 |
| 501 | Ga0207655_1033456 | 3300025728 | Bacteria | 2329 |
| 502 | Ga0207655_1043386 | 3300025728 | Bacteria | 1902 |
| 503 | Ga0207655_1060285 | 3300025728 | Bacteria | 1472 |
| 504 | Ga0207655_1158180 | 3300025728 | Bacteria | 711 |
| 505 | Ga0207713_1000010 | 3300025735 | Bacteria | 528374 |
| 506 | Ga0207713_1000079 | 3300025735 | Bacteria | 172274 |
| 507 | Ga0207713_1000249 | 3300025735 | Bacteria | 68771 |
| 508 | Ga0207713_1000835 | 3300025735 | Bacteria | 28378 |
| 509 | Ga0207713_1001826 | 3300025735 | Bacteria | 16267 |
| 510 | Ga0207713_1004136 | 3300025735 | Bacteria | 9547 |
| 511 | Ga0207713_1006432 | 3300025735 | Bacteria | 7154 |
| 512 | Ga0207713_1009068 | 3300025735 | Bacteria | 5651 |
| 513 | Ga0207713_1011139 | 3300025735 | Bacteria | 4918 |
| 514 | Ga0207713_1013995 | 3300025735 | Bacteria | 4193 |
| 515 | Ga0207713_1015441 | 3300025735 | Bacteria | 3920 |
| 516 | Ga0207713_1025592 | 3300025735 | Bacteria | 2721 |
| 517 | Ga0207713_1028855 | 3300025735 | Bacteria | 2495 |
| 518 | Ga0207713_1041623 | 3300025735 | Bacteria | 1915 |
| 519 | Ga0207713_1043475 | 3300025735 | Bacteria | 1856 |
| 520 | Ga0207680_10584086 | 3300025903 | Bacteria | 799 |
| 521 | Ga0207705_10001989 | 3300025909 | Bacteria | 15885 |
| 522 | Ga0207705_10467378 | 3300025909 | Bacteria | 979 |
| 523 | Ga0207705_10469421 | 3300025909 | Bacteria | 976 |
| 524 | Ga0207654_10880263 | 3300025911 | Bacteria | 649 |
| 525 | Ga0207654_10990518 | 3300025911 | Bacteria | 611 |
| 526 | Ga0207707_11252320 | 3300025912 | Bacteria | 598 |
| 527 | Ga0207695_10001140 | 3300025913 | Bacteria | 46086 |
| 528 | Ga0207695_10014959 | 3300025913 | Bacteria | 9158 |
| 529 | Ga0207695_10028087 | 3300025913 | Bacteria | 6247 |
| 530 | Ga0207695_10040636 | 3300025913 | Bacteria | 4984 |
| 531 | Ga0207695_10044897 | 3300025913 | Bacteria | 4696 |
| 532 | Ga0207695_10136673 | 3300025913 | Bacteria | 2404 |
| 533 | Ga0207695_10188981 | 3300025913 | Bacteria | 1978 |
| 534 | Ga0207671_10000027 | 3300025914 | Bacteria | 264907 |
| 535 | Ga0207671_10283787 | 3300025914 | Bacteria | 1306 |
| 536 | Ga0207671_10393346 | 3300025914 | Bacteria | 1102 |
| 537 | Ga0207663_10622138 | 3300025916 | Bacteria | 850 |
| 538 | Ga0207660_10630904 | 3300025917 | Bacteria | 873 |
| 539 | Ga0207657_10038470 | 3300025919 | Bacteria | 4258 |
| 540 | Ga0207657_10124060 | 3300025919 | Bacteria | 2122 |
| 541 | Ga0207657_10302518 | 3300025919 | Unclassified | 1267 |
| 542 | Ga0207657_11066929 | 3300025919 | Bacteria | 618 |
| 543 | Ga0207649_10000012 | 3300025920 | Bacteria | 265674 |
| 544 | Ga0207649_10028271 | 3300025920 | Bacteria | 3301 |
| 545 | Ga0207649_10487847 | 3300025920 | Bacteria | 935 |
| 546 | Ga0207649_11046695 | 3300025920 | Bacteria | 643 |
| 547 | Ga0207652_10092949 | 3300025921 | Bacteria | 2654 |
| 548 | Ga0207652_10129967 | 3300025921 | Bacteria | 2246 |
| 549 | Ga0207681_10000138 | 3300025923 | Bacteria | 60354 |
| 550 | Ga0207681_10000600 | 3300025923 | Bacteria | 24430 |
| 551 | Ga0207694_10009484 | 3300025924 | Bacteria | 7338 |
| 552 | Ga0207694_10141519 | 3300025924 | Bacteria | 1935 |
| 553 | Ga0207694_10283409 | 3300025924 | Bacteria | 1361 |
| 554 | Ga0207694_10833486 | 3300025924 | Bacteria | 779 |
| 555 | Ga0207694_11362370 | 3300025924 | Bacteria | 600 |
| 556 | Ga0207650_10002879 | 3300025925 | Bacteria | 11883 |
| 557 | Ga0207650_10006459 | 3300025925 | Bacteria | 7984 |
| 558 | Ga0207687_10074432 | 3300025927 | Bacteria | 2434 |
| 559 | Ga0207700_10141254 | 3300025928 | Bacteria | 1979 |
| 560 | Ga0207664_10961499 | 3300025929 | Bacteria | 766 |
| 561 | Ga0207690_10116716 | 3300025932 | Bacteria | 1931 |
| 562 | Ga0207706_10000212 | 3300025933 | Bacteria | 63975 |
| 563 | Ga0207706_10006469 | 3300025933 | Bacteria | 10879 |
| 564 | Ga0207706_10021663 | 3300025933 | Bacteria | 5769 |
| 565 | Ga0207706_10053060 | 3300025933 | Bacteria | 3579 |
| 566 | Ga0207686_10002895 | 3300025934 | Bacteria | 9252 |
| 567 | Ga0207686_10050269 | 3300025934 | Bacteria | 2592 |
| 568 | Ga0207709_10000061 | 3300025935 | Bacteria | 199097 |
| 569 | Ga0207709_10000063 | 3300025935 | Bacteria | 191397 |
| 570 | Ga0207709_10001584 | 3300025935 | Bacteria | 15523 |
| 571 | Ga0207709_10007877 | 3300025935 | Bacteria | 5904 |
| 572 | Ga0207709_10009197 | 3300025935 | Bacteria | 5443 |
| 573 | Ga0207709_10196712 | 3300025935 | Bacteria | 1437 |
| 574 | Ga0207709_10397646 | 3300025935 | Bacteria | 1052 |
| 575 | Ga0207709_10731814 | 3300025935 | Bacteria | 794 |
| 576 | Ga0207669_10077464 | 3300025937 | Bacteria | 2115 |
| 577 | Ga0207691_10350749 | 3300025940 | Bacteria | 1262 |
| 578 | Ga0207711_10004604 | 3300025941 | Bacteria | 11726 |
| 579 | Ga0207689_10158293 | 3300025942 | Bacteria | 1867 |
| 580 | Ga0207661_10077134 | 3300025944 | Bacteria | 2739 |
| 581 | Ga0207679_10000015 | 3300025945 | Bacteria | 265674 |
| 582 | Ga0207667_10012143 | 3300025949 | Bacteria | 9948 |
| 583 | Ga0207667_10044273 | 3300025949 | Bacteria | 4717 |
| 584 | Ga0207667_10494966 | 3300025949 | Bacteria | 1240 |
| 585 | Ga0207667_11138887 | 3300025949 | Bacteria | 762 |
| 586 | Ga0207651_10249953 | 3300025960 | Bacteria | 1450 |
| 587 | Ga0207640_10005762 | 3300025981 | Bacteria | 6754 |
| 588 | Ga0207640_10332363 | 3300025981 | Bacteria | 1214 |
| 589 | Ga0207658_10111520 | 3300025986 | Bacteria | 2163 |
| 590 | Ga0207703_10444713 | 3300026035 | Bacteria | 1210 |
| 591 | Ga0207639_10000157 | 3300026041 | Bacteria | 51718 |
| 592 | Ga0207639_10199256 | 3300026041 | Bacteria | 1716 |
| 593 | Ga0207639_10308538 | 3300026041 | Bacteria | 1401 |
| 594 | Ga0207639_10314612 | 3300026041 | Bacteria | 1388 |
| 595 | Ga0207639_10631735 | 3300026041 | Bacteria | 989 |
| 596 | Ga0207678_10069855 | 3300026067 | Bacteria | 3011 |
| 597 | Ga0207678_10524829 | 3300026067 | Bacteria | 1034 |
| 598 | Ga0207702_10077491 | 3300026078 | Bacteria | 2875 |
| 599 | Ga0207702_10799081 | 3300026078 | Bacteria | 932 |
| 600 | Ga0207702_10923794 | 3300026078 | Bacteria | 865 |
| 601 | Ga0207641_10019492 | 3300026088 | Bacteria | 5569 |
| 602 | Ga0207648_10277149 | 3300026089 | Bacteria | 1499 |
| 603 | Ga0207648_10364162 | 3300026089 | Bacteria | 1305 |
| 604 | Ga0207674_10120183 | 3300026116 | Bacteria | 2595 |
| 605 | Ga0207683_10078444 | 3300026121 | Bacteria | 2926 |
| 606 | Ga0207683_10133624 | 3300026121 | Bacteria | 2232 |
| 607 | Ga0207683_10626202 | 3300026121 | Bacteria | 996 |
| 608 | Ga0207698_10065350 | 3300026142 | Bacteria | 2856 |
| 609 | Ga0207698_11975219 | 3300026142 | Bacteria | 598 |
| 610 | Ga0209281_1000016 | 3300027111 | Bacteria | 588107 |
| 611 | Ga0209281_1000019 | 3300027111 | Bacteria | 576164 |
| 612 | Ga0209389_1000036 | 3300027296 | Bacteria | 126146 |
| 613 | Ga0209389_1053487 | 3300027296 | Bacteria | 2713 |
| 614 | Ga0209371_1000066 | 3300027312 | Bacteria | 212660 |
| 615 | Ga0209371_1000176 | 3300027312 | Bacteria | 95739 |
| 616 | Ga0209371_1050371 | 3300027312 | Bacteria | 802 |
| 617 | Ga0209981_1057055 | 3300027378 | Bacteria | 596 |
| 618 | Ga0209982_1025188 | 3300027552 | Bacteria | 924 |
| 619 | Ga0209282_1007822 | 3300027666 | Bacteria | 6715 |
| 620 | Ga0209282_1041143 | 3300027666 | Bacteria | 2738 |
| 621 | Ga0209282_1104538 | 3300027666 | Bacteria | 1451 |
| 622 | Ga0207428_10043067 | 3300027907 | Bacteria | 3648 |
| 623 | Ga0207428_10081024 | 3300027907 | Bacteria | 2535 |
| 624 | Ga0207428_10112702 | 3300027907 | Bacteria | 2092 |
| 625 | Ga0207428_10114852 | 3300027907 | Bacteria | 2069 |
| 626 | Ga0207428_10119106 | 3300027907 | Bacteria | 2026 |
| 627 | Ga0207428_10123955 | 3300027907 | Bacteria | 1980 |
| 628 | Ga0207428_10291376 | 3300027907 | Bacteria | 1209 |
| 629 | Ga0207428_10569920 | 3300027907 | Bacteria | 818 |
| 630 | Ga0268266_10002571 | 3300028379 | Bacteria | 19245 |
| 631 | Ga0268266_10020327 | 3300028379 | Bacteria | 5659 |
| 632 | Ga0268266_10038288 | 3300028379 | Bacteria | 4082 |
| 633 | Ga0268266_10123433 | 3300028379 | Bacteria | 2307 |
| 634 | Ga0268266_10242278 | 3300028379 | Bacteria | 1665 |
| 635 | Ga0268266_10490046 | 3300028379 | Bacteria | 1172 |
| 636 | Ga0268265_10251286 | 3300028380 | Bacteria | 1566 |
| 637 | Ga0268264_11175002 | 3300028381 | Bacteria | 776 |
| 638 | Ga0265318_10009718 | 3300028577 | Bacteria | 4216 |
| 639 | Ga0307515_10550453 | 3300028794 | Bacteria | 764 |
| 640 | Ga0265338_10245937 | 3300028800 | Bacteria | 1322 |
| 641 | Ga0268256_1000063 | 3300030500 | Bacteria | 212660 |
| 642 | Ga0268256_1000146 | 3300030500 | Bacteria | 95753 |
| 643 | Ga0268256_1056659 | 3300030500 | Bacteria | 802 |
| 644 | Ga0316177_1070524 | 3300030731 | Bacteria | 1038 |
| 645 | Ga0316177_1180876 | 3300030731 | Bacteria | 5496 |
| 646 | Ga0316176_1043162 | 3300030732 | Bacteria | 3052 |
| 647 | Ga0314311_1040284 | 3300030733 | Bacteria | 3274 |
| 648 | Ga0314311_1105640 | 3300030733 | Bacteria | 2956 |
| 649 | Ga0316179_1011771 | 3300030734 | Bacteria | 1469 |
| 650 | Ga0316179_1026376 | 3300030734 | Bacteria | 3015 |
| 651 | Ga0316178_1047147 | 3300030735 | Bacteria | 102800 |
| 652 | Ga0316178_1120720 | 3300030735 | Bacteria | 1148 |
| 653 | Ga0316180_1058975 | 3300030736 | Bacteria | 3706 |
| 654 | Ga0316183_1077170 | 3300030742 | Bacteria | 6687 |
| 655 | Ga0316183_1205730 | 3300030742 | Bacteria | 3038 |
| 656 | Ga0316181_1009360 | 3300030744 | Bacteria | 2030 |
| 657 | Ga0316181_1063849 | 3300030744 | Bacteria | 1287 |
| 658 | Ga0316181_1124265 | 3300030744 | Bacteria | 765 |
| 659 | Ga0316181_1144972 | 3300030744 | Bacteria | 7327 |
| 660 | Ga0316182_1043997 | 3300030745 | Bacteria | 1271 |
| 661 | Ga0316182_1106649 | 3300030745 | Bacteria | 522 |
| 662 | Ga0316182_1234756 | 3300030745 | Bacteria | 5444 |
| 663 | Ga0316182_1390187 | 3300030745 | Bacteria | 563 |
| 664 | Ga0265330_10133814 | 3300031235 | Bacteria | 1055 |
| 665 | Ga0265332_10023082 | 3300031238 | Bacteria | 2744 |
| 666 | Ga0265320_10072850 | 3300031240 | Bacteria | 1615 |
| 667 | Ga0265325_10002800 | 3300031241 | Bacteria | 11641 |
| 668 | Ga0265325_10186974 | 3300031241 | Bacteria | 962 |
| 669 | Ga0265325_10354307 | 3300031241 | Bacteria | 648 |
| 670 | Ga0265329_10204041 | 3300031242 | Bacteria | 651 |
| 671 | Ga0265340_10012156 | 3300031247 | Bacteria | 4550 |
| 672 | Ga0265340_10192936 | 3300031247 | Bacteria | 918 |
| 673 | Ga0265339_10056109 | 3300031249 | Bacteria | 2134 |
| 674 | Ga0265339_10176300 | 3300031249 | Bacteria | 1067 |
| 675 | Ga0265331_10008993 | 3300031250 | Bacteria | 5644 |
| 676 | Ga0265331_10042787 | 3300031250 | Bacteria | 2196 |
| 677 | Ga0265327_10033411 | 3300031251 | Bacteria | 2866 |
| 678 | Ga0265316_10204375 | 3300031344 | Bacteria | 1463 |
| 679 | Ga0307509_10221193 | 3300031507 | Bacteria | 1706 |
| 680 | Ga0307509_10671613 | 3300031507 | Bacteria | 704 |
| 681 | Ga0307408_100000019 | 3300031548 | Bacteria | 344502 |
| 682 | Ga0307408_100007215 | 3300031548 | Bacteria | 7350 |
| 683 | Ga0307408_100015060 | 3300031548 | Bacteria | 5146 |
| 684 | Ga0307408_100020747 | 3300031548 | Bacteria | 4438 |
| 685 | Ga0307408_100043218 | 3300031548 | Bacteria | 3206 |
| 686 | Ga0307408_100103834 | 3300031548 | Bacteria | 2170 |
| 687 | Ga0307408_100302681 | 3300031548 | Bacteria | 1340 |
| 688 | Ga0307408_100448109 | 3300031548 | Bacteria | 1119 |
| 689 | Ga0307408_100782252 | 3300031548 | Bacteria | 864 |
| 690 | Ga0265313_10002996 | 3300031595 | Bacteria | 14059 |
| 691 | Ga0265313_10018280 | 3300031595 | Bacteria | 3942 |
| 692 | Ga0307514_10048005 | 3300031649 | Bacteria | 3329 |
| 693 | Ga0316575_10007778 | 3300031665 | Bacteria | 3887 |
| 694 | Ga0265314_10011318 | 3300031711 | Bacteria | 7375 |
| 695 | Ga0265314_10041344 | 3300031711 | Bacteria | 3301 |
| 696 | Ga0265314_10212841 | 3300031711 | Bacteria | 1134 |
| 697 | Ga0265342_10040406 | 3300031712 | Bacteria | 2829 |
| 698 | Ga0316576_10092090 | 3300031727 | Bacteria | 2259 |
| 699 | Ga0316576_10229401 | 3300031727 | Bacteria | 1396 |
| 700 | Ga0307516_10003211 | 3300031730 | Bacteria | 21220 |
| 701 | Ga0307516_10014174 | 3300031730 | Bacteria | 8447 |
| 702 | Ga0307516_10029985 | 3300031730 | Bacteria | 5494 |
| 703 | Ga0307405_10055662 | 3300031731 | Bacteria | 2477 |
| 704 | Ga0307405_10103490 | 3300031731 | Bacteria | 1914 |
| 705 | Ga0307405_10183573 | 3300031731 | Bacteria | 1504 |
| 706 | Ga0307405_10215311 | 3300031731 | Bacteria | 1405 |
| 707 | Ga0307405_10286704 | 3300031731 | Bacteria | 1242 |
| 708 | Ga0307405_10305287 | 3300031731 | Bacteria | 1209 |
| 709 | Ga0307405_10399412 | 3300031731 | Bacteria | 1075 |
| 710 | Ga0307413_10018385 | 3300031824 | Bacteria | 3666 |
| 711 | Ga0307413_10087511 | 3300031824 | Bacteria | 2018 |
| 712 | Ga0307413_10481950 | 3300031824 | Bacteria | 992 |
| 713 | Ga0307413_10744791 | 3300031824 | Bacteria | 818 |
| 714 | Ga0307410_10159004 | 3300031852 | Bacteria | 1691 |
| 715 | Ga0307406_10011531 | 3300031901 | Bacteria | 5022 |
| 716 | Ga0307406_10028572 | 3300031901 | Bacteria | 3370 |
| 717 | Ga0307407_10218346 | 3300031903 | Bacteria | 1288 |
| 718 | Ga0307407_10242384 | 3300031903 | Bacteria | 1230 |
| 719 | Ga0307412_10011436 | 3300031911 | Bacteria | 5143 |
| 720 | Ga0307412_10015679 | 3300031911 | Bacteria | 4498 |
| 721 | Ga0307412_10076892 | 3300031911 | Bacteria | 2294 |
| 722 | Ga0307412_10101173 | 3300031911 | Bacteria | 2038 |
| 723 | Ga0307412_10106150 | 3300031911 | Bacteria | 1996 |
| 724 | Ga0307412_10138218 | 3300031911 | Bacteria | 1780 |
| 725 | Ga0307412_10154122 | 3300031911 | Bacteria | 1699 |
| 726 | Ga0307412_10208085 | 3300031911 | Bacteria | 1491 |
| 727 | Ga0307412_10298891 | 3300031911 | Bacteria | 1271 |
| 728 | Ga0307412_10413954 | 3300031911 | Bacteria | 1101 |
| 729 | Ga0307412_10748402 | 3300031911 | Bacteria | 843 |
| 730 | Ga0307416_100012594 | 3300032002 | Bacteria | 5708 |
| 731 | Ga0307416_100076068 | 3300032002 | Bacteria | 2812 |
| 732 | Ga0307416_100241853 | 3300032002 | Bacteria | 1750 |
| 733 | Ga0307416_100525906 | 3300032002 | Bacteria | 1252 |
| 734 | Ga0307416_102159512 | 3300032002 | Bacteria | 658 |
| 735 | Ga0307414_10037403 | 3300032004 | Bacteria | 3249 |
| 736 | Ga0307414_10811857 | 3300032004 | Bacteria | 853 |
| 737 | Ga0307411_10055706 | 3300032005 | Bacteria | 2602 |
| 738 | Ga0307411_10156555 | 3300032005 | Bacteria | 1700 |
| 739 | Ga0307411_10373702 | 3300032005 | Bacteria | 1170 |
| 740 | Ga0307411_10614129 | 3300032005 | Bacteria | 936 |
| 741 | Ga0307411_11150651 | 3300032005 | Bacteria | 701 |
| 742 | Ga0316574_0016948 | 3300035398 | Bacteria | 4254 |
| 743 | Ga0316574_0240813 | 3300035398 | Bacteria | 1156 |
| 744 | Ga0373931_0147009 | 3300035691 | Bacteria | 1371 |
| 745 | Ga0395898_0366228 | 3300037466 | Bacteria | 1374 |
| 746 | Ga0395901_0433110 | 3300038443 | Bacteria | 1347 |
| 747 | Ga0400483_049425 | 3300039062 | Bacteria | 2712 |
| 748 | Ga0400483_289198 | 3300039062 | Bacteria | 1660 |
| 749 | Ga0436365_0255272 | 3300039437 | Bacteria | 725 |
| 750 | Ga0436365_0472641 | 3300039437 | Bacteria | 2166 |
| 751 | Ga0436360_0707346 | 3300039438 | Bacteria | 1146 |
| 752 | Ga0436363_0026702 | 3300039450 | Bacteria | 5368 |
| 753 | Ga0436362_1045686 | 3300039453 | Bacteria | 1148 |
| 754 | Ga0439436_0000393 | 3300041404 | Bacteria | 10904 |
| 755 | Ga0439436_0001705 | 3300041404 | Bacteria | 6427 |
| 756 | Ga0439438_009014 | 3300041405 | Bacteria | 3256 |
| 757 | Ga0439438_010619 | 3300041405 | Bacteria | 2901 |
| 758 | Ga0439438_014427 | 3300041405 | Bacteria | 2352 |
| 759 | Ga0439438_022379 | 3300041405 | Bacteria | 1753 |
| 760 | Ga0439438_029248 | 3300041405 | Bacteria | 1475 |
| 761 | Ga0439438_032917 | 3300041405 | Bacteria | 1371 |
| 762 | Ga0439438_052485 | 3300041405 | Bacteria | 1033 |
| 763 | Ga0439447_003796 | 3300041407 | Bacteria | 5304 |
| 764 | Ga0439447_003942 | 3300041407 | Bacteria | 5200 |
| 765 | Ga0439447_005384 | 3300041407 | Bacteria | 4264 |
| 766 | Ga0439447_007884 | 3300041407 | Bacteria | 3336 |
| 767 | Ga0439447_008473 | 3300041407 | Bacteria | 3178 |
| 768 | Ga0439447_010053 | 3300041407 | Bacteria | 2828 |
| 769 | Ga0439447_017695 | 3300041407 | Bacteria | 1937 |
| 770 | Ga0439447_029161 | 3300041407 | Bacteria | 1398 |
| 771 | Ga0439461_0023165 | 3300041410 | Bacteria | 1248 |
| 772 | Ga0439466_0003240 | 3300041411 | Bacteria | 6343 |
| 773 | Ga0439466_0004304 | 3300041411 | Bacteria | 5496 |
| 774 | Ga0439466_0012701 | 3300041411 | Bacteria | 3096 |
| 775 | Ga0439466_0012798 | 3300041411 | Bacteria | 3079 |
| 776 | Ga0439466_0013020 | 3300041411 | Bacteria | 3051 |
| 777 | Ga0439466_0032523 | 3300041411 | Bacteria | 1777 |
| 778 | Ga0439466_0033462 | 3300041411 | Bacteria | 1746 |
| 779 | Ga0439466_0057805 | 3300041411 | Bacteria | 1256 |
| 780 | Ga0439465_0004543 | 3300041413 | Bacteria | 4484 |
| 781 | Ga0439465_0006272 | 3300041413 | Bacteria | 3775 |
| 782 | Ga0451789_0759931 | 3300041443 | Bacteria | 533 |
| 783 | Ga0451802_2039099 | 3300041460 | Bacteria | 1405 |
| 784 | Ga0451853_3468156 | 3300041512 | Bacteria | 799 |
| 785 | Ga0451853_3963367 | 3300041512 | Bacteria | 999 |
| 786 | Ga0439431_0004440 | 3300041997 | Bacteria | 3085 |
| 787 | Ga0439431_0008002 | 3300041997 | Bacteria | 2368 |
| 788 | Ga0439431_0036530 | 3300041997 | Bacteria | 1237 |
| 789 | Ga0439433_0005132 | 3300041999 | Bacteria | 2813 |
| 790 | Ga0439437_000037 | 3300042000 | Bacteria | 9377 |
| 791 | Ga0439442_005424 | 3300042002 | Bacteria | 2550 |
| 792 | Ga0439445_0009266 | 3300042004 | Bacteria | 2317 |
| 793 | Ga0439445_0087885 | 3300042004 | Bacteria | 873 |
| 794 | Ga0439445_0108898 | 3300042004 | Bacteria | 789 |
| 795 | Ga0439445_0258874 | 3300042004 | Bacteria | 520 |
| 796 | Ga0439432_000677 | 3300042006 | Bacteria | 12757 |
| 797 | Ga0439432_001648 | 3300042006 | Bacteria | 8369 |
| 798 | Ga0439432_004015 | 3300042006 | Bacteria | 5399 |
| 799 | Ga0439432_010565 | 3300042006 | Bacteria | 3192 |
| 800 | Ga0439432_016837 | 3300042006 | Bacteria | 2458 |
| 801 | Ga0439432_027276 | 3300042006 | Bacteria | 1865 |
| 802 | Ga0439432_080105 | 3300042006 | Bacteria | 989 |
| 803 | Ga0439432_099946 | 3300042006 | Bacteria | 868 |
| 804 | Ga0439449_0000720 | 3300042007 | Bacteria | 12664 |
| 805 | Ga0439451_008918 | 3300042009 | Bacteria | 2032 |
| 806 | Ga0439451_011530 | 3300042009 | Bacteria | 1783 |
| 807 | Ga0439451_014175 | 3300042009 | Bacteria | 1608 |
| 808 | Ga0439451_018064 | 3300042009 | Bacteria | 1422 |
| 809 | Ga0439451_024145 | 3300042009 | Bacteria | 1224 |
| 810 | Ga0439451_051377 | 3300042009 | Bacteria | 825 |
| 811 | Ga0439452_000645 | 3300042010 | Bacteria | 17507 |
| 812 | Ga0439452_003726 | 3300042010 | Bacteria | 5260 |
| 813 | Ga0439452_004217 | 3300042010 | Bacteria | 4871 |
| 814 | Ga0439452_005024 | 3300042010 | Bacteria | 4323 |
| 815 | Ga0439452_012662 | 3300042010 | Bacteria | 2390 |
| 816 | Ga0439452_016934 | 3300042010 | Bacteria | 1970 |
| 817 | Ga0439452_021055 | 3300042010 | Bacteria | 1703 |
| 818 | Ga0439452_039019 | 3300042010 | Bacteria | 1125 |
| 819 | Ga0439452_039530 | 3300042010 | Bacteria | 1116 |
| 820 | Ga0439452_047649 | 3300042010 | Bacteria | 990 |
| 821 | Ga0439456_000220 | 3300042013 | Bacteria | 15563 |
| 822 | Ga0439456_026056 | 3300042013 | Bacteria | 1242 |
| 823 | Ga0439456_029960 | 3300042013 | Bacteria | 1163 |
| 824 | Ga0439456_041550 | 3300042013 | Bacteria | 996 |
| 825 | Ga0439457_001445 | 3300042014 | Bacteria | 7140 |
| 826 | Ga0439457_061008 | 3300042014 | Bacteria | 854 |
| 827 | Ga0439462_0008900 | 3300042015 | Bacteria | 2538 |
| 828 | Ga0439463_003695 | 3300042016 | Bacteria | 3857 |
| 829 | Ga0439463_021653 | 3300042016 | Bacteria | 1605 |
| 830 | Ga0439463_078827 | 3300042016 | Bacteria | 846 |
| 831 | Ga0450911_000011 | 3300042115 | Bacteria | 130739 |
| 832 | Ga0450911_005568 | 3300042115 | Bacteria | 1938 |
| 833 | Ga0450919_002799 | 3300042121 | Bacteria | 2239 |
| 834 | Ga0450919_019199 | 3300042121 | Bacteria | 772 |
| 835 | Ga0450922_001722 | 3300042124 | Bacteria | 2123 |
| 836 | Ga0450923_051094 | 3300042125 | Bacteria | 888 |
| 837 | Ga0450890_009580 | 3300042127 | Bacteria | 1242 |
| 838 | Ga0450892_019568 | 3300042130 | Bacteria | 657 |
| 839 | Ga0450894_022440 | 3300042131 | Bacteria | 855 |
| 840 | Ga0450895_018695 | 3300042132 | Bacteria | 634 |
| 841 | Ga0450898_078339 | 3300042134 | Bacteria | 669 |
| 842 | Ga0450900_002826 | 3300042136 | Bacteria | 1875 |
| 843 | Ga0450900_024938 | 3300042136 | Bacteria | 850 |
| 844 | Ga0450902_004902 | 3300042137 | Bacteria | 2005 |
| 845 | Ga0450902_026388 | 3300042137 | Bacteria | 971 |
| 846 | Ga0450904_000254 | 3300042139 | Bacteria | 11505 |
| 847 | Ga0450904_004804 | 3300042139 | Bacteria | 1390 |
| 848 | Ga0450904_011718 | 3300042139 | Bacteria | 868 |
| 849 | Ga0450905_000418 | 3300042142 | Bacteria | 5188 |
| 850 | Ga0450905_002843 | 3300042142 | Bacteria | 2245 |
| 851 | Ga0450905_012866 | 3300042142 | Bacteria | 1182 |
| 852 | Ga0450905_016150 | 3300042142 | Bacteria | 1075 |
| 853 | Ga0450906_003305 | 3300042145 | Bacteria | 3481 |
| 854 | Ga0450906_003770 | 3300042145 | Bacteria | 3225 |
| 855 | Ga0450907_001318 | 3300042146 | Bacteria | 5516 |
| 856 | Ga0450907_002543 | 3300042146 | Bacteria | 3445 |
| 857 | Ga0450907_008997 | 3300042146 | Bacteria | 1656 |
| 858 | Ga0450910_005072 | 3300042147 | Bacteria | 1790 |
| 859 | Ga0450910_020673 | 3300042147 | Bacteria | 993 |
| 860 | Ga0439446_0000772 | 3300042156 | Bacteria | 6754 |
| 861 | Ga0439446_0014612 | 3300042156 | Bacteria | 2169 |
| 862 | Ga0439446_0017035 | 3300042156 | Bacteria | 2028 |
| 863 | Ga0439446_0025556 | 3300042156 | Bacteria | 1688 |
| 864 | Ga0439446_0028447 | 3300042156 | Bacteria | 1609 |
| 865 | Ga0439446_0034841 | 3300042156 | Bacteria | 1466 |
| 866 | Ga0439446_0073482 | 3300042156 | Bacteria | 1049 |
| 867 | Ga0450908_004670 | 3300042184 | Bacteria | 2639 |
| 868 | Ga0450908_008357 | 3300042184 | Bacteria | 1941 |
| 869 | Ga0450909_000439 | 3300042185 | Bacteria | 5374 |
| 870 | Ga0450909_002156 | 3300042185 | Bacteria | 2780 |
| 871 | Ga0450909_011026 | 3300042185 | Bacteria | 1323 |
| 872 | Ga0439434_0000506 | 3300042435 | Bacteria | 11109 |
| 873 | Ga0439434_0002566 | 3300042435 | Bacteria | 5287 |
| 874 | Ga0439459_0002782 | 3300042438 | Bacteria | 2726 |
| 875 | Ga0439464_0000312 | 3300042439 | Bacteria | 9273 |
| 876 | Ga0439464_0003589 | 3300042439 | Bacteria | 3930 |
| 877 | Ga0439464_0008110 | 3300042439 | Bacteria | 2754 |
| 878 | Ga0439460_0001605 | 3300042461 | Bacteria | 5351 |
| 879 | Ga0439460_0003802 | 3300042461 | Bacteria | 3653 |
| 880 | Ga0450916_003515 | 3300042530 | Bacteria | 1722 |
| 881 | Ga0450918_000856 | 3300042531 | Bacteria | 6418 |
| 882 | Ga0450893_0031055 | 3300042532 | Bacteria | 953 |
| 883 | Ga0450901_018910 | 3300042533 | Bacteria | 733 |
| 884 | Ga0451577_0039597 | 3300042876 | Bacteria | 4235 |
