F495303
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1679 | 680 | 3358 | 251 |
Family's Representative Sequence
| Representative Sequence | 3300027512|Ga0209179_1024849|Ga0209179_10248492 |
| Length | 247 |
| Sequence | MTDAIRPLIAGNWKMNGLRASLGEFEAMRAGASEVADKADLLVCPPATLIAAFVERAGGSRTVAVGAQDCHPDASGPHTGDISAEMLADAGASAIIVGHSERRADHGETDVLVRQKTEAVWRAGLTAIVCIGETQRQRLDICRGQLNVSLPDGARADNLVVAYEPVWAIGTGLTPTAEDVEQIHRFIRELLAARFNQEGSRIRILYGGSVKPSNASELMAVANVNGALVGGASLKAADFLAIARSCP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 2 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 3 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 4 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 5 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 6 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 7 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 8 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 9 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 15 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 16 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 18 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 29 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 41 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 43 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 45 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 52 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 54 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 55 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 56 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 57 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 58 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 59 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 60 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 61 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 62 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 63 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 64 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 65 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 66 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 67 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 68 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 69 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 70 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 72 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 73 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 74 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 75 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 76 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 77 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 78 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 79 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 80 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 81 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 82 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 84 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 85 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 86 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 87 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 88 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 89 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 90 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 92 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 93 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 94 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 95 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 96 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 97 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300012505 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 | Metagenome | Rhizosphere |
| 113 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 129 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 130 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 131 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 132 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 133 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 134 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 135 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 136 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 137 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 138 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 139 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 202 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 203 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 204 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 205 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 207 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 208 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 212 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 213 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 214 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 215 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 216 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 217 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 218 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 219 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 220 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 221 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 222 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 223 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 224 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 225 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 226 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 227 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 228 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 229 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 230 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 231 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 232 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 233 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 234 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 235 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 236 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 237 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 238 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 239 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 240 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 241 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 242 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 243 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 244 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 245 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 246 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 247 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 248 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 249 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 250 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 251 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 252 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 253 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 254 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 255 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 256 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 257 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 258 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 259 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 260 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 261 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 262 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 263 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 264 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 265 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 266 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 267 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 268 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 269 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 270 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 271 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 272 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 273 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 274 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 275 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 276 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 277 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 278 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 279 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 280 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 281 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 282 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 283 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 284 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 285 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 369 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 370 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 371 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 372 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 373 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 374 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 375 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 376 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 377 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 378 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 379 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 380 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 381 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 382 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 