| 885 | Ga0439440_0015179 | 3300042993 | Bacteria | 1672 |
| 886 | Ga0439440_0030834 | 3300042993 | Bacteria | 1264 |
| 887 | Ga0466965_0023451 | 3300044683 | Bacteria | 2980 |
| 888 | Ga0466957_0345110 | 3300044842 | Bacteria | 1009 |
| 889 | Ga0466960_0443712 | 3300044901 | Bacteria | 753 |
| 890 | Ga0495617_004617 | 3300046452 | Bacteria | 4987 |
| 891 | Ga0495617_019844 | 3300046452 | Bacteria | 2272 |
| 892 | Ga0495617_078835 | 3300046452 | Bacteria | 1079 |
| 893 | Ga0495627_000095 | 3300046453 | Bacteria | 108094 |
| 894 | Ga0495627_003716 | 3300046453 | Bacteria | 6601 |
| 895 | Ga0495627_011272 | 3300046453 | Bacteria | 3212 |
| 896 | Ga0495627_013285 | 3300046453 | Bacteria | 2899 |
| 897 | Ga0495627_014354 | 3300046453 | Bacteria | 2765 |
| 898 | Ga0495627_120091 | 3300046453 | Bacteria | 742 |
| 899 | Ga0495603_0031080 | 3300046455 | Bacteria | 3214 |
| 900 | Ga0495603_0037741 | 3300046455 | Bacteria | 2898 |
| 901 | Ga0495603_0897726 | 3300046455 | Bacteria | 503 |
| 902 | Ga0495590_0070662 | 3300046457 | Bacteria | 1224 |
| 903 | Ga0495591_000198 | 3300046458 | Bacteria | 61546 |
| 904 | Ga0495591_003674 | 3300046458 | Bacteria | 7802 |
| 905 | Ga0495591_003881 | 3300046458 | Bacteria | 7537 |
| 906 | Ga0495591_004039 | 3300046458 | Bacteria | 7332 |
| 907 | Ga0495591_007055 | 3300046458 | Bacteria | 4841 |
| 908 | Ga0495591_039195 | 3300046458 | Bacteria | 1359 |
| 909 | Ga0495591_061314 | 3300046458 | Bacteria | 998 |
| 910 | Ga0495629_0016371 | 3300046459 | Bacteria | 5322 |
| 911 | Ga0495638_0014264 | 3300046460 | Bacteria | 5378 |
| 912 | Ga0495638_0034509 | 3300046460 | Bacteria | 3229 |
| 913 | Ga0495638_0053799 | 3300046460 | Bacteria | 2504 |
| 914 | Ga0495638_0164658 | 3300046460 | Bacteria | 1276 |
| 915 | Ga0495638_0165468 | 3300046460 | Bacteria | 1272 |
| 916 | Ga0495638_0197824 | 3300046460 | Bacteria | 1136 |
| 917 | Ga0495638_0287268 | 3300046460 | Bacteria | 891 |
| 918 | Ga0495653_0024315 | 3300046463 | Bacteria | 4883 |
| 919 | Ga0495653_0385859 | 3300046463 | Bacteria | 893 |
| 920 | Ga0495650_0000938 | 3300046471 | Bacteria | 33877 |
| 921 | Ga0495650_0005982 | 3300046471 | Bacteria | 7707 |
| 922 | Ga0495650_0008522 | 3300046471 | Bacteria | 5966 |
| 923 | Ga0495650_0009607 | 3300046471 | Bacteria | 5484 |
| 924 | Ga0495650_0079874 | 3300046471 | Bacteria | 1263 |
| 925 | Ga0495582_0025469 | 3300046473 | Bacteria | 3240 |
| 926 | Ga0495605_0000019 | 3300046474 | Bacteria | 270010 |
| 927 | Ga0495605_0000570 | 3300046474 | Bacteria | 29915 |
| 928 | Ga0495605_0003684 | 3300046474 | Bacteria | 9102 |
| 929 | Ga0495605_0007838 | 3300046474 | Bacteria | 6049 |
| 930 | Ga0495605_0068028 | 3300046474 | Bacteria | 1688 |
| 931 | Ga0495605_0095670 | 3300046474 | Bacteria | 1370 |
| 932 | Ga0495605_0124855 | 3300046474 | Bacteria | 1164 |
| 933 | Ga0495605_0232126 | 3300046474 | Bacteria | 794 |
| 934 | Ga0495639_0003531 | 3300046475 | Bacteria | 6752 |
| 935 | Ga0495639_0107934 | 3300046475 | Bacteria | 1318 |
| 936 | Ga0495584_0015687 | 3300046491 | Bacteria | 3863 |
| 937 | Ga0495584_0027889 | 3300046491 | Bacteria | 2860 |
| 938 | Ga0495584_0124579 | 3300046491 | Bacteria | 1305 |
| 939 | Ga0495584_0241461 | 3300046491 | Bacteria | 918 |
| 940 | Ga0495584_0264405 | 3300046491 | Bacteria | 874 |
| 941 | Ga0495585_0006926 | 3300046492 | Bacteria | 6986 |
| 942 | Ga0495585_0018550 | 3300046492 | Bacteria | 4012 |
| 943 | Ga0495585_0048303 | 3300046492 | Bacteria | 2366 |
| 944 | Ga0495594_0003155 | 3300046499 | Bacteria | 8524 |
| 945 | Ga0495594_0164034 | 3300046499 | Bacteria | 1263 |
| 946 | Ga0495596_0000889 | 3300046500 | Bacteria | 18026 |
| 947 | Ga0495607_0003674 | 3300046501 | Bacteria | 11642 |
| 948 | Ga0495607_0004336 | 3300046501 | Bacteria | 10464 |
| 949 | Ga0495607_0004339 | 3300046501 | Bacteria | 10463 |
| 950 | Ga0495607_0005115 | 3300046501 | Bacteria | 9484 |
| 951 | Ga0495607_0008664 | 3300046501 | Bacteria | 6934 |
| 952 | Ga0495607_0016353 | 3300046501 | Bacteria | 4787 |
| 953 | Ga0495607_0064442 | 3300046501 | Bacteria | 2069 |
| 954 | Ga0495607_0071439 | 3300046501 | Bacteria | 1935 |
| 955 | Ga0495607_0081022 | 3300046501 | Bacteria | 1783 |
| 956 | Ga0495607_0092082 | 3300046501 | Bacteria | 1640 |
| 957 | Ga0495607_0102972 | 3300046501 | Bacteria | 1525 |
| 958 | Ga0495607_0140959 | 3300046501 | Bacteria | 1243 |
| 959 | Ga0495607_0305913 | 3300046501 | Bacteria | 746 |
| 960 | Ga0495583_0000146 | 3300046506 | Bacteria | 119793 |
| 961 | Ga0495583_0004677 | 3300046506 | Bacteria | 9649 |
| 962 | Ga0495583_0004736 | 3300046506 | Bacteria | 9566 |
| 963 | Ga0495583_0006804 | 3300046506 | Bacteria | 7383 |
| 964 | Ga0495583_0084237 | 3300046506 | Bacteria | 1377 |
| 965 | Ga0495583_0237850 | 3300046506 | Bacteria | 732 |
| 966 | Ga0495583_0300230 | 3300046506 | Bacteria | 638 |
| 967 | Ga0495606_0000204 | 3300046507 | Bacteria | 103880 |
| 968 | Ga0495606_0005284 | 3300046507 | Bacteria | 12446 |
| 969 | Ga0495606_0155809 | 3300046507 | Bacteria | 1336 |
| 970 | Ga0495606_0557283 | 3300046507 | Bacteria | 569 |
| 971 | Ga0495606_0630603 | 3300046507 | Bacteria | 521 |
| 972 | Ga0495610_0006827 | 3300046512 | Bacteria | 7737 |
| 973 | Ga0495610_0012418 | 3300046512 | Bacteria | 5130 |
| 974 | Ga0495610_0027938 | 3300046512 | Bacteria | 2990 |
| 975 | Ga0495610_0042218 | 3300046512 | Bacteria | 2283 |
| 976 | Ga0495610_0107327 | 3300046512 | Bacteria | 1241 |
| 977 | Ga0495610_0123868 | 3300046512 | Bacteria | 1129 |
| 978 | Ga0495616_0013956 | 3300046513 | Bacteria | 4513 |
| 979 | Ga0495616_0032800 | 3300046513 | Bacteria | 2710 |
| 980 | Ga0495616_0037580 | 3300046513 | Bacteria | 2490 |
| 981 | Ga0495616_0111920 | 3300046513 | Bacteria | 1267 |
| 982 | Ga0495616_0143857 | 3300046513 | Bacteria | 1083 |
| 983 | Ga0495616_0330987 | 3300046513 | Bacteria | 637 |
| 984 | Ga0495620_0000032 | 3300046515 | Bacteria | 119164 |
| 985 | Ga0495620_0000108 | 3300046515 | Bacteria | 66218 |
| 986 | Ga0495620_0002361 | 3300046515 | Bacteria | 10939 |
| 987 | Ga0495620_0077923 | 3300046515 | Bacteria | 1344 |
| 988 | Ga0495620_0144397 | 3300046515 | Bacteria | 929 |
| 989 | Ga0495620_0160595 | 3300046515 | Bacteria | 873 |
| 990 | Ga0495630_0098873 | 3300046517 | Bacteria | 2207 |
| 991 | Ga0495630_0355872 | 3300046517 | Bacteria | 1120 |
| 992 | Ga0495631_0002010 | 3300046518 | Bacteria | 11851 |
| 993 | Ga0495631_0009636 | 3300046518 | Bacteria | 4816 |
| 994 | Ga0495631_0016529 | 3300046518 | Bacteria | 3515 |
| 995 | Ga0495631_0050623 | 3300046518 | Bacteria | 1816 |
| 996 | Ga0495631_0313435 | 3300046518 | Bacteria | 667 |
| 997 | Ga0495632_0001812 | 3300046519 | Bacteria | 17207 |
| 998 | Ga0495632_0004345 | 3300046519 | Bacteria | 9654 |
| 999 | Ga0495632_0095293 | 3300046519 | Bacteria | 1406 |
| 1000 | Ga0495632_0111449 | 3300046519 | Bacteria | 1284 |
| 1001 | Ga0495632_0122792 | 3300046519 | Bacteria | 1212 |
| 1002 | Ga0495632_0257871 | 3300046519 | Bacteria | 780 |
| 1003 | Ga0495637_0003861 | 3300046520 | Bacteria | 7862 |
| 1004 | Ga0495637_0004201 | 3300046520 | Bacteria | 7479 |
| 1005 | Ga0495637_0004356 | 3300046520 | Bacteria | 7347 |
| 1006 | Ga0495637_0005898 | 3300046520 | Bacteria | 6191 |
| 1007 | Ga0495637_0010699 | 3300046520 | Bacteria | 4427 |
| 1008 | Ga0495637_0012776 | 3300046520 | Bacteria | 4007 |
| 1009 | Ga0495637_0026764 | 3300046520 | Bacteria | 2585 |
| 1010 | Ga0495637_0030808 | 3300046520 | Bacteria | 2376 |
| 1011 | Ga0495637_0072585 | 3300046520 | Bacteria | 1385 |
| 1012 | Ga0495637_0074567 | 3300046520 | Bacteria | 1362 |
| 1013 | Ga0495637_0076287 | 3300046520 | Bacteria | 1343 |
| 1014 | Ga0495637_0079406 | 3300046520 | Bacteria | 1310 |
| 1015 | Ga0495637_0170974 | 3300046520 | Bacteria | 810 |
| 1016 | Ga0495637_0278279 | 3300046520 | Bacteria | 597 |
| 1017 | Ga0495643_0000084 | 3300046522 | Bacteria | 158427 |
| 1018 | Ga0495643_0001486 | 3300046522 | Bacteria | 21343 |
| 1019 | Ga0495643_0002761 | 3300046522 | Bacteria | 13432 |
| 1020 | Ga0495643_0014980 | 3300046522 | Bacteria | 4595 |
| 1021 | Ga0495643_0016737 | 3300046522 | Bacteria | 4303 |
| 1022 | Ga0495643_0020764 | 3300046522 | Bacteria | 3779 |
| 1023 | Ga0495643_0100420 | 3300046522 | Bacteria | 1483 |
| 1024 | Ga0495643_0153683 | 3300046522 | Bacteria | 1137 |
| 1025 | Ga0495644_0269979 | 3300046523 | Bacteria | 662 |
| 1026 | Ga0495648_0001464 | 3300046524 | Bacteria | 23091 |
| 1027 | Ga0495648_0014109 | 3300046524 | Bacteria | 5869 |
| 1028 | Ga0495648_0020872 | 3300046524 | Bacteria | 4555 |
| 1029 | Ga0495648_0023122 | 3300046524 | Bacteria | 4263 |
| 1030 | Ga0495648_0053541 | 3300046524 | Bacteria | 2444 |
| 1031 | Ga0495648_0136151 | 3300046524 | Bacteria | 1298 |
| 1032 | Ga0495648_0151296 | 3300046524 | Bacteria | 1210 |
| 1033 | Ga0495663_0289514 | 3300046525 | Bacteria | 588 |
| 1034 | Ga0495666_0008469 | 3300046526 | Bacteria | 5158 |
| 1035 | Ga0495666_0277867 | 3300046526 | Bacteria | 759 |
| 1036 | Ga0495642_0020860 | 3300046528 | Bacteria | 2576 |
| 1037 | Ga0495642_0036150 | 3300046528 | Bacteria | 1996 |
| 1038 | Ga0495642_0085577 | 3300046528 | Bacteria | 1331 |
| 1039 | Ga0495654_0006676 | 3300046530 | Bacteria | 6531 |
| 1040 | Ga0495654_0006980 | 3300046530 | Bacteria | 6362 |
| 1041 | Ga0495654_0011839 | 3300046530 | Bacteria | 4707 |
| 1042 | Ga0495654_0020203 | 3300046530 | Bacteria | 3473 |
| 1043 | Ga0495654_0040352 | 3300046530 | Bacteria | 2326 |
| 1044 | Ga0495654_0076875 | 3300046530 | Bacteria | 1572 |
| 1045 | Ga0495654_0111249 | 3300046530 | Bacteria | 1249 |
| 1046 | Ga0495654_0271266 | 3300046530 | Bacteria | 700 |
| 1047 | Ga0495654_0306917 | 3300046530 | Bacteria | 646 |
| 1048 | Ga0495586_0007706 | 3300046535 | Bacteria | 5739 |
| 1049 | Ga0495587_0019133 | 3300046536 | Bacteria | 4241 |
| 1050 | Ga0495587_0156788 | 3300046536 | Bacteria | 1296 |
| 1051 | Ga0495609_0000098 | 3300046538 | Bacteria | 103106 |
| 1052 | Ga0495609_0000101 | 3300046538 | Bacteria | 100818 |
| 1053 | Ga0495609_0003114 | 3300046538 | Bacteria | 9706 |
| 1054 | Ga0495609_0071160 | 3300046538 | Bacteria | 1528 |
| 1055 | Ga0495609_0106506 | 3300046538 | Bacteria | 1212 |
| 1056 | Ga0495609_0217313 | 3300046538 | Bacteria | 794 |
| 1057 | Ga0495609_0234257 | 3300046538 | Bacteria | 759 |
| 1058 | Ga0495621_0016061 | 3300046539 | Bacteria | 2396 |
| 1059 | Ga0495621_0054585 | 3300046539 | Bacteria | 1436 |
| 1060 | Ga0495597_0000033 | 3300046542 | Bacteria | 126661 |
| 1061 | Ga0495597_0007497 | 3300046542 | Bacteria | 5533 |
| 1062 | Ga0495597_0007724 | 3300046542 | Bacteria | 5437 |
| 1063 | Ga0495597_0010129 | 3300046542 | Bacteria | 4618 |
| 1064 | Ga0495597_0027103 | 3300046542 | Bacteria | 2628 |
| 1065 | Ga0495597_0032004 | 3300046542 | Bacteria | 2389 |
| 1066 | Ga0495597_0112951 | 3300046542 | Bacteria | 1137 |
| 1067 | Ga0495597_0168212 | 3300046542 | Bacteria | 891 |
| 1068 | Ga0495645_0059966 | 3300046543 | Bacteria | 2758 |
| 1069 | Ga0495622_0002902 | 3300046557 | Bacteria | 8180 |
| 1070 | Ga0495622_0006825 | 3300046557 | Bacteria | 5298 |
| 1071 | Ga0495622_0191153 | 3300046557 | Bacteria | 915 |
| 1072 | Ga0495633_0000129 | 3300046558 | Bacteria | 100833 |
| 1073 | Ga0495633_0319920 | 3300046558 | Bacteria | 704 |
| 1074 | Ga0495656_0000202 | 3300046615 | Bacteria | 21338 |
| 1075 | Ga0495656_0012623 | 3300046615 | Bacteria | 3122 |
| 1076 | Ga0495656_0250217 | 3300046615 | Bacteria | 895 |
| 1077 | Ga0495668_0010805 | 3300046616 | Bacteria | 5507 |
| 1078 | Ga0495668_0049935 | 3300046616 | Bacteria | 2320 |
| 1079 | Ga0495668_0070832 | 3300046616 | Bacteria | 1916 |
| 1080 | Ga0495668_0099059 | 3300046616 | Bacteria | 1595 |
| 1081 | Ga0495668_0196039 | 3300046616 | Bacteria | 1106 |
| 1082 | Ga0495634_0074625 | 3300046642 | Bacteria | 2228 |
| 1083 | Ga0495611_0000619 | 3300046648 | Bacteria | 20516 |
| 1084 | Ga0495611_0021168 | 3300046648 | Bacteria | 2806 |
| 1085 | Ga0495611_0055983 | 3300046648 | Bacteria | 1785 |
| 1086 | Ga0495625_0000113 | 3300046660 | Bacteria | 124185 |
| 1087 | Ga0495625_0013990 | 3300046660 | Bacteria | 6426 |
| 1088 | Ga0495625_0043722 | 3300046660 | Bacteria | 3247 |
| 1089 | Ga0495625_0045004 | 3300046660 | Bacteria | 3192 |
| 1090 | Ga0495625_0176303 | 3300046660 | Bacteria | 1424 |
| 1091 | Ga0495625_0188310 | 3300046660 | Bacteria | 1368 |
| 1092 | Ga0495625_0423463 | 3300046660 | Bacteria | 827 |
| 1093 | Ga0495625_0523918 | 3300046660 | Bacteria | 721 |
| 1094 | Ga0495635_0032290 | 3300046663 | Bacteria | 3632 |
| 1095 | Ga0495635_0158202 | 3300046663 | Bacteria | 1542 |
| 1096 | Ga0495635_0212289 | 3300046663 | Bacteria | 1310 |
| 1097 | Ga0495659_0007458 | 3300046664 | Bacteria | 3471 |
| 1098 | Ga0495661_0000050 | 3300046665 | Bacteria | 143435 |
| 1099 | Ga0495661_0000196 | 3300046665 | Bacteria | 69840 |
| 1100 | Ga0495661_0000237 | 3300046665 | Bacteria | 63564 |
| 1101 | Ga0495661_0000791 | 3300046665 | Bacteria | 30044 |
| 1102 | Ga0495661_0039015 | 3300046665 | Bacteria | 2953 |
| 1103 | Ga0495661_0102259 | 3300046665 | Bacteria | 1611 |
| 1104 | Ga0495661_0143880 | 3300046665 | Bacteria | 1294 |
| 1105 | Ga0495588_0006320 | 3300046674 | Bacteria | 5333 |
| 1106 | Ga0495588_0029331 | 3300046674 | Bacteria | 2759 |
| 1107 | Ga0495588_0220866 | 3300046674 | Bacteria | 1000 |
| 1108 | Ga0495646_0134234 | 3300046680 | Bacteria | 1390 |
| 1109 | Ga0495646_0211047 | 3300046680 | Bacteria | 1053 |
| 1110 | Ga0495658_0325399 | 3300046683 | Bacteria | 975 |
| 1111 | Ga0495669_0006747 | 3300046684 | Bacteria | 4803 |
| 1112 | Ga0495613_0019320 | 3300046689 | Bacteria | 5080 |
| 1113 | Ga0495670_0004611 | 3300046691 | Bacteria | 6758 |
| 1114 | Ga0495670_0029549 | 3300046691 | Bacteria | 2720 |
| 1115 | Ga0495670_0033258 | 3300046691 | Bacteria | 2565 |
| 1116 | Ga0495670_0074612 | 3300046691 | Bacteria | 1721 |
| 1117 | Ga0495670_0091940 | 3300046691 | Bacteria | 1553 |
| 1118 | Ga0495670_0146646 | 3300046691 | Bacteria | 1236 |
| 1119 | Ga0495670_0149990 | 3300046691 | Bacteria | 1222 |
| 1120 | Ga0495671_0002273 | 3300046692 | Bacteria | 12221 |
| 1121 | Ga0495671_0003386 | 3300046692 | Bacteria | 9816 |
| 1122 | Ga0495671_0009251 | 3300046692 | Bacteria | 5507 |
| 1123 | Ga0495671_0011351 | 3300046692 | Bacteria | 4906 |
| 1124 | Ga0495671_0014255 | 3300046692 | Bacteria | 4283 |
| 1125 | Ga0495671_0063231 | 3300046692 | Bacteria | 1823 |
| 1126 | Ga0495671_0123705 | 3300046692 | Bacteria | 1261 |
| 1127 | Ga0495671_0252737 | 3300046692 | Bacteria | 850 |
| 1128 | Ga0495671_0348240 | 3300046692 | Bacteria | 710 |
| 1129 | Ga0495649_0000559 | 3300046694 | Bacteria | 31486 |
| 1130 | Ga0495649_0004109 | 3300046694 | Bacteria | 9562 |
| 1131 | Ga0495649_0005576 | 3300046694 | Bacteria | 7967 |
| 1132 | Ga0495649_0011664 | 3300046694 | Bacteria | 5146 |
| 1133 | Ga0495649_0026139 | 3300046694 | Bacteria | 3249 |
| 1134 | Ga0495649_0067043 | 3300046694 | Bacteria | 1925 |
| 1135 | Ga0495649_0100412 | 3300046694 | Bacteria | 1538 |
| 1136 | Ga0495649_0152725 | 3300046694 | Bacteria | 1212 |
| 1137 | Ga0495649_0209165 | 3300046694 | Bacteria | 1011 |
| 1138 | Ga0495589_0004366 | 3300046794 | Bacteria | 7540 |
| 1139 | Ga0495589_0019045 | 3300046794 | Bacteria | 3520 |
| 1140 | Ga0495589_0022667 | 3300046794 | Bacteria | 3203 |
| 1141 | Ga0495589_0111778 | 3300046794 | Bacteria | 1318 |
| 1142 | Ga0495600_0029762 | 3300046809 | Bacteria | 3536 |
| 1143 | Ga0495660_0002195 | 3300046810 | Bacteria | 12561 |
| 1144 | Ga0495660_0004003 | 3300046810 | Bacteria | 8991 |
| 1145 | Ga0495660_0009901 | 3300046810 | Bacteria | 5546 |
| 1146 | Ga0495660_0011258 | 3300046810 | Bacteria | 5193 |
| 1147 | Ga0495660_0015775 | 3300046810 | Bacteria | 4362 |
| 1148 | Ga0495660_0036962 | 3300046810 | Bacteria | 2722 |
| 1149 | Ga0495660_0081717 | 3300046810 | Bacteria | 1693 |
| 1150 | Ga0495660_0096203 | 3300046810 | Bacteria | 1530 |
| 1151 | Ga0495660_0113277 | 3300046810 | Bacteria | 1381 |
| 1152 | Ga0495660_0158337 | 3300046810 | Bacteria | 1112 |
| 1153 | Ga0495660_0236010 | 3300046810 | Bacteria | 854 |
| 1154 | Ga0495581_0747091 | 3300047315 | Bacteria | 563 |
| 1155 | Ga0495604_0224792 | 3300047317 | Bacteria | 1290 |
| 1156 | Ga0495604_0594284 | 3300047317 | Bacteria | 710 |
| 1157 | Ga0495636_0469873 | 3300047318 | Bacteria | 605 |
| 1158 | Ga0495674_0367443 | 3300047319 | Bacteria | 1166 |
| 1159 | Ga0495674_0692370 | 3300047319 | Bacteria | 800 |
| 1160 | Ga0495672_0008685 | 3300047320 | Bacteria | 7457 |
| 1161 | Ga0495672_0017665 | 3300047320 | Bacteria | 4764 |
| 1162 | Ga0495672_0032448 | 3300047320 | Bacteria | 3248 |
| 1163 | Ga0495672_0036714 | 3300047320 | Bacteria | 3006 |
| 1164 | Ga0495672_0036760 | 3300047320 | Bacteria | 3004 |
| 1165 | Ga0495672_0061709 | 3300047320 | Bacteria | 2159 |
| 1166 | Ga0495672_0069020 | 3300047320 | Bacteria | 2007 |
| 1167 | Ga0495672_0077165 | 3300047320 | Bacteria | 1869 |
| 1168 | Ga0495672_0104839 | 3300047320 | Bacteria | 1527 |
| 1169 | Ga0495672_0108826 | 3300047320 | Bacteria | 1490 |
| 1170 | Ga0495672_0122707 | 3300047320 | Bacteria | 1378 |
| 1171 | Ga0495672_0126392 | 3300047320 | Bacteria | 1351 |
| 1172 | Ga0495676_0000032 | 3300047321 | Bacteria | 131215 |
| 1173 | Ga0495676_0040988 | 3300047321 | Bacteria | 3816 |
| 1174 | Ga0495676_0041046 | 3300047321 | Bacteria | 3812 |
| 1175 | Ga0495680_0008846 | 3300047322 | Bacteria | 9108 |
| 1176 | Ga0495680_0158307 | 3300047322 | Bacteria | 1646 |
| 1177 | Ga0495680_0491239 | 3300047322 | Bacteria | 834 |
| 1178 | Ga0495680_0723396 | 3300047322 | Bacteria | 656 |
| 1179 | Ga0495683_0000055 | 3300047323 | Bacteria | 119199 |
| 1180 | Ga0495683_0000075 | 3300047323 | Bacteria | 100715 |
| 1181 | Ga0495683_0013729 | 3300047323 | Bacteria | 4231 |
| 1182 | Ga0495683_0034418 | 3300047323 | Bacteria | 2576 |
| 1183 | Ga0495683_0079854 | 3300047323 | Bacteria | 1597 |
| 1184 | Ga0495683_0132110 | 3300047323 | Bacteria | 1176 |
| 1185 | Ga0495683_0249969 | 3300047323 | Bacteria | 778 |
| 1186 | Ga0495687_024590 | 3300047443 | Bacteria | 2860 |
| 1187 | Ga0495687_060119 | 3300047443 | Bacteria | 1568 |
| 1188 | Ga0495675_0060903 | 3300047444 | Bacteria | 2391 |
| 1189 | Ga0495677_0096017 | 3300047445 | Bacteria | 1119 |
| 1190 | Ga0495677_0101945 | 3300047445 | Bacteria | 1087 |
| 1191 | Ga0495679_000495 | 3300047446 | Bacteria | 27885 |
| 1192 | Ga0495679_027905 | 3300047446 | Bacteria | 1856 |
| 1193 | Ga0495679_064991 | 3300047446 | Bacteria | 1062 |
| 1194 | Ga0495679_105866 | 3300047446 | Bacteria | 777 |
| 1195 | Ga0495673_0004043 | 3300047469 | Bacteria | 9346 |
| 1196 | Ga0495673_0005552 | 3300047469 | Bacteria | 7601 |
| 1197 | Ga0495673_0006295 | 3300047469 | Bacteria | 6992 |
| 1198 | Ga0495673_0011348 | 3300047469 | Bacteria | 4796 |
| 1199 | Ga0495673_0028651 | 3300047469 | Bacteria | 2635 |
| 1200 | Ga0495673_0035666 | 3300047469 | Bacteria | 2288 |
| 1201 | Ga0495673_0054911 | 3300047469 | Bacteria | 1730 |
| 1202 | Ga0495673_0068619 | 3300047469 | Bacteria | 1497 |
| 1203 | Ga0495673_0070498 | 3300047469 | Bacteria | 1471 |
| 1204 | Ga0495673_0080658 | 3300047469 | Bacteria | 1348 |
| 1205 | Ga0495673_0080788 | 3300047469 | Bacteria | 1347 |
| 1206 | Ga0495673_0107488 | 3300047469 | Bacteria | 1119 |
| 1207 | Ga0495673_0315656 | 3300047469 | Bacteria | 558 |
| 1208 | Ga0495681_0003330 | 3300047470 | Bacteria | 11177 |
| 1209 | Ga0495681_0009290 | 3300047470 | Bacteria | 6071 |
| 1210 | Ga0495681_0010491 | 3300047470 | Bacteria | 5604 |
| 1211 | Ga0495681_0026799 | 3300047470 | Bacteria | 2992 |
| 1212 | Ga0495681_0046902 | 3300047470 | Bacteria | 2057 |
| 1213 | Ga0495681_0094003 | 3300047470 | Bacteria | 1320 |
| 1214 | Ga0495681_0208313 | 3300047470 | Bacteria | 789 |
| 1215 | Ga0495686_0057742 | 3300047472 | Bacteria | 2421 |
| 1216 | Ga0495686_0188888 | 3300047472 | Bacteria | 1189 |
| 1217 | Ga0495593_0021928 | 3300047673 | Bacteria | 3563 |
| 1218 | Ga0495593_0034350 | 3300047673 | Bacteria | 2758 |
| 1219 | Ga0495593_0493703 | 3300047673 | Bacteria | 614 |
| 1220 | Ga0495614_0018096 | 3300048089 | Bacteria | 3053 |
| 1221 | Ga0495615_0223300 | 3300048090 | Bacteria | 589 |
| 1222 | Ga0495626_0000024 | 3300048091 | Bacteria | 214179 |
| 1223 | Ga0495626_0006021 | 3300048091 | Bacteria | 6972 |
| 1224 | Ga0495626_0007440 | 3300048091 | Bacteria | 6097 |
| 1225 | Ga0495626_0030264 | 3300048091 | Bacteria | 2611 |
| 1226 | Ga0495626_0091432 | 3300048091 | Bacteria | 1337 |
| 1227 | Ga0495626_0092114 | 3300048091 | Bacteria | 1331 |
| 1228 | Ga0495626_0229073 | 3300048091 | Bacteria | 752 |
| 1229 | Ga0496100_0007462 | 3300048903 | Bacteria | 6035 |
| 1230 | Ga0496100_1266712 | 3300048903 | Bacteria | 582 |
| 1231 | Ga0496101_0001014 | 3300048904 | Bacteria | 16554 |
| 1232 | Ga0496102_0021686 | 3300048905 | Bacteria | 5682 |
| 1233 | Ga0496102_0022497 | 3300048905 | Bacteria | 5586 |
| 1234 | Ga0496102_1913148 | 3300048905 | Bacteria | 510 |
| 1235 | Ga0496103_0156800 | 3300048906 | Bacteria | 1459 |
| 1236 | Ga0496104_0007646 | 3300048907 | Bacteria | 9569 |
| 1237 | Ga0496105_0025015 | 3300048908 | Bacteria | 4854 |
| 1238 | Ga0496105_0541806 | 3300048908 | Bacteria | 909 |
| 1239 | Ga0496106_0419181 | 3300048909 | Bacteria | 1076 |
| 1240 | Ga0496107_0070855 | 3300048910 | Bacteria | 2532 |
| 1241 | Ga0496108_0140948 | 3300048911 | Bacteria | 2077 |
| 1242 | Ga0496108_0505068 | 3300048911 | Bacteria | 1056 |
| 1243 | Ga0496109_0095304 | 3300048912 | Bacteria | 2755 |
| 1244 | Ga0496110_0012658 | 3300048913 | Bacteria | 6941 |
| 1245 | Ga0496110_0057839 | 3300048913 | Bacteria | 3414 |
| 1246 | Ga0496110_0215624 | 3300048913 | Bacteria | 1745 |
| 1247 | Ga0496110_0479361 | 3300048913 | Bacteria | 1133 |
| 1248 | Ga0496110_0532282 | 3300048913 | Bacteria | 1068 |
| 1249 | Ga0496111_0008593 | 3300048914 | Bacteria | 6769 |
| 1250 | Ga0496111_0127973 | 3300048914 | Bacteria | 1878 |
| 1251 | Ga0496111_0332160 | 3300048914 | Bacteria | 1126 |
| 1252 | Ga0496111_0597354 | 3300048914 | Bacteria | 808 |
| 1253 | Ga0496112_1876480 | 3300048915 | Bacteria | 511 |
| 1254 | Ga0496113_0210462 | 3300048916 | Bacteria | 1548 |
| 1255 | Ga0496113_0373904 | 3300048916 | Bacteria | 1144 |
| 1256 | Ga0496114_0033938 | 3300048917 | Bacteria | 4207 |
| 1257 | Ga0496114_0058158 | 3300048917 | Bacteria | 3228 |
| 1258 | Ga0496114_0090573 | 3300048917 | Bacteria | 2596 |
| 1259 | Ga0496116_0000008 | 3300048919 | Bacteria | 726753 |
| 1260 | Ga0496116_0000553 | 3300048919 | Bacteria | 50128 |
| 1261 | Ga0496116_0013021 | 3300048919 | Bacteria | 6746 |
| 1262 | Ga0496116_0018645 | 3300048919 | Bacteria | 5338 |
| 1263 | Ga0496116_0019155 | 3300048919 | Bacteria | 5248 |
| 1264 | Ga0496116_0038119 | 3300048919 | Bacteria | 3342 |
| 1265 | Ga0496116_0049986 | 3300048919 | Bacteria | 2790 |
| 1266 | Ga0496116_0170552 | 3300048919 | Bacteria | 1179 |