383 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 384 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 385 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 386 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 387 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 388 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 389 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 390 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 391 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 392 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 393 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 394 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 396 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 397 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 398 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 399 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 400 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 401 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 402 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 403 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 404 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 405 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 406 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 407 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 408 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 409 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 410 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 411 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 412 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 413 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 414 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 415 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 416 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 417 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 418 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 419 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 420 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 421 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 422 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 423 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 424 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 425 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 426 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 427 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 428 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 429 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 430 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 431 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 432 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 433 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 434 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 435 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 436 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 437 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 438 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 439 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 440 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 441 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 442 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 443 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 444 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 445 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 446 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 447 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 448 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 449 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 450 | 3300053089 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere | Metagenome | Endosphere |
| 451 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 452 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 453 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 454 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 455 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 456 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 457 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 458 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 459 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 460 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 461 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 462 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 463 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 464 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 465 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 466 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 467 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 468 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 469 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 470 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 471 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 472 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 473 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 474 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 475 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 476 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 477 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 478 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 479 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 480 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 481 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 482 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 483 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 484 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 485 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 486 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 487 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 488 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 489 | 3300053725 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere | Metagenome | Endosphere |
| 490 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 491 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 492 | 3300053736 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere | Metagenome | Endosphere |
| 493 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 494 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 495 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 496 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 497 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 498 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 499 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 500 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 501 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 502 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 503 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 504 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 505 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 506 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 507 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 508 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 509 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 510 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 511 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 512 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 513 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 514 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 515 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 516 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 517 | 2599185236 | Rhizobium sp. NFR07 | Isolate | Rhizoplane |
| 518 | 2602042107 | Bradyrhizobium sp. NFR13 | Isolate | Rhizoplane |
| 519 | 2643221547 | Pseudolabrys sp. Root1462 | Isolate | Unclassified |
| 520 | 2643221623 | Aminobacter sp. DSM 101952 Root100 | Isolate | Unclassified |
| 521 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 522 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 523 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 524 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 525 | 2791355199 | |||
| 526 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 527 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 528 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 529 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 530 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 531 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 532 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 533 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 534 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 535 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 536 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 537 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 538 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 539 | 2837651117 | Pseudohoeflea suaedae YC6898 | Isolate | Unclassified |
| 540 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 541 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 542 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 543 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 544 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 545 | 2857524615 | Tardiphaga sp. R-73074 | Isolate | Unclassified |