| 1267 | Ga0496116_0199457 | 3300048919 | Bacteria | 1049 |
| 1268 | Ga0496117_0006615 | 3300048920 | Bacteria | 11648 |
| 1269 | Ga0496117_0006932 | 3300048920 | Bacteria | 11230 |
| 1270 | Ga0496117_0024953 | 3300048920 | Bacteria | 4709 |
| 1271 | Ga0496117_0025916 | 3300048920 | Bacteria | 4597 |
| 1272 | Ga0496117_0026843 | 3300048920 | Bacteria | 4498 |
| 1273 | Ga0496117_0031455 | 3300048920 | Bacteria | 4050 |
| 1274 | Ga0496117_0032865 | 3300048920 | Bacteria | 3933 |
| 1275 | Ga0496117_0154774 | 3300048920 | Bacteria | 1351 |
| 1276 | Ga0496117_0158249 | 3300048920 | Bacteria | 1330 |
| 1277 | Ga0496117_0365643 | 3300048920 | Bacteria | 739 |
| 1278 | Ga0496118_0007748 | 3300048921 | Bacteria | 11275 |
| 1279 | Ga0496118_0015717 | 3300048921 | Bacteria | 6988 |
| 1280 | Ga0496118_0020580 | 3300048921 | Bacteria | 5844 |
| 1281 | Ga0496118_0088388 | 3300048921 | Bacteria | 2143 |
| 1282 | Ga0496118_0099858 | 3300048921 | Bacteria | 1965 |
| 1283 | Ga0496118_0116427 | 3300048921 | Bacteria | 1756 |
| 1284 | Ga0496118_0125720 | 3300048921 | Bacteria | 1660 |
| 1285 | Ga0496118_0263243 | 3300048921 | Bacteria | 971 |
| 1286 | Ga0496119_0125748 | 3300048922 | Bacteria | 1403 |
| 1287 | Ga0496121_0000012 | 3300048924 | Bacteria | 653131 |
| 1288 | Ga0496121_0008919 | 3300048924 | Bacteria | 11641 |
| 1289 | Ga0496121_0011761 | 3300048924 | Bacteria | 9653 |
| 1290 | Ga0496121_0101509 | 3300048924 | Bacteria | 2218 |
| 1291 | Ga0496121_0115362 | 3300048924 | Bacteria | 2039 |
| 1292 | Ga0496121_0169638 | 3300048924 | Bacteria | 1587 |
| 1293 | Ga0496121_0216973 | 3300048924 | Bacteria | 1350 |
| 1294 | Ga0496121_0218219 | 3300048924 | Bacteria | 1345 |
| 1295 | Ga0496121_0281425 | 3300048924 | Bacteria | 1137 |
| 1296 | Ga0496121_0508017 | 3300048924 | Bacteria | 763 |
| 1297 | Ga0496122_0007258 | 3300048925 | Bacteria | 12395 |
| 1298 | Ga0496122_0018013 | 3300048925 | Bacteria | 6550 |
| 1299 | Ga0496122_0021634 | 3300048925 | Bacteria | 5749 |
| 1300 | Ga0496122_0034642 | 3300048925 | Bacteria | 4128 |
| 1301 | Ga0496122_0061280 | 3300048925 | Bacteria | 2762 |
| 1302 | Ga0496122_0078839 | 3300048925 | Bacteria | 2305 |
| 1303 | Ga0496122_0140241 | 3300048925 | Bacteria | 1514 |
| 1304 | Ga0496122_0190174 | 3300048925 | Bacteria | 1213 |
| 1305 | Ga0496122_0371410 | 3300048925 | Bacteria | 738 |
| 1306 | Ga0496123_0000178 | 3300048926 | Bacteria | 128587 |
| 1307 | Ga0496123_0007242 | 3300048926 | Bacteria | 10533 |
| 1308 | Ga0496123_0010680 | 3300048926 | Bacteria | 8080 |
| 1309 | Ga0496123_0023248 | 3300048926 | Bacteria | 4748 |
| 1310 | Ga0496123_0027433 | 3300048926 | Bacteria | 4241 |
| 1311 | Ga0496123_0113888 | 3300048926 | Bacteria | 1539 |
| 1312 | Ga0496123_0170119 | 3300048926 | Bacteria | 1150 |
| 1313 | Ga0496123_0304831 | 3300048926 | Bacteria | 758 |
| 1314 | Ga0496123_0307071 | 3300048926 | Bacteria | 754 |
| 1315 | Ga0496124_0004321 | 3300048927 | Bacteria | 16654 |
| 1316 | Ga0496124_0006372 | 3300048927 | Bacteria | 12872 |
| 1317 | Ga0496124_0023502 | 3300048927 | Bacteria | 5625 |
| 1318 | Ga0496124_0053909 | 3300048927 | Bacteria | 3406 |
| 1319 | Ga0496124_0057238 | 3300048927 | Bacteria | 3286 |
| 1320 | Ga0496124_0099855 | 3300048927 | Bacteria | 2353 |
| 1321 | Ga0496124_0137724 | 3300048927 | Bacteria | 1930 |
| 1322 | Ga0496124_0145590 | 3300048927 | Bacteria | 1864 |
| 1323 | Ga0496124_0150009 | 3300048927 | Bacteria | 1830 |
| 1324 | Ga0496124_0220964 | 3300048927 | Bacteria | 1425 |
| 1325 | Ga0496124_0240376 | 3300048927 | Bacteria | 1347 |
| 1326 | Ga0496124_0329605 | 3300048927 | Bacteria | 1089 |
| 1327 | Ga0496125_0001493 | 3300048928 | Bacteria | 33555 |
| 1328 | Ga0496125_0007042 | 3300048928 | Bacteria | 12020 |
| 1329 | Ga0496125_0019719 | 3300048928 | Bacteria | 6347 |
| 1330 | Ga0496125_0030847 | 3300048928 | Bacteria | 4787 |
| 1331 | Ga0496125_0069620 | 3300048928 | Bacteria | 2760 |
| 1332 | Ga0496125_0111577 | 3300048928 | Bacteria | 1978 |
| 1333 | Ga0496125_0143002 | 3300048928 | Bacteria | 1659 |
| 1334 | Ga0496125_0191586 | 3300048928 | Bacteria | 1349 |
| 1335 | Ga0496125_0191943 | 3300048928 | Bacteria | 1348 |
| 1336 | Ga0496126_0081568 | 3300048929 | Bacteria | 2859 |
| 1337 | Ga0496126_0148335 | 3300048929 | Bacteria | 2012 |
| 1338 | Ga0496126_0343497 | 3300048929 | Bacteria | 1222 |
| 1339 | Ga0495678_000106 | 3300049459 | Bacteria | 100780 |
| 1340 | Ga0495678_016396 | 3300049459 | Bacteria | 3388 |
| 1341 | Ga0495678_033178 | 3300049459 | Bacteria | 2133 |
| 1342 | Ga0495678_173455 | 3300049459 | Bacteria | 680 |
| 1343 | Ga0495682_0000573 | 3300049460 | Bacteria | 24941 |
| 1344 | Ga0495682_0088795 | 3300049460 | Bacteria | 1110 |
| 1345 | Ga0501031_0118073 | 3300049568 | Bacteria | 1733 |
| 1346 | Ga0501032_0086582 | 3300049569 | Bacteria | 2082 |
| 1347 | Ga0501033_0007721 | 3300049570 | Bacteria | 8344 |
| 1348 | Ga0501033_0145409 | 3300049570 | Bacteria | 1712 |
| 1349 | Ga0501033_0304465 | 3300049570 | Bacteria | 1121 |
| 1350 | Ga0501034_0000143 | 3300049571 | Bacteria | 133317 |
| 1351 | Ga0501034_0030982 | 3300049571 | Bacteria | 5435 |
| 1352 | Ga0501037_0032838 | 3300049573 | Bacteria | 3835 |
| 1353 | Ga0501037_0339358 | 3300049573 | Bacteria | 1038 |
| 1354 | Ga0501037_0440011 | 3300049573 | Bacteria | 890 |
| 1355 | Ga0501038_0105642 | 3300049574 | Bacteria | 2339 |
| 1356 | Ga0501038_0221714 | 3300049574 | Bacteria | 1508 |
| 1357 | Ga0501039_0851823 | 3300049575 | Bacteria | 710 |
| 1358 | Ga0501043_0554477 | 3300049579 | Bacteria | 853 |
| 1359 | Ga0501043_0636961 | 3300049579 | Bacteria | 784 |
| 1360 | Ga0501046_0122247 | 3300049580 | Bacteria | 1980 |
| 1361 | Ga0501046_0139837 | 3300049580 | Bacteria | 1833 |
| 1362 | Ga0501047_0016472 | 3300049581 | Bacteria | 7056 |
| 1363 | Ga0501047_0021113 | 3300049581 | Bacteria | 6252 |
| 1364 | Ga0501047_0149829 | 3300049581 | Bacteria | 2209 |
| 1365 | Ga0501047_0231916 | 3300049581 | Bacteria | 1699 |
| 1366 | Ga0501048_0182176 | 3300049582 | Bacteria | 1489 |
| 1367 | Ga0501070_0452375 | 3300049586 | Bacteria | 1035 |
| 1368 | Ga0501238_044073 | 3300049671 | Bacteria | 661 |
| 1369 | Ga0501249_036362 | 3300049679 | Bacteria | 1109 |
| 1370 | Ga0501249_169889 | 3300049679 | Bacteria | 558 |
| 1371 | Ga0501252_030271 | 3300049682 | Bacteria | 747 |
| 1372 | Ga0501225_0111583 | 3300049705 | Bacteria | 806 |
| 1373 | Ga0501080_0152059 | 3300049742 | Bacteria | 2139 |
| 1374 | Ga0501241_023838 | 3300049758 | Bacteria | 1134 |
| 1375 | Ga0501241_155203 | 3300049758 | Bacteria | 530 |
| 1376 | Ga0501035_0008231 | 3300049822 | Bacteria | 9715 |
| 1377 | Ga0501035_0020102 | 3300049822 | Bacteria | 6133 |
| 1378 | Ga0501035_0028649 | 3300049822 | Bacteria | 5083 |
| 1379 | Ga0501035_0077655 | 3300049822 | Bacteria | 2934 |
| 1380 | Ga0501035_0107461 | 3300049822 | Bacteria | 2446 |
| 1381 | Ga0501044_0001123 | 3300049823 | Bacteria | 31793 |
| 1382 | Ga0501044_0015234 | 3300049823 | Bacteria | 8282 |
| 1383 | Ga0501044_0030699 | 3300049823 | Bacteria | 5662 |
| 1384 | Ga0501044_0263494 | 3300049823 | Bacteria | 1661 |
| 1385 | Ga0501226_000049 | 3300049853 | Bacteria | 53390 |
| 1386 | nmdc:mga03683_12567_c1 | 3300050489 | Bacteria | 3097 |
| 1387 | nmdc:mga03683_25008_c1 | 3300050489 | Bacteria | 1336 |
| 1388 | nmdc:mga03n38_113886_c1 | 3300050490 | Bacteria | 1321 |
| 1389 | nmdc:mga03n38_148938_c1 | 3300050490 | Bacteria | 1176 |
| 1390 | nmdc:mga03n38_30830_c1 | 3300050490 | Bacteria | 2258 |
| 1391 | nmdc:mga00v17_1492_c1 | 3300050491 | Bacteria | 12236 |
| 1392 | nmdc:mga00v17_436110_c1 | 3300050491 | Bacteria | 851 |
| 1393 | nmdc:mga00v17_571_c1 | 3300050491 | Bacteria | 20580 |
| 1394 | nmdc:mga00v17_94841_c1 | 3300050491 | Bacteria | 1878 |
| 1395 | nmdc:mga0yw44_217_c1 | 3300050492 | Bacteria | 20338 |
| 1396 | nmdc:mga0yw44_34070_c1 | 3300050492 | Bacteria | 2981 |
| 1397 | nmdc:mga0yw44_37482_c1 | 3300050492 | Bacteria | 2863 |
| 1398 | nmdc:mga0yw44_935410_c1 | 3300050492 | Bacteria | 587 |
| 1399 | nmdc:mga0k408_108860_c1 | 3300050493 | Bacteria | 1637 |
| 1400 | nmdc:mga0k408_11346_c1 | 3300050493 | Bacteria | 2757 |
| 1401 | nmdc:mga0k408_17545_c1 | 3300050493 | Bacteria | 3990 |
| 1402 | nmdc:mga06z11_174630_c1 | 3300050494 | Bacteria | 1236 |
| 1403 | nmdc:mga06z11_1852_c1 | 3300050494 | Bacteria | 7981 |
| 1404 | nmdc:mga06z11_46024_c1 | 3300050494 | Bacteria | 2208 |
| 1405 | nmdc:mga06z11_49970_c1 | 3300050494 | Bacteria | 2135 |
| 1406 | nmdc:mga07m45_1061_c1 | 3300050496 | Bacteria | 12249 |
| 1407 | nmdc:mga07m45_16790_c1 | 3300050496 | Bacteria | 3922 |
| 1408 | nmdc:mga07m45_1912_c1 | 3300050496 | Bacteria | 9618 |
| 1409 | nmdc:mga07m45_75127_c1 | 3300050496 | Bacteria | 1925 |
| 1410 | nmdc:mga07m45_7984_c1 | 3300050496 | Bacteria | 5423 |
| 1411 | nmdc:mga07m45_8240_c1 | 3300050496 | Bacteria | 5347 |
| 1412 | nmdc:mga07m45_898_c1 | 3300050496 | Bacteria | 12980 |
| 1413 | nmdc:mga05p37_1439989_c1 | 3300050507 | Bacteria | 691 |
| 1414 | nmdc:mga09592_3652_c1 | 3300050508 | Bacteria | 12406 |
| 1415 | nmdc:mga0n895_1547153_c1 | 3300050512 | Unclassified | 629 |
| 1416 | nmdc:mga0sz30_137975_c1 | 3300050516 | Bacteria | 1076 |
| 1417 | nmdc:mga0sz30_320_c2 | 3300050516 | Bacteria | 9066 |
| 1418 | Ga0500610_0027879 | 3300053079 | Bacteria | 2840 |
| 1419 | Ga0500610_0037753 | 3300053079 | Bacteria | 2487 |
| 1420 | Ga0500610_0042155 | 3300053079 | Bacteria | 2361 |
| 1421 | Ga0500643_003702 | 3300053087 | Bacteria | 7204 |
| 1422 | Ga0500647_0255319 | 3300053091 | Bacteria | 768 |
| 1423 | Ga0500651_0000029 | 3300053093 | Bacteria | 113528 |
| 1424 | Ga0500566_0096020 | 3300053094 | Bacteria | 1632 |
| 1425 | Ga0500641_0249275 | 3300053096 | Bacteria | 745 |
| 1426 | Ga0500562_077614 | 3300053108 | Bacteria | 898 |
| 1427 | Ga0500569_057735 | 3300053109 | Bacteria | 1190 |
| 1428 | Ga0500571_001234 | 3300053110 | Bacteria | 11738 |
| 1429 | Ga0500572_030735 | 3300053111 | Bacteria | 1495 |
| 1430 | Ga0500592_007013 | 3300053116 | Bacteria | 1792 |
| 1431 | Ga0500593_001548 | 3300053117 | Bacteria | 8259 |
| 1432 | Ga0500595_002496 | 3300053119 | Bacteria | 9097 |
| 1433 | Ga0500595_042249 | 3300053119 | Bacteria | 1460 |
| 1434 | Ga0500608_019691 | 3300053122 | Bacteria | 3098 |
| 1435 | Ga0500626_051154 | 3300053128 | Bacteria | 1858 |
| 1436 | Ga0500655_000253 | 3300053133 | Bacteria | 12573 |
| 1437 | Ga0500658_0001930 | 3300053134 | Bacteria | 8115 |
| 1438 | Ga0500658_0002544 | 3300053134 | Bacteria | 7063 |
| 1439 | Ga0500659_0005549 | 3300053135 | Bacteria | 7057 |
| 1440 | Ga0500564_005374 | 3300053138 | Bacteria | 5236 |
| 1441 | Ga0500568_0006729 | 3300053139 | Bacteria | 5744 |
| 1442 | Ga0500574_004090 | 3300053141 | Bacteria | 2676 |
| 1443 | Ga0500577_0009905 | 3300053142 | Bacteria | 2784 |
| 1444 | Ga0500616_0042382 | 3300053153 | Bacteria | 2437 |
| 1445 | Ga0500627_0001507 | 3300053158 | Bacteria | 6546 |
| 1446 | Ga0500634_0010416 | 3300053161 | Bacteria | 4751 |
| 1447 | Ga0500638_166502 | 3300053162 | Bacteria | 964 |
| 1448 | Ga0500645_014949 | 3300053730 | Bacteria | 2467 |
| 1449 | Ga0500565_000623 | 3300053734 | Bacteria | 2022 |
| 1450 | Ga0500596_019858 | 3300053735 | Bacteria | 1010 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300035398 | Ga0316574_0240813 | Ga0316574_0240813_34_402 | 122 |
| 2 | 3300049460 | Ga0495682_0088795 | Ga0495682_0088795_709_1077 | 122 |
| 3 | 3300049569 | Ga0501032_0086582 | Ga0501032_0086582_22_495 | 131 |
| 4 | 3300049570 | Ga0501033_0007721 | Ga0501033_0007721_1453_1926 | 131 |
| 5 | 3300049573 | Ga0501037_0032838 | Ga0501037_0032838_2127_2600 | 131 |
| 6 | 3300049574 | Ga0501038_0221714 | Ga0501038_0221714_753_1226 | 131 |
| 7 | 3300049581 | Ga0501047_0016472 | Ga0501047_0016472_5508_5981 | 131 |
| 8 | 3300049822 | Ga0501035_0008231 | Ga0501035_0008231_4018_4491 | 131 |
| 9 | 3300049823 | Ga0501044_0001123 | Ga0501044_0001123_29903_30376 | 131 |
| 10 | 3300046526 | Ga0495666_0277867 | Ga0495666_0277867_27_428 | 133 |
| 11 | 3300047319 | Ga0495674_0692370 | Ga0495674_0692370_369_770 | 133 |
| 12 | 3300049570 | Ga0501033_0304465 | Ga0501033_0304465_87_554 | 133 |
| 13 | 3300049582 | Ga0501048_0182176 | Ga0501048_0182176_1001_1468 | 133 |
| 14 | 3300049822 | Ga0501035_0107461 | Ga0501035_0107461_425_892 | 133 |
| 15 | 3300049823 | Ga0501044_0015234 | Ga0501044_0015234_470_937 | 133 |
| 16 | iso_pu_bacteria | 2643221683 | 2644469196 | 133 |
| 17 | iso_pu_bacteria | 2842733646 | 2842735306 | 133 |
| 18 | 3300026078 | Ga0207702_10799081 | Ga0207702_107990811 | 136 |
| 19 | 3300003761 | Ga0055535_1000849 | Ga0055535_100084910 | 137 |
| 20 | 3300003773 | Ga0055537_1000490 | Ga0055537_100049014 | 137 |
| 21 | 3300003781 | Ga0055536_1004465 | Ga0055536_10044653 | 137 |
| 22 | 3300003790 | Ga0055528_1000242 | Ga0055528_100024238 | 137 |
| 23 | 3300003792 | Ga0055540_1002002 | Ga0055540_10020029 | 137 |
| 24 | 3300003792 | Ga0055540_1006621 | Ga0055540_10066215 | 137 |
| 25 | 3300005288 | Ga0065714_10243308 | Ga0065714_102433081 | 137 |
| 26 | 3300005289 | Ga0065704_10240311 | Ga0065704_102403112 | 137 |
| 27 | 3300005366 | Ga0070659_101583069 | Ga0070659_1015830691 | 137 |
| 28 | 3300005367 | Ga0070667_100039195 | Ga0070667_1000391952 | 137 |
| 29 | 3300005459 | Ga0068867_100157834 | Ga0068867_1001578342 | 137 |
| 30 | 3300005543 | Ga0070672_100469195 | Ga0070672_1004691952 | 137 |
| 31 | 3300005577 | Ga0068857_100247199 | Ga0068857_1002471993 | 137 |
| 32 | 3300005577 | Ga0068857_100851124 | Ga0068857_1008511241 | 137 |
| 33 | 3300005841 | Ga0068863_100671152 | Ga0068863_1006711522 | 137 |
| 34 | 3300006038 | Ga0075365_10029846 | Ga0075365_100298463 | 137 |
| 35 | 3300006038 | Ga0075365_10490777 | Ga0075365_104907771 | 137 |
| 36 | 3300006048 | Ga0075363_100011892 | Ga0075363_1000118923 | 137 |
| 37 | 3300006048 | Ga0075363_100023389 | Ga0075363_1000233892 | 137 |
| 38 | 3300006048 | Ga0075363_100045017 | Ga0075363_1000450173 | 137 |
| 39 | 3300006051 | Ga0075364_10138651 | Ga0075364_101386512 | 137 |
| 40 | 3300006051 | Ga0075364_10349567 | Ga0075364_103495672 | 137 |
| 41 | 3300006058 | Ga0075432_10028921 | Ga0075432_100289213 | 137 |
| 42 | 3300006177 | Ga0075362_10025103 | Ga0075362_100251033 | 137 |
| 43 | 3300006177 | Ga0075362_10027254 | Ga0075362_100272543 | 137 |
| 44 | 3300006178 | Ga0075367_10072090 | Ga0075367_100720903 | 137 |
| 45 | 3300006178 | Ga0075367_10119723 | Ga0075367_101197232 | 137 |
| 46 | 3300006195 | Ga0075366_10023437 | Ga0075366_100234372 | 137 |
| 47 | 3300006237 | Ga0097621_100472123 | Ga0097621_1004721233 | 137 |
| 48 | 3300006353 | Ga0075370_10018167 | Ga0075370_100181674 | 137 |
| 49 | 3300006353 | Ga0075370_10019251 | Ga0075370_100192513 | 137 |
| 50 | 3300006353 | Ga0075370_10021275 | Ga0075370_100212755 | 137 |
| 51 | 3300006353 | Ga0075370_10023017 | Ga0075370_100230174 | 137 |
| 52 | 3300006353 | Ga0075370_10075336 | Ga0075370_100753363 | 137 |
| 53 | 3300006948 | Ga0099826_10075199 | Ga0099826_100751993 | 137 |
| 54 | 3300009148 | Ga0105243_10010063 | Ga0105243_100100634 | 137 |
| 55 | 3300013100 | Ga0157373_10008319 | Ga0157373_100083194 | 137 |
| 56 | 3300013104 | Ga0157370_10563491 | Ga0157370_105634912 | 137 |
| 57 | 3300014497 | Ga0182008_10109911 | Ga0182008_101099112 | 137 |
| 58 | 3300015261 | Ga0182006_1017980 | Ga0182006_10179802 | 137 |
| 59 | 3300015261 | Ga0182006_1084670 | Ga0182006_10846701 | 137 |
| 60 | 3300015262 | Ga0182007_10050733 | Ga0182007_100507332 | 137 |
| 61 | 3300017792 | Ga0163161_10000166 | Ga0163161_1000016656 | 137 |
| 62 | 3300017792 | Ga0163161_10007380 | Ga0163161_100073803 | 137 |
| 63 | 3300017792 | Ga0163161_10021628 | Ga0163161_100216284 | 137 |
| 64 | 3300017792 | Ga0163161_10029422 | Ga0163161_100294222 | 137 |
| 65 | 3300025228 | Ga0209672_101630 | Ga0209672_1016302 | 137 |
| 66 | 3300025242 | Ga0209258_100089 | Ga0209258_10008925 | 137 |
| 67 | 3300025254 | Ga0209148_1000097 | Ga0209148_100009725 | 137 |
| 68 | 3300025263 | Ga0209565_1000083 | Ga0209565_100008384 | 137 |
| 69 | 3300025273 | Ga0209673_1000323 | Ga0209673_100032381 | 137 |
| 70 | 3300025273 | Ga0209673_1022389 | Ga0209673_10223893 | 137 |
| 71 | 3300025291 | Ga0209675_1000081 | Ga0209675_100008184 | 137 |
| 72 | 3300025291 | Ga0209675_1007159 | Ga0209675_10071593 | 137 |
| 73 | 3300025292 | Ga0209676_1005014 | Ga0209676_10050148 | 137 |
| 74 | 3300025292 | Ga0209676_1073271 | Ga0209676_10732711 | 137 |
| 75 | 3300025294 | Ga0209025_1015457 | Ga0209025_10154575 | 137 |
| 76 | 3300025298 | Ga0209050_1006114 | Ga0209050_10061144 | 137 |
| 77 | 3300025303 | Ga0209051_1000373 | Ga0209051_100037329 | 137 |
| 78 | 3300025303 | Ga0209051_1002063 | Ga0209051_10020638 | 137 |
| 79 | 3300025304 | Ga0209257_1000449 | Ga0209257_100044965 | 137 |
| 80 | 3300025728 | Ga0207655_1001731 | Ga0207655_10017316 | 137 |
| 81 | 3300025920 | Ga0207649_10028271 | Ga0207649_100282712 | 137 |
| 82 | 3300025924 | Ga0207694_10141519 | Ga0207694_101415193 | 137 |
| 83 | 3300025932 | Ga0207690_10116716 | Ga0207690_101167161 | 137 |
| 84 | 3300025933 | Ga0207706_10006469 | Ga0207706_100064694 | 137 |
| 85 | 3300025933 | Ga0207706_10053060 | Ga0207706_100530603 | 137 |
| 86 | 3300025935 | Ga0207709_10001584 | Ga0207709_100015844 | 137 |
| 87 | 3300025935 | Ga0207709_10007877 | Ga0207709_100078778 | 137 |
| 88 | 3300025940 | Ga0207691_10350749 | Ga0207691_103507492 | 137 |
| 89 | 3300025960 | Ga0207651_10249953 | Ga0207651_102499532 | 137 |
| 90 | 3300025981 | Ga0207640_10332363 | Ga0207640_103323632 | 137 |
| 91 | 3300025986 | Ga0207658_10111520 | Ga0207658_101115202 | 137 |
| 92 | 3300026041 | Ga0207639_10308538 | Ga0207639_103085382 | 137 |
| 93 | 3300026067 | Ga0207678_10069855 | Ga0207678_100698553 | 137 |
| 94 | 3300026089 | Ga0207648_10277149 | Ga0207648_102771492 | 137 |
| 95 | 3300026116 | Ga0207674_10120183 | Ga0207674_101201833 | 137 |
| 96 | 3300026121 | Ga0207683_10133624 | Ga0207683_101336241 | 137 |
| 97 | 3300027666 | Ga0209282_1007822 | Ga0209282_10078228 | 137 |
| 98 | 3300027666 | Ga0209282_1104538 | Ga0209282_11045381 | 137 |
| 99 | 3300027907 | Ga0207428_10119106 | Ga0207428_101191063 | 137 |
| 100 | 3300028381 | Ga0268264_11175002 | Ga0268264_111750021 | 137 |
| 101 | 3300030732 | Ga0316176_1043162 | Ga0316176_10431624 | 137 |
| 102 | 3300030733 | Ga0314311_1040284 | Ga0314311_10402842 | 137 |
| 103 | 3300030734 | Ga0316179_1026376 | Ga0316179_10263763 | 137 |
| 104 | 3300030735 | Ga0316178_1120720 | Ga0316178_11207202 | 137 |
| 105 | 3300030736 | Ga0316180_1058975 | Ga0316180_10589753 | 137 |
| 106 | 3300030742 | Ga0316183_1077170 | Ga0316183_10771707 | 137 |
| 107 | 3300030744 | Ga0316181_1144972 | Ga0316181_11449723 | 137 |
| 108 | 3300030745 | Ga0316182_1234756 | Ga0316182_12347567 | 137 |
| 109 | 3300030745 | Ga0316182_1390187 | Ga0316182_13901872 | 137 |
| 110 | 3300031548 | Ga0307408_100007215 | Ga0307408_1000072157 | 137 |
| 111 | 3300031548 | Ga0307408_100043218 | Ga0307408_1000432183 | 137 |
| 112 | 3300031548 | Ga0307408_100782252 | Ga0307408_1007822522 | 137 |
| 113 | 3300031649 | Ga0307514_10048005 | Ga0307514_100480054 | 137 |
| 114 | 3300031731 | Ga0307405_10103490 | Ga0307405_101034902 | 137 |
| 115 | 3300031731 | Ga0307405_10215311 | Ga0307405_102153111 | 137 |
| 116 | 3300031731 | Ga0307405_10286704 | Ga0307405_102867042 | 137 |
| 117 | 3300031731 | Ga0307405_10305287 | Ga0307405_103052872 | 137 |
| 118 | 3300031824 | Ga0307413_10087511 | Ga0307413_100875112 | 137 |
| 119 | 3300031824 | Ga0307413_10481950 | Ga0307413_104819502 | 137 |
| 120 | 3300031824 | Ga0307413_10744791 | Ga0307413_107447911 | 137 |
| 121 | 3300031852 | Ga0307410_10159004 | Ga0307410_101590043 | 137 |
| 122 | 3300031901 | Ga0307406_10028572 | Ga0307406_100285723 | 137 |
| 123 | 3300031903 | Ga0307407_10218346 | Ga0307407_102183462 | 137 |
| 124 | 3300031903 | Ga0307407_10242384 | Ga0307407_102423841 | 137 |
| 125 | 3300031911 | Ga0307412_10015679 | Ga0307412_100156796 | 137 |
| 126 | 3300031911 | Ga0307412_10076892 | Ga0307412_100768923 | 137 |
| 127 | 3300031911 | Ga0307412_10138218 | Ga0307412_101382183 | 137 |
| 128 | 3300031911 | Ga0307412_10298891 | Ga0307412_102988913 | 137 |
| 129 | 3300032002 | Ga0307416_100012594 | Ga0307416_1000125943 | 137 |
| 130 | 3300032002 | Ga0307416_100076068 | Ga0307416_1000760683 | 137 |
| 131 | 3300032002 | Ga0307416_100241853 | Ga0307416_1002418533 | 137 |
| 132 | 3300032002 | Ga0307416_102159512 | Ga0307416_1021595121 | 137 |
| 133 | 3300032005 | Ga0307411_10156555 | Ga0307411_101565551 | 137 |
| 134 | 3300032005 | Ga0307411_10373702 | Ga0307411_103737022 | 137 |
| 135 | 3300032005 | Ga0307411_10614129 | Ga0307411_106141291 | 137 |
| 136 | 3300032005 | Ga0307411_11150651 | Ga0307411_111506512 | 137 |
| 137 | 3300041404 | Ga0439436_0001705 | Ga0439436_0001705_483_896 | 137 |
| 138 | 3300041407 | Ga0439447_007884 | Ga0439447_007884_911_1324 | 137 |
| 139 | 3300041410 | Ga0439461_0023165 | Ga0439461_0023165_21_434 | 137 |
| 140 | 3300041411 | Ga0439466_0013020 | Ga0439466_0013020_1287_1700 | 137 |
| 141 | 3300041413 | Ga0439465_0004543 | Ga0439465_0004543_1477_1890 | 137 |
| 142 | 3300041413 | Ga0439465_0006272 | Ga0439465_0006272_1119_1532 | 137 |
| 143 | 3300041997 | Ga0439431_0004440 | Ga0439431_0004440_700_1113 | 137 |
| 144 | 3300041999 | Ga0439433_0005132 | Ga0439433_0005132_12_425 | 137 |
| 145 | 3300042002 | Ga0439442_005424 | Ga0439442_005424_1991_2404 | 137 |
| 146 | 3300042004 | Ga0439445_0009266 | Ga0439445_0009266_1477_1890 | 137 |
| 147 | 3300042004 | Ga0439445_0258874 | Ga0439445_0258874_91_504 | 137 |
| 148 | 3300042006 | Ga0439432_000677 | Ga0439432_000677_2770_3183 | 137 |
| 149 | 3300042007 | Ga0439449_0000720 | Ga0439449_0000720_2644_3057 | 137 |
| 150 | 3300042014 | Ga0439457_001445 | Ga0439457_001445_5768_6181 | 137 |
| 151 | 3300042014 | Ga0439457_061008 | Ga0439457_061008_254_667 | 137 |
| 152 | 3300042015 | Ga0439462_0008900 | Ga0439462_0008900_813_1226 | 137 |
| 153 | 3300042121 | Ga0450919_019199 | Ga0450919_019199_323_736 | 137 |
| 154 | 3300042125 | Ga0450923_051094 | Ga0450923_051094_125_538 | 137 |
| 155 | 3300042131 | Ga0450894_022440 | Ga0450894_022440_132_545 | 137 |
| 156 | 3300042132 | Ga0450895_018695 | Ga0450895_018695_205_618 | 137 |
| 157 | 3300042134 | Ga0450898_078339 | Ga0450898_078339_105_518 | 137 |
| 158 | 3300042145 | Ga0450906_003305 | Ga0450906_003305_2350_2763 | 137 |
| 159 | 3300042156 | Ga0439446_0000772 | Ga0439446_0000772_5595_6008 | 137 |
| 160 | 3300042156 | Ga0439446_0014612 | Ga0439446_0014612_1727_2140 | 137 |
| 161 | 3300042156 | Ga0439446_0028447 | Ga0439446_0028447_1078_1491 | 137 |
| 162 | 3300042184 | Ga0450908_004670 | Ga0450908_004670_207_620 | 137 |
| 163 | 3300042531 | Ga0450918_000856 | Ga0450918_000856_3541_3954 | 137 |
| 164 | 3300042532 | Ga0450893_0031055 | Ga0450893_0031055_64_477 | 137 |