| 546 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 547 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 548 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 549 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 550 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 551 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 552 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 553 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 554 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 555 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 556 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 557 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 558 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 559 | 2883291878 | Hypericibacter terrae R5913 | Isolate | Rhizosphere |
| 560 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 561 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 562 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 563 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 564 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 565 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 566 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 567 | 2893066018 | Tardiphaga sp. P9-11 | Isolate | Unclassified |
| 568 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 569 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 570 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 571 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 572 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 573 | 2904699407 | |||
| 574 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 575 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 576 | 2906610324 | |||
| 577 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 578 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 579 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 580 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 581 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 582 | 2909042592 | Labrys sp. LIt4 | Isolate | Nodule |
| 583 | 2919073203 | Tardiphaga robiniae 1155 | Isolate | Unclassified |
| 584 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 585 | 2922368715 | |||
| 586 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 587 | 2922425934 | |||
| 588 | 2928531327 | Caulobacter sp. 1776 | Isolate | Rhizosphere |
| 589 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 590 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 591 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 592 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 593 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 594 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 595 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 596 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 597 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 598 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 599 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 600 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 601 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 602 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 603 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 604 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 605 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 606 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 607 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 608 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 609 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 610 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 611 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 612 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 613 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 614 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 615 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 616 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 617 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 618 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 619 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 620 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 621 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 622 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 623 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 624 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 625 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 626 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 627 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 628 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 629 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 630 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 631 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 632 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 633 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 634 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 635 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 636 | 2937843397 | Mesorhizobium xinjiangense lm94 | Isolate | Rhizosphere |
| 637 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 638 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 639 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 640 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 641 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 642 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 643 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 644 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 645 | 8006926726 | Bradyrhizobium guangdongense SM32 | Isolate | Unclassified |
| 646 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 647 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 648 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 649 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 650 | 8016522445 | Bradyrhizobium sp. LM6.9 | Isolate | Nodule |
| 651 | 8016530956 | Bradyrhizobium sp. LM6.11 | Isolate | Nodule |
| 652 | 8016539877 | Bradyrhizobium sp. LM6.10 | Isolate | Nodule |
| 653 | 8016548790 | Bradyrhizobium sp. LM3.6 | Isolate | Nodule |
| 654 | 8016557553 | Bradyrhizobium sp. LM3.4 | Isolate | Nodule |
| 655 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 656 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 657 | 8016613128 | Bradyrhizobium sp. LB7.1 | Isolate | Nodule |
| 658 | 8016622563 | Bradyrhizobium sp. LB13.1 | Isolate | Nodule |
| 659 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
| 660 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 661 | 8019530166 | Bradyrhizobium sp. LM4.3 | Isolate | Nodule |
| 662 | 8019538911 | Bradyrhizobium sp. LB9.1b | Isolate | Nodule |
| 663 | 8019547302 | Bradyrhizobium sp. LB1.3 | Isolate | Nodule |
| 664 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 665 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 666 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 667 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 668 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 669 | 8019619141 | Bradyrhizobium sp. GM7.3 | Isolate | Nodule |
| 670 | 8019629233 | Bradyrhizobium sp. GM6.1 | Isolate | Nodule |
| 671 | 8019638758 | Bradyrhizobium sp. GM5.1 | Isolate | Nodule |
| 672 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 673 | 8019659431 | Bradyrhizobium sp. GM22.5 | Isolate | Nodule |
| 674 | 8019668869 | Bradyrhizobium sp. GM2.4 | Isolate | Nodule |
| 675 | 8019678201 | Bradyrhizobium sp. GM0.4 | Isolate | Nodule |
| 676 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 677 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 678 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 679 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
| 680 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 89.19 |
| Metatranscriptomes | 0.18 |
| Isolates | 10.63 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 12.03 |
| Nodule | 8.22 |
| Rhizoplane | 7.03 |
| Rhizosphere | 65.46 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.18 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0209179_1024849 | 3300027512 | Bacteria | 1191 |
| 2 | JGI24738J21930_10006044 | 3300002075 | Bacteria | 2866 |
| 3 | JGI25406J46586_10001492 | 3300003203 | Bacteria | 11045 |
| 4 | JGI25153J46596_10009281 | 3300003215 | Bacteria | 4597 |
| 5 | JGI25153J46596_10009680 | 3300003215 | Bacteria | 4439 |
| 6 | JGI25153J46596_10014678 | 3300003215 | Bacteria | 3241 |
| 7 | JGI25153J46596_10015191 | 3300003215 | Bacteria | 3153 |
| 8 | JGI25160J50197_1008733 | 3300003354 | Bacteria | 3836 |
| 9 | JGI25160J50197_1011756 | 3300003354 | Bacteria | 3078 |
| 10 | JGI25404J52841_10015065 | 3300003659 | Bacteria | 1679 |
| 11 | Ga0055530_10010917 | 3300003791 | Bacteria | 3305 |
| 12 | Ga0055531_10001195 | 3300003794 | Bacteria | 19919 |
| 13 | Ga0055531_10003993 | 3300003794 | Bacteria | 9150 |
| 14 | Ga0070658_10338462 | 3300005327 | Bacteria | 1287 |
| 15 | Ga0070658_10384769 | 3300005327 | Bacteria | 1204 |
| 16 | Ga0070676_10013022 | 3300005328 | Bacteria | 4557 |
| 17 | Ga0070683_100276774 | 3300005329 | Bacteria | 1597 |
| 18 | Ga0070690_100331020 | 3300005330 | Bacteria | 1100 |
| 19 | Ga0070670_100193124 | 3300005331 | Bacteria | 1769 |
| 20 | Ga0070670_100350836 | 3300005331 | Bacteria | 1296 |
| 21 | Ga0068869_100102291 | 3300005334 | Bacteria | 2168 |
| 22 | Ga0068869_100114761 | 3300005334 | Bacteria | 2053 |
| 23 | Ga0070680_100013526 | 3300005336 | Bacteria | 6357 |
| 24 | Ga0070680_100016985 | 3300005336 | Bacteria | 5730 |
| 25 | Ga0070680_100175148 | 3300005336 | Bacteria | 1806 |
| 26 | Ga0070680_100435939 | 3300005336 | Bacteria | 1119 |
| 27 | Ga0070682_100036640 | 3300005337 | Bacteria | 2999 |
| 28 | Ga0070682_100264717 | 3300005337 | Bacteria | 1246 |
| 29 | Ga0068868_100003958 | 3300005338 | Bacteria | 10340 |
| 30 | Ga0068868_100011518 | 3300005338 | Bacteria | 6441 |
| 31 | Ga0070660_100017870 | 3300005339 | Bacteria | 5173 |
| 32 | Ga0070689_100064814 | 3300005340 | Bacteria | 2845 |
| 33 | Ga0070691_10083779 | 3300005341 | Bacteria | 1565 |
| 34 | Ga0070661_100101272 | 3300005344 | Bacteria | 2143 |
| 35 | Ga0070668_100042528 | 3300005347 | Bacteria | 3483 |
| 36 | Ga0070668_100153283 | 3300005347 | Bacteria | 1865 |