| 165 | 3300046528 | Ga0495642_0085577 | Ga0495642_0085577_862_1275 | 137 |
| 166 | 3300046539 | Ga0495621_0054585 | Ga0495621_0054585_864_1277 | 137 |
| 167 | 3300046558 | Ga0495633_0319920 | Ga0495633_0319920_211_624 | 137 |
| 168 | 3300046615 | Ga0495656_0000202 | Ga0495656_0000202_9571_9984 | 137 |
| 169 | 3300046660 | Ga0495625_0013990 | Ga0495625_0013990_5174_5587 | 137 |
| 170 | 3300048903 | Ga0496100_1266712 | Ga0496100_1266712_151_564 | 137 |
| 171 | 3300049671 | Ga0501238_044073 | Ga0501238_044073_56_469 | 137 |
| 172 | 3300049679 | Ga0501249_036362 | Ga0501249_036362_181_594 | 137 |
| 173 | 3300049679 | Ga0501249_169889 | Ga0501249_169889_77_490 | 137 |
| 174 | 3300049682 | Ga0501252_030271 | Ga0501252_030271_169_582 | 137 |
| 175 | 3300049705 | Ga0501225_0111583 | Ga0501225_0111583_260_673 | 137 |
| 176 | 3300049758 | Ga0501241_155203 | Ga0501241_155203_88_501 | 137 |
| 177 | 3300050489 | nmdc:mga03683_12567_c1 | nmdc:mga03683_12567_c1_1247_1660 | 137 |
| 178 | 3300050490 | nmdc:mga03n38_113886_c1 | nmdc:mga03n38_113886_c1_734_1147 | 137 |
| 179 | 3300050490 | nmdc:mga03n38_148938_c1 | nmdc:mga03n38_148938_c1_704_1117 | 137 |
| 180 | 3300050491 | nmdc:mga00v17_94841_c1 | nmdc:mga00v17_94841_c1_378_791 | 137 |
| 181 | 3300050492 | nmdc:mga0yw44_37482_c1 | nmdc:mga0yw44_37482_c1_2411_2824 | 137 |
| 182 | 3300050493 | nmdc:mga0k408_17545_c1 | nmdc:mga0k408_17545_c1_2511_2924 | 137 |
| 183 | 3300050494 | nmdc:mga06z11_49970_c1 | nmdc:mga06z11_49970_c1_1497_1910 | 137 |
| 184 | 3300050516 | nmdc:mga0sz30_137975_c1 | nmdc:mga0sz30_137975_c1_270_683 | 137 |
| 185 | 3300005327 | Ga0070658_11909505 | Ga0070658_119095051 | 139 |
| 186 | 3300005456 | Ga0070678_100110197 | Ga0070678_1001101972 | 139 |
| 187 | 3300044842 | Ga0466957_0345110 | Ga0466957_0345110_259_726 | 139 |
| 188 | 3300031711 | Ga0265314_10041344 | Ga0265314_100413444 | 140 |
| 189 | 3300005548 | Ga0070665_100065852 | Ga0070665_1000658524 | 141 |
| 190 | 3300050496 | nmdc:mga07m45_75127_c1 | nmdc:mga07m45_75127_c1_191_637 | 142 |
| 191 | 3300035691 | Ga0373931_0147009 | Ga0373931_0147009_565_1011 | 143 |
| 192 | iso_pu_bacteria | 2513020051 | 2513230272 | 144 |
| 193 | iso_pu_bacteria | 2599185214 | 2599624013 | 144 |
| 194 | iso_pu_bacteria | 2599185226 | 2599672024 | 144 |
| 195 | iso_pu_bacteria | 2599185227 | 2599681894 | 144 |
| 196 | iso_pu_bacteria | 2599185229 | 2599693907 | 144 |
| 197 | iso_pu_bacteria | 2643221628 | 2644162807 | 144 |
| 198 | iso_pu_bacteria | 2643221658 | 2644328774 | 144 |
| 199 | iso_pu_bacteria | 2643221672 | 2644398007 | 144 |
| 200 | iso_pu_bacteria | 2738541277 | 2738719979 | 144 |
| 201 | iso_pu_bacteria | 2738541307 | 2738881480 | 144 |
| 202 | iso_pu_bacteria | 2738543013 | 2739249863 | 144 |
| 203 | iso_pu_bacteria | 2738543019 | 2739279178 | 144 |
| 204 | iso_pu_bacteria | 2818991446 | 2819596465 | 144 |
| 205 | iso_pu_bacteria | 2831265667 | 2831270204 | 144 |
| 206 | iso_pu_bacteria | 2838054893 | 2838059991 | 144 |
| 207 | iso_pu_bacteria | 2842677519 | 2842682377 | 144 |
| 208 | iso_pu_bacteria | 2842747753 | 2842749075 | 144 |
| 209 | iso_pu_bacteria | 2885192300 | 2885196180 | 144 |
| 210 | iso_pu_bacteria | 2885198086 | 2885199599 | 144 |
| 211 | iso_pu_bacteria | 2885211737 | 2885213128 | 144 |
| 212 | iso_pu_bacteria | 2899924645 | 2899931178 | 144 |
| 213 | iso_pu_bacteria | 2904449895 | 2904454837 | 144 |
| 214 | iso_pu_bacteria | 2904456579 | 2904462590 | 144 |
| 215 | iso_pu_bacteria | 2904541872 | 2904546819 | 144 |
| 216 | iso_pu_bacteria | 2919462493 | 2919464031 | 144 |
| 217 | iso_pu_bacteria | 2928037797 | 2928038045 | 144 |
| 218 | iso_pu_bacteria | 2928044640 | 2928046349 | 144 |
| 219 | iso_pu_bacteria | 2928051484 | 2928054041 | 144 |
| 220 | iso_pu_bacteria | 2928064002 | 2928065794 | 144 |
| 221 | iso_pu_bacteria | 2928070936 | 2928077883 | 144 |
| 222 | iso_pu_bacteria | 2928084124 | 2928090826 | 144 |
| 223 | iso_pu_bacteria | 2928115317 | 2928119239 | 144 |
| 224 | iso_pu_bacteria | 2929160207 | 2929164292 | 144 |
| 225 | iso_pu_bacteria | 2929520902 | 2929523872 | 144 |
| 226 | iso_pu_bacteria | 2945909444 | 2945913054 | 144 |
| 227 | iso_pu_bacteria | 2945972063 | 2945976560 | 144 |
| 228 | iso_pu_bacteria | 2945984333 | 2945984662 | 144 |
| 229 | iso_pu_bacteria | 2954767861 | 2954771593 | 144 |
| 230 | 3300005327 | Ga0070658_10071426 | Ga0070658_100714262 | 145 |
| 231 | 3300005327 | Ga0070658_10093094 | Ga0070658_100930942 | 145 |
| 232 | 3300005335 | Ga0070666_10396438 | Ga0070666_103964381 | 145 |
| 233 | 3300005336 | Ga0070680_100149304 | Ga0070680_1001493042 | 145 |
| 234 | 3300005339 | Ga0070660_100476071 | Ga0070660_1004760712 | 145 |
| 235 | 3300005339 | Ga0070660_101296214 | Ga0070660_1012962142 | 145 |
| 236 | 3300005344 | Ga0070661_100375478 | Ga0070661_1003754782 | 145 |
| 237 | 3300005367 | Ga0070667_102125694 | Ga0070667_1021256941 | 145 |
| 238 | 3300005436 | Ga0070713_100222930 | Ga0070713_1002229302 | 145 |
| 239 | 3300005436 | Ga0070713_100297250 | Ga0070713_1002972502 | 145 |
| 240 | 3300005437 | Ga0070710_10706905 | Ga0070710_107069052 | 145 |
| 241 | 3300005458 | Ga0070681_10076285 | Ga0070681_100762853 | 145 |
| 242 | 3300005458 | Ga0070681_10155002 | Ga0070681_101550022 | 145 |
| 243 | 3300005530 | Ga0070679_100060117 | Ga0070679_1000601175 | 145 |
| 244 | 3300005530 | Ga0070679_100076853 | Ga0070679_1000768532 | 145 |
| 245 | 3300005539 | Ga0068853_100221057 | Ga0068853_1002210572 | 145 |
| 246 | 3300005539 | Ga0068853_101824436 | Ga0068853_1018244361 | 145 |
| 247 | 3300005548 | Ga0070665_100000571 | Ga0070665_10000057121 | 145 |
| 248 | 3300005548 | Ga0070665_100013698 | Ga0070665_1000136989 | 145 |
| 249 | 3300005548 | Ga0070665_100244621 | Ga0070665_1002446212 | 145 |
| 250 | 3300005563 | Ga0068855_100025725 | Ga0068855_1000257252 | 145 |
| 251 | 3300005563 | Ga0068855_100029751 | Ga0068855_1000297515 | 145 |
| 252 | 3300005563 | Ga0068855_100381117 | Ga0068855_1003811172 | 145 |
| 253 | 3300005563 | Ga0068855_100910186 | Ga0068855_1009101862 | 145 |
| 254 | 3300005614 | Ga0068856_101061333 | Ga0068856_1010613332 | 145 |
| 255 | 3300005614 | Ga0068856_101622280 | Ga0068856_1016222802 | 145 |
| 256 | 3300005937 | Ga0081455_10409371 | Ga0081455_104093713 | 145 |
| 257 | 3300006237 | Ga0097621_100003551 | Ga0097621_1000035519 | 145 |
| 258 | 3300009093 | Ga0105240_10026474 | Ga0105240_100264747 | 145 |
| 259 | 3300009093 | Ga0105240_10030705 | Ga0105240_100307056 | 145 |
| 260 | 3300009093 | Ga0105240_10059229 | Ga0105240_100592294 | 145 |
| 261 | 3300009093 | Ga0105240_10163963 | Ga0105240_101639633 | 145 |
| 262 | 3300009093 | Ga0105240_10441892 | Ga0105240_104418921 | 145 |
| 263 | 3300009093 | Ga0105240_10794417 | Ga0105240_107944172 | 145 |
| 264 | 3300009093 | Ga0105240_10815851 | Ga0105240_108158512 | 145 |
| 265 | 3300009093 | Ga0105240_10874246 | Ga0105240_108742462 | 145 |
| 266 | 3300009174 | Ga0105241_10411683 | Ga0105241_104116832 | 145 |
| 267 | 3300009174 | Ga0105241_11885326 | Ga0105241_118853262 | 145 |
| 268 | 3300009174 | Ga0105241_11950070 | Ga0105241_119500701 | 145 |
| 269 | 3300009176 | Ga0105242_10273086 | Ga0105242_102730863 | 145 |
| 270 | 3300009545 | Ga0105237_10035344 | Ga0105237_100353442 | 145 |
| 271 | 3300009545 | Ga0105237_10645582 | Ga0105237_106455822 | 145 |
| 272 | 3300009545 | Ga0105237_12468941 | Ga0105237_124689411 | 145 |
| 273 | 3300009551 | Ga0105238_10041466 | Ga0105238_100414665 | 145 |
| 274 | 3300009551 | Ga0105238_10045275 | Ga0105238_100452755 | 145 |
| 275 | 3300009551 | Ga0105238_10096688 | Ga0105238_100966882 | 145 |
| 276 | 3300009551 | Ga0105238_10408404 | Ga0105238_104084042 | 145 |
| 277 | 3300009551 | Ga0105238_10606979 | Ga0105238_106069792 | 145 |
| 278 | 3300010375 | Ga0105239_10013020 | Ga0105239_100130205 | 145 |
| 279 | 3300010375 | Ga0105239_10208649 | Ga0105239_102086492 | 145 |
| 280 | 3300010375 | Ga0105239_10374025 | Ga0105239_103740253 | 145 |
| 281 | 3300010375 | Ga0105239_10685003 | Ga0105239_106850032 | 145 |
| 282 | 3300013104 | Ga0157370_10040646 | Ga0157370_100406466 | 145 |
| 283 | 3300013104 | Ga0157370_10210777 | Ga0157370_102107772 | 145 |
| 284 | 3300013105 | Ga0157369_10407945 | Ga0157369_104079452 | 145 |
| 285 | 3300013105 | Ga0157369_10414656 | Ga0157369_104146562 | 145 |
| 286 | 3300013307 | Ga0157372_11817603 | Ga0157372_118176032 | 145 |
| 287 | 3300021377 | Ga0213874_10001191 | Ga0213874_100011918 | 145 |
| 288 | 3300025231 | Ga0207427_116162 | Ga0207427_1161621 | 145 |
| 289 | 3300025261 | Ga0209233_1000013 | Ga0209233_1000013661 | 145 |
| 290 | 3300025272 | Ga0209455_1013798 | Ga0209455_10137982 | 145 |
| 291 | 3300025297 | Ga0209758_1000185 | Ga0209758_1000185105 | 145 |
| 292 | 3300025903 | Ga0207680_10584086 | Ga0207680_105840862 | 145 |
| 293 | 3300025909 | Ga0207705_10001989 | Ga0207705_1000198911 | 145 |
| 294 | 3300025909 | Ga0207705_10467378 | Ga0207705_104673782 | 145 |
| 295 | 3300025909 | Ga0207705_10469421 | Ga0207705_104694212 | 145 |
| 296 | 3300025911 | Ga0207654_10990518 | Ga0207654_109905182 | 145 |
| 297 | 3300025912 | Ga0207707_11252320 | Ga0207707_112523202 | 145 |
| 298 | 3300025913 | Ga0207695_10014959 | Ga0207695_100149598 | 145 |
| 299 | 3300025913 | Ga0207695_10028087 | Ga0207695_100280876 | 145 |
| 300 | 3300025913 | Ga0207695_10040636 | Ga0207695_100406364 | 145 |
| 301 | 3300025913 | Ga0207695_10044897 | Ga0207695_100448976 | 145 |
| 302 | 3300025913 | Ga0207695_10136673 | Ga0207695_101366732 | 145 |
| 303 | 3300025913 | Ga0207695_10188981 | Ga0207695_101889813 | 145 |
| 304 | 3300025914 | Ga0207671_10283787 | Ga0207671_102837872 | 145 |
| 305 | 3300025916 | Ga0207663_10622138 | Ga0207663_106221382 | 145 |
| 306 | 3300025917 | Ga0207660_10630904 | Ga0207660_106309042 | 145 |
| 307 | 3300025919 | Ga0207657_10038470 | Ga0207657_100384702 | 145 |
| 308 | 3300025919 | Ga0207657_10124060 | Ga0207657_101240602 | 145 |
| 309 | 3300025919 | Ga0207657_10302518 | Ga0207657_103025182 | 145 |
| 310 | 3300025919 | Ga0207657_11066929 | Ga0207657_110669291 | 145 |
| 311 | 3300025920 | Ga0207649_10487847 | Ga0207649_104878472 | 145 |
| 312 | 3300025921 | Ga0207652_10092949 | Ga0207652_100929492 | 145 |
| 313 | 3300025921 | Ga0207652_10129967 | Ga0207652_101299673 | 145 |
| 314 | 3300025924 | Ga0207694_10833486 | Ga0207694_108334862 | 145 |
| 315 | 3300025928 | Ga0207700_10141254 | Ga0207700_101412544 | 145 |
| 316 | 3300025944 | Ga0207661_10077134 | Ga0207661_100771342 | 145 |
| 317 | 3300025949 | Ga0207667_10012143 | Ga0207667_100121439 | 145 |
| 318 | 3300025949 | Ga0207667_10044273 | Ga0207667_100442736 | 145 |
| 319 | 3300025949 | Ga0207667_10494966 | Ga0207667_104949662 | 145 |
| 320 | 3300025949 | Ga0207667_11138887 | Ga0207667_111388872 | 145 |
| 321 | 3300026041 | Ga0207639_10199256 | Ga0207639_101992563 | 145 |
| 322 | 3300026041 | Ga0207639_10631735 | Ga0207639_106317352 | 145 |
| 323 | 3300026067 | Ga0207678_10524829 | Ga0207678_105248293 | 145 |
| 324 | 3300026078 | Ga0207702_10923794 | Ga0207702_109237942 | 145 |
| 325 | 3300026121 | Ga0207683_10078444 | Ga0207683_100784442 | 145 |
| 326 | 3300028379 | Ga0268266_10002571 | Ga0268266_1000257116 | 145 |
| 327 | 3300028379 | Ga0268266_10020327 | Ga0268266_100203272 | 145 |
| 328 | 3300028379 | Ga0268266_10490046 | Ga0268266_104900462 | 145 |
| 329 | 3300028577 | Ga0265318_10009718 | Ga0265318_100097182 | 145 |
| 330 | 3300028800 | Ga0265338_10245937 | Ga0265338_102459372 | 145 |
| 331 | 3300031235 | Ga0265330_10133814 | Ga0265330_101338142 | 145 |
| 332 | 3300031238 | Ga0265332_10023082 | Ga0265332_100230822 | 145 |
| 333 | 3300031240 | Ga0265320_10072850 | Ga0265320_100728502 | 145 |
| 334 | 3300031241 | Ga0265325_10002800 | Ga0265325_100028005 | 145 |
| 335 | 3300031241 | Ga0265325_10186974 | Ga0265325_101869742 | 145 |
| 336 | 3300031241 | Ga0265325_10354307 | Ga0265325_103543071 | 145 |
| 337 | 3300031242 | Ga0265329_10204041 | Ga0265329_102040412 | 145 |
| 338 | 3300031247 | Ga0265340_10012156 | Ga0265340_100121567 | 145 |
| 339 | 3300031247 | Ga0265340_10192936 | Ga0265340_101929362 | 145 |
| 340 | 3300031249 | Ga0265339_10056109 | Ga0265339_100561092 | 145 |
| 341 | 3300031249 | Ga0265339_10176300 | Ga0265339_101763001 | 145 |
| 342 | 3300031250 | Ga0265331_10008993 | Ga0265331_100089933 | 145 |
| 343 | 3300031250 | Ga0265331_10042787 | Ga0265331_100427873 | 145 |
| 344 | 3300031344 | Ga0265316_10204375 | Ga0265316_102043752 | 145 |
| 345 | 3300031595 | Ga0265313_10002996 | Ga0265313_1000299612 | 145 |
| 346 | 3300031595 | Ga0265313_10018280 | Ga0265313_100182804 | 145 |
| 347 | 3300031711 | Ga0265314_10011318 | Ga0265314_100113182 | 145 |
| 348 | 3300031712 | Ga0265342_10040406 | Ga0265342_100404062 | 145 |
| 349 | 3300031730 | Ga0307516_10029985 | Ga0307516_100299853 | 145 |
| 350 | 3300037466 | Ga0395898_0366228 | Ga0395898_0366228_439_894 | 145 |
| 351 | 3300038443 | Ga0395901_0433110 | Ga0395901_0433110_268_723 | 145 |
| 352 | 3300039437 | Ga0436365_0255272 | Ga0436365_0255272_165_617 | 145 |
| 353 | 3300039438 | Ga0436360_0707346 | Ga0436360_0707346_224_676 | 145 |
| 354 | 3300039450 | Ga0436363_0026702 | Ga0436363_0026702_94_543 | 145 |
| 355 | 3300039453 | Ga0436362_1045686 | Ga0436362_1045686_623_1075 | 145 |
| 356 | 3300047317 | Ga0495604_0594284 | Ga0495604_0594284_181_636 | 145 |
| 357 | 3300047319 | Ga0495674_0367443 | Ga0495674_0367443_394_849 | 145 |
| 358 | 3300049570 | Ga0501033_0145409 | Ga0501033_0145409_713_1168 | 145 |
| 359 | 3300049573 | Ga0501037_0339358 | Ga0501037_0339358_454_921 | 145 |
| 360 | 3300049573 | Ga0501037_0440011 | Ga0501037_0440011_409_864 | 145 |
| 361 | 3300049575 | Ga0501039_0851823 | Ga0501039_0851823_188_640 | 145 |
| 362 | 3300049579 | Ga0501043_0554477 | Ga0501043_0554477_123_578 | 145 |
| 363 | 3300049580 | Ga0501046_0122247 | Ga0501046_0122247_1438_1890 | 145 |
| 364 | 3300049580 | Ga0501046_0139837 | Ga0501046_0139837_1081_1536 | 145 |
| 365 | 3300049581 | Ga0501047_0149829 | Ga0501047_0149829_962_1429 | 145 |
| 366 | 3300049581 | Ga0501047_0231916 | Ga0501047_0231916_763_1218 | 145 |
| 367 | 3300049586 | Ga0501070_0452375 | Ga0501070_0452375_457_912 | 145 |
| 368 | 3300049742 | Ga0501080_0152059 | Ga0501080_0152059_355_810 | 145 |
| 369 | 3300049822 | Ga0501035_0020102 | Ga0501035_0020102_2650_3105 | 145 |
| 370 | 3300049822 | Ga0501035_0077655 | Ga0501035_0077655_1223_1675 | 145 |
| 371 | 3300049823 | Ga0501044_0030699 | Ga0501044_0030699_497_952 | 145 |
| 372 | 3300050492 | nmdc:mga0yw44_935410_c1 | nmdc:mga0yw44_935410_c1_49_501 | 145 |
| 373 | 3300053119 | Ga0500595_042249 | Ga0500595_042249_378_833 | 145 |
| 374 | 3300053730 | Ga0500645_014949 | Ga0500645_014949_618_1070 | 145 |
| 375 | 3300025942 | Ga0207689_10158293 | Ga0207689_101582933 | 146 |
| 376 | 3300026035 | Ga0207703_10444713 | Ga0207703_104447132 | 146 |
| 377 | 3300050507 | nmdc:mga05p37_1439989_c1 | nmdc:mga05p37_1439989_c1_241_681 | 146 |
| 378 | 3300009098 | Ga0105245_10763192 | Ga0105245_107631922 | 147 |
| 379 | 3300009148 | Ga0105243_10117165 | Ga0105243_101171652 | 147 |
| 380 | 3300013297 | Ga0157378_10461464 | Ga0157378_104614642 | 147 |
| 381 | 3300025911 | Ga0207654_10880263 | Ga0207654_108802632 | 147 |
| 382 | 3300026121 | Ga0207683_10626202 | Ga0207683_106262022 | 147 |
| 383 | 3300031711 | Ga0265314_10212841 | Ga0265314_102128412 | 147 |
| 384 | 3300046648 | Ga0495611_0055983 | Ga0495611_0055983_138_605 | 147 |
| 385 | 3300048924 | Ga0496121_0169638 | Ga0496121_0169638_774_1241 | 147 |
| 386 | 3300049579 | Ga0501043_0636961 | Ga0501043_0636961_178_648 | 147 |
| 387 | 3300049581 | Ga0501047_0021113 | Ga0501047_0021113_1273_1743 | 147 |
| 388 | 3300049822 | Ga0501035_0028649 | Ga0501035_0028649_1344_1814 | 147 |
| 389 | 3300049823 | Ga0501044_0263494 | Ga0501044_0263494_1071_1541 | 147 |
| 390 | 3300053119 | Ga0500595_002496 | Ga0500595_002496_1727_2194 | 147 |
| 391 | iso_pu_bacteria | 2511231004 | 2511252667 | 147 |
| 392 | iso_pu_bacteria | 2511231006 | 2511263238 | 147 |
| 393 | iso_pu_bacteria | 2511231007 | 2511269974 | 147 |
| 394 | iso_pu_bacteria | 2511231008 | 2511275627 | 147 |
| 395 | iso_pu_bacteria | 2511231010 | 2511289889 | 147 |
| 396 | iso_pu_bacteria | 2511231011 | 2511294393 | 147 |
| 397 | iso_pu_bacteria | 2511231012 | 2511302014 | 147 |
| 398 | iso_pu_bacteria | 2511231014 | 2511315352 | 147 |
| 399 | iso_pu_bacteria | 2511231015 | 2511319358 | 147 |
| 400 | iso_pu_bacteria | 2511231016 | 2511325023 | 147 |
| 401 | iso_pu_bacteria | 2511231017 | 2511332083 | 147 |
| 402 | iso_pu_bacteria | 2511231018 | 2511339152 | 147 |
| 403 | iso_pu_bacteria | 2511231019 | 2511343144 | 147 |
| 404 | iso_pu_bacteria | 2511231020 | 2511348657 | 147 |
| 405 | iso_pu_bacteria | 2511231021 | 2511353637 | 147 |
| 406 | iso_pu_bacteria | 2511231022 | 2511364211 | 147 |
| 407 | iso_pu_bacteria | 2511231023 | 2511371552 | 147 |
| 408 | iso_pu_bacteria | 2511231024 | 2511373865 | 147 |
| 409 | iso_pu_bacteria | 2511231031 | 2511416519 | 147 |
| 410 | iso_pu_bacteria | 2511231156 | 2511827764 | 147 |
| 411 | iso_pu_bacteria | 2512047018 | 2512326550 | 147 |
| 412 | iso_pu_bacteria | 2554235132 | 2554818426 | 147 |
| 413 | iso_pu_bacteria | 2554235231 | 2555247981 | 147 |
| 414 | iso_pu_bacteria | 2554235341 | 2555672956 | 147 |
| 415 | iso_pu_bacteria | 2582580891 | 2583795599 | 147 |
| 416 | iso_pu_bacteria | 2597489887 | 2597861007 | 147 |
| 417 | iso_pu_bacteria | 2597489888 | 2597866747 | 147 |
| 418 | iso_pu_bacteria | 2597489889 | 2597872608 | 147 |
| 419 | iso_pu_bacteria | 2599185155 | 2599327629 | 147 |
| 420 | iso_pu_bacteria | 2599185160 | 2599355837 | 147 |
| 421 | iso_pu_bacteria | 2599185161 | 2599362761 | 147 |
| 422 | iso_pu_bacteria | 2599185162 | 2599368933 | 147 |
| 423 | iso_pu_bacteria | 2599185163 | 2599375870 | 147 |
| 424 | iso_pu_bacteria | 2599185164 | 2599380943 | 147 |
| 425 | iso_pu_bacteria | 2599185165 | 2599387541 | 147 |
| 426 | iso_pu_bacteria | 2599185166 | 2599394728 | 147 |
| 427 | iso_pu_bacteria | 2599185167 | 2599400913 | 147 |
| 428 | iso_pu_bacteria | 2599185168 | 2599406493 | 147 |
| 429 | iso_pu_bacteria | 2599185179 | 2599449742 | 147 |
| 430 | iso_pu_bacteria | 2599185181 | 2599462671 | 147 |
| 431 | iso_pu_bacteria | 2599185182 | 2599467907 | 147 |
| 432 | iso_pu_bacteria | 2599185185 | 2599485759 | 147 |
| 433 | iso_pu_bacteria | 2599185186 | 2599491688 | 147 |
| 434 | iso_pu_bacteria | 2599185188 | 2599500381 | 147 |
| 435 | iso_pu_bacteria | 2599185189 | 2599505870 | 147 |
| 436 | iso_pu_bacteria | 2599185190 | 2599511816 | 147 |
| 437 | iso_pu_bacteria | 2599185191 | 2599516800 | 147 |
| 438 | iso_pu_bacteria | 2599185212 | 2599615963 | 147 |
| 439 | iso_pu_bacteria | 2599185248 | 2599768025 | 147 |
| 440 | iso_pu_bacteria | 2599185257 | 2599804538 | 147 |
| 441 | iso_pu_bacteria | 2599185288 | 2599879160 | 147 |
| 442 | iso_pu_bacteria | 2599185289 | 2599885461 | 147 |
| 443 | iso_pu_bacteria | 2599185290 | 2599893319 | 147 |
| 444 | iso_pu_bacteria | 2599185291 | 2599897175 | 147 |
| 445 | iso_pu_bacteria | 2599185300 | 2599930596 | 147 |
| 446 | iso_pu_bacteria | 2599185302 | 2599942236 | 147 |
| 447 | iso_pu_bacteria | 2599185303 | 2599948893 | 147 |
| 448 | iso_pu_bacteria | 2599185304 | 2599954350 | 147 |
| 449 | iso_pu_bacteria | 2599185305 | 2599963043 | 147 |
| 450 | iso_pu_bacteria | 2599185306 | 2599966067 | 147 |
| 451 | iso_pu_bacteria | 2599185308 | 2599977883 | 147 |
| 452 | iso_pu_bacteria | 2599185309 | 2599982806 | 147 |
| 453 | iso_pu_bacteria | 2599185310 | 2599988443 | 147 |
| 454 | iso_pu_bacteria | 2599185311 | 2599994107 | 147 |
| 455 | iso_pu_bacteria | 2599185312 | 2599999239 | 147 |
| 456 | iso_pu_bacteria | 2599185313 | 2600004188 | 147 |
| 457 | iso_pu_bacteria | 2599185314 | 2600012050 | 147 |
| 458 | iso_pu_bacteria | 2599185315 | 2600019884 | 147 |
| 459 | iso_pu_bacteria | 2599185316 | 2600026186 | 147 |
| 460 | iso_pu_bacteria | 2599185317 | 2600031257 | 147 |
| 461 | iso_pu_bacteria | 2599185318 | 2600036099 | 147 |
| 462 | iso_pu_bacteria | 2599185319 | 2600044318 | 147 |
| 463 | iso_pu_bacteria | 2599185320 | 2600046769 | 147 |
| 464 | iso_pu_bacteria | 2599185321 | 2600054482 | 147 |
| 465 | iso_pu_bacteria | 2599185322 | 2600062224 | 147 |
| 466 | iso_pu_bacteria | 2599185323 | 2600067905 | 147 |
| 467 | iso_pu_bacteria | 2599185324 | 2600071988 | 147 |
| 468 | iso_pu_bacteria | 2599185325 | 2600076422 | 147 |
| 469 | iso_pu_bacteria | 2599185356 | 2600215295 | 147 |
| 470 | iso_pu_bacteria | 2600254930 | 2600359518 | 147 |
| 471 | iso_pu_bacteria | 2600254931 | 2600363428 | 147 |
| 472 | iso_pu_bacteria | 2600254954 | 2600442645 | 147 |
| 473 | iso_pu_bacteria | 2600255283 | 2601627564 | 147 |
| 474 | iso_pu_bacteria | 2600255296 | 2601693106 | 147 |
| 475 | iso_pu_bacteria | 2600255313 | 2601775461 | 147 |
| 476 | iso_pu_bacteria | 2600255318 | 2601798429 | 147 |
| 477 | iso_pu_bacteria | 2600255389 | 2602011020 | 147 |
| 478 | iso_pu_bacteria | 2603880185 | 2606077323 | 147 |
| 479 | iso_pu_bacteria | 2603880199 | 2606129431 | 147 |
| 480 | iso_pu_bacteria | 2606217733 | 2608385079 | 147 |
| 481 | iso_pu_bacteria | 2619619299 | 2621296726 | 147 |
| 482 | iso_pu_bacteria | 2623620443 | 2624483535 | 147 |
| 483 | iso_pu_bacteria | 2623620446 | 2624495084 | 147 |
| 484 | iso_pu_bacteria | 2643221565 | 2643843082 | 147 |
| 485 | iso_pu_bacteria | 2643221571 | 2643873330 | 147 |
| 486 | iso_pu_bacteria | 2643221589 | 2643956191 | 147 |
| 487 | iso_pu_bacteria | 2643221602 | 2644020311 | 147 |
| 488 | iso_pu_bacteria | 2643221633 | 2644184353 | 147 |
| 489 | iso_pu_bacteria | 2643221650 | 2644283108 | 147 |
| 490 | iso_pu_bacteria | 2643221713 | 2644624611 | 147 |
| 491 | iso_pu_bacteria | 2667528170 | 2671089676 | 147 |
| 492 | iso_pu_bacteria | 2667528171 | 2671099402 | 147 |
| 493 | iso_pu_bacteria | 2667528176 | 2671129514 | 147 |
| 494 | iso_pu_bacteria | 2671180172 | 2671771545 | 147 |
| 495 | iso_pu_bacteria | 2675903420 | 2677897274 | 147 |
| 496 | iso_pu_bacteria | 2675903515 | 2678266267 | 147 |
| 497 | iso_pu_bacteria | 2713897148 | 2715749716 | 147 |
| 498 | iso_pu_bacteria | 2713897149 | 2715754720 | 147 |
| 499 | iso_pu_bacteria | 2718217725 | 2718636738 | 147 |
| 500 | iso_pu_bacteria | 2721755607 | 2723251483 | 147 |
| 501 | iso_pu_bacteria | 2738541265 | 2738675379 | 147 |
| 502 | iso_pu_bacteria | 2738541271 | 2738690463 | 147 |
| 503 | iso_pu_bacteria | 2738541282 | 2738753782 | 147 |
| 504 | iso_pu_bacteria | 2738541294 | 2738807376 | 147 |
| 505 | iso_pu_bacteria | 2738541303 | 2738862771 | 147 |
| 506 | iso_pu_bacteria | 2738541309 | 2738894736 | 147 |
| 507 | iso_pu_bacteria | 2738543004 | 2739199174 | 147 |
| 508 | iso_pu_bacteria | 2738543015 | 2739260528 | 147 |
| 509 | iso_pu_bacteria | 2738543016 | 2739266237 | 147 |
| 510 | iso_pu_bacteria | 2738543020 | 2739285790 | 147 |
| 511 | iso_pu_bacteria | 2738543021 | 2739291103 | 147 |
| 512 | iso_pu_bacteria | 2738543025 | 2739312385 | 147 |
| 513 | iso_pu_bacteria | 2740892503 | 2743740547 | 147 |
| 514 | iso_pu_bacteria | 2744054620 | 2745007499 | 147 |
| 515 | iso_pu_bacteria | 2773857670 | 2774118227 | 147 |
| 516 | iso_pu_bacteria | 2773857673 | 2774136313 | 147 |
| 517 | iso_pu_bacteria | 2784132063 | 2784261690 | 147 |
| 518 | iso_pu_bacteria | 2784132072 | 2784313719 | 147 |
| 519 | iso_pu_bacteria | 2791355520 | 2794593721 | 147 |
| 520 | iso_pu_bacteria | 2806310737 | 2807410881 | 147 |
| 521 | iso_pu_bacteria | 2806310745 | 2807459222 | 147 |
| 522 | iso_pu_bacteria | 2808606361 | 2808855576 | 147 |
| 523 | iso_pu_bacteria | 2808606373 | 2808906145 | 147 |
| 524 | iso_pu_bacteria | 2808606376 | 2808926094 | 147 |
| 525 | iso_pu_bacteria | 2808606377 | 2808928314 | 147 |
| 526 | iso_pu_bacteria | 2808606378 | 2808935587 | 147 |
| 527 | iso_pu_bacteria | 2808606379 | 2808942195 | 147 |
| 528 | iso_pu_bacteria | 2808606380 | 2808948195 | 147 |
| 529 | iso_pu_bacteria | 2808606381 | 2808950503 | 147 |
| 530 | iso_pu_bacteria | 2808606382 | 2808959953 | 147 |
| 531 | iso_pu_bacteria | 2808606383 | 2808964195 | 147 |
| 532 | iso_pu_bacteria | 2808606385 | 2808976273 | 147 |
| 533 | iso_pu_bacteria | 2808606388 | 2808994265 | 147 |
| 534 | iso_pu_bacteria | 2808606389 | 2808998969 | 147 |
| 535 | iso_pu_bacteria | 2808606445 | 2809217327 | 147 |
| 536 | iso_pu_bacteria | 2816332298 | 2817494161 | 147 |
| 537 | iso_pu_bacteria | 2818991456 | 2819655256 | 147 |
| 538 | iso_pu_bacteria | 2818991464 | 2819704548 | 147 |
| 539 | iso_pu_bacteria | 2823421272 | 2823421517 | 147 |
| 540 | iso_pu_bacteria | 2825651385 | 2825654948 | 147 |
| 541 | iso_pu_bacteria | 2826581358 | 2826582373 | 147 |
| 542 | iso_pu_bacteria | 2834028612 | 2834031072 | 147 |
| 543 | iso_pu_bacteria | 2842805378 | 2842807724 | 147 |
| 544 | iso_pu_bacteria | 2842815866 | 2842816975 | 147 |
| 545 | iso_pu_bacteria | 2842826826 | 2842828650 | 147 |
| 546 | iso_pu_bacteria | 2842832357 | 2842833580 | 147 |
| 547 | iso_pu_bacteria | 2842837860 | 2842838017 | 147 |
| 548 | iso_pu_bacteria | 2842843487 | 2842845804 | 147 |
| 549 | iso_pu_bacteria | 2842849001 | 2842852146 | 147 |
| 550 | iso_pu_bacteria | 2842854478 | 2842855745 | 147 |
| 551 | iso_pu_bacteria | 2844665904 | 2844667220 | 147 |
| 552 | iso_pu_bacteria | 2852612431 | 2852616473 | 147 |
| 553 | iso_pu_bacteria | 2852657418 | 2852659937 | 147 |
| 554 | iso_pu_bacteria | 2852667396 | 2852671441 | 147 |
| 555 | iso_pu_bacteria | 2860339153 | 2860341852 | 147 |
| 556 | iso_pu_bacteria | 2860867994 | 2860873142 | 147 |
| 557 | iso_pu_bacteria | 2878029506 | 2878029542 | 147 |
| 558 | iso_pu_bacteria | 2880230671 | 2880236121 | 147 |
| 559 | iso_pu_bacteria | 2904518522 | 2904518828 | 147 |
| 560 | iso_pu_bacteria | 2904550169 | 2904551477 | 147 |
| 561 | iso_pu_bacteria | 2908446538 | 2908452736 | 147 |
| 562 | iso_pu_bacteria | 2912963787 | 2912969000 | 147 |
| 563 | iso_pu_bacteria | 2913036834 | 2913042648 | 147 |
| 564 | iso_pu_bacteria | 2917070673 | 2917076857 | 147 |
| 565 | iso_pu_bacteria | 2919063839 | 2919065387 | 147 |
| 566 | iso_pu_bacteria | 2919385768 | 2919389074 | 147 |
| 567 | iso_pu_bacteria | 2919456309 | 2919457705 | 147 |
| 568 | iso_pu_bacteria | 2919481497 | 2919485776 | 147 |
| 569 | iso_pu_bacteria | 2919487758 | 2919488001 | 147 |
| 570 | iso_pu_bacteria | 2919501602 | 2919505921 | 147 |
| 571 | iso_pu_bacteria | 2919697872 | 2919700453 | 147 |
| 572 | iso_pu_bacteria | 2923153595 | 2923159640 | 147 |
| 573 | iso_pu_bacteria | 2923586266 | 2923589118 | 147 |
| 574 | iso_pu_bacteria | 2926063275 | 2926067802 | 147 |
| 575 | iso_pu_bacteria | 2929144301 | 2929150042 | 147 |
| 576 | iso_pu_bacteria | 2929189879 | 2929195267 | 147 |
| 577 | iso_pu_bacteria | 2931369376 | 2931372517 | 147 |
| 578 | iso_pu_bacteria | 2931390751 | 2931390773 | 147 |
| 579 | iso_pu_bacteria | 2931396565 | 2931398238 | 147 |
| 580 | iso_pu_bacteria | 2935353572 | 2935358176 | 147 |
| 581 | iso_pu_bacteria | 2939636861 | 2939640681 | 147 |
| 582 | iso_pu_bacteria | 2939651529 | 2939654260 | 147 |
| 583 | iso_pu_bacteria | 2945928738 | 2945930796 | 147 |
| 584 | iso_pu_bacteria | 2945961074 | 2945966989 | 147 |
| 585 | iso_pu_bacteria | 2946006987 | 2946013145 | 147 |
| 586 | iso_pu_bacteria | 2946027586 | 2946028020 | 147 |
| 587 | iso_pu_bacteria | 2947233263 | 2947234547 | 147 |
| 588 | iso_pu_bacteria | 2974289157 | 2974293962 | 147 |
| 589 | iso_pu_bacteria | 2984286254 | 2984286474 | 147 |
| 590 | iso_pu_bacteria | 2988728565 | 2988731581 | 147 |
| 591 | iso_pu_bacteria | 2998139840 | 2998139865 | 147 |
| 592 | iso_pu_bacteria | 3007315729 | 3007316432 | 147 |
| 593 | iso_pu_bacteria | 3007419365 | 3007419396 | 147 |
| 594 | iso_pu_bacteria | 3007511990 | 3007517301 | 147 |
| 595 | iso_pu_bacteria | 3007614139 | 3007619654 | 147 |
| 596 | iso_pu_bacteria | 3007619802 | 3007624589 | 147 |
| 597 | iso_pu_bacteria | 3007718800 | 3007719561 | 147 |
| 598 | iso_pu_bacteria | 3007803356 | 3007806260 | 147 |
| 599 | iso_pu_bacteria | 3007855910 | 3007859315 | 147 |
| 600 | iso_pu_bacteria | 3007861166 | 3007864981 | 147 |
| 601 | iso_pu_bacteria | 3007866637 | 3007866662 | 147 |
| 602 | iso_pu_bacteria | 3007872151 | 3007873372 | 147 |
| 603 | iso_pu_bacteria | 637000220 | 637323388 | 147 |
| 604 | iso_pu_bacteria | 8015687852 | 8015693738 | 147 |
| 605 | iso_pu_bacteria | 8019769354 | 8019769649 | 147 |
| 606 | iso_pu_bacteria | 8019775933 | 8019781403 | 147 |
| 607 | iso_pu_bacteria | 8029995093 | 8029995389 | 147 |
| 608 | iso_pu_bacteria | 8034962539 | 8034964385 | 147 |
| 609 | iso_pu_bacteria | 8052494512 | 8052494734 | 147 |
| 610 | iso_pu_bacteria | 8054285046 | 8054290405 | 147 |
| 611 | iso_pu_bacteria | 8054347763 | 8054349465 | 147 |
| 612 | iso_pu_bacteria | 8054503363 | 8054503386 | 147 |
| 613 | iso_pu_bacteria | 8054929484 | 8054931211 | 147 |
| 614 | iso_pu_bacteria | 8055770955 | 8055776996 | 147 |
| 615 | iso_pu_bacteria | 8055817908 | 8055824030 | 147 |
| 616 | iso_pu_bacteria | 8056115690 | 8056116435 | 147 |
| 617 | iso_pu_bacteria | 8056120720 | 8056125795 | 147 |
| 618 | iso_pu_bacteria | 8056125926 | 8056125948 | 147 |
| 619 | iso_pu_bacteria | 8056131705 | 8056131727 | 147 |
| 620 | iso_pu_bacteria | 8056137416 | 8056142914 | 147 |
| 621 | iso_pu_bacteria | 8056143049 | 8056143075 | 147 |
| 622 | iso_pu_bacteria | 8056148874 | 8056151372 | 147 |
| 623 | iso_pu_bacteria | 8056155041 | 8056159829 | 147 |
| 624 | iso_pu_bacteria | 8056166840 | 8056171189 | 147 |
| 625 | iso_pu_bacteria | 8056172158 | 8056177295 | 147 |
| 626 | iso_pu_bacteria | 8056177738 | 8056182117 | 147 |
| 627 | iso_pu_bacteria | 8056569372 | 8056570590 | 147 |
| 628 | iso_pu_bacteria | 8057798959 | 8057802064 | 147 |
| 629 | 3300002739 | JGI25158J39367_1019037 | JGI25158J39367_10190371 | 148 |
| 630 | 3300002773 | JGI25152J39213_1022211 | JGI25152J39213_10222111 | 148 |
| 631 | 3300003187 | JGI25151J46595_10004639 | JGI25151J46595_100046398 | 148 |
| 632 | 3300003187 | JGI25151J46595_10020532 | JGI25151J46595_100205322 | 148 |
| 633 | 3300003187 | JGI25151J46595_10132605 | JGI25151J46595_101326051 | 148 |
| 634 | 3300003374 | JGI25161J50226_1004834 | JGI25161J50226_10048343 | 148 |
| 635 | 3300003578 | Ga0006562J51391_1029315 | Ga0006562J51391_10293153 | 148 |
| 636 | 3300003578 | Ga0006562J51391_1029316 | Ga0006562J51391_10293162 | 148 |
| 637 | 3300003762 | Ga0055542_1000033 | Ga0055542_100003326 | 148 |
| 638 | 3300003781 | Ga0055536_1015428 | Ga0055536_10154281 | 148 |
| 639 | 3300003781 | Ga0055536_1030978 | Ga0055536_10309781 | 148 |
| 640 | 3300003784 | Ga0055534_1000042 | Ga0055534_100004283 | 148 |
| 641 | 3300003791 | Ga0055530_10013632 | Ga0055530_100136321 | 148 |
| 642 | 3300003792 | Ga0055540_1008764 | Ga0055540_10087643 | 148 |
| 643 | 3300003792 | Ga0055540_1012754 | Ga0055540_10127541 | 148 |
| 644 | 3300003794 | Ga0055531_10020084 | Ga0055531_100200844 | 148 |
| 645 | 3300005344 | Ga0070661_100105889 | Ga0070661_1001058893 | 148 |
| 646 | 3300005344 | Ga0070661_101175700 | Ga0070661_1011757001 | 148 |
| 647 | 3300005457 | Ga0070662_100053572 | Ga0070662_1000535723 | 148 |
| 648 | 3300005457 | Ga0070662_100268482 | Ga0070662_1002684822 | 148 |
| 649 | 3300005459 | Ga0068867_100238418 | Ga0068867_1002384183 | 148 |
| 650 | 3300005539 | Ga0068853_100882267 | Ga0068853_1008822672 | 148 |
| 651 | 3300005616 | Ga0068852_100764704 | Ga0068852_1007647042 | 148 |
| 652 | 3300005844 | Ga0068862_100076069 | Ga0068862_1000760693 | 148 |
| 653 | 3300006048 | Ga0075363_100239570 | Ga0075363_1002395702 | 148 |
| 654 | 3300006177 | Ga0075362_10165140 | Ga0075362_101651402 | 148 |
| 655 | 3300006195 | Ga0075366_10034240 | Ga0075366_100342404 | 148 |
| 656 | 3300006946 | Ga0079104_1087561 | Ga0079104_10875612 | 148 |
| 657 | 3300006948 | Ga0099826_10009833 | Ga0099826_100098334 | 148 |
| 658 | 3300007076 | Ga0075435_101277415 | Ga0075435_1012774152 | 148 |
| 659 | 3300009036 | Ga0105244_10003747 | Ga0105244_100037478 | 148 |
| 660 | 3300009036 | Ga0105244_10187125 | Ga0105244_101871251 | 148 |
| 661 | 3300009093 | Ga0105240_10172079 | Ga0105240_101720793 | 148 |
| 662 | 3300009098 | Ga0105245_10275295 | Ga0105245_102752952 | 148 |
| 663 | 3300009148 | Ga0105243_10019997 | Ga0105243_100199973 | 148 |
| 664 | 3300009148 | Ga0105243_10029768 | Ga0105243_100297683 | 148 |
| 665 | 3300009176 | Ga0105242_10447245 | Ga0105242_104472452 | 148 |
| 666 | 3300009545 | Ga0105237_10012953 | Ga0105237_100129534 | 148 |
| 667 | 3300009551 | Ga0105238_10128726 | Ga0105238_101287264 | 148 |
| 668 | 3300010375 | Ga0105239_10144596 | Ga0105239_101445963 | 148 |
| 669 | 3300010375 | Ga0105239_11930690 | Ga0105239_119306901 | 148 |
| 670 | 3300011119 | Ga0105246_10088711 | Ga0105246_100887113 | 148 |
| 671 | 3300012502 | Ga0157347_1001430 | Ga0157347_10014303 | 148 |
| 672 | 3300013104 | Ga0157370_10017421 | Ga0157370_100174218 | 148 |
| 673 | 3300013104 | Ga0157370_11569551 | Ga0157370_115695511 | 148 |
| 674 | 3300013105 | Ga0157369_10041845 | Ga0157369_100418453 | 148 |
| 675 | 3300013306 | Ga0163162_10600889 | Ga0163162_106008892 | 148 |
| 676 | 3300013307 | Ga0157372_10124073 | Ga0157372_101240732 | 148 |
| 677 | 3300014497 | Ga0182008_10003873 | Ga0182008_1000387310 | 148 |
| 678 | 3300014497 | Ga0182008_10004162 | Ga0182008_100041629 | 148 |
| 679 | 3300014969 | Ga0157376_11013557 | Ga0157376_110135572 | 148 |
| 680 | 3300015261 | Ga0182006_1002216 | Ga0182006_100221612 | 148 |
| 681 | 3300015262 | Ga0182007_10000825 | Ga0182007_100008258 | 148 |
| 682 | 3300015265 | Ga0182005_1045196 | Ga0182005_10451961 | 148 |
| 683 | 3300025208 | Ga0209436_122849 | Ga0209436_1228492 | 148 |
| 684 | 3300025229 | Ga0209147_100783 | Ga0209147_10078329 | 148 |
| 685 | 3300025258 | Ga0209129_1000071 | Ga0209129_1000071134 | 148 |
| 686 | 3300025258 | Ga0209129_1005062 | Ga0209129_10050623 | 148 |
| 687 | 3300025258 | Ga0209129_1005094 | Ga0209129_10050944 | 148 |
| 688 | 3300025263 | Ga0209565_1000334 | Ga0209565_10003347 | 148 |
| 689 | 3300025263 | Ga0209565_1002220 | Ga0209565_10022203 | 148 |
| 690 | 3300025273 | Ga0209673_1001906 | Ga0209673_100190613 | 148 |
| 691 | 3300025284 | Ga0209130_1003240 | Ga0209130_10032405 | 148 |
| 692 | 3300025284 | Ga0209130_1003577 | Ga0209130_10035777 | 148 |
| 693 | 3300025291 | Ga0209675_1003063 | Ga0209675_10030639 | 148 |
| 694 | 3300025292 | Ga0209676_1000005 | Ga0209676_100000549 | 148 |
| 695 | 3300025294 | Ga0209025_1000544 | Ga0209025_10005443 | 148 |
| 696 | 3300025294 | Ga0209025_1000854 | Ga0209025_100085445 | 148 |
| 697 | 3300025294 | Ga0209025_1001296 | Ga0209025_10012962 | 148 |
| 698 | 3300025294 | Ga0209025_1012749 | Ga0209025_10127493 | 148 |
| 699 | 3300025295 | Ga0209564_1000239 | Ga0209564_100023957 | 148 |
| 700 | 3300025297 | Ga0209758_1000027 | Ga0209758_1000027375 | 148 |
| 701 | 3300025297 | Ga0209758_1003037 | Ga0209758_100303714 | 148 |
| 702 | 3300025298 | Ga0209050_1000007 | Ga0209050_10000071049 | 148 |
| 703 | 3300025299 | Ga0209256_1000081 | Ga0209256_1000081134 | 148 |
| 704 | 3300025302 | Ga0207426_1000027 | Ga0207426_1000027340 | 148 |
| 705 | 3300025302 | Ga0207426_1000614 | Ga0207426_100061442 | 148 |
| 706 | 3300025303 | Ga0209051_1000009 | Ga0209051_100000949 | 148 |
| 707 | 3300025303 | Ga0209051_1020630 | Ga0209051_10206302 | 148 |
| 708 | 3300025303 | Ga0209051_1137235 | Ga0209051_11372351 | 148 |
| 709 | 3300025304 | Ga0209257_1000011 | Ga0209257_100001123 | 148 |
| 710 | 3300025920 | Ga0207649_11046695 | Ga0207649_110466951 | 148 |
| 711 | 3300025924 | Ga0207694_10283409 | Ga0207694_102834092 | 148 |
| 712 | 3300025927 | Ga0207687_10074432 | Ga0207687_100744324 | 148 |
| 713 | 3300025937 | Ga0207669_10077464 | Ga0207669_100774641 | 148 |
| 714 | 3300026041 | Ga0207639_10314612 | Ga0207639_103146122 | 148 |
| 715 | 3300026089 | Ga0207648_10364162 | Ga0207648_103641622 | 148 |
| 716 | 3300028380 | Ga0268265_10251286 | Ga0268265_102512863 | 148 |
| 717 | 3300030731 | Ga0316177_1070524 | Ga0316177_10705242 | 148 |
| 718 | 3300030744 | Ga0316181_1124265 | Ga0316181_11242652 | 148 |
| 719 | 3300031251 | Ga0265327_10033411 | Ga0265327_100334112 | 148 |
| 720 | 3300031507 | Ga0307509_10671613 | Ga0307509_106716132 | 148 |
| 721 | 3300031730 | Ga0307516_10003211 | Ga0307516_100032119 | 148 |
| 722 | 3300031731 | Ga0307405_10183573 | Ga0307405_101835731 | 148 |
| 723 | 3300031911 | Ga0307412_10748402 | Ga0307412_107484021 | 148 |
| 724 | 3300041443 | Ga0451789_0759931 | Ga0451789_0759931_48_494 | 148 |
| 725 | 3300041460 | Ga0451802_2039099 | Ga0451802_2039099_706_1155 | 148 |
| 726 | 3300044683 | Ga0466965_0023451 | Ga0466965_0023451_1557_2003 | 148 |
| 727 | 3300044901 | Ga0466960_0443712 | Ga0466960_0443712_53_499 | 148 |
| 728 | 3300046453 | Ga0495627_003716 | Ga0495627_003716_5439_5885 | 148 |
| 729 | 3300046453 | Ga0495627_011272 | Ga0495627_011272_162_608 | 148 |
| 730 | 3300046463 | Ga0495653_0385859 | Ga0495653_0385859_422_868 | 148 |
| 731 | 3300046506 | Ga0495583_0300230 | Ga0495583_0300230_139_585 | 148 |
| 732 | 3300046512 | Ga0495610_0042218 | Ga0495610_0042218_43_489 | 148 |
| 733 | 3300046512 | Ga0495610_0123868 | Ga0495610_0123868_344_790 | 148 |
| 734 | 3300046515 | Ga0495620_0160595 | Ga0495620_0160595_369_815 | 148 |
| 735 | 3300046518 | Ga0495631_0002010 | Ga0495631_0002010_2314_2760 | 148 |
| 736 | 3300046520 | Ga0495637_0004201 | Ga0495637_0004201_2275_2721 | 148 |
| 737 | 3300046520 | Ga0495637_0012776 | Ga0495637_0012776_1872_2318 | 148 |
| 738 | 3300046525 | Ga0495663_0289514 | Ga0495663_0289514_132_578 | 148 |
| 739 | 3300046528 | Ga0495642_0036150 | Ga0495642_0036150_1508_1954 | 148 |
| 740 | 3300046530 | Ga0495654_0020203 | Ga0495654_0020203_268_714 | 148 |
| 741 | 3300046539 | Ga0495621_0016061 | Ga0495621_0016061_603_1049 | 148 |
| 742 | 3300046557 | Ga0495622_0191153 | Ga0495622_0191153_49_495 | 148 |
| 743 | 3300046615 | Ga0495656_0250217 | Ga0495656_0250217_437_883 | 148 |
| 744 | 3300046616 | Ga0495668_0099059 | Ga0495668_0099059_655_1101 | 148 |
| 745 | 3300046616 | Ga0495668_0196039 | Ga0495668_0196039_74_520 | 148 |
| 746 | 3300046660 | Ga0495625_0043722 | Ga0495625_0043722_35_481 | 148 |
| 747 | 3300046660 | Ga0495625_0423463 | Ga0495625_0423463_271_717 | 148 |
| 748 | 3300046663 | Ga0495635_0158202 | Ga0495635_0158202_605_1051 | 148 |
| 749 | 3300046674 | Ga0495588_0029331 | Ga0495588_0029331_1407_1853 | 148 |
| 750 | 3300046683 | Ga0495658_0325399 | Ga0495658_0325399_358_804 | 148 |
| 751 | 3300046691 | Ga0495670_0149990 | Ga0495670_0149990_747_1193 | 148 |
| 752 | 3300046692 | Ga0495671_0014255 | Ga0495671_0014255_2474_2920 | 148 |
| 753 | 3300047315 | Ga0495581_0747091 | Ga0495581_0747091_101_547 | 148 |
| 754 | 3300047321 | Ga0495676_0040988 | Ga0495676_0040988_2722_3168 | 148 |
| 755 | 3300047323 | Ga0495683_0079854 | Ga0495683_0079854_245_691 | 148 |
| 756 | 3300047673 | Ga0495593_0021928 | Ga0495593_0021928_770_1216 | 148 |
| 757 | 3300047673 | Ga0495593_0493703 | Ga0495593_0493703_152_598 | 148 |
| 758 | 3300048089 | Ga0495614_0018096 | Ga0495614_0018096_133_579 | 148 |
| 759 | 3300048090 | Ga0495615_0223300 | Ga0495615_0223300_12_458 | 148 |
| 760 | 3300048903 | Ga0496100_0007462 | Ga0496100_0007462_1956_2402 | 148 |
| 761 | 3300048912 | Ga0496109_0095304 | Ga0496109_0095304_670_1116 | 148 |
| 762 | 3300048913 | Ga0496110_0057839 | Ga0496110_0057839_1397_1843 | 148 |
| 763 | 3300048914 | Ga0496111_0127973 | Ga0496111_0127973_185_631 | 148 |
| 764 | 3300048916 | Ga0496113_0210462 | Ga0496113_0210462_459_905 | 148 |
| 765 | 3300048919 | Ga0496116_0000008 | Ga0496116_0000008_266968_267471 | 148 |
| 766 | 3300048919 | Ga0496116_0038119 | Ga0496116_0038119_999_1445 | 148 |
| 767 | 3300048919 | Ga0496116_0049986 | Ga0496116_0049986_894_1340 | 148 |
| 768 | 3300048919 | Ga0496116_0199457 | Ga0496116_0199457_66_512 | 148 |
| 769 | 3300048920 | Ga0496117_0025916 | Ga0496117_0025916_1529_1975 | 148 |
| 770 | 3300048920 | Ga0496117_0032865 | Ga0496117_0032865_2325_2771 | 148 |
| 771 | 3300048921 | Ga0496118_0015717 | Ga0496118_0015717_4619_5065 | 148 |
| 772 | 3300048921 | Ga0496118_0020580 | Ga0496118_0020580_3425_3871 | 148 |
| 773 | 3300048924 | Ga0496121_0000012 | Ga0496121_0000012_448259_448762 | 148 |
| 774 | 3300048924 | Ga0496121_0101509 | Ga0496121_0101509_1195_1641 | 148 |
| 775 | 3300048925 | Ga0496122_0078839 | Ga0496122_0078839_1110_1556 | 148 |
| 776 | 3300048925 | Ga0496122_0140241 | Ga0496122_0140241_908_1354 | 148 |
| 777 | 3300048925 | Ga0496122_0190174 | Ga0496122_0190174_248_694 | 148 |
| 778 | 3300048926 | Ga0496123_0023248 | Ga0496123_0023248_4204_4650 | 148 |
| 779 | 3300048926 | Ga0496123_0113888 | Ga0496123_0113888_203_649 | 148 |
| 780 | 3300048926 | Ga0496123_0307071 | Ga0496123_0307071_85_531 | 148 |
| 781 | 3300048927 | Ga0496124_0053909 | Ga0496124_0053909_2159_2605 | 148 |
| 782 | 3300048927 | Ga0496124_0099855 | Ga0496124_0099855_1011_1457 | 148 |
| 783 | 3300048927 | Ga0496124_0240376 | Ga0496124_0240376_751_1197 | 148 |
| 784 | 3300048928 | Ga0496125_0019719 | Ga0496125_0019719_1214_1660 | 148 |
| 785 | 3300048928 | Ga0496125_0030847 | Ga0496125_0030847_2326_2772 | 148 |
| 786 | 3300048928 | Ga0496125_0143002 | Ga0496125_0143002_643_1089 | 148 |
| 787 | 3300048929 | Ga0496126_0081568 | Ga0496126_0081568_1920_2366 | 148 |
| 788 | 3300050493 | nmdc:mga0k408_108860_c1 | nmdc:mga0k408_108860_c1_401_847 | 148 |
| 789 | 3300050493 | nmdc:mga0k408_11346_c1 | nmdc:mga0k408_11346_c1_501_947 | 148 |
| 790 | 3300050494 | nmdc:mga06z11_46024_c1 | nmdc:mga06z11_46024_c1_1293_1739 | 148 |
| 791 | 3300050496 | nmdc:mga07m45_16790_c1 | nmdc:mga07m45_16790_c1_3160_3606 | 148 |
| 792 | 3300050496 | nmdc:mga07m45_1912_c1 | nmdc:mga07m45_1912_c1_7935_8381 | 148 |
| 793 | 3300050496 | nmdc:mga07m45_8240_c1 | nmdc:mga07m45_8240_c1_2673_3119 | 148 |
| 794 | 3300050496 | nmdc:mga07m45_898_c1 | nmdc:mga07m45_898_c1_7746_8192 | 148 |
| 795 | 3300053079 | Ga0500610_0027879 | Ga0500610_0027879_554_1000 | 148 |
| 796 | 3300053079 | Ga0500610_0037753 | Ga0500610_0037753_966_1412 | 148 |
| 797 | 3300053079 | Ga0500610_0042155 | Ga0500610_0042155_78_524 | 148 |
| 798 | 3300053087 | Ga0500643_003702 | Ga0500643_003702_5827_6273 | 148 |
| 799 | 3300053091 | Ga0500647_0255319 | Ga0500647_0255319_220_666 | 148 |
| 800 | 3300053093 | Ga0500651_0000029 | Ga0500651_0000029_79068_79514 | 148 |
| 801 | 3300053094 | Ga0500566_0096020 | Ga0500566_0096020_293_739 | 148 |
| 802 | 3300053096 | Ga0500641_0249275 | Ga0500641_0249275_169_615 | 148 |
| 803 | 3300053108 | Ga0500562_077614 | Ga0500562_077614_400_846 | 148 |
| 804 | 3300053109 | Ga0500569_057735 | Ga0500569_057735_82_528 | 148 |
| 805 | 3300053110 | Ga0500571_001234 | Ga0500571_001234_9141_9587 | 148 |
| 806 | 3300053111 | Ga0500572_030735 | Ga0500572_030735_653_1099 | 148 |
| 807 | 3300053116 | Ga0500592_007013 | Ga0500592_007013_1029_1475 | 148 |
| 808 | 3300053117 | Ga0500593_001548 | Ga0500593_001548_2056_2502 | 148 |
| 809 | 3300053122 | Ga0500608_019691 | Ga0500608_019691_771_1217 | 148 |
| 810 | 3300053128 | Ga0500626_051154 | Ga0500626_051154_845_1291 | 148 |
| 811 | 3300053133 | Ga0500655_000253 | Ga0500655_000253_9957_10403 | 148 |
| 812 | 3300053134 | Ga0500658_0001930 | Ga0500658_0001930_2104_2550 | 148 |
| 813 | 3300053134 | Ga0500658_0002544 | Ga0500658_0002544_2391_2837 | 148 |
| 814 | 3300053138 | Ga0500564_005374 | Ga0500564_005374_3543_3989 | 148 |
| 815 | 3300053139 | Ga0500568_0006729 | Ga0500568_0006729_3218_3664 | 148 |
| 816 | 3300053141 | Ga0500574_004090 | Ga0500574_004090_2199_2645 | 148 |
| 817 | 3300053153 | Ga0500616_0042382 | Ga0500616_0042382_1880_2326 | 148 |
| 818 | 3300053158 | Ga0500627_0001507 | Ga0500627_0001507_1133_1579 | 148 |
| 819 | 3300053161 | Ga0500634_0010416 | Ga0500634_0010416_1269_1715 | 148 |
| 820 | 3300053162 | Ga0500638_166502 | Ga0500638_166502_133_579 | 148 |
| 821 | 3300053734 | Ga0500565_000623 | Ga0500565_000623_497_943 | 148 |
| 822 | 3300053735 | Ga0500596_019858 | Ga0500596_019858_163_609 | 148 |
| 823 | iso_pu_bacteria | 2690315857 | 2691329318 | 148 |
| 824 | iso_pu_bacteria | 2919493220 | 2919497315 | 148 |
| 825 | iso_pu_bacteria | 2919534386 | 2919537504 | 148 |
| 826 | iso_pu_bacteria | 2919543075 | 2919547460 | 148 |
| 827 | iso_pu_bacteria | 2919688452 | 2919690135 | 148 |
| 828 | iso_pu_bacteria | 2923525760 | 2923526287 | 148 |
| 829 | iso_pu_bacteria | 8002745576 | 8002746110 | 148 |
| 830 | 3300009176 | Ga0105242_10315112 | Ga0105242_103151122 | 149 |
| 831 | 3300013308 | Ga0157375_11677046 | Ga0157375_116770461 | 149 |
| 832 | 3300014497 | Ga0182008_10007331 | Ga0182008_100073317 | 149 |
| 833 | 3300014969 | Ga0157376_10243875 | Ga0157376_102438752 | 149 |
| 834 | 3300015262 | Ga0182007_10000601 | Ga0182007_1000060119 | 149 |
| 835 | 3300031911 | Ga0307412_10413954 | Ga0307412_104139542 | 149 |
| 836 | 3300046665 | Ga0495661_0102259 | Ga0495661_0102259_996_1445 | 149 |
| 837 | 3300046674 | Ga0495588_0220866 | Ga0495588_0220866_462_950 | 149 |
| 838 | 3300048904 | Ga0496101_0001014 | Ga0496101_0001014_6520_7008 | 149 |
| 839 | 3300048905 | Ga0496102_0022497 | Ga0496102_0022497_2312_2800 | 149 |
| 840 | 3300048907 | Ga0496104_0007646 | Ga0496104_0007646_6126_6614 | 149 |
| 841 | 3300048908 | Ga0496105_0025015 | Ga0496105_0025015_2006_2494 | 149 |
| 842 | 3300048910 | Ga0496107_0070855 | Ga0496107_0070855_1473_1961 | 149 |
| 843 | 3300048911 | Ga0496108_0140948 | Ga0496108_0140948_333_821 | 149 |
| 844 | 3300048913 | Ga0496110_0012658 | Ga0496110_0012658_1663_2151 | 149 |
| 845 | 3300048914 | Ga0496111_0008593 | Ga0496111_0008593_4596_5084 | 149 |
| 846 | 3300048917 | Ga0496114_0058158 | Ga0496114_0058158_1374_1862 | 149 |