| 37 | Ga0070668_100268800 | 3300005347 | Bacteria | 1420 |
| 38 | Ga0070669_100090979 | 3300005353 | Bacteria | 2288 |
| 39 | Ga0070669_100527332 | 3300005353 | Bacteria | 982 |
| 40 | Ga0070675_100187545 | 3300005354 | Bacteria | 1791 |
| 41 | Ga0070671_100011296 | 3300005355 | Bacteria | 7175 |
| 42 | Ga0070671_100015678 | 3300005355 | Bacteria | 6124 |
| 43 | Ga0070671_100086510 | 3300005355 | Bacteria | 2623 |
| 44 | Ga0070674_100026165 | 3300005356 | Bacteria | 3808 |
| 45 | Ga0070673_100425115 | 3300005364 | Bacteria | 1192 |
| 46 | Ga0070688_100006780 | 3300005365 | Bacteria | 6141 |
| 47 | Ga0070688_100028217 | 3300005365 | Bacteria | 3348 |
| 48 | Ga0070659_100050790 | 3300005366 | Bacteria | 3260 |
| 49 | Ga0070667_100028910 | 3300005367 | Bacteria | 4616 |
| 50 | Ga0070667_100087889 | 3300005367 | Bacteria | 2668 |
| 51 | Ga0070709_10005966 | 3300005434 | Bacteria | 6615 |
| 52 | Ga0070709_10007727 | 3300005434 | Bacteria | 5904 |
| 53 | Ga0070709_10015676 | 3300005434 | Bacteria | 4316 |
| 54 | Ga0070709_10154349 | 3300005434 | Bacteria | 1590 |
| 55 | Ga0070709_10611680 | 3300005434 | Bacteria | 840 |
| 56 | Ga0070714_100009892 | 3300005435 | Bacteria | 7520 |
| 57 | Ga0070714_100029375 | 3300005435 | Bacteria | 4571 |
| 58 | Ga0070714_100036016 | 3300005435 | Bacteria | 4149 |
| 59 | Ga0070714_100088688 | 3300005435 | Bacteria | 2707 |
| 60 | Ga0070714_100130627 | 3300005435 | Bacteria | 2244 |
| 61 | Ga0070713_100004379 | 3300005436 | Bacteria | 9485 |
| 62 | Ga0070713_100010400 | 3300005436 | Bacteria | 6719 |
| 63 | Ga0070713_100021269 | 3300005436 | Bacteria | 4986 |
| 64 | Ga0070713_100074356 | 3300005436 | Bacteria | 2879 |
| 65 | Ga0070713_100101791 | 3300005436 | Bacteria | 2489 |
| 66 | Ga0070713_100467968 | 3300005436 | Bacteria | 1186 |
| 67 | Ga0070710_10000344 | 3300005437 | Bacteria | 22093 |
| 68 | Ga0070710_10000395 | 3300005437 | Bacteria | 20362 |
| 69 | Ga0070710_10007756 | 3300005437 | Bacteria | 5207 |
| 70 | Ga0070710_10013495 | 3300005437 | Bacteria | 4095 |
| 71 | Ga0070701_10086418 | 3300005438 | Bacteria | 1709 |
| 72 | Ga0070711_100000702 | 3300005439 | Bacteria | 17552 |
| 73 | Ga0070711_100013855 | 3300005439 | Bacteria | 5072 |
| 74 | Ga0070711_100054002 | 3300005439 | Bacteria | 2771 |
| 75 | Ga0070711_100154357 | 3300005439 | Bacteria | 1734 |
| 76 | Ga0070711_100263486 | 3300005439 | Bacteria | 1357 |
| 77 | Ga0070663_100007150 | 3300005455 | Bacteria | 6777 |
| 78 | Ga0070663_100027479 | 3300005455 | Bacteria | 3865 |
| 79 | Ga0070663_100162013 | 3300005455 | Bacteria | 1722 |
| 80 | Ga0070663_100227965 | 3300005455 | Bacteria | 1466 |
| 81 | Ga0070678_100009881 | 3300005456 | Bacteria | 5799 |
| 82 | Ga0070678_100034185 | 3300005456 | Bacteria | 3538 |
| 83 | Ga0070678_100092332 | 3300005456 | Bacteria | 2325 |
| 84 | Ga0070662_100117538 | 3300005457 | Bacteria | 2034 |
| 85 | Ga0070662_100307659 | 3300005457 | Bacteria | 1289 |
| 86 | Ga0070662_100323031 | 3300005457 | Bacteria | 1259 |
| 87 | Ga0070681_10203620 | 3300005458 | Bacteria | 1897 |
| 88 | Ga0070681_10209729 | 3300005458 | Bacteria | 1864 |
| 89 | Ga0070681_10358218 | 3300005458 | Bacteria | 1369 |
| 90 | Ga0070685_10007975 | 3300005466 | Bacteria | 5427 |
| 91 | Ga0070685_10030623 | 3300005466 | Bacteria | 3000 |
| 92 | Ga0070685_10201983 | 3300005466 | Bacteria | 1292 |
| 93 | Ga0070679_100028788 | 3300005530 | Bacteria | 5479 |
| 94 | Ga0070679_100056398 | 3300005530 | Bacteria | 3914 |
| 95 | Ga0070679_100243480 | 3300005530 | Bacteria | 1756 |
| 96 | Ga0070684_100021896 | 3300005535 | Bacteria | 5324 |
| 97 | Ga0070684_100032076 | 3300005535 | Bacteria | 4475 |
| 98 | Ga0070684_100141149 | 3300005535 | Bacteria | 2178 |
| 99 | Ga0070684_100456791 | 3300005535 | Bacteria | 1181 |
| 100 | Ga0068853_100007032 | 3300005539 | Bacteria | 8995 |
| 101 | Ga0068853_100018974 | 3300005539 | Bacteria | 5697 |
| 102 | Ga0068853_100290030 | 3300005539 | Bacteria | 1510 |
| 103 | Ga0068853_100514028 | 3300005539 | Bacteria | 1132 |
| 104 | Ga0070672_100115669 | 3300005543 | Bacteria | 2190 |
| 105 | Ga0070672_100269487 | 3300005543 | Bacteria | 1437 |
| 106 | Ga0070672_100414845 | 3300005543 | Bacteria | 1156 |
| 107 | Ga0070672_100629406 | 3300005543 | Bacteria | 936 |
| 108 | Ga0070686_100012110 | 3300005544 | Bacteria | 4908 |
| 109 | Ga0070695_100267217 | 3300005545 | Bacteria | 1251 |
| 110 | Ga0070696_100225617 | 3300005546 | Bacteria | 1407 |
| 111 | Ga0070693_100034460 | 3300005547 | Bacteria | 2801 |
| 112 | Ga0070665_100016641 | 3300005548 | Bacteria | 7369 |
| 113 | Ga0070665_100099989 | 3300005548 | Bacteria | 2904 |
| 114 | Ga0070665_100123757 | 3300005548 | Bacteria | 2588 |
| 115 | Ga0070665_100259127 | 3300005548 | Bacteria | 1740 |
| 116 | Ga0070665_100266730 | 3300005548 | Bacteria | 1713 |
| 117 | Ga0070665_100392500 | 3300005548 | Bacteria | 1395 |
| 118 | Ga0070665_100739589 | 3300005548 | Bacteria | 997 |
| 119 | Ga0068855_100024338 | 3300005563 | Bacteria | 7247 |
| 120 | Ga0068855_100043049 | 3300005563 | Bacteria | 5350 |
| 121 | Ga0068855_100049847 | 3300005563 | Bacteria | 4936 |
| 122 | Ga0068855_100076413 | 3300005563 | Bacteria | 3887 |
| 123 | Ga0068855_100101580 | 3300005563 | Bacteria | 3310 |
| 124 | Ga0068855_100132096 | 3300005563 | Bacteria | 2850 |
| 125 | Ga0068855_100162720 | 3300005563 | Bacteria | 2531 |
| 126 | Ga0068855_100482974 | 3300005563 | Bacteria | 1348 |
| 127 | Ga0070664_100198428 | 3300005564 | Bacteria | 1790 |
| 128 | Ga0068857_100024325 | 3300005577 | Bacteria | 5331 |
| 129 | Ga0068857_100071597 | 3300005577 | Bacteria | 3088 |
| 130 | Ga0068857_100192669 | 3300005577 | Bacteria | 1857 |
| 131 | Ga0068857_100400913 | 3300005577 | Bacteria | 1276 |
| 132 | Ga0068854_100015803 | 3300005578 | Bacteria | 5012 |
| 133 | Ga0068856_100007904 | 3300005614 | Bacteria | 10390 |
| 134 | Ga0068856_100063923 | 3300005614 | Bacteria | 3636 |
| 135 | Ga0068856_100086868 | 3300005614 | Bacteria | 3108 |
| 136 | Ga0068856_100153160 | 3300005614 | Bacteria | 2315 |
| 137 | Ga0068856_100224895 | 3300005614 | Bacteria | 1892 |
| 138 | Ga0068856_100549921 | 3300005614 | Bacteria | 1175 |
| 139 | Ga0068852_100063265 | 3300005616 | Bacteria | 3222 |
| 140 | Ga0068859_100058087 | 3300005617 | Bacteria | 3896 |
| 141 | Ga0068859_100100410 | 3300005617 | Bacteria | 2949 |
| 142 | Ga0068859_100978039 | 3300005617 | Bacteria | 929 |
| 143 | Ga0068864_100050145 | 3300005618 | Bacteria | 3592 |
| 144 | Ga0068864_100058520 | 3300005618 | Bacteria | 3331 |
| 145 | Ga0068864_100186187 | 3300005618 | Bacteria | 1900 |
| 146 | Ga0068864_100426410 | 3300005618 | Bacteria | 1264 |
| 147 | Ga0068866_10111148 | 3300005718 | Bacteria | 1529 |
| 148 | Ga0068866_10175444 | 3300005718 | Bacteria | 1261 |
| 149 | Ga0068866_10186540 | 3300005718 | Bacteria | 1229 |
| 150 | Ga0068866_10304992 | 3300005718 | Bacteria | 996 |
| 151 | Ga0068861_100153715 | 3300005719 | Bacteria | 1890 |
| 152 | Ga0068861_100180027 | 3300005719 | Bacteria | 1759 |
| 153 | Ga0068861_100447729 | 3300005719 | Bacteria | 1156 |
| 154 | Ga0068851_10006063 | 3300005834 | Bacteria | 5513 |
| 155 | Ga0068863_100237338 | 3300005841 | Bacteria | 1760 |
| 156 | Ga0068863_100273758 | 3300005841 | Bacteria | 1635 |
| 157 | Ga0068858_100047295 | 3300005842 | Bacteria | 3988 |
| 158 | Ga0068858_100406507 | 3300005842 | Bacteria | 1308 |
| 159 | Ga0068858_100486121 | 3300005842 | Bacteria | 1192 |
| 160 | Ga0068860_100000497 | 3300005843 | Bacteria | 48753 |
| 161 | Ga0068860_100080702 | 3300005843 | Bacteria | 3093 |
| 162 | Ga0068860_100211082 | 3300005843 | Bacteria | 1883 |
| 163 | Ga0068860_100462526 | 3300005843 | Bacteria | 1262 |
| 164 | Ga0068862_100245860 | 3300005844 | Bacteria | 1628 |
| 165 | Ga0068862_100365685 | 3300005844 | Bacteria | 1341 |
| 166 | Ga0081455_10001069 | 3300005937 | Bacteria | 34502 |
| 167 | Ga0081455_10012384 | 3300005937 | Bacteria | 8511 |
| 168 | Ga0081455_10016028 | 3300005937 | Bacteria | 7250 |
| 169 | Ga0081455_10021328 | 3300005937 | Bacteria | 6079 |
| 170 | Ga0081455_10026882 | 3300005937 | Bacteria | 5282 |
| 171 | Ga0081455_10047175 | 3300005937 | Bacteria | 3733 |
| 172 | Ga0081455_10057286 | 3300005937 | Bacteria | 3303 |
| 173 | Ga0081538_10004388 | 3300005981 | Bacteria | 13027 |
| 174 | Ga0081538_10038370 | 3300005981 | Bacteria | 3091 |
| 175 | Ga0081538_10054726 | 3300005981 | Bacteria | 2356 |
| 176 | Ga0081540_1002393 | 3300005983 | Bacteria | 15301 |
| 177 | Ga0081540_1003961 | 3300005983 | Bacteria | 11505 |
| 178 | Ga0081540_1005402 | 3300005983 | Bacteria | 9541 |
| 179 | Ga0081540_1013623 | 3300005983 | Bacteria | 5273 |
| 180 | Ga0081540_1016233 | 3300005983 | Bacteria | 4672 |
| 181 | Ga0081540_1020841 | 3300005983 | Bacteria | 3927 |
| 182 | Ga0081540_1025112 | 3300005983 | Bacteria | 3440 |
| 183 | Ga0081540_1031237 | 3300005983 | Bacteria | 2933 |
| 184 | Ga0081540_1034946 | 3300005983 | Bacteria | 2702 |
| 185 | Ga0081540_1058821 | 3300005983 | Bacteria | 1848 |
| 186 | Ga0081540_1136757 | 3300005983 | Bacteria | 991 |
| 187 | Ga0081539_10000379 | 3300005985 | Bacteria | 97134 |
| 188 | Ga0081539_10001555 | 3300005985 | Bacteria | 38208 |
| 189 | Ga0081539_10018827 | 3300005985 | Bacteria | 4760 |
| 190 | Ga0070717_10000224 | 3300006028 | Bacteria | 39308 |
| 191 | Ga0070717_10002876 | 3300006028 | Bacteria | 12213 |
| 192 | Ga0070717_10057087 | 3300006028 | Bacteria | 3227 |
| 193 | Ga0070717_10072326 | 3300006028 | Bacteria | 2879 |
| 194 | Ga0070717_10106427 | 3300006028 | Bacteria | 2388 |
| 195 | Ga0070717_10107691 | 3300006028 | Bacteria | 2374 |
| 196 | Ga0075365_10001527 | 3300006038 | Bacteria | 10583 |
| 197 | Ga0075365_10031975 | 3300006038 | Bacteria | 3379 |
| 198 | Ga0075365_10042446 | 3300006038 | Bacteria | 2973 |
| 199 | Ga0075365_10066502 | 3300006038 | Bacteria | 2418 |
| 200 | Ga0075365_10073284 | 3300006038 | Bacteria | 2308 |
| 201 | Ga0075365_10118132 | 3300006038 | Bacteria | 1827 |
| 202 | Ga0075365_10126379 | 3300006038 | Bacteria | 1767 |