| 847 | 3300005434 | Ga0070709_10011208 | Ga0070709_100112085 | 150 |
| 848 | 3300005456 | Ga0070678_101021335 | Ga0070678_1010213351 | 150 |
| 849 | 2124908027 | MRS2a_Contig_1014 | MRS2a_00040110 | 151 |
| 850 | 2124908027 | MRS2a_Contig_772 | MRS2a_00629170 | 151 |
| 851 | 2162886007 | SwRhRL2b_contig_3165809 | SwRhRL2b_0271.00002100 | 151 |
| 852 | 3300001915 | JGI24741J21665_1001298 | JGI24741J21665_10012983 | 151 |
| 853 | 3300001990 | JGI24737J22298_10060107 | JGI24737J22298_100601073 | 151 |
| 854 | 3300002737 | JGI25162J39368_1002064 | JGI25162J39368_10020645 | 151 |
| 855 | 3300002738 | JGI25154J39366_1006179 | JGI25154J39366_10061792 | 151 |
| 856 | 3300002771 | JGI25163J39215_1005917 | JGI25163J39215_10059172 | 151 |
| 857 | 3300002772 | JGI25164J39214_1001004 | JGI25164J39214_10010045 | 151 |
| 858 | 3300002772 | JGI25164J39214_1001279 | JGI25164J39214_10012796 | 151 |
| 859 | 3300003214 | JGI25165J46597_1001843 | JGI25165J46597_10018435 | 151 |
| 860 | 3300003214 | JGI25165J46597_1001871 | JGI25165J46597_10018714 | 151 |
| 861 | 3300003751 | Ga0055538_1000012 | Ga0055538_1000012268 | 151 |
| 862 | 3300003752 | Ga0055539_1000017 | Ga0055539_1000017268 | 151 |
| 863 | 3300003756 | Ga0055533_1000021 | Ga0055533_1000021268 | 151 |
| 864 | 3300003758 | Ga0055532_1000119 | Ga0055532_100011958 | 151 |
| 865 | 3300003759 | Ga0055525_1000078 | Ga0055525_1000078140 | 151 |
| 866 | 3300003781 | Ga0055536_1001878 | Ga0055536_10018784 | 151 |
| 867 | 3300003781 | Ga0055536_1015916 | Ga0055536_10159162 | 151 |
| 868 | 3300003781 | Ga0055536_1016356 | Ga0055536_10163562 | 151 |
| 869 | 3300003781 | Ga0055536_1018125 | Ga0055536_10181253 | 151 |
| 870 | 3300003791 | Ga0055530_10002438 | Ga0055530_100024389 | 151 |
| 871 | 3300003791 | Ga0055530_10004784 | Ga0055530_100047846 | 151 |
| 872 | 3300003791 | Ga0055530_10005023 | Ga0055530_100050233 | 151 |
| 873 | 3300003791 | Ga0055530_10020556 | Ga0055530_100205562 | 151 |
| 874 | 3300003792 | Ga0055540_1004056 | Ga0055540_10040566 | 151 |
| 875 | 3300003792 | Ga0055540_1004284 | Ga0055540_10042843 | 151 |
| 876 | 3300003792 | Ga0055540_1005786 | Ga0055540_10057862 | 151 |
| 877 | 3300003794 | Ga0055531_10001137 | Ga0055531_1000113719 | 151 |
| 878 | 3300003794 | Ga0055531_10033391 | Ga0055531_100333912 | 151 |
| 879 | 3300003841 | Ga0055541_1000012 | Ga0055541_1000012268 | 151 |
| 880 | 3300003856 | Ga0058692_1010460 | Ga0058692_10104603 | 151 |
| 881 | 3300005288 | Ga0065714_10003175 | Ga0065714_100031755 | 151 |
| 882 | 3300005288 | Ga0065714_10004868 | Ga0065714_100048684 | 151 |
| 883 | 3300005288 | Ga0065714_10005207 | Ga0065714_100052072 | 151 |
| 884 | 3300005288 | Ga0065714_10009160 | Ga0065714_100091601 | 151 |
| 885 | 3300005288 | Ga0065714_10009607 | Ga0065714_100096074 | 151 |
| 886 | 3300005288 | Ga0065714_10011643 | Ga0065714_100116432 | 151 |
| 887 | 3300005288 | Ga0065714_10015892 | Ga0065714_100158921 | 151 |
| 888 | 3300005288 | Ga0065714_10023761 | Ga0065714_100237611 | 151 |
| 889 | 3300005288 | Ga0065714_10098776 | Ga0065714_100987761 | 151 |
| 890 | 3300005288 | Ga0065714_10131594 | Ga0065714_101315941 | 151 |
| 891 | 3300005288 | Ga0065714_10287392 | Ga0065714_102873921 | 151 |
| 892 | 3300005289 | Ga0065704_10005330 | Ga0065704_100053303 | 151 |
| 893 | 3300005289 | Ga0065704_10026003 | Ga0065704_100260032 | 151 |
| 894 | 3300005289 | Ga0065704_10141314 | Ga0065704_101413142 | 151 |
| 895 | 3300005289 | Ga0065704_10309346 | Ga0065704_103093461 | 151 |
| 896 | 3300005289 | Ga0065704_10717670 | Ga0065704_107176701 | 151 |
| 897 | 3300005290 | Ga0065712_10000996 | Ga0065712_100009963 | 151 |
| 898 | 3300005290 | Ga0065712_10067862 | Ga0065712_100678624 | 151 |
| 899 | 3300005293 | Ga0065715_10009373 | Ga0065715_100093733 | 151 |
| 900 | 3300005329 | Ga0070683_102276832 | Ga0070683_1022768321 | 151 |
| 901 | 3300005331 | Ga0070670_100016361 | Ga0070670_1000163614 | 151 |
| 902 | 3300005331 | Ga0070670_100088585 | Ga0070670_1000885854 | 151 |
| 903 | 3300005334 | Ga0068869_100636661 | Ga0068869_1006366612 | 151 |
| 904 | 3300005339 | Ga0070660_100236784 | Ga0070660_1002367842 | 151 |
| 905 | 3300005344 | Ga0070661_100001250 | Ga0070661_10000125016 | 151 |
| 906 | 3300005347 | Ga0070668_100466150 | Ga0070668_1004661502 | 151 |
| 907 | 3300005353 | Ga0070669_100002433 | Ga0070669_1000024331 | 151 |
| 908 | 3300005353 | Ga0070669_100003104 | Ga0070669_1000031044 | 151 |
| 909 | 3300005353 | Ga0070669_100022656 | Ga0070669_1000226562 | 151 |
| 910 | 3300005366 | Ga0070659_100142285 | Ga0070659_1001422852 | 151 |
| 911 | 3300005457 | Ga0070662_100000829 | Ga0070662_1000008294 | 151 |
| 912 | 3300005457 | Ga0070662_100013692 | Ga0070662_1000136924 | 151 |
| 913 | 3300005457 | Ga0070662_100927868 | Ga0070662_1009278682 | 151 |
| 914 | 3300005530 | Ga0070679_100342252 | Ga0070679_1003422522 | 151 |
| 915 | 3300005539 | Ga0068853_100000031 | Ga0068853_10000003150 | 151 |
| 916 | 3300005548 | Ga0070665_100059460 | Ga0070665_1000594602 | 151 |
| 917 | 3300005548 | Ga0070665_100124423 | Ga0070665_1001244232 | 151 |
| 918 | 3300005548 | Ga0070665_100291021 | Ga0070665_1002910212 | 151 |
| 919 | 3300005548 | Ga0070665_100675342 | Ga0070665_1006753422 | 151 |
| 920 | 3300005548 | Ga0070665_101020082 | Ga0070665_1010200821 | 151 |
| 921 | 3300005563 | Ga0068855_100077352 | Ga0068855_1000773524 | 151 |
| 922 | 3300005564 | Ga0070664_100001524 | Ga0070664_1000015244 | 151 |
| 923 | 3300005578 | Ga0068854_100013592 | Ga0068854_1000135924 | 151 |
| 924 | 3300005614 | Ga0068856_100045082 | Ga0068856_1000450822 | 151 |
| 925 | 3300005616 | Ga0068852_100016998 | Ga0068852_1000169982 | 151 |
| 926 | 3300005617 | Ga0068859_100018254 | Ga0068859_1000182546 | 151 |
| 927 | 3300005834 | Ga0068851_10000007 | Ga0068851_10000007179 | 151 |
| 928 | 3300005841 | Ga0068863_100025309 | Ga0068863_1000253092 | 151 |
| 929 | 3300006038 | Ga0075365_10000743 | Ga0075365_100007433 | 151 |
| 930 | 3300006038 | Ga0075365_10106132 | Ga0075365_101061322 | 151 |
| 931 | 3300006048 | Ga0075363_100184208 | Ga0075363_1001842082 | 151 |
| 932 | 3300006051 | Ga0075364_10017430 | Ga0075364_100174302 | 151 |
| 933 | 3300006051 | Ga0075364_10038491 | Ga0075364_100384914 | 151 |
| 934 | 3300006051 | Ga0075364_10124551 | Ga0075364_101245512 | 151 |
| 935 | 3300006051 | Ga0075364_10498566 | Ga0075364_104985661 | 151 |
| 936 | 3300006051 | Ga0075364_10816516 | Ga0075364_108165161 | 151 |
| 937 | 3300006058 | Ga0075432_10015325 | Ga0075432_100153254 | 151 |
| 938 | 3300006058 | Ga0075432_10029537 | Ga0075432_100295372 | 151 |
| 939 | 3300006058 | Ga0075432_10033375 | Ga0075432_100333753 | 151 |
| 940 | 3300006058 | Ga0075432_10067101 | Ga0075432_100671012 | 151 |
| 941 | 3300006058 | Ga0075432_10191120 | Ga0075432_101911201 | 151 |
| 942 | 3300006058 | Ga0075432_10294525 | Ga0075432_102945251 | 151 |
| 943 | 3300006177 | Ga0075362_10069996 | Ga0075362_100699961 | 151 |
| 944 | 3300006178 | Ga0075367_10002366 | Ga0075367_100023663 | 151 |
| 945 | 3300006178 | Ga0075367_10286879 | Ga0075367_102868792 | 151 |
| 946 | 3300006178 | Ga0075367_10451170 | Ga0075367_104511701 | 151 |
| 947 | 3300006186 | Ga0075369_10001094 | Ga0075369_100010946 | 151 |
| 948 | 3300006186 | Ga0075369_10184425 | Ga0075369_101844251 | 151 |
| 949 | 3300006194 | Ga0075427_10000019 | Ga0075427_100000191 | 151 |
| 950 | 3300006195 | Ga0075366_10298341 | Ga0075366_102983412 | 151 |
| 951 | 3300006237 | Ga0097621_101038863 | Ga0097621_1010388632 | 151 |
| 952 | 3300006353 | Ga0075370_10017763 | Ga0075370_100177633 | 151 |
| 953 | 3300006358 | Ga0068871_100107957 | Ga0068871_1001079572 | 151 |
| 954 | 3300006871 | Ga0075434_101843405 | Ga0075434_1018434051 | 151 |
| 955 | 3300006880 | Ga0075429_100010636 | Ga0075429_1000106363 | 151 |
| 956 | 3300006881 | Ga0068865_100786334 | Ga0068865_1007863342 | 151 |
| 957 | 3300006914 | Ga0075436_100188367 | Ga0075436_1001883672 | 151 |
| 958 | 3300006914 | Ga0075436_101095196 | Ga0075436_1010951962 | 151 |
| 959 | 3300006931 | Ga0097620_100018254 | Ga0097620_1000182546 | 151 |
| 960 | 3300006944 | Ga0099823_1020334 | Ga0099823_10203343 | 151 |
| 961 | 3300006946 | Ga0079104_1000886 | Ga0079104_100088621 | 151 |
| 962 | 3300006946 | Ga0079104_1002975 | Ga0079104_10029754 | 151 |
| 963 | 3300006946 | Ga0079104_1104169 | Ga0079104_11041691 | 151 |
| 964 | 3300006948 | Ga0099826_10008314 | Ga0099826_100083144 | 151 |
| 965 | 3300009011 | Ga0105251_10000089 | Ga0105251_1000008977 | 151 |
| 966 | 3300009011 | Ga0105251_10006466 | Ga0105251_100064664 | 151 |
| 967 | 3300009011 | Ga0105251_10008076 | Ga0105251_100080764 | 151 |
| 968 | 3300009011 | Ga0105251_10014857 | Ga0105251_100148573 | 151 |
| 969 | 3300009011 | Ga0105251_10017646 | Ga0105251_100176461 | 151 |
| 970 | 3300009011 | Ga0105251_10033069 | Ga0105251_100330692 | 151 |
| 971 | 3300009011 | Ga0105251_10035071 | Ga0105251_100350712 | 151 |
| 972 | 3300009011 | Ga0105251_10059218 | Ga0105251_100592182 | 151 |
| 973 | 3300009011 | Ga0105251_10336160 | Ga0105251_103361602 | 151 |
| 974 | 3300009011 | Ga0105251_10378634 | Ga0105251_103786342 | 151 |
| 975 | 3300009011 | Ga0105251_10430314 | Ga0105251_104303142 | 151 |
| 976 | 3300009036 | Ga0105244_10000196 | Ga0105244_1000019660 | 151 |
| 977 | 3300009036 | Ga0105244_10005963 | Ga0105244_100059634 | 151 |
| 978 | 3300009036 | Ga0105244_10011172 | Ga0105244_100111724 | 151 |
| 979 | 3300009036 | Ga0105244_10027606 | Ga0105244_100276062 | 151 |
| 980 | 3300009036 | Ga0105244_10041570 | Ga0105244_100415702 | 151 |
| 981 | 3300009036 | Ga0105244_10060997 | Ga0105244_100609971 | 151 |
| 982 | 3300009036 | Ga0105244_10061037 | Ga0105244_100610371 | 151 |
| 983 | 3300009036 | Ga0105244_10065517 | Ga0105244_100655172 | 151 |
| 984 | 3300009036 | Ga0105244_10097606 | Ga0105244_100976062 | 151 |
| 985 | 3300009036 | Ga0105244_10144840 | Ga0105244_101448402 | 151 |
| 986 | 3300009036 | Ga0105244_10246856 | Ga0105244_102468561 | 151 |
| 987 | 3300009092 | Ga0105250_10001996 | Ga0105250_100019963 | 151 |
| 988 | 3300009092 | Ga0105250_10004445 | Ga0105250_100044453 | 151 |
| 989 | 3300009092 | Ga0105250_10024530 | Ga0105250_100245303 | 151 |
| 990 | 3300009092 | Ga0105250_10033320 | Ga0105250_100333202 | 151 |
| 991 | 3300009092 | Ga0105250_10042488 | Ga0105250_100424881 | 151 |
| 992 | 3300009092 | Ga0105250_10085431 | Ga0105250_100854312 | 151 |
| 993 | 3300009092 | Ga0105250_10129468 | Ga0105250_101294682 | 151 |
| 994 | 3300009092 | Ga0105250_10145565 | Ga0105250_101455651 | 151 |
| 995 | 3300009092 | Ga0105250_10357028 | Ga0105250_103570282 | 151 |
| 996 | 3300009093 | Ga0105240_10000196 | Ga0105240_1000019627 | 151 |
| 997 | 3300009094 | Ga0111539_11074799 | Ga0111539_110747991 | 151 |
| 998 | 3300009148 | Ga0105243_10001894 | Ga0105243_1000189416 | 151 |
| 999 | 3300009148 | Ga0105243_10003861 | Ga0105243_1000386110 | 151 |
| 1000 | 3300009148 | Ga0105243_10006988 | Ga0105243_100069888 | 151 |
| 1001 | 3300009148 | Ga0105243_10016847 | Ga0105243_100168474 | 151 |
| 1002 | 3300009148 | Ga0105243_10066246 | Ga0105243_100662462 | 151 |
| 1003 | 3300009148 | Ga0105243_10161863 | Ga0105243_101618632 | 151 |
| 1004 | 3300009148 | Ga0105243_10275276 | Ga0105243_102752762 | 151 |
| 1005 | 3300009176 | Ga0105242_10000836 | Ga0105242_1000083616 | 151 |
| 1006 | 3300009176 | Ga0105242_10238879 | Ga0105242_102388793 | 151 |
| 1007 | 3300009176 | Ga0105242_11602830 | Ga0105242_116028301 | 151 |
| 1008 | 3300009177 | Ga0105248_10001345 | Ga0105248_100013458 | 151 |
| 1009 | 3300009545 | Ga0105237_10020421 | Ga0105237_100204213 | 151 |
| 1010 | 3300009545 | Ga0105237_10331750 | Ga0105237_103317502 | 151 |
| 1011 | 3300009545 | Ga0105237_10372931 | Ga0105237_103729312 | 151 |
| 1012 | 3300009551 | Ga0105238_10006772 | Ga0105238_1000677210 | 151 |
| 1013 | 3300009551 | Ga0105238_11536362 | Ga0105238_115363622 | 151 |
| 1014 | 3300010375 | Ga0105239_10003927 | Ga0105239_100039278 | 151 |
| 1015 | 3300010375 | Ga0105239_10649836 | Ga0105239_106498361 | 151 |
| 1016 | 3300011119 | Ga0105246_10005173 | Ga0105246_100051735 | 151 |
| 1017 | 3300011119 | Ga0105246_10011634 | Ga0105246_100116344 | 151 |
| 1018 | 3300011119 | Ga0105246_10014367 | Ga0105246_100143674 | 151 |
| 1019 | 3300011119 | Ga0105246_10018086 | Ga0105246_100180864 | 151 |
| 1020 | 3300011119 | Ga0105246_10371024 | Ga0105246_103710242 | 151 |
| 1021 | 3300012498 | Ga0157345_1032913 | Ga0157345_10329131 | 151 |
| 1022 | 3300013100 | Ga0157373_10018807 | Ga0157373_100188072 | 151 |
| 1023 | 3300013100 | Ga0157373_10066274 | Ga0157373_100662742 | 151 |
| 1024 | 3300013100 | Ga0157373_10088195 | Ga0157373_100881952 | 151 |
| 1025 | 3300013100 | Ga0157373_10430524 | Ga0157373_104305242 | 151 |
| 1026 | 3300013100 | Ga0157373_10505974 | Ga0157373_105059742 | 151 |
| 1027 | 3300013100 | Ga0157373_10576649 | Ga0157373_105766492 | 151 |
| 1028 | 3300013102 | Ga0157371_10000109 | Ga0157371_1000010930 | 151 |
| 1029 | 3300013102 | Ga0157371_10008603 | Ga0157371_100086035 | 151 |
| 1030 | 3300013102 | Ga0157371_10045024 | Ga0157371_100450242 | 151 |
| 1031 | 3300013102 | Ga0157371_10234453 | Ga0157371_102344532 | 151 |
| 1032 | 3300013104 | Ga0157370_10007852 | Ga0157370_100078524 | 151 |
| 1033 | 3300013104 | Ga0157370_10116418 | Ga0157370_101164183 | 151 |
| 1034 | 3300013104 | Ga0157370_10134274 | Ga0157370_101342742 | 151 |
| 1035 | 3300013104 | Ga0157370_10323710 | Ga0157370_103237101 | 151 |
| 1036 | 3300013104 | Ga0157370_10359664 | Ga0157370_103596643 | 151 |
| 1037 | 3300013104 | Ga0157370_10371228 | Ga0157370_103712282 | 151 |
| 1038 | 3300013104 | Ga0157370_10953585 | Ga0157370_109535851 | 151 |
| 1039 | 3300013105 | Ga0157369_10478494 | Ga0157369_104784942 | 151 |
| 1040 | 3300013105 | Ga0157369_10703299 | Ga0157369_107032991 | 151 |
| 1041 | 3300013297 | Ga0157378_10000149 | Ga0157378_1000014952 | 151 |
| 1042 | 3300013297 | Ga0157378_10370848 | Ga0157378_103708482 | 151 |
| 1043 | 3300013297 | Ga0157378_11139984 | Ga0157378_111399841 | 151 |
| 1044 | 3300013306 | Ga0163162_10013294 | Ga0163162_100132945 | 151 |
| 1045 | 3300013306 | Ga0163162_10608873 | Ga0163162_106088731 | 151 |
| 1046 | 3300013308 | Ga0157375_10780112 | Ga0157375_107801122 | 151 |
| 1047 | 3300014497 | Ga0182008_10004134 | Ga0182008_100041344 | 151 |
| 1048 | 3300014497 | Ga0182008_10006124 | Ga0182008_100061244 | 151 |
| 1049 | 3300014497 | Ga0182008_10039089 | Ga0182008_100390892 | 151 |
| 1050 | 3300014497 | Ga0182008_10059379 | Ga0182008_100593793 | 151 |
| 1051 | 3300014497 | Ga0182008_10156555 | Ga0182008_101565552 | 151 |
| 1052 | 3300014497 | Ga0182008_10484950 | Ga0182008_104849502 | 151 |
| 1053 | 3300014969 | Ga0157376_10094787 | Ga0157376_100947872 | 151 |
| 1054 | 3300015261 | Ga0182006_1002773 | Ga0182006_10027734 | 151 |
| 1055 | 3300015261 | Ga0182006_1005056 | Ga0182006_10050563 | 151 |
| 1056 | 3300015261 | Ga0182006_1006299 | Ga0182006_10062994 | 151 |
| 1057 | 3300015261 | Ga0182006_1009996 | Ga0182006_10099963 | 151 |
| 1058 | 3300015261 | Ga0182006_1029087 | Ga0182006_10290872 | 151 |
| 1059 | 3300015261 | Ga0182006_1033525 | Ga0182006_10335253 | 151 |
| 1060 | 3300015261 | Ga0182006_1046029 | Ga0182006_10460292 | 151 |
| 1061 | 3300015261 | Ga0182006_1064534 | Ga0182006_10645341 | 151 |
| 1062 | 3300015261 | Ga0182006_1083909 | Ga0182006_10839092 | 151 |
| 1063 | 3300015262 | Ga0182007_10003930 | Ga0182007_100039305 | 151 |
| 1064 | 3300015262 | Ga0182007_10418662 | Ga0182007_104186621 | 151 |
| 1065 | 3300015265 | Ga0182005_1002649 | Ga0182005_10026493 | 151 |
| 1066 | 3300015265 | Ga0182005_1044755 | Ga0182005_10447552 | 151 |
| 1067 | 3300017792 | Ga0163161_10034169 | Ga0163161_100341693 | 151 |
| 1068 | 3300017792 | Ga0163161_10065983 | Ga0163161_100659832 | 151 |
| 1069 | 3300017792 | Ga0163161_11676332 | Ga0163161_116763322 | 151 |
| 1070 | 3300017792 | Ga0163161_11770748 | Ga0163161_117707482 | 151 |
| 1071 | 3300021384 | Ga0213876_10017706 | Ga0213876_100177062 | 151 |
| 1072 | 3300021384 | Ga0213876_10161765 | Ga0213876_101617652 | 151 |
| 1073 | 3300025206 | Ga0209435_102395 | Ga0209435_1023952 | 151 |
| 1074 | 3300025207 | Ga0209760_100253 | Ga0209760_1002533 | 151 |
| 1075 | 3300025207 | Ga0209760_100420 | Ga0209760_1004208 | 151 |
| 1076 | 3300025224 | Ga0209784_100007 | Ga0209784_100007266 | 151 |
| 1077 | 3300025225 | Ga0209566_100009 | Ga0209566_100009266 | 151 |
| 1078 | 3300025226 | Ga0209674_100021 | Ga0209674_100021266 | 151 |
| 1079 | 3300025229 | Ga0209147_100009 | Ga0209147_100009266 | 151 |
| 1080 | 3300025230 | Ga0209563_100018 | Ga0209563_100018266 | 151 |
| 1081 | 3300025231 | Ga0207427_100005 | Ga0207427_100005448 | 151 |
| 1082 | 3300025231 | Ga0207427_100006 | Ga0207427_100006325 | 151 |
| 1083 | 3300025233 | Ga0209437_100013 | Ga0209437_100013325 | 151 |
| 1084 | 3300025233 | Ga0209437_100018 | Ga0209437_100018358 | 151 |
| 1085 | 3300025242 | Ga0209258_100249 | Ga0209258_10024939 | 151 |
| 1086 | 3300025246 | Ga0209646_1000298 | Ga0209646_100029821 | 151 |
| 1087 | 3300025253 | Ga0209677_100012 | Ga0209677_100012266 | 151 |
| 1088 | 3300025256 | Ga0209759_1014362 | Ga0209759_10143622 | 151 |
| 1089 | 3300025256 | Ga0209759_1015841 | Ga0209759_10158412 | 151 |
| 1090 | 3300025261 | Ga0209233_1000021 | Ga0209233_1000021448 | 151 |
| 1091 | 3300025261 | Ga0209233_1000022 | Ga0209233_1000022325 | 151 |
| 1092 | 3300025291 | Ga0209675_1032780 | Ga0209675_10327802 | 151 |
| 1093 | 3300025292 | Ga0209676_1000015 | Ga0209676_1000015293 | 151 |
| 1094 | 3300025292 | Ga0209676_1000030 | Ga0209676_1000030392 | 151 |
| 1095 | 3300025292 | Ga0209676_1000041 | Ga0209676_100004154 | 151 |
| 1096 | 3300025292 | Ga0209676_1001510 | Ga0209676_100151015 | 151 |
| 1097 | 3300025292 | Ga0209676_1009214 | Ga0209676_10092144 | 151 |
| 1098 | 3300025292 | Ga0209676_1021084 | Ga0209676_10210842 | 151 |
| 1099 | 3300025298 | Ga0209050_1000024 | Ga0209050_100002448 | 151 |
| 1100 | 3300025298 | Ga0209050_1000030 | Ga0209050_1000030145 | 151 |
| 1101 | 3300025298 | Ga0209050_1000332 | Ga0209050_100033286 | 151 |
| 1102 | 3300025298 | Ga0209050_1002018 | Ga0209050_100201811 | 151 |
| 1103 | 3300025303 | Ga0209051_1000012 | Ga0209051_1000012386 | 151 |
| 1104 | 3300025303 | Ga0209051_1000426 | Ga0209051_10004264 | 151 |
| 1105 | 3300025303 | Ga0209051_1000719 | Ga0209051_10007194 | 151 |
| 1106 | 3300025304 | Ga0209257_1000262 | Ga0209257_100026240 | 151 |
| 1107 | 3300025304 | Ga0209257_1004152 | Ga0209257_100415211 | 151 |
| 1108 | 3300025321 | Ga0207656_10000015 | Ga0207656_1000001552 | 151 |
| 1109 | 3300025711 | Ga0207696_1000055 | Ga0207696_100005510 | 151 |
| 1110 | 3300025711 | Ga0207696_1000078 | Ga0207696_1000078143 | 151 |
| 1111 | 3300025711 | Ga0207696_1000080 | Ga0207696_100008032 | 151 |
| 1112 | 3300025711 | Ga0207696_1000204 | Ga0207696_100020483 | 151 |
| 1113 | 3300025711 | Ga0207696_1003242 | Ga0207696_10032424 | 151 |
| 1114 | 3300025711 | Ga0207696_1003560 | Ga0207696_10035603 | 151 |
| 1115 | 3300025711 | Ga0207696_1004230 | Ga0207696_10042305 | 151 |
| 1116 | 3300025711 | Ga0207696_1006665 | Ga0207696_10066652 | 151 |
| 1117 | 3300025711 | Ga0207696_1009586 | Ga0207696_10095862 | 151 |
| 1118 | 3300025711 | Ga0207696_1022512 | Ga0207696_10225122 | 151 |
| 1119 | 3300025711 | Ga0207696_1026800 | Ga0207696_10268002 | 151 |
| 1120 | 3300025728 | Ga0207655_1000033 | Ga0207655_1000033196 | 151 |
| 1121 | 3300025728 | Ga0207655_1000747 | Ga0207655_100074732 | 151 |
| 1122 | 3300025728 | Ga0207655_1001006 | Ga0207655_10010064 | 151 |
| 1123 | 3300025728 | Ga0207655_1001169 | Ga0207655_100116910 | 151 |
| 1124 | 3300025728 | Ga0207655_1002470 | Ga0207655_10024705 | 151 |
| 1125 | 3300025728 | Ga0207655_1004567 | Ga0207655_10045679 | 151 |
| 1126 | 3300025728 | Ga0207655_1010154 | Ga0207655_10101542 | 151 |
| 1127 | 3300025728 | Ga0207655_1013075 | Ga0207655_10130752 | 151 |
| 1128 | 3300025728 | Ga0207655_1015746 | Ga0207655_10157464 | 151 |
| 1129 | 3300025728 | Ga0207655_1030164 | Ga0207655_10301642 | 151 |
| 1130 | 3300025728 | Ga0207655_1030991 | Ga0207655_10309912 | 151 |
| 1131 | 3300025728 | Ga0207655_1033456 | Ga0207655_10334562 | 151 |
| 1132 | 3300025728 | Ga0207655_1043386 | Ga0207655_10433861 | 151 |
| 1133 | 3300025728 | Ga0207655_1060285 | Ga0207655_10602851 | 151 |
| 1134 | 3300025728 | Ga0207655_1158180 | Ga0207655_11581801 | 151 |
| 1135 | 3300025735 | Ga0207713_1000010 | Ga0207713_1000010362 | 151 |
| 1136 | 3300025735 | Ga0207713_1000079 | Ga0207713_100007931 | 151 |
| 1137 | 3300025735 | Ga0207713_1000249 | Ga0207713_100024915 | 151 |
| 1138 | 3300025735 | Ga0207713_1000835 | Ga0207713_10008352 | 151 |
| 1139 | 3300025735 | Ga0207713_1001826 | Ga0207713_100182614 | 151 |
| 1140 | 3300025735 | Ga0207713_1004136 | Ga0207713_10041369 | 151 |
| 1141 | 3300025735 | Ga0207713_1006432 | Ga0207713_10064327 | 151 |
| 1142 | 3300025735 | Ga0207713_1009068 | Ga0207713_10090684 | 151 |
| 1143 | 3300025735 | Ga0207713_1011139 | Ga0207713_10111392 | 151 |
| 1144 | 3300025735 | Ga0207713_1013995 | Ga0207713_10139952 | 151 |
| 1145 | 3300025735 | Ga0207713_1015441 | Ga0207713_10154411 | 151 |
| 1146 | 3300025735 | Ga0207713_1025592 | Ga0207713_10255922 | 151 |
| 1147 | 3300025735 | Ga0207713_1028855 | Ga0207713_10288553 | 151 |
| 1148 | 3300025735 | Ga0207713_1041623 | Ga0207713_10416232 | 151 |
| 1149 | 3300025735 | Ga0207713_1043475 | Ga0207713_10434752 | 151 |
| 1150 | 3300025913 | Ga0207695_10001140 | Ga0207695_1000114027 | 151 |
| 1151 | 3300025914 | Ga0207671_10000027 | Ga0207671_10000027195 | 151 |
| 1152 | 3300025914 | Ga0207671_10393346 | Ga0207671_103933462 | 151 |
| 1153 | 3300025920 | Ga0207649_10000012 | Ga0207649_10000012231 | 151 |
| 1154 | 3300025923 | Ga0207681_10000138 | Ga0207681_1000013858 | 151 |
| 1155 | 3300025923 | Ga0207681_10000600 | Ga0207681_1000060021 | 151 |
| 1156 | 3300025924 | Ga0207694_10009484 | Ga0207694_100094842 | 151 |
| 1157 | 3300025924 | Ga0207694_11362370 | Ga0207694_113623701 | 151 |
| 1158 | 3300025925 | Ga0207650_10002879 | Ga0207650_100028794 | 151 |
| 1159 | 3300025925 | Ga0207650_10006459 | Ga0207650_100064594 | 151 |
| 1160 | 3300025929 | Ga0207664_10961499 | Ga0207664_109614992 | 151 |
| 1161 | 3300025933 | Ga0207706_10000212 | Ga0207706_1000021250 | 151 |
| 1162 | 3300025933 | Ga0207706_10021663 | Ga0207706_100216634 | 151 |
| 1163 | 3300025934 | Ga0207686_10002895 | Ga0207686_100028954 | 151 |
| 1164 | 3300025934 | Ga0207686_10050269 | Ga0207686_100502692 | 151 |
| 1165 | 3300025935 | Ga0207709_10000061 | Ga0207709_10000061149 | 151 |
| 1166 | 3300025935 | Ga0207709_10000063 | Ga0207709_10000063169 | 151 |
| 1167 | 3300025935 | Ga0207709_10009197 | Ga0207709_100091974 | 151 |
| 1168 | 3300025935 | Ga0207709_10196712 | Ga0207709_101967122 | 151 |
| 1169 | 3300025935 | Ga0207709_10397646 | Ga0207709_103976462 | 151 |
| 1170 | 3300025935 | Ga0207709_10731814 | Ga0207709_107318142 | 151 |
| 1171 | 3300025941 | Ga0207711_10004604 | Ga0207711_100046042 | 151 |
| 1172 | 3300025945 | Ga0207679_10000015 | Ga0207679_10000015231 | 151 |
| 1173 | 3300025981 | Ga0207640_10005762 | Ga0207640_100057627 | 151 |
| 1174 | 3300026041 | Ga0207639_10000157 | Ga0207639_1000015745 | 151 |
| 1175 | 3300026078 | Ga0207702_10077491 | Ga0207702_100774912 | 151 |
| 1176 | 3300026088 | Ga0207641_10019492 | Ga0207641_100194922 | 151 |
| 1177 | 3300026142 | Ga0207698_10065350 | Ga0207698_100653502 | 151 |
| 1178 | 3300026142 | Ga0207698_11975219 | Ga0207698_119752191 | 151 |
| 1179 | 3300027111 | Ga0209281_1000016 | Ga0209281_1000016425 | 151 |
| 1180 | 3300027111 | Ga0209281_1000019 | Ga0209281_1000019103 | 151 |
| 1181 | 3300027296 | Ga0209389_1000036 | Ga0209389_10000367 | 151 |
| 1182 | 3300027296 | Ga0209389_1053487 | Ga0209389_10534872 | 151 |
| 1183 | 3300027312 | Ga0209371_1000066 | Ga0209371_100006684 | 151 |
| 1184 | 3300027312 | Ga0209371_1000176 | Ga0209371_100017612 | 151 |
| 1185 | 3300027312 | Ga0209371_1050371 | Ga0209371_10503712 | 151 |
| 1186 | 3300027378 | Ga0209981_1057055 | Ga0209981_10570552 | 151 |
| 1187 | 3300027552 | Ga0209982_1025188 | Ga0209982_10251882 | 151 |
| 1188 | 3300027666 | Ga0209282_1041143 | Ga0209282_10411432 | 151 |
| 1189 | 3300027907 | Ga0207428_10043067 | Ga0207428_100430673 | 151 |
| 1190 | 3300027907 | Ga0207428_10081024 | Ga0207428_100810242 | 151 |
| 1191 | 3300027907 | Ga0207428_10112702 | Ga0207428_101127021 | 151 |
| 1192 | 3300027907 | Ga0207428_10114852 | Ga0207428_101148522 | 151 |
| 1193 | 3300027907 | Ga0207428_10123955 | Ga0207428_101239552 | 151 |
| 1194 | 3300027907 | Ga0207428_10291376 | Ga0207428_102913763 | 151 |
| 1195 | 3300027907 | Ga0207428_10569920 | Ga0207428_105699201 | 151 |
| 1196 | 3300028379 | Ga0268266_10038288 | Ga0268266_100382884 | 151 |
| 1197 | 3300028379 | Ga0268266_10123433 | Ga0268266_101234332 | 151 |
| 1198 | 3300028379 | Ga0268266_10242278 | Ga0268266_102422782 | 151 |
| 1199 | 3300028794 | Ga0307515_10550453 | Ga0307515_105504532 | 151 |
| 1200 | 3300030500 | Ga0268256_1000063 | Ga0268256_100006384 | 151 |
| 1201 | 3300030500 | Ga0268256_1000146 | Ga0268256_100014688 | 151 |
| 1202 | 3300030500 | Ga0268256_1056659 | Ga0268256_10566592 | 151 |
| 1203 | 3300030731 | Ga0316177_1180876 | Ga0316177_11808762 | 151 |
| 1204 | 3300030733 | Ga0314311_1105640 | Ga0314311_11056402 | 151 |
| 1205 | 3300030734 | Ga0316179_1011771 | Ga0316179_10117712 | 151 |
| 1206 | 3300030735 | Ga0316178_1047147 | Ga0316178_10471476 | 151 |
| 1207 | 3300030742 | Ga0316183_1205730 | Ga0316183_12057302 | 151 |
| 1208 | 3300030744 | Ga0316181_1009360 | Ga0316181_10093602 | 151 |
| 1209 | 3300030744 | Ga0316181_1063849 | Ga0316181_10638492 | 151 |
| 1210 | 3300030745 | Ga0316182_1043997 | Ga0316182_10439972 | 151 |
| 1211 | 3300030745 | Ga0316182_1106649 | Ga0316182_11066491 | 151 |
| 1212 | 3300031507 | Ga0307509_10221193 | Ga0307509_102211931 | 151 |
| 1213 | 3300031548 | Ga0307408_100000019 | Ga0307408_100000019272 | 151 |
| 1214 | 3300031548 | Ga0307408_100015060 | Ga0307408_1000150604 | 151 |
| 1215 | 3300031548 | Ga0307408_100020747 | Ga0307408_1000207474 | 151 |
| 1216 | 3300031548 | Ga0307408_100103834 | Ga0307408_1001038342 | 151 |
| 1217 | 3300031548 | Ga0307408_100302681 | Ga0307408_1003026812 | 151 |
| 1218 | 3300031548 | Ga0307408_100448109 | Ga0307408_1004481091 | 151 |
| 1219 | 3300031665 | Ga0316575_10007778 | Ga0316575_100077782 | 151 |
| 1220 | 3300031727 | Ga0316576_10092090 | Ga0316576_100920902 | 151 |
| 1221 | 3300031727 | Ga0316576_10229401 | Ga0316576_102294012 | 151 |
| 1222 | 3300031730 | Ga0307516_10014174 | Ga0307516_100141744 | 151 |
| 1223 | 3300031731 | Ga0307405_10055662 | Ga0307405_100556622 | 151 |
| 1224 | 3300031731 | Ga0307405_10399412 | Ga0307405_103994122 | 151 |
| 1225 | 3300031824 | Ga0307413_10018385 | Ga0307413_100183853 | 151 |
| 1226 | 3300031901 | Ga0307406_10011531 | Ga0307406_100115312 | 151 |
| 1227 | 3300031911 | Ga0307412_10011436 | Ga0307412_100114364 | 151 |
| 1228 | 3300031911 | Ga0307412_10101173 | Ga0307412_101011732 | 151 |
| 1229 | 3300031911 | Ga0307412_10106150 | Ga0307412_101061502 | 151 |
| 1230 | 3300031911 | Ga0307412_10154122 | Ga0307412_101541221 | 151 |
| 1231 | 3300031911 | Ga0307412_10208085 | Ga0307412_102080852 | 151 |
| 1232 | 3300032002 | Ga0307416_100525906 | Ga0307416_1005259062 | 151 |
| 1233 | 3300032004 | Ga0307414_10037403 | Ga0307414_100374032 | 151 |
| 1234 | 3300032004 | Ga0307414_10811857 | Ga0307414_108118572 | 151 |
| 1235 | 3300032005 | Ga0307411_10055706 | Ga0307411_100557062 | 151 |
| 1236 | 3300035398 | Ga0316574_0016948 | Ga0316574_0016948_1823_2278 | 151 |
| 1237 | 3300039062 | Ga0400483_049425 | Ga0400483_049425_965_1420 | 151 |
| 1238 | 3300039062 | Ga0400483_289198 | Ga0400483_289198_1178_1633 | 151 |
| 1239 | 3300039437 | Ga0436365_0472641 | Ga0436365_0472641_1062_1517 | 151 |
| 1240 | 3300041404 | Ga0439436_0000393 | Ga0439436_0000393_10089_10544 | 151 |
| 1241 | 3300041405 | Ga0439438_009014 | Ga0439438_009014_778_1233 | 151 |
| 1242 | 3300041405 | Ga0439438_010619 | Ga0439438_010619_791_1246 | 151 |
| 1243 | 3300041405 | Ga0439438_014427 | Ga0439438_014427_1420_1875 | 151 |
| 1244 | 3300041405 | Ga0439438_022379 | Ga0439438_022379_586_1041 | 151 |
| 1245 | 3300041405 | Ga0439438_029248 | Ga0439438_029248_802_1257 | 151 |
| 1246 | 3300041405 | Ga0439438_032917 | Ga0439438_032917_643_1098 | 151 |
| 1247 | 3300041405 | Ga0439438_052485 | Ga0439438_052485_96_551 | 151 |
| 1248 | 3300041407 | Ga0439447_003796 | Ga0439447_003796_4105_4560 | 151 |
| 1249 | 3300041407 | Ga0439447_003942 | Ga0439447_003942_3841_4296 | 151 |
| 1250 | 3300041407 | Ga0439447_005384 | Ga0439447_005384_631_1086 | 151 |
| 1251 | 3300041407 | Ga0439447_008473 | Ga0439447_008473_2247_2702 | 151 |
| 1252 | 3300041407 | Ga0439447_010053 | Ga0439447_010053_101_556 | 151 |
| 1253 | 3300041407 | Ga0439447_017695 | Ga0439447_017695_707_1162 | 151 |
| 1254 | 3300041407 | Ga0439447_029161 | Ga0439447_029161_877_1332 | 151 |
| 1255 | 3300041411 | Ga0439466_0003240 | Ga0439466_0003240_1806_2261 | 151 |
| 1256 | 3300041411 | Ga0439466_0004304 | Ga0439466_0004304_921_1376 | 151 |
| 1257 | 3300041411 | Ga0439466_0012701 | Ga0439466_0012701_1967_2422 | 151 |
| 1258 | 3300041411 | Ga0439466_0012798 | Ga0439466_0012798_1847_2302 | 151 |
| 1259 | 3300041411 | Ga0439466_0032523 | Ga0439466_0032523_530_985 | 151 |
| 1260 | 3300041411 | Ga0439466_0033462 | Ga0439466_0033462_660_1115 | 151 |
| 1261 | 3300041411 | Ga0439466_0057805 | Ga0439466_0057805_71_526 | 151 |
| 1262 | 3300041512 | Ga0451853_3468156 | Ga0451853_3468156_99_554 | 151 |
| 1263 | 3300041512 | Ga0451853_3963367 | Ga0451853_3963367_367_822 | 151 |
| 1264 | 3300041997 | Ga0439431_0008002 | Ga0439431_0008002_1768_2223 | 151 |
| 1265 | 3300041997 | Ga0439431_0036530 | Ga0439431_0036530_651_1106 | 151 |
| 1266 | 3300042000 | Ga0439437_000037 | Ga0439437_000037_2205_2660 | 151 |
| 1267 | 3300042004 | Ga0439445_0087885 | Ga0439445_0087885_125_580 | 151 |
| 1268 | 3300042004 | Ga0439445_0108898 | Ga0439445_0108898_134_589 | 151 |
| 1269 | 3300042006 | Ga0439432_001648 | Ga0439432_001648_4651_5106 | 151 |
| 1270 | 3300042006 | Ga0439432_004015 | Ga0439432_004015_778_1233 | 151 |
| 1271 | 3300042006 | Ga0439432_010565 | Ga0439432_010565_2053_2508 | 151 |
| 1272 | 3300042006 | Ga0439432_016837 | Ga0439432_016837_591_1046 | 151 |
| 1273 | 3300042006 | Ga0439432_027276 | Ga0439432_027276_1385_1840 | 151 |
| 1274 | 3300042006 | Ga0439432_080105 | Ga0439432_080105_35_490 | 151 |
| 1275 | 3300042006 | Ga0439432_099946 | Ga0439432_099946_48_503 | 151 |
| 1276 | 3300042009 | Ga0439451_008918 | Ga0439451_008918_1491_1946 | 151 |
| 1277 | 3300042009 | Ga0439451_011530 | Ga0439451_011530_1072_1527 | 151 |
| 1278 | 3300042009 | Ga0439451_014175 | Ga0439451_014175_683_1138 | 151 |
| 1279 | 3300042009 | Ga0439451_018064 | Ga0439451_018064_935_1390 | 151 |
| 1280 | 3300042009 | Ga0439451_024145 | Ga0439451_024145_16_471 | 151 |
| 1281 | 3300042009 | Ga0439451_051377 | Ga0439451_051377_276_731 | 151 |
| 1282 | 3300042010 | Ga0439452_000645 | Ga0439452_000645_9977_10432 | 151 |
| 1283 | 3300042010 | Ga0439452_003726 | Ga0439452_003726_669_1124 | 151 |
| 1284 | 3300042010 | Ga0439452_004217 | Ga0439452_004217_3844_4299 | 151 |
| 1285 | 3300042010 | Ga0439452_005024 | Ga0439452_005024_2955_3410 | 151 |
| 1286 | 3300042010 | Ga0439452_012662 | Ga0439452_012662_1847_2302 | 151 |
| 1287 | 3300042010 | Ga0439452_016934 | Ga0439452_016934_1460_1915 | 151 |
| 1288 | 3300042010 | Ga0439452_021055 | Ga0439452_021055_1235_1690 | 151 |
| 1289 | 3300042010 | Ga0439452_039019 | Ga0439452_039019_274_729 | 151 |
| 1290 | 3300042010 | Ga0439452_039530 | Ga0439452_039530_109_564 | 151 |
| 1291 | 3300042010 | Ga0439452_047649 | Ga0439452_047649_27_482 | 151 |
| 1292 | 3300042013 | Ga0439456_000220 | Ga0439456_000220_6017_6472 | 151 |
| 1293 | 3300042013 | Ga0439456_026056 | Ga0439456_026056_28_483 | 151 |
| 1294 | 3300042013 | Ga0439456_029960 | Ga0439456_029960_550_1005 | 151 |
| 1295 | 3300042013 | Ga0439456_041550 | Ga0439456_041550_242_697 | 151 |
| 1296 | 3300042016 | Ga0439463_003695 | Ga0439463_003695_1129_1584 | 151 |
| 1297 | 3300042016 | Ga0439463_021653 | Ga0439463_021653_17_472 | 151 |
| 1298 | 3300042016 | Ga0439463_078827 | Ga0439463_078827_29_484 | 151 |
| 1299 | 3300042115 | Ga0450911_000011 | Ga0450911_000011_56694_57149 | 151 |
| 1300 | 3300042115 | Ga0450911_005568 | Ga0450911_005568_826_1281 | 151 |
| 1301 | 3300042121 | Ga0450919_002799 | Ga0450919_002799_630_1085 | 151 |
| 1302 | 3300042124 | Ga0450922_001722 | Ga0450922_001722_850_1305 | 151 |
| 1303 | 3300042127 | Ga0450890_009580 | Ga0450890_009580_626_1081 | 151 |
| 1304 | 3300042130 | Ga0450892_019568 | Ga0450892_019568_35_490 | 151 |
| 1305 | 3300042136 | Ga0450900_002826 | Ga0450900_002826_138_593 | 151 |
| 1306 | 3300042136 | Ga0450900_024938 | Ga0450900_024938_16_471 | 151 |
| 1307 | 3300042137 | Ga0450902_004902 | Ga0450902_004902_770_1225 | 151 |
| 1308 | 3300042137 | Ga0450902_026388 | Ga0450902_026388_258_713 | 151 |
| 1309 | 3300042139 | Ga0450904_000254 | Ga0450904_000254_8666_9121 | 151 |
| 1310 | 3300042139 | Ga0450904_004804 | Ga0450904_004804_758_1213 | 151 |
| 1311 | 3300042139 | Ga0450904_011718 | Ga0450904_011718_86_541 | 151 |
| 1312 | 3300042142 | Ga0450905_000418 | Ga0450905_000418_86_541 | 151 |
| 1313 | 3300042142 | Ga0450905_002843 | Ga0450905_002843_1560_2015 | 151 |
| 1314 | 3300042142 | Ga0450905_012866 | Ga0450905_012866_150_605 | 151 |
| 1315 | 3300042142 | Ga0450905_016150 | Ga0450905_016150_553_1008 | 151 |
| 1316 | 3300042145 | Ga0450906_003770 | Ga0450906_003770_1134_1589 | 151 |
| 1317 | 3300042146 | Ga0450907_001318 | Ga0450907_001318_4177_4632 | 151 |
| 1318 | 3300042146 | Ga0450907_002543 | Ga0450907_002543_927_1382 | 151 |
| 1319 | 3300042146 | Ga0450907_008997 | Ga0450907_008997_12_467 | 151 |
| 1320 | 3300042147 | Ga0450910_005072 | Ga0450910_005072_599_1054 | 151 |
| 1321 | 3300042147 | Ga0450910_020673 | Ga0450910_020673_100_555 | 151 |
| 1322 | 3300042156 | Ga0439446_0017035 | Ga0439446_0017035_834_1289 | 151 |
| 1323 | 3300042156 | Ga0439446_0025556 | Ga0439446_0025556_106_561 | 151 |
| 1324 | 3300042156 | Ga0439446_0034841 | Ga0439446_0034841_97_552 | 151 |
| 1325 | 3300042156 | Ga0439446_0073482 | Ga0439446_0073482_413_868 | 151 |
| 1326 | 3300042184 | Ga0450908_008357 | Ga0450908_008357_795_1250 | 151 |
| 1327 | 3300042185 | Ga0450909_000439 | Ga0450909_000439_784_1239 | 151 |
| 1328 | 3300042185 | Ga0450909_002156 | Ga0450909_002156_570_1025 | 151 |
| 1329 | 3300042185 | Ga0450909_011026 | Ga0450909_011026_67_522 | 151 |
| 1330 | 3300042435 | Ga0439434_0000506 | Ga0439434_0000506_9961_10416 | 151 |
| 1331 | 3300042435 | Ga0439434_0002566 | Ga0439434_0002566_4147_4602 | 151 |
| 1332 | 3300042438 | Ga0439459_0002782 | Ga0439459_0002782_1593_2048 | 151 |
| 1333 | 3300042439 | Ga0439464_0000312 | Ga0439464_0000312_1962_2417 | 151 |
| 1334 | 3300042439 | Ga0439464_0003589 | Ga0439464_0003589_2400_2855 | 151 |
| 1335 | 3300042439 | Ga0439464_0008110 | Ga0439464_0008110_1999_2454 | 151 |
| 1336 | 3300042461 | Ga0439460_0001605 | Ga0439460_0001605_4160_4615 | 151 |
| 1337 | 3300042461 | Ga0439460_0003802 | Ga0439460_0003802_2001_2456 | 151 |
| 1338 | 3300042530 | Ga0450916_003515 | Ga0450916_003515_372_827 | 151 |
| 1339 | 3300042533 | Ga0450901_018910 | Ga0450901_018910_152_607 | 151 |
| 1340 | 3300042876 | Ga0451577_0039597 | Ga0451577_0039597_579_1034 | 151 |
| 1341 | 3300042993 | Ga0439440_0015179 | Ga0439440_0015179_334_789 | 151 |
| 1342 | 3300042993 | Ga0439440_0030834 | Ga0439440_0030834_714_1169 | 151 |
| 1343 | 3300046452 | Ga0495617_004617 | Ga0495617_004617_734_1189 | 151 |
| 1344 | 3300046452 | Ga0495617_019844 | Ga0495617_019844_803_1258 | 151 |
| 1345 | 3300046452 | Ga0495617_078835 | Ga0495617_078835_29_484 | 151 |
| 1346 | 3300046453 | Ga0495627_000095 | Ga0495627_000095_66963_67418 | 151 |
| 1347 | 3300046453 | Ga0495627_013285 | Ga0495627_013285_379_834 | 151 |
| 1348 | 3300046453 | Ga0495627_014354 | Ga0495627_014354_1588_2043 | 151 |
| 1349 | 3300046453 | Ga0495627_120091 | Ga0495627_120091_263_718 | 151 |
| 1350 | 3300046455 | Ga0495603_0031080 | Ga0495603_0031080_1923_2378 | 151 |
| 1351 | 3300046455 | Ga0495603_0037741 | Ga0495603_0037741_1656_2111 | 151 |
| 1352 | 3300046455 | Ga0495603_0897726 | Ga0495603_0897726_20_475 | 151 |
| 1353 | 3300046457 | Ga0495590_0070662 | Ga0495590_0070662_622_1077 | 151 |
| 1354 | 3300046458 | Ga0495591_000198 | Ga0495591_000198_24170_24625 | 151 |
| 1355 | 3300046458 | Ga0495591_003674 | Ga0495591_003674_2080_2535 | 151 |
| 1356 | 3300046458 | Ga0495591_003881 | Ga0495591_003881_3688_4143 | 151 |
| 1357 | 3300046458 | Ga0495591_004039 | Ga0495591_004039_4133_4588 | 151 |
| 1358 | 3300046458 | Ga0495591_007055 | Ga0495591_007055_1018_1473 | 151 |
| 1359 | 3300046458 | Ga0495591_039195 | Ga0495591_039195_314_769 | 151 |
| 1360 | 3300046458 | Ga0495591_061314 | Ga0495591_061314_14_469 | 151 |
| 1361 | 3300046459 | Ga0495629_0016371 | Ga0495629_0016371_4080_4535 | 151 |
| 1362 | 3300046460 | Ga0495638_0014264 | Ga0495638_0014264_933_1388 | 151 |
| 1363 | 3300046460 | Ga0495638_0034509 | Ga0495638_0034509_1356_1811 | 151 |
| 1364 | 3300046460 | Ga0495638_0053799 | Ga0495638_0053799_693_1148 | 151 |
| 1365 | 3300046460 | Ga0495638_0164658 | Ga0495638_0164658_776_1231 | 151 |
| 1366 | 3300046460 | Ga0495638_0165468 | Ga0495638_0165468_773_1228 | 151 |
| 1367 | 3300046460 | Ga0495638_0197824 | Ga0495638_0197824_21_476 | 151 |
| 1368 | 3300046460 | Ga0495638_0287268 | Ga0495638_0287268_410_865 | 151 |
| 1369 | 3300046463 | Ga0495653_0024315 | Ga0495653_0024315_4198_4653 | 151 |
| 1370 | 3300046471 | Ga0495650_0000938 | Ga0495650_0000938_4385_4840 | 151 |
| 1371 | 3300046471 | Ga0495650_0005982 | Ga0495650_0005982_3173_3628 | 151 |
| 1372 | 3300046471 | Ga0495650_0008522 | Ga0495650_0008522_4052_4507 | 151 |
| 1373 | 3300046471 | Ga0495650_0009607 | Ga0495650_0009607_4202_4657 | 151 |
| 1374 | 3300046471 | Ga0495650_0079874 | Ga0495650_0079874_313_768 | 151 |
| 1375 | 3300046473 | Ga0495582_0025469 | Ga0495582_0025469_1989_2444 | 151 |
| 1376 | 3300046474 | Ga0495605_0000019 | Ga0495605_0000019_265483_265938 | 151 |
| 1377 | 3300046474 | Ga0495605_0000570 | Ga0495605_0000570_24421_24876 | 151 |
| 1378 | 3300046474 | Ga0495605_0003684 | Ga0495605_0003684_6241_6696 | 151 |
| 1379 | 3300046474 | Ga0495605_0007838 | Ga0495605_0007838_2935_3390 | 151 |
| 1380 | 3300046474 | Ga0495605_0068028 | Ga0495605_0068028_125_580 | 151 |
| 1381 | 3300046474 | Ga0495605_0095670 | Ga0495605_0095670_765_1220 | 151 |
| 1382 | 3300046474 | Ga0495605_0124855 | Ga0495605_0124855_241_696 | 151 |
| 1383 | 3300046474 | Ga0495605_0232126 | Ga0495605_0232126_138_593 | 151 |
| 1384 | 3300046475 | Ga0495639_0003531 | Ga0495639_0003531_4141_4596 | 151 |
| 1385 | 3300046475 | Ga0495639_0107934 | Ga0495639_0107934_834_1289 | 151 |
| 1386 | 3300046491 | Ga0495584_0015687 | Ga0495584_0015687_2973_3428 | 151 |
| 1387 | 3300046491 | Ga0495584_0027889 | Ga0495584_0027889_1007_1462 | 151 |
| 1388 | 3300046491 | Ga0495584_0124579 | Ga0495584_0124579_159_614 | 151 |
| 1389 | 3300046491 | Ga0495584_0241461 | Ga0495584_0241461_403_858 | 151 |
| 1390 | 3300046491 | Ga0495584_0264405 | Ga0495584_0264405_319_774 | 151 |
| 1391 | 3300046492 | Ga0495585_0006926 | Ga0495585_0006926_4083_4538 | 151 |
| 1392 | 3300046492 | Ga0495585_0018550 | Ga0495585_0018550_2756_3211 | 151 |
| 1393 | 3300046492 | Ga0495585_0048303 | Ga0495585_0048303_803_1258 | 151 |
| 1394 | 3300046499 | Ga0495594_0003155 | Ga0495594_0003155_4090_4545 | 151 |
| 1395 | 3300046499 | Ga0495594_0164034 | Ga0495594_0164034_289_744 | 151 |
| 1396 | 3300046500 | Ga0495596_0000889 | Ga0495596_0000889_2747_3202 | 151 |
| 1397 | 3300046501 | Ga0495607_0003674 | Ga0495607_0003674_4042_4497 | 151 |
| 1398 | 3300046501 | Ga0495607_0004336 | Ga0495607_0004336_3501_3956 | 151 |
| 1399 | 3300046501 | Ga0495607_0004339 | Ga0495607_0004339_3960_4415 | 151 |
| 1400 | 3300046501 | Ga0495607_0005115 | Ga0495607_0005115_3940_4395 | 151 |
| 1401 | 3300046501 | Ga0495607_0008664 | Ga0495607_0008664_6435_6890 | 151 |
| 1402 | 3300046501 | Ga0495607_0016353 | Ga0495607_0016353_703_1158 | 151 |
| 1403 | 3300046501 | Ga0495607_0064442 | Ga0495607_0064442_677_1132 | 151 |
| 1404 | 3300046501 | Ga0495607_0071439 | Ga0495607_0071439_747_1202 | 151 |
| 1405 | 3300046501 | Ga0495607_0081022 | Ga0495607_0081022_1008_1463 | 151 |
| 1406 | 3300046501 | Ga0495607_0092082 | Ga0495607_0092082_768_1223 | 151 |
| 1407 | 3300046501 | Ga0495607_0102972 | Ga0495607_0102972_1020_1475 | 151 |
| 1408 | 3300046501 | Ga0495607_0140959 | Ga0495607_0140959_740_1195 | 151 |
| 1409 | 3300046501 | Ga0495607_0305913 | Ga0495607_0305913_263_718 | 151 |
| 1410 | 3300046506 | Ga0495583_0000146 | Ga0495583_0000146_4075_4530 | 151 |
| 1411 | 3300046506 | Ga0495583_0004677 | Ga0495583_0004677_5086_5541 | 151 |
| 1412 | 3300046506 | Ga0495583_0004736 | Ga0495583_0004736_5092_5547 | 151 |
| 1413 | 3300046506 | Ga0495583_0006804 | Ga0495583_0006804_2813_3268 | 151 |
| 1414 | 3300046506 | Ga0495583_0084237 | Ga0495583_0084237_29_484 | 151 |
| 1415 | 3300046506 | Ga0495583_0237850 | Ga0495583_0237850_36_491 | 151 |
| 1416 | 3300046507 | Ga0495606_0000204 | Ga0495606_0000204_29030_29485 | 151 |
| 1417 | 3300046507 | Ga0495606_0005284 | Ga0495606_0005284_8990_9445 | 151 |
| 1418 | 3300046507 | Ga0495606_0155809 | Ga0495606_0155809_861_1316 | 151 |
| 1419 | 3300046507 | Ga0495606_0557283 | Ga0495606_0557283_39_494 | 151 |
| 1420 | 3300046507 | Ga0495606_0630603 | Ga0495606_0630603_41_496 | 151 |
| 1421 | 3300046512 | Ga0495610_0006827 | Ga0495610_0006827_157_612 | 151 |
| 1422 | 3300046512 | Ga0495610_0012418 | Ga0495610_0012418_517_972 | 151 |
| 1423 | 3300046512 | Ga0495610_0027938 | Ga0495610_0027938_2289_2744 | 151 |
| 1424 | 3300046512 | Ga0495610_0107327 | Ga0495610_0107327_20_475 | 151 |
| 1425 | 3300046513 | Ga0495616_0013956 | Ga0495616_0013956_1062_1517 | 151 |
| 1426 | 3300046513 | Ga0495616_0032800 | Ga0495616_0032800_789_1244 | 151 |
| 1427 | 3300046513 | Ga0495616_0037580 | Ga0495616_0037580_1796_2251 | 151 |
| 1428 | 3300046513 | Ga0495616_0111920 | Ga0495616_0111920_657_1112 | 151 |
| 1429 | 3300046513 | Ga0495616_0143857 | Ga0495616_0143857_23_478 | 151 |
| 1430 | 3300046513 | Ga0495616_0330987 | Ga0495616_0330987_46_501 | 151 |
| 1431 | 3300046515 | Ga0495620_0000032 | Ga0495620_0000032_39965_40420 | 151 |
| 1432 | 3300046515 | Ga0495620_0000108 | Ga0495620_0000108_4098_4553 | 151 |
| 1433 | 3300046515 | Ga0495620_0002361 | Ga0495620_0002361_7784_8239 | 151 |
| 1434 | 3300046515 | Ga0495620_0077923 | Ga0495620_0077923_24_479 | 151 |
| 1435 | 3300046515 | Ga0495620_0144397 | Ga0495620_0144397_162_617 | 151 |
| 1436 | 3300046517 | Ga0495630_0098873 | Ga0495630_0098873_845_1300 | 151 |
| 1437 | 3300046517 | Ga0495630_0355872 | Ga0495630_0355872_24_479 | 151 |
| 1438 | 3300046518 | Ga0495631_0009636 | Ga0495631_0009636_4219_4674 | 151 |
| 1439 | 3300046518 | Ga0495631_0016529 | Ga0495631_0016529_1310_1765 | 151 |
| 1440 | 3300046518 | Ga0495631_0050623 | Ga0495631_0050623_848_1303 | 151 |
| 1441 | 3300046518 | Ga0495631_0313435 | Ga0495631_0313435_61_516 | 151 |
| 1442 | 3300046519 | Ga0495632_0001812 | Ga0495632_0001812_1993_2448 | 151 |
| 1443 | 3300046519 | Ga0495632_0004345 | Ga0495632_0004345_4097_4552 | 151 |
| 1444 | 3300046519 | Ga0495632_0095293 | Ga0495632_0095293_229_684 | 151 |
| 1445 | 3300046519 | Ga0495632_0111449 | Ga0495632_0111449_18_473 | 151 |
| 1446 | 3300046519 | Ga0495632_0122792 | Ga0495632_0122792_244_699 | 151 |
| 1447 | 3300046519 | Ga0495632_0257871 | Ga0495632_0257871_295_750 | 151 |
| 1448 | 3300046520 | Ga0495637_0003861 | Ga0495637_0003861_5091_5546 | 151 |
| 1449 | 3300046520 | Ga0495637_0004356 | Ga0495637_0004356_4062_4517 | 151 |
| 1450 | 3300046520 | Ga0495637_0005898 | Ga0495637_0005898_1663_2118 | 151 |
| 1451 | 3300046520 | Ga0495637_0010699 | Ga0495637_0010699_2988_3443 | 151 |
| 1452 | 3300046520 | Ga0495637_0026764 | Ga0495637_0026764_22_477 | 151 |
| 1453 | 3300046520 | Ga0495637_0030808 | Ga0495637_0030808_361_816 | 151 |
| 1454 | 3300046520 | Ga0495637_0072585 | Ga0495637_0072585_863_1318 | 151 |
| 1455 | 3300046520 | Ga0495637_0074567 | Ga0495637_0074567_65_520 | 151 |
| 1456 | 3300046520 | Ga0495637_0076287 | Ga0495637_0076287_767_1222 | 151 |
| 1457 | 3300046520 | Ga0495637_0079406 | Ga0495637_0079406_44_499 | 151 |
| 1458 | 3300046520 | Ga0495637_0170974 | Ga0495637_0170974_332_787 | 151 |
| 1459 | 3300046520 | Ga0495637_0278279 | Ga0495637_0278279_126_581 | 151 |
| 1460 | 3300046522 | Ga0495643_0000084 | Ga0495643_0000084_63296_63751 | 151 |
| 1461 | 3300046522 | Ga0495643_0001486 | Ga0495643_0001486_4147_4602 | 151 |
| 1462 | 3300046522 | Ga0495643_0002761 | Ga0495643_0002761_279_734 | 151 |
| 1463 | 3300046522 | Ga0495643_0014980 | Ga0495643_0014980_2244_2699 | 151 |
| 1464 | 3300046522 | Ga0495643_0016737 | Ga0495643_0016737_1288_1743 | 151 |
| 1465 | 3300046522 | Ga0495643_0020764 | Ga0495643_0020764_425_880 | 151 |
| 1466 | 3300046522 | Ga0495643_0100420 | Ga0495643_0100420_911_1366 | 151 |
| 1467 | 3300046522 | Ga0495643_0153683 | Ga0495643_0153683_109_564 | 151 |
| 1468 | 3300046523 | Ga0495644_0269979 | Ga0495644_0269979_113_568 | 151 |
| 1469 | 3300046524 | Ga0495648_0001464 | Ga0495648_0001464_7871_8326 | 151 |
| 1470 | 3300046524 | Ga0495648_0014109 | Ga0495648_0014109_4135_4590 | 151 |
| 1471 | 3300046524 | Ga0495648_0020872 | Ga0495648_0020872_121_576 | 151 |
| 1472 | 3300046524 | Ga0495648_0023122 | Ga0495648_0023122_914_1369 | 151 |