| 203 | Ga0075365_10258049 | 3300006038 | Bacteria | 1225 |
| 204 | Ga0075368_10002837 | 3300006042 | Bacteria | 5719 |
| 205 | Ga0075368_10005831 | 3300006042 | Bacteria | 4258 |
| 206 | Ga0075368_10020493 | 3300006042 | Bacteria | 2505 |
| 207 | Ga0075368_10032889 | 3300006042 | Bacteria | 2016 |
| 208 | Ga0075368_10048271 | 3300006042 | Bacteria | 1687 |
| 209 | Ga0075368_10080844 | 3300006042 | Bacteria | 1322 |
| 210 | Ga0075363_100010269 | 3300006048 | Bacteria | 4436 |
| 211 | Ga0075363_100017003 | 3300006048 | Bacteria | 3601 |
| 212 | Ga0075363_100213795 | 3300006048 | Bacteria | 1104 |
| 213 | Ga0075364_10039692 | 3300006051 | Bacteria | 3052 |
| 214 | Ga0075364_10050143 | 3300006051 | Bacteria | 2724 |
| 215 | Ga0075364_10060728 | 3300006051 | Bacteria | 2479 |
| 216 | Ga0070715_10001633 | 3300006163 | Bacteria | 6629 |
| 217 | Ga0070716_100004798 | 3300006173 | Bacteria | 6492 |
| 218 | Ga0070716_100010255 | 3300006173 | Bacteria | 4694 |
| 219 | Ga0070716_100013159 | 3300006173 | Bacteria | 4212 |
| 220 | Ga0070716_100098727 | 3300006173 | Bacteria | 1785 |
| 221 | Ga0070716_100108952 | 3300006173 | Bacteria | 1713 |
| 222 | Ga0070716_100277977 | 3300006173 | Bacteria | 1154 |
| 223 | Ga0070712_100009415 | 3300006175 | Bacteria | 6156 |
| 224 | Ga0070712_100108299 | 3300006175 | Bacteria | 2069 |
| 225 | Ga0070712_100181556 | 3300006175 | Bacteria | 1640 |
| 226 | Ga0070712_100303697 | 3300006175 | Bacteria | 1292 |
| 227 | Ga0070712_100633261 | 3300006175 | Bacteria | 908 |
| 228 | Ga0075362_10005833 | 3300006177 | Bacteria | 4542 |
| 229 | Ga0075367_10012090 | 3300006178 | Bacteria | 4590 |
| 230 | Ga0075367_10240836 | 3300006178 | Bacteria | 1134 |
| 231 | Ga0075367_10241596 | 3300006178 | Bacteria | 1132 |
| 232 | Ga0075369_10049416 | 3300006186 | Bacteria | 1817 |
| 233 | Ga0075366_10011006 | 3300006195 | Bacteria | 5093 |
| 234 | Ga0075366_10068704 | 3300006195 | Bacteria | 2108 |
| 235 | Ga0075366_10084529 | 3300006195 | Bacteria | 1897 |
| 236 | Ga0075366_10095194 | 3300006195 | Bacteria | 1785 |
| 237 | Ga0097621_100028885 | 3300006237 | Bacteria | 4375 |
| 238 | Ga0097621_100348408 | 3300006237 | Bacteria | 1317 |
| 239 | Ga0075370_10052522 | 3300006353 | Bacteria | 2312 |
| 240 | Ga0075370_10089873 | 3300006353 | Bacteria | 1771 |
| 241 | Ga0075370_10176574 | 3300006353 | Bacteria | 1256 |
| 242 | Ga0068871_100042230 | 3300006358 | Bacteria | 3660 |
| 243 | Ga0075428_100074465 | 3300006844 | Bacteria | 3709 |
| 244 | Ga0075428_100897466 | 3300006844 | Bacteria | 940 |
| 245 | Ga0075430_100024425 | 3300006846 | Bacteria | 5142 |
| 246 | Ga0075434_100007100 | 3300006871 | Bacteria | 10345 |
| 247 | Ga0075434_100330546 | 3300006871 | Unclassified | 1545 |
| 248 | Ga0075434_100460050 | 3300006871 | Bacteria | 1293 |
| 249 | Ga0075434_100613723 | 3300006871 | Bacteria | 1107 |
| 250 | Ga0068865_100367686 | 3300006881 | Bacteria | 1169 |
| 251 | Ga0075436_100081189 | 3300006914 | Bacteria | 2248 |
| 252 | Ga0075436_100345800 | 3300006914 | Bacteria | 1071 |
| 253 | Ga0097620_100058087 | 3300006931 | Bacteria | 3896 |
| 254 | Ga0097620_100100398 | 3300006931 | Bacteria | 2949 |
| 255 | Ga0097620_100977842 | 3300006931 | Bacteria | 929 |
| 256 | Ga0099824_1003889 | 3300006942 | Bacteria | 21658 |
| 257 | Ga0099822_1018677 | 3300006943 | Bacteria | 7180 |
| 258 | Ga0099823_1024679 | 3300006944 | Bacteria | 5421 |
| 259 | Ga0075435_100087656 | 3300007076 | Bacteria | 2565 |
| 260 | Ga0099794_10003317 | 3300007265 | Bacteria | 6112 |
| 261 | Ga0099794_10098671 | 3300007265 | Bacteria | 1456 |
| 262 | Ga0099795_10003094 | 3300007788 | Bacteria | 4066 |
| 263 | Ga0099795_10028013 | 3300007788 | Bacteria | 1911 |
| 264 | Ga0105244_10074608 | 3300009036 | Bacteria | 1687 |
| 265 | Ga0105240_10003456 | 3300009093 | Bacteria | 24510 |
| 266 | Ga0105240_10012909 | 3300009093 | Bacteria | 11506 |
| 267 | Ga0105240_10043532 | 3300009093 | Bacteria | 5712 |
| 268 | Ga0105240_10071555 | 3300009093 | Bacteria | 4289 |
| 269 | Ga0105240_10094483 | 3300009093 | Bacteria | 3647 |
| 270 | Ga0105240_10209403 | 3300009093 | Bacteria | 2279 |
| 271 | Ga0105240_10287268 | 3300009093 | Bacteria | 1887 |
| 272 | Ga0105240_10354146 | 3300009093 | Bacteria | 1665 |
| 273 | Ga0105240_10631035 | 3300009093 | Bacteria | 1176 |
| 274 | Ga0111539_10041513 | 3300009094 | Bacteria | 5531 |
| 275 | Ga0111539_10273642 | 3300009094 | Bacteria | 1965 |
| 276 | Ga0111539_10288746 | 3300009094 | Bacteria | 1909 |
| 277 | Ga0111539_10313558 | 3300009094 | Bacteria | 1826 |
| 278 | Ga0111539_10656131 | 3300009094 | Bacteria | 1222 |
| 279 | Ga0105245_10048518 | 3300009098 | Bacteria | 3799 |
| 280 | Ga0105245_10062478 | 3300009098 | Bacteria | 3360 |
| 281 | Ga0105245_10295203 | 3300009098 | Bacteria | 1588 |
| 282 | Ga0105245_10898606 | 3300009098 | Bacteria | 927 |
| 283 | Ga0105247_10033948 | 3300009101 | Bacteria | 3106 |
| 284 | Ga0105247_10107324 | 3300009101 | Bacteria | 1793 |
| 285 | Ga0105247_10310290 | 3300009101 | Bacteria | 1097 |
| 286 | Ga0114129_10099524 | 3300009147 | Bacteria | 4024 |
| 287 | Ga0114129_10100119 | 3300009147 | Bacteria | 4010 |
| 288 | Ga0114129_10258935 | 3300009147 | Bacteria | 2333 |
| 289 | Ga0105243_10042136 | 3300009148 | Bacteria | 3573 |
| 290 | Ga0105241_10029805 | 3300009174 | Bacteria | 4074 |
| 291 | Ga0105241_10082586 | 3300009174 | Bacteria | 2519 |
| 292 | Ga0105241_10322680 | 3300009174 | Bacteria | 1332 |
| 293 | Ga0105241_10375461 | 3300009174 | Bacteria | 1241 |
| 294 | Ga0105241_10509816 | 3300009174 | Bacteria | 1074 |
| 295 | Ga0105242_10278478 | 3300009176 | Bacteria | 1518 |
| 296 | Ga0105242_10434735 | 3300009176 | Bacteria | 1233 |
| 297 | Ga0105248_10032228 | 3300009177 | Bacteria | 5858 |
| 298 | Ga0105248_10088266 | 3300009177 | Bacteria | 3490 |
| 299 | Ga0105248_10221469 | 3300009177 | Bacteria | 2130 |
| 300 | Ga0105248_10272994 | 3300009177 | Bacteria | 1904 |
| 301 | Ga0105248_10299459 | 3300009177 | Bacteria | 1811 |
| 302 | Ga0105237_10083404 | 3300009545 | Bacteria | 3188 |
| 303 | Ga0105237_10205582 | 3300009545 | Bacteria | 1969 |
| 304 | Ga0105237_10217788 | 3300009545 | Bacteria | 1909 |
| 305 | Ga0105237_10247229 | 3300009545 | Bacteria | 1785 |
| 306 | Ga0105237_10469786 | 3300009545 | Bacteria | 1264 |
| 307 | Ga0105238_10015239 | 3300009551 | Bacteria | 7783 |
| 308 | Ga0105238_10017873 | 3300009551 | Bacteria | 7209 |
| 309 | Ga0105238_10039830 | 3300009551 | Bacteria | 4764 |
| 310 | Ga0105238_10049070 | 3300009551 | Bacteria | 4253 |
| 311 | Ga0105238_10056888 | 3300009551 | Bacteria | 3923 |
| 312 | Ga0105238_10119143 | 3300009551 | Bacteria | 2620 |
| 313 | Ga0105238_10126156 | 3300009551 | Bacteria | 2538 |
| 314 | Ga0105238_10560042 | 3300009551 | Bacteria | 1148 |
| 315 | Ga0105249_10088853 | 3300009553 | Bacteria | 2886 |
| 316 | Ga0105249_10593228 | 3300009553 | Bacteria | 1162 |
| 317 | Ga0105239_10007768 | 3300010375 | Bacteria | 12275 |
| 318 | Ga0105239_10041053 | 3300010375 | Bacteria | 5070 |
| 319 | Ga0105239_10047108 | 3300010375 | Bacteria | 4724 |
| 320 | Ga0105239_10543654 | 3300010375 | Bacteria | 1323 |
| 321 | Ga0105246_10027415 | 3300011119 | Bacteria | 3731 |
| 322 | Ga0105246_10128931 | 3300011119 | Bacteria | 1886 |
| 323 | Ga0105246_10142910 | 3300011119 | Bacteria | 1802 |
| 324 | Ga0105246_10265888 | 3300011119 | Bacteria | 1369 |
| 325 | Ga0105246_10319180 | 3300011119 | Bacteria | 1262 |
| 326 | Ga0157339_1001999 | 3300012505 | Bacteria | 1330 |
| 327 | Ga0157373_10054578 | 3300013100 | Bacteria | 2839 |
| 328 | Ga0157373_10080298 | 3300013100 | Bacteria | 2300 |
| 329 | Ga0157371_10087194 | 3300013102 | Bacteria | 2210 |
| 330 | Ga0157370_10071166 | 3300013104 | Bacteria | 3282 |
| 331 | Ga0157370_10245754 | 3300013104 | Bacteria | 1655 |
| 332 | Ga0157369_10012284 | 3300013105 | Bacteria | 9726 |
| 333 | Ga0157369_10047236 | 3300013105 | Bacteria | 4676 |
| 334 | Ga0157369_10217338 | 3300013105 | Bacteria | 2001 |
| 335 | Ga0157374_10038013 | 3300013296 | Bacteria | 4422 |
| 336 | Ga0157374_10190078 | 3300013296 | Bacteria | 2008 |
| 337 | Ga0157374_10733350 | 3300013296 | Bacteria | 1002 |
| 338 | Ga0157378_10109936 | 3300013297 | Bacteria | 2525 |
| 339 | Ga0157378_10438037 | 3300013297 | Bacteria | 1295 |
| 340 | Ga0157378_10483300 | 3300013297 | Bacteria | 1234 |
| 341 | Ga0163162_10117935 | 3300013306 | Bacteria | 2756 |
| 342 | Ga0163162_10236196 | 3300013306 | Bacteria | 1958 |
| 343 | Ga0157372_10061655 | 3300013307 | Bacteria | 4200 |
| 344 | Ga0157372_10212623 | 3300013307 | Bacteria | 2241 |
| 345 | Ga0157372_10462919 | 3300013307 | Bacteria | 1478 |
| 346 | Ga0157375_10141087 | 3300013308 | Bacteria | 2537 |
| 347 | Ga0157375_10195603 | 3300013308 | Bacteria | 2177 |
| 348 | Ga0157375_10296391 | 3300013308 | Bacteria | 1780 |
| 349 | Ga0157375_10514473 | 3300013308 | Bacteria | 1361 |
| 350 | Ga0163163_10009676 | 3300014325 | Bacteria | 8623 |
| 351 | Ga0163163_10036866 | 3300014325 | Bacteria | 4752 |
| 352 | Ga0163163_10207624 | 3300014325 | Bacteria | 2007 |
| 353 | Ga0163163_10288375 | 3300014325 | Bacteria | 1693 |
| 354 | Ga0163163_10288660 | 3300014325 | Bacteria | 1693 |
| 355 | Ga0157380_10080959 | 3300014326 | Bacteria | 2655 |
| 356 | Ga0157380_10146325 | 3300014326 | Bacteria | 2037 |
| 357 | Ga0157377_10189865 | 3300014745 | Bacteria | 1298 |
| 358 | Ga0157377_10231667 | 3300014745 | Bacteria | 1188 |
| 359 | Ga0157377_10270908 | 3300014745 | Bacteria | 1109 |
| 360 | Ga0157379_10173043 | 3300014968 | Bacteria | 1949 |
| 361 | Ga0157379_10249068 | 3300014968 | Bacteria | 1612 |
| 362 | Ga0157379_10351511 | 3300014968 | Bacteria | 1349 |
| 363 | Ga0157376_10059767 | 3300014969 | Bacteria | 3197 |
| 364 | Ga0157376_10104151 | 3300014969 | Bacteria | 2486 |
| 365 | Ga0157376_10116336 | 3300014969 | Bacteria | 2362 |
| 366 | Ga0157376_10175130 | 3300014969 | Bacteria | 1956 |
| 367 | Ga0163161_10113354 | 3300017792 | Bacteria | 2029 |
| 368 | Ga0163161_10222549 | 3300017792 | Bacteria | 1462 |
| 369 | Ga0163161_10239596 | 3300017792 | Bacteria | 1410 |
| 370 | Ga0197907_11209949 | 3300020069 | Bacteria | 1419 |
| 371 | Ga0206354_10920056 | 3300020081 | Bacteria | 920 |
| 372 | Ga0206353_10108935 | 3300020082 | Bacteria | 874 |
| 373 | Ga0209563_104891 | 3300025230 | Bacteria | 2501 |
| 374 | Ga0209233_1002215 | 3300025261 | Bacteria | 7293 |
| 375 | Ga0209676_1000327 | 3300025292 | Bacteria | 91596 |
| 376 | Ga0209564_1001796 | 3300025295 | Bacteria | 19822 |
| 377 | Ga0209564_1003203 | 3300025295 | Bacteria | 11497 |
| 378 | Ga0209564_1047021 | 3300025295 | Bacteria | 1092 |
| 379 | Ga0209758_1000371 | 3300025297 | Bacteria | 78923 |
| 380 | Ga0209758_1001291 | 3300025297 | Bacteria | 30796 |
| 381 | Ga0209758_1001559 | 3300025297 | Bacteria | 26277 |
| 382 | Ga0209758_1003458 | 3300025297 | Bacteria | 14328 |
| 383 | Ga0209758_1011126 | 3300025297 | Bacteria | 5256 |
| 384 | Ga0209758_1014744 | 3300025297 | Bacteria | 4124 |
| 385 | Ga0209758_1085607 | 3300025297 | Bacteria | 938 |
| 386 | Ga0209050_1001093 | 3300025298 | Bacteria | 32922 |
| 387 | Ga0207426_1000352 | 3300025302 | Bacteria | 84141 |
| 388 | Ga0207426_1005546 | 3300025302 | Bacteria | 5737 |
| 389 | Ga0209257_1000609 | 3300025304 | Bacteria | 58413 |
| 390 | Ga0207697_10014505 | 3300025315 | Bacteria | 3268 |
| 391 | Ga0207697_10070251 | 3300025315 | Bacteria | 1466 |
| 392 | Ga0207656_10007348 | 3300025321 | Bacteria | 4007 |
| 393 | Ga0207682_10003960 | 3300025893 | Bacteria | 6310 |
| 394 | Ga0207692_10000724 | 3300025898 | Bacteria | 11629 |
| 395 | Ga0207692_10010688 | 3300025898 | Bacteria | 3879 |
| 396 | Ga0207692_10253297 | 3300025898 | Bacteria | 1056 |
| 397 | Ga0207642_10149832 | 3300025899 | Bacteria | 1240 |
| 398 | Ga0207710_10005547 | 3300025900 | Bacteria | 5429 |
| 399 | Ga0207710_10216016 | 3300025900 | Bacteria | 951 |
| 400 | Ga0207710_10235481 | 3300025900 | Bacteria | 912 |
| 401 | Ga0207688_10033354 | 3300025901 | Bacteria | 2847 |
| 402 | Ga0207688_10054478 | 3300025901 | Bacteria | 2244 |
| 403 | Ga0207688_10062052 | 3300025901 | Bacteria | 2107 |
| 404 | Ga0207688_10077716 | 3300025901 | Bacteria | 1892 |
| 405 | Ga0207680_10052069 | 3300025903 | Bacteria | 2451 |
| 406 | Ga0207680_10124672 | 3300025903 | Bacteria | 1689 |
| 407 | Ga0207647_10004508 | 3300025904 | Bacteria | 10321 |
| 408 | Ga0207647_10015943 | 3300025904 | Bacteria | 5137 |
| 409 | Ga0207647_10166333 | 3300025904 | Bacteria | 1285 |
| 410 | Ga0207685_10000490 | 3300025905 | Bacteria | 6723 |
| 411 | Ga0207685_10046559 | 3300025905 | Bacteria | 1651 |
| 412 | Ga0207699_10001497 | 3300025906 | Bacteria | 11087 |
| 413 | Ga0207699_10002390 | 3300025906 | Bacteria | 8860 |
| 414 | Ga0207699_10021380 | 3300025906 | Bacteria | 3486 |
| 415 | Ga0207699_10094410 | 3300025906 | Bacteria | 1884 |
| 416 | Ga0207643_10040058 | 3300025908 | Bacteria | 2637 |
| 417 | Ga0207705_10100992 | 3300025909 | Bacteria | 2122 |
| 418 | Ga0207705_10243255 | 3300025909 | Bacteria | 1371 |
| 419 | Ga0207705_10352742 | 3300025909 | Bacteria | 1134 |
| 420 | Ga0207684_10545295 | 3300025910 | Bacteria | 992 |
| 421 | Ga0207654_10000344 | 3300025911 | Bacteria | 27758 |
| 422 | Ga0207654_10034166 | 3300025911 | Bacteria | 2824 |
| 423 | Ga0207654_10080204 | 3300025911 | Bacteria | 1962 |
| 424 | Ga0207654_10200746 | 3300025911 | Bacteria | 1313 |
| 425 | Ga0207707_10038828 | 3300025912 | Bacteria | 4161 |
| 426 | Ga0207707_10103434 | 3300025912 | Bacteria | 2489 |
| 427 | Ga0207707_10132454 | 3300025912 | Bacteria | 2180 |
| 428 | Ga0207707_10387875 | 3300025912 | Bacteria | 1200 |
| 429 | Ga0207695_10000015 | 3300025913 | Bacteria | 803205 |
| 430 | Ga0207695_10000402 | 3300025913 | Bacteria | 96771 |
| 431 | Ga0207695_10026603 | 3300025913 | Bacteria | 6456 |
| 432 | Ga0207695_10037699 | 3300025913 | Bacteria | 5214 |
| 433 | Ga0207695_10089621 | 3300025913 | Bacteria | 3093 |
| 434 | Ga0207695_10148509 | 3300025913 | Bacteria | 2285 |
| 435 | Ga0207671_10001316 | 3300025914 | Bacteria | 29070 |
| 436 | Ga0207671_10053672 | 3300025914 | Bacteria | 2986 |
| 437 | Ga0207693_10003086 | 3300025915 | Bacteria | 14356 |
| 438 | Ga0207693_10018422 | 3300025915 | Bacteria | 5562 |
| 439 | Ga0207693_10020465 | 3300025915 | Bacteria | 5262 |
| 440 | Ga0207693_10035146 | 3300025915 | Bacteria | 3951 |
| 441 | Ga0207693_10051463 | 3300025915 | Bacteria | 3232 |
| 442 | Ga0207693_10346168 | 3300025915 | Bacteria | 1163 |
| 443 | Ga0207663_10001974 | 3300025916 | Bacteria | 9722 |
| 444 | Ga0207663_10005570 | 3300025916 | Bacteria | 6356 |
| 445 | Ga0207663_10025028 | 3300025916 | Bacteria | 3444 |
| 446 | Ga0207663_10057238 | 3300025916 | Bacteria | 2455 |
| 447 | Ga0207663_10082371 | 3300025916 | Bacteria | 2110 |
| 448 | Ga0207660_10002465 | 3300025917 | Bacteria | 12153 |
| 449 | Ga0207660_10022470 | 3300025917 | Bacteria | 4250 |
| 450 | Ga0207657_10019503 | 3300025919 | Bacteria | 6437 |
| 451 | Ga0207657_10027909 | 3300025919 | Bacteria | 5161 |
| 452 | Ga0207657_10066342 | 3300025919 | Bacteria | 3072 |
| 453 | Ga0207657_10258441 | 3300025919 | Bacteria | 1386 |
| 454 | Ga0207652_10002286 | 3300025921 | Bacteria | 16255 |
| 455 | Ga0207652_10175524 | 3300025921 | Bacteria | 1924 |
| 456 | Ga0207652_10533685 | 3300025921 | Bacteria | 1055 |
| 457 | Ga0207681_10273578 | 3300025923 | Bacteria | 1327 |
| 458 | Ga0207694_10000095 | 3300025924 | Bacteria | 99130 |
| 459 | Ga0207694_10028380 | 3300025924 | Bacteria | 4266 |
| 460 | Ga0207694_10040730 | 3300025924 | Bacteria | 3578 |
| 461 | Ga0207694_10054256 | 3300025924 | Bacteria | 3109 |
| 462 | Ga0207650_10054104 | 3300025925 | Bacteria | 2976 |
| 463 | Ga0207650_10227353 | 3300025925 | Bacteria | 1504 |
| 464 | Ga0207659_10152389 | 3300025926 | Bacteria | 1806 |
| 465 | Ga0207687_10008392 | 3300025927 | Bacteria | 6758 |
| 466 | Ga0207687_10077091 | 3300025927 | Bacteria | 2396 |
| 467 | Ga0207687_10298241 | 3300025927 | Bacteria | 1297 |
| 468 | Ga0207687_10316001 | 3300025927 | Bacteria | 1263 |
| 469 | Ga0207687_10411048 | 3300025927 | Bacteria | 1115 |
| 470 | Ga0207700_10004634 | 3300025928 | Bacteria | 8144 |
| 471 | Ga0207700_10012786 | 3300025928 | Bacteria | 5428 |
| 472 | Ga0207700_10017235 | 3300025928 | Bacteria | 4820 |
| 473 | Ga0207700_10060010 | 3300025928 | Bacteria | 2879 |
| 474 | Ga0207700_10071819 | 3300025928 | Bacteria | 2666 |
| 475 | Ga0207700_10074945 | 3300025928 | Bacteria | 2620 |
| 476 | Ga0207700_10092425 | 3300025928 | Bacteria | 2392 |
| 477 | Ga0207700_10392555 | 3300025928 | Bacteria | 1215 |
| 478 | Ga0207664_10005861 | 3300025929 | Bacteria | 8404 |
| 479 | Ga0207664_10055230 | 3300025929 | Bacteria | 3151 |
| 480 | Ga0207664_10060623 | 3300025929 | Bacteria | 3016 |
| 481 | Ga0207664_10081041 | 3300025929 | Bacteria | 2640 |
| 482 | Ga0207644_10010381 | 3300025931 | Bacteria | 6138 |
| 483 | Ga0207644_10024814 | 3300025931 | Bacteria | 4118 |
| 484 | Ga0207644_10284045 | 3300025931 | Bacteria | 1329 |
| 485 | Ga0207644_10455504 | 3300025931 | Bacteria | 1051 |
| 486 | Ga0207690_10080890 | 3300025932 | Bacteria | 2268 |
| 487 | Ga0207690_10173761 | 3300025932 | Bacteria | 1616 |
| 488 | Ga0207706_10012740 | 3300025933 | Bacteria | 7654 |
| 489 | Ga0207706_10212076 | 3300025933 | Bacteria | 1697 |
| 490 | Ga0207686_10012373 | 3300025934 | Bacteria | 4692 |
| 491 | Ga0207686_10046906 | 3300025934 | Bacteria | 2668 |
| 492 | Ga0207709_10052202 | 3300025935 | Bacteria | 2510 |
| 493 | Ga0207670_10030422 | 3300025936 | Bacteria | 3450 |
| 494 | Ga0207670_10317589 | 3300025936 | Bacteria | 1225 |
| 495 | Ga0207670_10328262 | 3300025936 | Bacteria | 1205 |
| 496 | Ga0207669_10033925 | 3300025937 | Bacteria | 2886 |
| 497 | Ga0207669_10115076 | 3300025937 | Bacteria | 1812 |
| 498 | Ga0207669_10351262 | 3300025937 | Bacteria | 1139 |
| 499 | Ga0207704_10005807 | 3300025938 | Bacteria | 5708 |
| 500 | Ga0207704_10050895 | 3300025938 | Bacteria | 2501 |
| 501 | Ga0207704_10124949 | 3300025938 | Bacteria | 1769 |
| 502 | Ga0207704_10673730 | 3300025938 | Bacteria | 854 |
| 503 | Ga0207665_10000455 | 3300025939 | Bacteria | 28194 |
| 504 | Ga0207665_10003636 | 3300025939 | Bacteria | 10301 |
| 505 | Ga0207665_10011323 | 3300025939 | Bacteria | 5856 |
| 506 | Ga0207665_10088607 | 3300025939 | Bacteria | 2141 |
| 507 | Ga0207665_10292275 | 3300025939 | Bacteria | 1216 |
| 508 | Ga0207691_10069954 | 3300025940 | Bacteria | 3169 |
| 509 | Ga0207691_10131391 | 3300025940 | Bacteria | 2212 |
| 510 | Ga0207711_10022195 | 3300025941 | Bacteria | 5307 |
| 511 | Ga0207711_10095450 | 3300025941 | Bacteria | 2623 |
| 512 | Ga0207689_10021472 | 3300025942 | Bacteria | 5427 |
| 513 | Ga0207689_10030547 | 3300025942 | Bacteria | 4490 |
| 514 | Ga0207661_10000227 | 3300025944 | Bacteria | 36896 |
| 515 | Ga0207661_10043715 | 3300025944 | Bacteria | 3537 |
| 516 | Ga0207661_10353844 | 3300025944 | Bacteria | 1325 |
| 517 | Ga0207679_10140943 | 3300025945 | Bacteria | 1948 |
| 518 | Ga0207679_10318224 | 3300025945 | Bacteria | 1346 |
| 519 | Ga0207667_10037625 | 3300025949 | Bacteria | 5172 |
| 520 | Ga0207667_10042452 | 3300025949 | Bacteria | 4833 |
| 521 | Ga0207667_10069488 | 3300025949 | Bacteria | 3665 |
| 522 | Ga0207667_10129097 | 3300025949 | Bacteria | 2603 |
| 523 | Ga0207667_10258659 | 3300025949 | Bacteria | 1780 |
| 524 | Ga0207667_10318937 | 3300025949 | Bacteria | 1587 |
| 525 | Ga0207667_10400518 | 3300025949 | Bacteria | 1397 |
| 526 | Ga0207651_10139634 | 3300025960 | Bacteria | 1869 |
| 527 | Ga0207651_10155253 | 3300025960 | Bacteria | 1787 |
| 528 | Ga0207651_10181556 | 3300025960 | Bacteria | 1670 |
| 529 | Ga0207651_10224091 | 3300025960 | Bacteria | 1522 |
| 530 | Ga0207712_10178151 | 3300025961 | Bacteria | 1667 |
| 531 | Ga0207712_10203294 | 3300025961 | Bacteria | 1572 |
| 532 | Ga0207668_10018976 | 3300025972 | Bacteria | 4336 |
| 533 | Ga0207668_10050682 | 3300025972 | Bacteria | 2862 |
| 534 | Ga0207668_10173452 | 3300025972 | Bacteria | 1693 |
| 535 | Ga0207668_10252375 | 3300025972 | Bacteria | 1433 |
| 536 | Ga0207640_10018371 | 3300025981 | Bacteria | 4109 |
| 537 | Ga0207640_10143765 | 3300025981 | Bacteria | 1742 |
| 538 | Ga0207658_10015698 | 3300025986 | Bacteria | 5199 |
| 539 | Ga0207658_10018042 | 3300025986 | Bacteria | 4867 |
| 540 | Ga0207658_10164950 | 3300025986 | Bacteria | 1819 |
| 541 | Ga0207658_10315632 | 3300025986 | Bacteria | 1351 |
| 542 | Ga0207658_10437314 | 3300025986 | Bacteria | 1156 |
| 543 | Ga0207677_10009719 | 3300026023 | Bacteria | 5417 |
| 544 | Ga0207677_10385440 | 3300026023 | Bacteria | 1184 |
| 545 | Ga0207703_10228165 | 3300026035 | Bacteria | 1668 |
| 546 | Ga0207703_10575241 | 3300026035 | Bacteria | 1064 |
| 547 | Ga0207639_10049151 | 3300026041 | Bacteria | 3196 |
| 548 | Ga0207639_10088929 | 3300026041 | Bacteria | 2466 |
| 549 | Ga0207639_10276048 | 3300026041 | Bacteria | 1476 |
| 550 | Ga0207639_10290452 | 3300026041 | Bacteria | 1441 |
| 551 | Ga0207639_10647564 | 3300026041 | Bacteria | 977 |
| 552 | Ga0207678_10016707 | 3300026067 | Bacteria | 6446 |
| 553 | Ga0207678_10018224 | 3300026067 | Bacteria | 6166 |
| 554 | Ga0207678_10144884 | 3300026067 | Bacteria | 2028 |
| 555 | Ga0207678_10152456 | 3300026067 | Bacteria | 1974 |
| 556 | Ga0207678_10165636 | 3300026067 | Bacteria | 1887 |
| 557 | Ga0207678_10231459 | 3300026067 | Bacteria | 1582 |
| 558 | Ga0207678_10243570 | 3300026067 | Bacteria | 1540 |
| 559 | Ga0207678_10255834 | 3300026067 | Bacteria | 1500 |
| 560 | Ga0207678_10285683 | 3300026067 | Bacteria | 1416 |
| 561 | Ga0207678_10515968 | 3300026067 | Bacteria | 1043 |
| 562 | Ga0207708_10347917 | 3300026075 | Bacteria | 1215 |
| 563 | Ga0207702_10000025 | 3300026078 | Bacteria | 186312 |
| 564 | Ga0207702_10000075 | 3300026078 | Bacteria | 112303 |
| 565 | Ga0207702_10008399 | 3300026078 | Bacteria | 8713 |
| 566 | Ga0207702_10139135 | 3300026078 | Bacteria | 2194 |
| 567 | Ga0207702_10151415 | 3300026078 | Bacteria | 2110 |
| 568 | Ga0207702_10159644 | 3300026078 | Bacteria | 2058 |
| 569 | Ga0207702_10197843 | 3300026078 | Bacteria | 1861 |
| 570 | Ga0207702_10614955 | 3300026078 | Bacteria | 1067 |
| 571 | Ga0207641_10069289 | 3300026088 | Bacteria | 3027 |
| 572 | Ga0207641_10246807 | 3300026088 | Bacteria | 1666 |
| 573 | Ga0207641_10315497 | 3300026088 | Bacteria | 1481 |
| 574 | Ga0207641_10493922 | 3300026088 | Bacteria | 1188 |
| 575 | Ga0207676_10008170 | 3300026095 | Bacteria | 7443 |
| 576 | Ga0207676_10071536 | 3300026095 | Bacteria | 2785 |
| 577 | Ga0207676_10277560 | 3300026095 | Bacteria | 1520 |
| 578 | Ga0207674_10022795 | 3300026116 | Bacteria | 6719 |
| 579 | Ga0207674_10063245 | 3300026116 | Bacteria | 3735 |
| 580 | Ga0207674_10078135 | 3300026116 | Bacteria | 3315 |
| 581 | Ga0207674_10128285 | 3300026116 | Bacteria | 2501 |
| 582 | Ga0207674_10176530 | 3300026116 | Bacteria | 2088 |
| 583 | Ga0207674_10379881 | 3300026116 | Bacteria | 1366 |
| 584 | Ga0207674_10510214 | 3300026116 | Bacteria | 1162 |
| 585 | Ga0207675_100023527 | 3300026118 | Bacteria | 5731 |
| 586 | Ga0207675_100148916 | 3300026118 | Bacteria | 2227 |
| 587 | Ga0207675_100151263 | 3300026118 | Bacteria | 2209 |
| 588 | Ga0207675_100240797 | 3300026118 | Bacteria | 1748 |
| 589 | Ga0207683_10013509 | 3300026121 | Bacteria | 6968 |
| 590 | Ga0207683_10020817 | 3300026121 | Bacteria | 5611 |
| 591 | Ga0207683_10033981 | 3300026121 | Bacteria | 4430 |
| 592 | Ga0207683_10034301 | 3300026121 | Bacteria | 4410 |
| 593 | Ga0207683_10073168 | 3300026121 | Bacteria | 3031 |
| 594 | Ga0207683_10079700 | 3300026121 | Bacteria | 2904 |
| 595 | Ga0207683_10204096 | 3300026121 | Bacteria | 1797 |
| 596 | Ga0207683_10690267 | 3300026121 | Bacteria | 946 |
| 597 | Ga0207698_10011948 | 3300026142 | Bacteria | 5656 |
| 598 | Ga0207698_10241062 | 3300026142 | Bacteria | 1648 |
| 599 | Ga0207698_10592153 | 3300026142 | Bacteria | 1092 |
| 600 | Ga0207698_10916301 | 3300026142 | Bacteria | 884 |
| 601 | Ga0209389_1000132 | 3300027296 | Bacteria | 66230 |
| 602 | Ga0209589_1000003 | 3300027357 | Bacteria | 629130 |
| 603 | Ga0209489_100003 | 3300027361 | Bacteria | 663105 |
| 604 | Ga0209489_103912 | 3300027361 | Bacteria | 28301 |
| 605 | Ga0209700_100003 | 3300027363 | Bacteria | 663105 |
| 606 | Ga0209700_100281 | 3300027363 | Bacteria | 90519 |
| 607 | Ga0209588_1004688 | 3300027671 | Bacteria | 3876 |
| 608 | Ga0209813_10004019 | 3300027866 | Bacteria | 3485 |
| 609 | Ga0209813_10042829 | 3300027866 | Bacteria | 1385 |
| 610 | Ga0209813_10097669 | 3300027866 | Bacteria | 995 |
| 611 | Ga0207428_10149772 | 3300027907 | Bacteria | 1776 |
| 612 | Ga0268266_10002093 | 3300028379 | Bacteria | 22080 |
| 613 | Ga0268266_10003481 | 3300028379 | Bacteria | 15689 |
| 614 | Ga0268266_10004788 | 3300028379 | Bacteria | 12854 |
| 615 | Ga0268266_10010224 | 3300028379 | Bacteria | 8219 |
| 616 | Ga0268266_10016552 | 3300028379 | Bacteria | 6303 |
| 617 | Ga0268266_10071199 | 3300028379 | Bacteria | 3013 |
| 618 | Ga0268266_10481587 | 3300028379 | Bacteria | 1183 |
| 619 | Ga0268265_10060380 | 3300028380 | Bacteria | 2905 |
| 620 | Ga0268265_10098647 | 3300028380 | Bacteria | 2353 |
| 621 | Ga0268265_10451672 | 3300028380 | Bacteria | 1200 |
| 622 | Ga0268265_10547078 | 3300028380 | Bacteria | 1098 |
| 623 | Ga0268264_10000022 | 3300028381 | Bacteria | 476624 |
| 624 | Ga0268264_10149643 | 3300028381 | Bacteria | 2091 |
| 625 | Ga0265334_10035881 | 3300028573 | Bacteria | 1960 |
| 626 | Ga0307517_10000111 | 3300028786 | Bacteria | 120304 |
| 627 | Ga0307515_10198993 | 3300028794 | Bacteria | 1886 |
| 628 | Ga0307511_10028875 | 3300030521 | Bacteria | 5022 |
| 629 | Ga0265330_10015875 | 3300031235 | Bacteria | 3479 |
| 630 | Ga0265330_10028009 | 3300031235 | Bacteria | 2542 |
| 631 | Ga0265332_10005648 | 3300031238 | Bacteria | 5750 |
| 632 | Ga0265332_10061076 | 3300031238 | Bacteria | 1611 |
| 633 | Ga0265325_10000006 | 3300031241 | Bacteria | 255758 |
| 634 | Ga0265325_10005078 | 3300031241 | Bacteria | 8189 |
| 635 | Ga0265340_10001029 | 3300031247 | Bacteria | 15913 |
| 636 | Ga0265316_10069202 | 3300031344 | Bacteria | 2724 |
| 637 | Ga0265316_10397008 | 3300031344 | Bacteria | 994 |
| 638 | Ga0265316_10428241 | 3300031344 | Bacteria | 951 |
| 639 | Ga0307509_10083821 | 3300031507 | Bacteria | 3285 |
| 640 | Ga0307509_10204439 | 3300031507 | Bacteria | 1807 |
| 641 | Ga0307509_10235360 | 3300031507 | Bacteria | 1630 |
| 642 | Ga0265313_10004211 | 3300031595 | Bacteria | 11152 |
| 643 | Ga0265313_10038758 | 3300031595 | Bacteria | 2370 |
| 644 | Ga0307508_10000001 | 3300031616 | Bacteria | 553635 |
| 645 | Ga0265314_10007699 | 3300031711 | Bacteria | 9314 |
| 646 | Ga0265314_10053368 | 3300031711 | Bacteria | 2804 |
| 647 | Ga0265342_10062563 | 3300031712 | Bacteria | 2190 |
| 648 | Ga0265342_10143952 | 3300031712 | Bacteria | 1328 |
| 649 | Ga0307516_10080872 | 3300031730 | Bacteria | 3093 |
| 650 | Ga0307412_10192022 | 3300031911 | Bacteria | 1545 |
| 651 | Ga0307409_100031793 | 3300031995 | Bacteria | 3815 |
| 652 | Ga0307411_10162698 | 3300032005 | Bacteria | 1674 |
| 653 | Ga0307415_100088179 | 3300032126 | Bacteria | 2238 |
| 654 | Ga0307415_100106386 | 3300032126 | Bacteria | 2071 |
| 655 | Ga0307415_100301385 | 3300032126 | Bacteria | 1328 |
| 656 | Ga0307510_10001748 | 3300033180 | Bacteria | 24223 |
| 657 | Ga0307510_10214854 | 3300033180 | Bacteria | 1441 |
| 658 | Ga0315911_1000001 | 3300033442 | Bacteria | 1088602 |
| 659 | Ga0373930_0009477 | 3300034816 | Bacteria | 1723 |
| 660 | Ga0373958_0050421 | 3300034819 | Bacteria | 878 |
| 661 | Ga0373959_0004888 | 3300034820 | Bacteria | 2181 |
| 662 | Ga0373938_0014855 | 3300034957 | Bacteria | 1500 |
| 663 | Ga0373929_0004081 | 3300035085 | Bacteria | 2617 |
| 664 | Ga0373934_0002524 | 3300035086 | Bacteria | 6733 |
| 665 | Ga0373934_0043127 | 3300035086 | Bacteria | 1783 |
| 666 | Ga0373934_0047487 | 3300035086 | Bacteria | 1698 |
| 667 | Ga0373940_0005371 | 3300035088 | Bacteria | 2772 |
| 668 | Ga0373952_0000703 | 3300035092 | Bacteria | 5962 |
| 669 | Ga0373932_0004218 | 3300035112 | Bacteria | 3414 |
| 670 | Ga0373936_0005474 | 3300035113 | Bacteria | 4790 |
| 671 | Ga0373936_0036940 | 3300035113 | Bacteria | 1949 |
| 672 | Ga0373936_0054933 | 3300035113 | Bacteria | 1616 |
| 673 | Ga0373941_0009331 | 3300035115 | Bacteria | 2468 |
| 674 | Ga0373941_0032545 | 3300035115 | Bacteria | 1561 |
| 675 | Ga0373945_0012567 | 3300035116 | Bacteria | 2814 |
| 676 | Ga0373945_0024502 | 3300035116 | Bacteria | 2091 |
| 677 | Ga0373945_0103450 | 3300035116 | Bacteria | 1117 |
| 678 | Ga0373953_0006545 | 3300035117 | Bacteria | 3845 |
| 679 | Ga0373953_0130758 | 3300035117 | Bacteria | 1070 |
| 680 | Ga0373954_0001369 | 3300035118 | Bacteria | 9839 |
| 681 | Ga0373956_0028711 | 3300035119 | Bacteria | 2422 |
| 682 | Ga0373956_0079479 | 3300035119 | Bacteria | 1503 |
| 683 | Ga0373957_0040888 | 3300035120 | Bacteria | 1744 |
| 684 | Ga0373960_0009007 | 3300035121 | Bacteria | 2408 |
| 685 | Ga0373943_0007816 | 3300035170 | Bacteria | 4803 |
| 686 | Ga0373943_0023765 | 3300035170 | Bacteria | 2852 |
| 687 | Ga0373943_0026965 | 3300035170 | Bacteria | 2695 |
| 688 | Ga0373943_0039720 | 3300035170 | Bacteria | 2269 |
| 689 | Ga0373946_0014662 | 3300035171 | Bacteria | 2958 |
| 690 | Ga0373946_0038028 | 3300035171 | Bacteria | 1958 |
| 691 | Ga0373955_0001864 | 3300035172 | Bacteria | 9068 |
| 692 | Ga0373955_0027869 | 3300035172 | Bacteria | 2924 |
| 693 | Ga0373955_0048107 | 3300035172 | Bacteria | 2311 |
| 694 | Ga0373961_0012551 | 3300035241 | Bacteria | 2123 |
| 695 | Ga0373962_0005970 | 3300035242 | Bacteria | 2939 |
| 696 | Ga0373924_0004443 | 3300035410 | Bacteria | 4896 |
| 697 | Ga0373924_0031770 | 3300035410 | Bacteria | 2125 |
| 698 | Ga0373931_0003730 | 3300035691 | Bacteria | 6894 |
| 699 | Ga0373931_0013950 | 3300035691 | Bacteria | 3920 |
| 700 | Ga0373931_0014396 | 3300035691 | Bacteria | 3865 |
| 701 | Ga0373935_0000110 | 3300035692 | Bacteria | 37393 |
| 702 | Ga0373935_0028868 | 3300035692 | Bacteria | 3429 |
| 703 | Ga0373935_0041167 | 3300035692 | Bacteria | 2901 |
| 704 | Ga0373935_0203993 | 3300035692 | Bacteria | 1367 |
| 705 | Ga0373927_0002008 | 3300035695 | Bacteria | 14993 |
| 706 | Ga0373927_0005256 | 3300035695 | Bacteria | 8954 |
| 707 | Ga0373927_0038834 | 3300035695 | Bacteria | 3090 |
| 708 | Ga0373933_0000117 | 3300035724 | Bacteria | 51348 |
| 709 | Ga0373933_0000863 | 3300035724 | Bacteria | 18584 |
| 710 | Ga0373933_0033912 | 3300035724 | Bacteria | 2972 |
| 711 | Ga0373933_0056752 | 3300035724 | Bacteria | 2351 |
| 712 | Ga0373933_0154366 | 3300035724 | Bacteria | 1455 |
| 713 | Ga0373933_0205792 | 3300035724 | Bacteria | 1260 |
| 714 | Ga0373947_0001449 | 3300035725 | Bacteria | 14598 |
| 715 | Ga0373947_0012614 | 3300035725 | Bacteria | 4847 |
| 716 | Ga0373947_0096855 | 3300035725 | Bacteria | 1848 |
| 717 | Ga0373947_0203348 | 3300035725 | Bacteria | 1297 |
| 718 | Ga0373947_0277508 | 3300035725 | Bacteria | 1113 |
| 719 | Ga0373937_0007186 | 3300036401 | Bacteria | 9632 |
| 720 | Ga0373937_0031239 | 3300036401 | Bacteria | 4824 |
| 721 | Ga0373937_0080469 | 3300036401 | Bacteria | 3013 |
| 722 | Ga0373937_0208724 | 3300036401 | Bacteria | 1837 |
| 723 | Ga0373937_0373974 | 3300036401 | Bacteria | 1351 |
| 724 | Ga0373925_0000748 | 3300037068 | Bacteria | 29849 |
| 725 | Ga0373925_0004770 | 3300037068 | Bacteria | 10213 |
| 726 | Ga0373925_0021180 | 3300037068 | Bacteria | 4737 |
| 727 | Ga0373925_0082755 | 3300037068 | Bacteria | 2443 |
| 728 | Ga0373925_0087242 | 3300037068 | Bacteria | 2381 |
| 729 | Ga0373925_0148842 | 3300037068 | Bacteria | 1837 |
| 730 | Ga0373925_0289015 | 3300037068 | Bacteria | 1322 |
| 731 | Ga0373925_0567824 | 3300037068 | Bacteria | 933 |
| 732 | Ga0395900_0001759 | 3300037418 | Bacteria | 24863 |
| 733 | Ga0395900_0005207 | 3300037418 | Bacteria | 13642 |
| 734 | Ga0395898_0001625 | 3300037466 | Bacteria | 30490 |
| 735 | Ga0395898_0055146 | 3300037466 | Bacteria | 3877 |
| 736 | Ga0395898_0063202 | 3300037466 | Bacteria | 3593 |
| 737 | Ga0395898_0122535 | 3300037466 | Bacteria | 2491 |
| 738 | Ga0395898_0395500 | 3300037466 | Bacteria | 1318 |
| 739 | Ga0395905_0002799 | 3300037471 | Bacteria | 19109 |
| 740 | Ga0395905_0174543 | 3300037471 | Bacteria | 2018 |
| 741 | Ga0395905_0499771 | 3300037471 | Bacteria | 1116 |
| 742 | Ga0436364_0539583 | 3300037853 | Bacteria | 4923 |
| 743 | Ga0395901_0043346 | 3300038443 | Bacteria | 4668 |
| 744 | Ga0395901_0102918 | 3300038443 | Bacteria | 2996 |
| 745 | Ga0395901_0410686 | 3300038443 | Bacteria | 1390 |
| 746 | Ga0400483_060836 | 3300039062 | Bacteria | 1154 |
| 747 | Ga0436365_0257418 | 3300039437 | Bacteria | 2138 |
| 748 | Ga0436365_1023002 | 3300039437 | Bacteria | 2389 |
| 749 | Ga0436360_0096391 | 3300039438 | Bacteria | 2568 |
| 750 | Ga0436361_0480907 | 3300039447 | Bacteria | 7901 |
| 751 | Ga0436361_0862295 | 3300039447 | Bacteria | 1175 |
| 752 | Ga0436363_0062258 | 3300039450 | Bacteria | 1042 |
| 753 | Ga0436363_1628114 | 3300039450 | Bacteria | 2395 |
| 754 | Ga0439453_0006931 | 3300041408 | Bacteria | 1780 |
| 755 | Ga0439435_0001490 | 3300042436 | Bacteria | 4353 |
| 756 | Ga0466969_0163530 | 3300044656 | Bacteria | 1022 |
| 757 | Ga0466972_0000125 | 3300044658 | Bacteria | 65105 |
| 758 | Ga0466965_0313425 | 3300044683 | Bacteria | 853 |
| 759 | Ga0466966_0161906 | 3300044684 | Bacteria | 1362 |
| 760 | Ga0466966_0168686 | 3300044684 | Bacteria | 1331 |
| 761 | Ga0466966_0214125 | 3300044684 | Bacteria | 1164 |
| 762 | Ga0466961_0023660 | 3300044693 | Bacteria | 3953 |
| 763 | Ga0466961_0099657 | 3300044693 | Bacteria | 1831 |
| 764 | Ga0466963_0016505 | 3300044694 | Bacteria | 4592 |
| 765 | Ga0466963_0105572 | 3300044694 | Bacteria | 1931 |
| 766 | Ga0466957_0322588 | 3300044842 | Bacteria | 1042 |
| 767 | Ga0466960_0159631 | 3300044901 | Bacteria | 1210 |
| 768 | Ga0466959_0018639 | 3300045049 | Bacteria | 5098 |
| 769 | Ga0466959_0360311 | 3300045049 | Bacteria | 991 |
| 770 | Ga0466958_0139995 | 3300045836 | Bacteria | 1523 |
| 771 | Ga0466958_0328468 | 3300045836 | Bacteria | 983 |
| 772 | Ga0466967_0002462 | 3300045976 | Bacteria | 11534 |
| 773 | Ga0466967_0042275 | 3300045976 | Bacteria | 3937 |
| 774 | Ga0466967_0468639 | 3300045976 | Bacteria | 1233 |
| 775 | Ga0466967_0546005 | 3300045976 | Bacteria | 1140 |
| 776 | Ga0495617_068258 | 3300046452 | Bacteria | 1170 |
| 777 | Ga0495592_0003752 | 3300046454 | Bacteria | 10963 |
| 778 | Ga0495592_0030096 | 3300046454 | Bacteria | 4106 |
| 779 | Ga0495592_0054979 | 3300046454 | Bacteria | 2947 |
| 780 | Ga0495592_0210847 | 3300046454 | Bacteria | 1304 |
| 781 | Ga0495603_0000011 | 3300046455 | Bacteria | 69832 |
| 782 | Ga0495603_0016002 | 3300046455 | Bacteria | 4535 |
| 783 | Ga0495603_0018500 | 3300046455 | Bacteria | 4215 |
| 784 | Ga0495603_0018693 | 3300046455 | Bacteria | 4193 |
| 785 | Ga0495603_0029271 | 3300046455 | Bacteria | 3321 |
| 786 | Ga0495603_0126687 | 3300046455 | Bacteria | 1488 |
| 787 | Ga0495603_0145321 | 3300046455 | Bacteria | 1379 |
| 788 | Ga0495629_0000251 | 3300046459 | Bacteria | 46643 |
| 789 | Ga0495629_0000253 | 3300046459 | Bacteria | 46595 |
| 790 | Ga0495629_0002122 | 3300046459 | Bacteria | 15363 |
| 791 | Ga0495638_0009386 | 3300046460 | Bacteria | 6876 |
| 792 | Ga0495638_0022362 | 3300046460 | Bacteria | 4151 |
| 793 | Ga0495638_0036500 | 3300046460 | Bacteria | 3131 |
| 794 | Ga0495638_0039823 | 3300046460 | Bacteria | 2981 |
| 795 | Ga0495638_0056366 | 3300046460 | Bacteria | 2438 |
| 796 | Ga0495641_0014674 | 3300046461 | Bacteria | 4228 |
| 797 | Ga0495641_0017327 | 3300046461 | Bacteria | 3757 |
| 798 | Ga0495641_0039165 | 3300046461 | Bacteria | 2211 |
| 799 | Ga0495651_0015572 | 3300046462 | Bacteria | 5884 |
| 800 | Ga0495651_0085167 | 3300046462 | Bacteria | 2380 |
| 801 | Ga0495651_0120048 | 3300046462 | Bacteria | 1932 |
| 802 | Ga0495653_0000473 | 3300046463 | Bacteria | 31165 |
| 803 | Ga0495653_0113012 | 3300046463 | Bacteria | 1948 |
| 804 | Ga0495650_0085380 | 3300046471 | Bacteria | 1209 |
| 805 | Ga0495580_0015052 | 3300046472 | Bacteria | 5853 |
| 806 | Ga0495580_0018909 | 3300046472 | Bacteria | 5125 |
| 807 | Ga0495580_0533797 | 3300046472 | Bacteria | 780 |
| 808 | Ga0495582_0000974 | 3300046473 | Bacteria | 16016 |
| 809 | Ga0495582_0027990 | 3300046473 | Bacteria | 3092 |
| 810 | Ga0495605_0032938 | 3300046474 | Bacteria | 2635 |
| 811 | Ga0495639_0000017 | 3300046475 | Bacteria | 76508 |
| 812 | Ga0495639_0060223 | 3300046475 | Bacteria | 1739 |
| 813 | Ga0495639_0198543 | 3300046475 | Bacteria | 981 |
| 814 | Ga0495662_0000179 | 3300046476 | Bacteria | 25483 |
| 815 | Ga0495662_0129503 | 3300046476 | Bacteria | 1240 |
| 816 | Ga0495662_0220546 | 3300046476 | Bacteria | 935 |
| 817 | Ga0495662_0233079 | 3300046476 | Bacteria | 907 |
| 818 | Ga0495664_0035477 | 3300046477 | Bacteria | 2937 |
| 819 | Ga0495664_0089776 | 3300046477 | Bacteria | 1847 |
| 820 | Ga0495664_0278364 | 3300046477 | Bacteria | 1011 |
| 821 | Ga0495585_0004643 | 3300046492 | Bacteria | 8861 |
| 822 | Ga0495585_0088116 | 3300046492 | Bacteria | 1674 |
| 823 | Ga0495594_0000094 | 3300046499 | Bacteria | 41090 |
| 824 | Ga0495594_0007078 | 3300046499 | Bacteria | 5769 |
| 825 | Ga0495594_0079170 | 3300046499 | Bacteria | 1834 |
| 826 | Ga0495594_0098064 | 3300046499 | Bacteria | 1647 |
| 827 | Ga0495594_0102898 | 3300046499 | Bacteria | 1607 |
| 828 | Ga0495606_0002138 | 3300046507 | Bacteria | 23850 |
| 829 | Ga0495606_0102853 | 3300046507 | Bacteria | 1736 |
| 830 | Ga0495608_0007400 | 3300046511 | Bacteria | 7752 |
| 831 | Ga0495608_0060453 | 3300046511 | Bacteria | 2493 |
| 832 | Ga0495610_0075749 | 3300046512 | Bacteria | 1557 |
| 833 | Ga0495616_0043510 | 3300046513 | Bacteria | 2281 |
| 834 | Ga0495616_0052942 | 3300046513 | Bacteria | 2019 |
| 835 | Ga0495616_0107873 | 3300046513 | Bacteria | 1297 |
| 836 | Ga0495618_0084293 | 3300046514 | Bacteria | 2031 |
| 837 | Ga0495618_0095271 | 3300046514 | Bacteria | 1903 |
| 838 | Ga0495618_0189316 | 3300046514 | Bacteria | 1305 |
| 839 | Ga0495618_0430564 | 3300046514 | Bacteria | 803 |
| 840 | Ga0495620_0024967 | 3300046515 | Bacteria | 2836 |
| 841 | Ga0495620_0121661 | 3300046515 | Bacteria | 1028 |
| 842 | Ga0495628_0027034 | 3300046516 | Bacteria | 4671 |
| 843 | Ga0495628_0030482 | 3300046516 | Bacteria | 4367 |
| 844 | Ga0495628_0064067 | 3300046516 | Bacteria | 2878 |
| 845 | Ga0495628_0180064 | 3300046516 | Bacteria | 1599 |
| 846 | Ga0495628_0244898 | 3300046516 | Bacteria | 1340 |
| 847 | Ga0495630_0008181 | 3300046517 | Bacteria | 7511 |
| 848 | Ga0495630_0036331 | 3300046517 | Bacteria | 3683 |
| 849 | Ga0495632_0130764 | 3300046519 | Bacteria | 1168 |
| 850 | Ga0495632_0157335 | 3300046519 | Bacteria | 1048 |
| 851 | Ga0495644_0003084 | 3300046523 | Bacteria | 6594 |
| 852 | Ga0495648_0000494 | 3300046524 | Bacteria | 42434 |
| 853 | Ga0495648_0001433 | 3300046524 | Bacteria | 23346 |
| 854 | Ga0495648_0060116 | 3300046524 | Bacteria | 2263 |
| 855 | Ga0495666_0149246 | 3300046526 | Bacteria | 1087 |
| 856 | Ga0495666_0191232 | 3300046526 | Bacteria | 943 |
| 857 | Ga0495642_0129722 | 3300046528 | Bacteria | 1085 |
| 858 | Ga0495652_0006106 | 3300046529 | Bacteria | 11263 |
| 859 | Ga0495652_0013728 | 3300046529 | Bacteria | 7286 |
| 860 | Ga0495652_0091230 | 3300046529 | Bacteria | 2491 |
| 861 | Ga0495652_0113263 | 3300046529 | Bacteria | 2178 |
| 862 | Ga0495652_0119722 | 3300046529 | Bacteria | 2102 |
| 863 | Ga0495654_0005880 | 3300046530 | Bacteria | 7057 |
| 864 | Ga0495654_0032938 | 3300046530 | Bacteria | 2625 |
| 865 | Ga0495654_0165740 | 3300046530 | Bacteria | 967 |
| 866 | Ga0495665_0000032 | 3300046531 | Bacteria | 53670 |
| 867 | Ga0495665_0023158 | 3300046531 | Bacteria | 3335 |
| 868 | Ga0495640_0001724 | 3300046533 | Bacteria | 17333 |
| 869 | Ga0495640_0025020 | 3300046533 | Bacteria | 4336 |
| 870 | Ga0495640_0033866 | 3300046533 | Bacteria | 3629 |
| 871 | Ga0495640_0196234 | 3300046533 | Bacteria | 1281 |
| 872 | Ga0495586_0070505 