| 1473 | 3300046524 | Ga0495648_0053541 | Ga0495648_0053541_1734_2189 | 151 |
| 1474 | 3300046524 | Ga0495648_0136151 | Ga0495648_0136151_657_1112 | 151 |
| 1475 | 3300046524 | Ga0495648_0151296 | Ga0495648_0151296_683_1138 | 151 |
| 1476 | 3300046526 | Ga0495666_0008469 | Ga0495666_0008469_555_1010 | 151 |
| 1477 | 3300046528 | Ga0495642_0020860 | Ga0495642_0020860_1297_1752 | 151 |
| 1478 | 3300046530 | Ga0495654_0006676 | Ga0495654_0006676_4065_4520 | 151 |
| 1479 | 3300046530 | Ga0495654_0006980 | Ga0495654_0006980_4107_4562 | 151 |
| 1480 | 3300046530 | Ga0495654_0011839 | Ga0495654_0011839_4064_4519 | 151 |
| 1481 | 3300046530 | Ga0495654_0040352 | Ga0495654_0040352_1251_1706 | 151 |
| 1482 | 3300046530 | Ga0495654_0076875 | Ga0495654_0076875_27_482 | 151 |
| 1483 | 3300046530 | Ga0495654_0111249 | Ga0495654_0111249_124_579 | 151 |
| 1484 | 3300046530 | Ga0495654_0271266 | Ga0495654_0271266_225_680 | 151 |
| 1485 | 3300046530 | Ga0495654_0306917 | Ga0495654_0306917_124_579 | 151 |
| 1486 | 3300046535 | Ga0495586_0007706 | Ga0495586_0007706_1081_1536 | 151 |
| 1487 | 3300046536 | Ga0495587_0019133 | Ga0495587_0019133_86_541 | 151 |
| 1488 | 3300046536 | Ga0495587_0156788 | Ga0495587_0156788_805_1260 | 151 |
| 1489 | 3300046538 | Ga0495609_0000098 | Ga0495609_0000098_98679_99134 | 151 |
| 1490 | 3300046538 | Ga0495609_0000101 | Ga0495609_0000101_4076_4531 | 151 |
| 1491 | 3300046538 | Ga0495609_0003114 | Ga0495609_0003114_5128_5583 | 151 |
| 1492 | 3300046538 | Ga0495609_0071160 | Ga0495609_0071160_317_772 | 151 |
| 1493 | 3300046538 | Ga0495609_0106506 | Ga0495609_0106506_84_539 | 151 |
| 1494 | 3300046538 | Ga0495609_0217313 | Ga0495609_0217313_84_539 | 151 |
| 1495 | 3300046538 | Ga0495609_0234257 | Ga0495609_0234257_30_485 | 151 |
| 1496 | 3300046542 | Ga0495597_0000033 | Ga0495597_0000033_109731_110186 | 151 |
| 1497 | 3300046542 | Ga0495597_0007497 | Ga0495597_0007497_988_1443 | 151 |
| 1498 | 3300046542 | Ga0495597_0007724 | Ga0495597_0007724_3054_3509 | 151 |
| 1499 | 3300046542 | Ga0495597_0010129 | Ga0495597_0010129_920_1375 | 151 |
| 1500 | 3300046542 | Ga0495597_0027103 | Ga0495597_0027103_924_1379 | 151 |
| 1501 | 3300046542 | Ga0495597_0032004 | Ga0495597_0032004_395_850 | 151 |
| 1502 | 3300046542 | Ga0495597_0112951 | Ga0495597_0112951_23_478 | 151 |
| 1503 | 3300046542 | Ga0495597_0168212 | Ga0495597_0168212_180_635 | 151 |
| 1504 | 3300046543 | Ga0495645_0059966 | Ga0495645_0059966_1849_2304 | 151 |
| 1505 | 3300046557 | Ga0495622_0002902 | Ga0495622_0002902_3643_4098 | 151 |
| 1506 | 3300046557 | Ga0495622_0006825 | Ga0495622_0006825_3228_3683 | 151 |
| 1507 | 3300046558 | Ga0495633_0000129 | Ga0495633_0000129_96288_96743 | 151 |
| 1508 | 3300046615 | Ga0495656_0012623 | Ga0495656_0012623_1924_2379 | 151 |
| 1509 | 3300046616 | Ga0495668_0010805 | Ga0495668_0010805_926_1381 | 151 |
| 1510 | 3300046616 | Ga0495668_0049935 | Ga0495668_0049935_1228_1683 | 151 |
| 1511 | 3300046616 | Ga0495668_0070832 | Ga0495668_0070832_847_1302 | 151 |
| 1512 | 3300046642 | Ga0495634_0074625 | Ga0495634_0074625_918_1373 | 151 |
| 1513 | 3300046648 | Ga0495611_0000619 | Ga0495611_0000619_17105_17560 | 151 |
| 1514 | 3300046648 | Ga0495611_0021168 | Ga0495611_0021168_2095_2550 | 151 |
| 1515 | 3300046660 | Ga0495625_0000113 | Ga0495625_0000113_4123_4578 | 151 |
| 1516 | 3300046660 | Ga0495625_0045004 | Ga0495625_0045004_18_473 | 151 |
| 1517 | 3300046660 | Ga0495625_0176303 | Ga0495625_0176303_899_1354 | 151 |
| 1518 | 3300046660 | Ga0495625_0188310 | Ga0495625_0188310_168_623 | 151 |
| 1519 | 3300046660 | Ga0495625_0523918 | Ga0495625_0523918_144_599 | 151 |
| 1520 | 3300046663 | Ga0495635_0032290 | Ga0495635_0032290_1990_2445 | 151 |
| 1521 | 3300046663 | Ga0495635_0212289 | Ga0495635_0212289_760_1215 | 151 |
| 1522 | 3300046664 | Ga0495659_0007458 | Ga0495659_0007458_1853_2308 | 151 |
| 1523 | 3300046665 | Ga0495661_0000050 | Ga0495661_0000050_120807_121262 | 151 |
| 1524 | 3300046665 | Ga0495661_0000196 | Ga0495661_0000196_4083_4538 | 151 |
| 1525 | 3300046665 | Ga0495661_0000237 | Ga0495661_0000237_4089_4544 | 151 |
| 1526 | 3300046665 | Ga0495661_0000791 | Ga0495661_0000791_4103_4558 | 151 |
| 1527 | 3300046665 | Ga0495661_0039015 | Ga0495661_0039015_763_1218 | 151 |
| 1528 | 3300046665 | Ga0495661_0143880 | Ga0495661_0143880_756_1211 | 151 |
| 1529 | 3300046674 | Ga0495588_0006320 | Ga0495588_0006320_4199_4654 | 151 |
| 1530 | 3300046680 | Ga0495646_0134234 | Ga0495646_0134234_231_686 | 151 |
| 1531 | 3300046680 | Ga0495646_0211047 | Ga0495646_0211047_17_472 | 151 |
| 1532 | 3300046684 | Ga0495669_0006747 | Ga0495669_0006747_3913_4368 | 151 |
| 1533 | 3300046689 | Ga0495613_0019320 | Ga0495613_0019320_3799_4254 | 151 |
| 1534 | 3300046691 | Ga0495670_0004611 | Ga0495670_0004611_2595_3050 | 151 |
| 1535 | 3300046691 | Ga0495670_0029549 | Ga0495670_0029549_830_1285 | 151 |
| 1536 | 3300046691 | Ga0495670_0033258 | Ga0495670_0033258_734_1189 | 151 |
| 1537 | 3300046691 | Ga0495670_0074612 | Ga0495670_0074612_974_1429 | 151 |
| 1538 | 3300046691 | Ga0495670_0091940 | Ga0495670_0091940_1040_1495 | 151 |
| 1539 | 3300046691 | Ga0495670_0146646 | Ga0495670_0146646_194_649 | 151 |
| 1540 | 3300046692 | Ga0495671_0002273 | Ga0495671_0002273_3075_3530 | 151 |
| 1541 | 3300046692 | Ga0495671_0003386 | Ga0495671_0003386_5933_6388 | 151 |
| 1542 | 3300046692 | Ga0495671_0009251 | Ga0495671_0009251_878_1333 | 151 |
| 1543 | 3300046692 | Ga0495671_0011351 | Ga0495671_0011351_3711_4166 | 151 |
| 1544 | 3300046692 | Ga0495671_0063231 | Ga0495671_0063231_1148_1603 | 151 |
| 1545 | 3300046692 | Ga0495671_0123705 | Ga0495671_0123705_685_1140 | 151 |
| 1546 | 3300046692 | Ga0495671_0252737 | Ga0495671_0252737_313_768 | 151 |
| 1547 | 3300046692 | Ga0495671_0348240 | Ga0495671_0348240_134_589 | 151 |
| 1548 | 3300046694 | Ga0495649_0000559 | Ga0495649_0000559_22497_22952 | 151 |
| 1549 | 3300046694 | Ga0495649_0004109 | Ga0495649_0004109_3996_4451 | 151 |
| 1550 | 3300046694 | Ga0495649_0005576 | Ga0495649_0005576_6085_6540 | 151 |
| 1551 | 3300046694 | Ga0495649_0011664 | Ga0495649_0011664_4258_4713 | 151 |
| 1552 | 3300046694 | Ga0495649_0026139 | Ga0495649_0026139_2343_2798 | 151 |
| 1553 | 3300046694 | Ga0495649_0067043 | Ga0495649_0067043_1400_1855 | 151 |
| 1554 | 3300046694 | Ga0495649_0100412 | Ga0495649_0100412_672_1127 | 151 |
| 1555 | 3300046694 | Ga0495649_0152725 | Ga0495649_0152725_644_1099 | 151 |
| 1556 | 3300046694 | Ga0495649_0209165 | Ga0495649_0209165_409_864 | 151 |
| 1557 | 3300046794 | Ga0495589_0004366 | Ga0495589_0004366_2051_2506 | 151 |
| 1558 | 3300046794 | Ga0495589_0019045 | Ga0495589_0019045_2304_2759 | 151 |
| 1559 | 3300046794 | Ga0495589_0022667 | Ga0495589_0022667_2351_2806 | 151 |
| 1560 | 3300046794 | Ga0495589_0111778 | Ga0495589_0111778_835_1290 | 151 |
| 1561 | 3300046809 | Ga0495600_0029762 | Ga0495600_0029762_1990_2445 | 151 |
| 1562 | 3300046810 | Ga0495660_0002195 | Ga0495660_0002195_11045_11500 | 151 |
| 1563 | 3300046810 | Ga0495660_0004003 | Ga0495660_0004003_5094_5549 | 151 |
| 1564 | 3300046810 | Ga0495660_0009901 | Ga0495660_0009901_2097_2552 | 151 |
| 1565 | 3300046810 | Ga0495660_0011258 | Ga0495660_0011258_4573_5028 | 151 |
| 1566 | 3300046810 | Ga0495660_0015775 | Ga0495660_0015775_1685_2140 | 151 |
| 1567 | 3300046810 | Ga0495660_0036962 | Ga0495660_0036962_1106_1561 | 151 |
| 1568 | 3300046810 | Ga0495660_0081717 | Ga0495660_0081717_983_1438 | 151 |
| 1569 | 3300046810 | Ga0495660_0096203 | Ga0495660_0096203_920_1375 | 151 |
| 1570 | 3300046810 | Ga0495660_0113277 | Ga0495660_0113277_76_531 | 151 |
| 1571 | 3300046810 | Ga0495660_0158337 | Ga0495660_0158337_637_1092 | 151 |
| 1572 | 3300046810 | Ga0495660_0236010 | Ga0495660_0236010_200_655 | 151 |
| 1573 | 3300047317 | Ga0495604_0224792 | Ga0495604_0224792_797_1252 | 151 |
| 1574 | 3300047318 | Ga0495636_0469873 | Ga0495636_0469873_81_536 | 151 |
| 1575 | 3300047320 | Ga0495672_0008685 | Ga0495672_0008685_3121_3576 | 151 |
| 1576 | 3300047320 | Ga0495672_0017665 | Ga0495672_0017665_1288_1743 | 151 |
| 1577 | 3300047320 | Ga0495672_0032448 | Ga0495672_0032448_1316_1771 | 151 |
| 1578 | 3300047320 | Ga0495672_0036714 | Ga0495672_0036714_1217_1672 | 151 |
| 1579 | 3300047320 | Ga0495672_0036760 | Ga0495672_0036760_2465_2920 | 151 |
| 1580 | 3300047320 | Ga0495672_0061709 | Ga0495672_0061709_483_938 | 151 |
| 1581 | 3300047320 | Ga0495672_0069020 | Ga0495672_0069020_649_1104 | 151 |
| 1582 | 3300047320 | Ga0495672_0077165 | Ga0495672_0077165_1168_1623 | 151 |
| 1583 | 3300047320 | Ga0495672_0104839 | Ga0495672_0104839_495_950 | 151 |
| 1584 | 3300047320 | Ga0495672_0108826 | Ga0495672_0108826_21_476 | 151 |
| 1585 | 3300047320 | Ga0495672_0122707 | Ga0495672_0122707_27_482 | 151 |
| 1586 | 3300047320 | Ga0495672_0126392 | Ga0495672_0126392_750_1205 | 151 |
| 1587 | 3300047321 | Ga0495676_0000032 | Ga0495676_0000032_126643_127098 | 151 |
| 1588 | 3300047321 | Ga0495676_0041046 | Ga0495676_0041046_2474_2929 | 151 |
| 1589 | 3300047322 | Ga0495680_0008846 | Ga0495680_0008846_1863_2318 | 151 |
| 1590 | 3300047322 | Ga0495680_0158307 | Ga0495680_0158307_191_646 | 151 |
| 1591 | 3300047322 | Ga0495680_0491239 | Ga0495680_0491239_364_819 | 151 |
| 1592 | 3300047322 | Ga0495680_0723396 | Ga0495680_0723396_147_602 | 151 |
| 1593 | 3300047323 | Ga0495683_0000055 | Ga0495683_0000055_98323_98778 | 151 |
| 1594 | 3300047323 | Ga0495683_0000075 | Ga0495683_0000075_4077_4532 | 151 |
| 1595 | 3300047323 | Ga0495683_0013729 | Ga0495683_0013729_2973_3428 | 151 |
| 1596 | 3300047323 | Ga0495683_0034418 | Ga0495683_0034418_1268_1723 | 151 |
| 1597 | 3300047323 | Ga0495683_0132110 | Ga0495683_0132110_68_523 | 151 |
| 1598 | 3300047323 | Ga0495683_0249969 | Ga0495683_0249969_130_585 | 151 |
| 1599 | 3300047443 | Ga0495687_024590 | Ga0495687_024590_515_970 | 151 |
| 1600 | 3300047443 | Ga0495687_060119 | Ga0495687_060119_680_1135 | 151 |
| 1601 | 3300047444 | Ga0495675_0060903 | Ga0495675_0060903_1706_2161 | 151 |
| 1602 | 3300047445 | Ga0495677_0096017 | Ga0495677_0096017_520_975 | 151 |
| 1603 | 3300047445 | Ga0495677_0101945 | Ga0495677_0101945_609_1064 | 151 |
| 1604 | 3300047446 | Ga0495679_000495 | Ga0495679_000495_23356_23811 | 151 |
| 1605 | 3300047446 | Ga0495679_027905 | Ga0495679_027905_33_488 | 151 |
| 1606 | 3300047446 | Ga0495679_064991 | Ga0495679_064991_297_752 | 151 |
| 1607 | 3300047446 | Ga0495679_105866 | Ga0495679_105866_285_740 | 151 |
| 1608 | 3300047469 | Ga0495673_0004043 | Ga0495673_0004043_4955_5410 | 151 |
| 1609 | 3300047469 | Ga0495673_0005552 | Ga0495673_0005552_4041_4496 | 151 |
| 1610 | 3300047469 | Ga0495673_0006295 | Ga0495673_0006295_6000_6455 | 151 |
| 1611 | 3300047469 | Ga0495673_0011348 | Ga0495673_0011348_4091_4546 | 151 |
| 1612 | 3300047469 | Ga0495673_0028651 | Ga0495673_0028651_1043_1498 | 151 |
| 1613 | 3300047469 | Ga0495673_0035666 | Ga0495673_0035666_776_1231 | 151 |
| 1614 | 3300047469 | Ga0495673_0054911 | Ga0495673_0054911_1059_1514 | 151 |
| 1615 | 3300047469 | Ga0495673_0068619 | Ga0495673_0068619_43_498 | 151 |
| 1616 | 3300047469 | Ga0495673_0070498 | Ga0495673_0070498_949_1404 | 151 |
| 1617 | 3300047469 | Ga0495673_0080658 | Ga0495673_0080658_876_1331 | 151 |
| 1618 | 3300047469 | Ga0495673_0080788 | Ga0495673_0080788_808_1263 | 151 |
| 1619 | 3300047469 | Ga0495673_0107488 | Ga0495673_0107488_635_1090 | 151 |
| 1620 | 3300047469 | Ga0495673_0315656 | Ga0495673_0315656_31_486 | 151 |
| 1621 | 3300047470 | Ga0495681_0003330 | Ga0495681_0003330_7630_8085 | 151 |
| 1622 | 3300047470 | Ga0495681_0009290 | Ga0495681_0009290_4074_4529 | 151 |
| 1623 | 3300047470 | Ga0495681_0010491 | Ga0495681_0010491_4085_4540 | 151 |
| 1624 | 3300047470 | Ga0495681_0026799 | Ga0495681_0026799_1793_2248 | 151 |
| 1625 | 3300047470 | Ga0495681_0046902 | Ga0495681_0046902_1512_1967 | 151 |
| 1626 | 3300047470 | Ga0495681_0094003 | Ga0495681_0094003_31_486 | 151 |
| 1627 | 3300047470 | Ga0495681_0208313 | Ga0495681_0208313_245_700 | 151 |
| 1628 | 3300047472 | Ga0495686_0057742 | Ga0495686_0057742_1084_1539 | 151 |
| 1629 | 3300047472 | Ga0495686_0188888 | Ga0495686_0188888_22_477 | 151 |
| 1630 | 3300047673 | Ga0495593_0034350 | Ga0495593_0034350_918_1373 | 151 |
| 1631 | 3300048091 | Ga0495626_0000024 | Ga0495626_0000024_121951_122406 | 151 |
| 1632 | 3300048091 | Ga0495626_0006021 | Ga0495626_0006021_3275_3730 | 151 |
| 1633 | 3300048091 | Ga0495626_0007440 | Ga0495626_0007440_1557_2012 | 151 |
| 1634 | 3300048091 | Ga0495626_0030264 | Ga0495626_0030264_2013_2468 | 151 |
| 1635 | 3300048091 | Ga0495626_0091432 | Ga0495626_0091432_862_1317 | 151 |
| 1636 | 3300048091 | Ga0495626_0092114 | Ga0495626_0092114_31_486 | 151 |
| 1637 | 3300048091 | Ga0495626_0229073 | Ga0495626_0229073_53_508 | 151 |
| 1638 | 3300048905 | Ga0496102_0021686 | Ga0496102_0021686_1126_1581 | 151 |
| 1639 | 3300048905 | Ga0496102_1913148 | Ga0496102_1913148_10_465 | 151 |
| 1640 | 3300048906 | Ga0496103_0156800 | Ga0496103_0156800_70_525 | 151 |
| 1641 | 3300048908 | Ga0496105_0541806 | Ga0496105_0541806_81_536 | 151 |
| 1642 | 3300048909 | Ga0496106_0419181 | Ga0496106_0419181_385_840 | 151 |
| 1643 | 3300048911 | Ga0496108_0505068 | Ga0496108_0505068_415_870 | 151 |
| 1644 | 3300048913 | Ga0496110_0215624 | Ga0496110_0215624_357_812 | 151 |
| 1645 | 3300048913 | Ga0496110_0479361 | Ga0496110_0479361_633_1088 | 151 |
| 1646 | 3300048913 | Ga0496110_0532282 | Ga0496110_0532282_16_471 | 151 |
| 1647 | 3300048914 | Ga0496111_0332160 | Ga0496111_0332160_637_1092 | 151 |
| 1648 | 3300048914 | Ga0496111_0597354 | Ga0496111_0597354_284_739 | 151 |
| 1649 | 3300048915 | Ga0496112_1876480 | Ga0496112_1876480_44_499 | 151 |
| 1650 | 3300048916 | Ga0496113_0373904 | Ga0496113_0373904_525_980 | 151 |
| 1651 | 3300048917 | Ga0496114_0033938 | Ga0496114_0033938_1749_2204 | 151 |
| 1652 | 3300048917 | Ga0496114_0090573 | Ga0496114_0090573_161_616 | 151 |
| 1653 | 3300048919 | Ga0496116_0000553 | Ga0496116_0000553_4085_4540 | 151 |
| 1654 | 3300048919 | Ga0496116_0013021 | Ga0496116_0013021_4142_4597 | 151 |
| 1655 | 3300048919 | Ga0496116_0018645 | Ga0496116_0018645_70_525 | 151 |
| 1656 | 3300048919 | Ga0496116_0019155 | Ga0496116_0019155_759_1214 | 151 |
| 1657 | 3300048919 | Ga0496116_0170552 | Ga0496116_0170552_24_479 | 151 |
| 1658 | 3300048920 | Ga0496117_0006615 | Ga0496117_0006615_4080_4535 | 151 |
| 1659 | 3300048920 | Ga0496117_0006932 | Ga0496117_0006932_2099_2554 | 151 |
| 1660 | 3300048920 | Ga0496117_0024953 | Ga0496117_0024953_576_1031 | 151 |
| 1661 | 3300048920 | Ga0496117_0026843 | Ga0496117_0026843_683_1138 | 151 |
| 1662 | 3300048920 | Ga0496117_0031455 | Ga0496117_0031455_420_875 | 151 |
| 1663 | 3300048920 | Ga0496117_0154774 | Ga0496117_0154774_63_518 | 151 |
| 1664 | 3300048920 | Ga0496117_0158249 | Ga0496117_0158249_79_534 | 151 |
| 1665 | 3300048920 | Ga0496117_0365643 | Ga0496117_0365643_28_483 | 151 |
| 1666 | 3300048921 | Ga0496118_0007748 | Ga0496118_0007748_4117_4572 | 151 |
| 1667 | 3300048921 | Ga0496118_0088388 | Ga0496118_0088388_1345_1800 | 151 |
| 1668 | 3300048921 | Ga0496118_0099858 | Ga0496118_0099858_171_626 | 151 |
| 1669 | 3300048921 | Ga0496118_0116427 | Ga0496118_0116427_105_560 | 151 |
| 1670 | 3300048921 | Ga0496118_0125720 | Ga0496118_0125720_981_1436 | 151 |
| 1671 | 3300048921 | Ga0496118_0263243 | Ga0496118_0263243_49_504 | 151 |
| 1672 | 3300048922 | Ga0496119_0125748 | Ga0496119_0125748_492_947 | 151 |
| 1673 | 3300048924 | Ga0496121_0008919 | Ga0496121_0008919_4086_4541 | 151 |
| 1674 | 3300048924 | Ga0496121_0011761 | Ga0496121_0011761_4059_4514 | 151 |
| 1675 | 3300048924 | Ga0496121_0115362 | Ga0496121_0115362_305_760 | 151 |
| 1676 | 3300048924 | Ga0496121_0216973 | Ga0496121_0216973_91_546 | 151 |
| 1677 | 3300048924 | Ga0496121_0218219 | Ga0496121_0218219_227_682 | 151 |
| 1678 | 3300048924 | Ga0496121_0281425 | Ga0496121_0281425_607_1062 | 151 |
| 1679 | 3300048924 | Ga0496121_0508017 | Ga0496121_0508017_132_587 | 151 |
| 1680 | 3300048925 | Ga0496122_0007258 | Ga0496122_0007258_5706_6161 | 151 |
| 1681 | 3300048925 | Ga0496122_0018013 | Ga0496122_0018013_1864_2319 | 151 |
| 1682 | 3300048925 | Ga0496122_0021634 | Ga0496122_0021634_1162_1617 | 151 |
| 1683 | 3300048925 | Ga0496122_0034642 | Ga0496122_0034642_1606_2061 | 151 |
| 1684 | 3300048925 | Ga0496122_0061280 | Ga0496122_0061280_1408_1863 | 151 |
| 1685 | 3300048925 | Ga0496122_0371410 | Ga0496122_0371410_119_574 | 151 |
| 1686 | 3300048926 | Ga0496123_0000178 | Ga0496123_0000178_116226_116681 | 151 |
| 1687 | 3300048926 | Ga0496123_0007242 | Ga0496123_0007242_5995_6450 | 151 |
| 1688 | 3300048926 | Ga0496123_0010680 | Ga0496123_0010680_4056_4511 | 151 |
| 1689 | 3300048926 | Ga0496123_0027433 | Ga0496123_0027433_861_1316 | 151 |
| 1690 | 3300048926 | Ga0496123_0170119 | Ga0496123_0170119_670_1125 | 151 |
| 1691 | 3300048926 | Ga0496123_0304831 | Ga0496123_0304831_280_735 | 151 |
| 1692 | 3300048927 | Ga0496124_0004321 | Ga0496124_0004321_4205_4660 | 151 |
| 1693 | 3300048927 | Ga0496124_0006372 | Ga0496124_0006372_2160_2615 | 151 |
| 1694 | 3300048927 | Ga0496124_0023502 | Ga0496124_0023502_983_1438 | 151 |
| 1695 | 3300048927 | Ga0496124_0057238 | Ga0496124_0057238_2143_2598 | 151 |
| 1696 | 3300048927 | Ga0496124_0137724 | Ga0496124_0137724_1426_1881 | 151 |
| 1697 | 3300048927 | Ga0496124_0145590 | Ga0496124_0145590_711_1166 | 151 |
| 1698 | 3300048927 | Ga0496124_0150009 | Ga0496124_0150009_117_572 | 151 |
| 1699 | 3300048927 | Ga0496124_0220964 | Ga0496124_0220964_102_557 | 151 |
| 1700 | 3300048927 | Ga0496124_0329605 | Ga0496124_0329605_73_528 | 151 |
| 1701 | 3300048928 | Ga0496125_0001493 | Ga0496125_0001493_28680_29135 | 151 |
| 1702 | 3300048928 | Ga0496125_0007042 | Ga0496125_0007042_806_1261 | 151 |
| 1703 | 3300048928 | Ga0496125_0069620 | Ga0496125_0069620_1448_1903 | 151 |
| 1704 | 3300048928 | Ga0496125_0111577 | Ga0496125_0111577_1447_1908 | 151 |
| 1705 | 3300048928 | Ga0496125_0191586 | Ga0496125_0191586_31_486 | 151 |
| 1706 | 3300048928 | Ga0496125_0191943 | Ga0496125_0191943_71_526 | 151 |
| 1707 | 3300048929 | Ga0496126_0148335 | Ga0496126_0148335_1306_1761 | 151 |
| 1708 | 3300048929 | Ga0496126_0343497 | Ga0496126_0343497_486_941 | 151 |
| 1709 | 3300049459 | Ga0495678_000106 | Ga0495678_000106_4075_4530 | 151 |
| 1710 | 3300049459 | Ga0495678_016396 | Ga0495678_016396_2534_2989 | 151 |
| 1711 | 3300049459 | Ga0495678_033178 | Ga0495678_033178_738_1193 | 151 |
| 1712 | 3300049459 | Ga0495678_173455 | Ga0495678_173455_105_560 | 151 |
| 1713 | 3300049460 | Ga0495682_0000573 | Ga0495682_0000573_14583_15038 | 151 |
| 1714 | 3300049568 | Ga0501031_0118073 | Ga0501031_0118073_636_1091 | 151 |
| 1715 | 3300049571 | Ga0501034_0000143 | Ga0501034_0000143_2638_3093 | 151 |
| 1716 | 3300049571 | Ga0501034_0030982 | Ga0501034_0030982_2867_3322 | 151 |
| 1717 | 3300049574 | Ga0501038_0105642 | Ga0501038_0105642_1434_1889 | 151 |
| 1718 | 3300049758 | Ga0501241_023838 | Ga0501241_023838_656_1111 | 151 |
| 1719 | 3300049853 | Ga0501226_000049 | Ga0501226_000049_23607_24062 | 151 |
| 1720 | 3300050489 | nmdc:mga03683_25008_c1 | nmdc:mga03683_25008_c1_688_1143 | 151 |
| 1721 | 3300050490 | nmdc:mga03n38_30830_c1 | nmdc:mga03n38_30830_c1_624_1079 | 151 |
| 1722 | 3300050491 | nmdc:mga00v17_1492_c1 | nmdc:mga00v17_1492_c1_1651_2106 | 151 |
| 1723 | 3300050491 | nmdc:mga00v17_436110_c1 | nmdc:mga00v17_436110_c1_13_468 | 151 |
| 1724 | 3300050491 | nmdc:mga00v17_571_c1 | nmdc:mga00v17_571_c1_17088_17543 | 151 |
| 1725 | 3300050492 | nmdc:mga0yw44_217_c1 | nmdc:mga0yw44_217_c1_9186_9641 | 151 |
| 1726 | 3300050492 | nmdc:mga0yw44_34070_c1 | nmdc:mga0yw44_34070_c1_2010_2513 | 151 |
| 1727 | 3300050494 | nmdc:mga06z11_174630_c1 | nmdc:mga06z11_174630_c1_61_516 | 151 |
| 1728 | 3300050494 | nmdc:mga06z11_1852_c1 | nmdc:mga06z11_1852_c1_4340_4795 | 151 |
| 1729 | 3300050496 | nmdc:mga07m45_1061_c1 | nmdc:mga07m45_1061_c1_10017_10472 | 151 |
| 1730 | 3300050496 | nmdc:mga07m45_7984_c1 | nmdc:mga07m45_7984_c1_4532_5038 | 151 |
| 1731 | 3300050508 | nmdc:mga09592_3652_c1 | nmdc:mga09592_3652_c1_10175_10630 | 151 |
| 1732 | 3300050512 | nmdc:mga0n895_1547153_c1 | nmdc:mga0n895_1547153_c1_104_559 | 151 |
| 1733 | 3300050516 | nmdc:mga0sz30_320_c2 | nmdc:mga0sz30_320_c2_1761_2216 | 151 |
| 1734 | 3300053135 | Ga0500659_0005549 | Ga0500659_0005549_2250_2705 | 151 |
| 1735 | 3300053142 | Ga0500577_0009905 | Ga0500577_0009905_545_1000 | 151 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1dup-assembly1.cif.gz_A | deoxyuridine 5'-triphosphate nucleotido hydrolase (d-utpase) | 0.9343 | 1 | 135 |
| 1rnj-assembly1.cif.gz_A | crystal structure of inactive mutant dutpase complexed with substrate analogue imido-dutp | 0.9299 | 1 | 135 |
| 4lhr-assembly1.cif.gz_A | crystal structure of a deoxyuridine 5'-triphosphate nucleotidohydrolase from burkholderia thailandensis | 0.9295 | 3 | 135 |
| 3tqz-assembly1.cif.gz_A | structure of a deoxyuridine 5'-triphosphate nucleotidohydrolase (dut) from coxiella burnetii | 0.9255 | 1 | 137 |
| 6mai-assembly1.cif.gz_A | crystal structure of deoxyuridine 5'-triphosphate nucleotidohydrolase from legionella pneumophila philadelphia 1 | 0.9236 | 1 | 137 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3tqzA00 | Mainly Beta;Distorted Sandwich;Deoxyuridine 5'-Triphosphate Nucleotidohydrolase; Chain A;Deoxyuridine triphosphatase (dUTPase) | 0.9246 | 1 | 137 | 2.70.40.10 |
| 3tqzA00 | Mainly Beta;Distorted Sandwich;Deoxyuridine 5'-Triphosphate Nucleotidohydrolase; Chain A;Deoxyuridine triphosphatase (dUTPase) | 0.9182 | 1 | 137 | 2.70.40.10 |
| 1snfC00 | Mainly Beta;Distorted Sandwich;Deoxyuridine 5'-Triphosphate Nucleotidohydrolase; Chain A;Deoxyuridine triphosphatase (dUTPase) | 0.9025 | 3 | 135 | 2.70.40.10 |
| 1sjnC00 | Mainly Beta;Distorted Sandwich;Deoxyuridine 5'-Triphosphate Nucleotidohydrolase; Chain A;Deoxyuridine triphosphatase (dUTPase) | 0.8909 | 3 | 135 | 2.70.40.10 |
| 1snfC00 | Mainly Beta;Distorted Sandwich;Deoxyuridine 5'-Triphosphate Nucleotidohydrolase; Chain A;Deoxyuridine triphosphatase (dUTPase) | 0.8829 | 3 | 135 | 2.70.40.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A661CKF5-F1-model_v4 | dUTP diphosphatase (EC 3.6.1.23) | 0.9494 | 1 | 126 |
GO:0000287
GO:0004170 GO:0006226 GO:0046081 |
| AF-A0A447QL67-F1-model_v4 | dUTP diphosphatase (EC 3.6.1.23) | 0.9492 | 1 | 122 |
GO:0000287
GO:0004170 GO:0006226 GO:0046081 |
| AF-A0A661CKF5-F1-model_v4 | dUTP diphosphatase (EC 3.6.1.23) | 0.9421 | 1 | 126 |
GO:0000287
GO:0004170 GO:0006226 GO:0046081 |
| AF-A0A534E2N6-F1-model_v4 | deleted | 0.9399 | 13 | 118 |
|
| AF-A0A359GZM5-F1-model_v4 | dUTP diphosphatase (EC 3.6.1.23) | 0.9364 | 3 | 132 |
GO:0000287
GO:0004170 GO:0006226 GO:0046081 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar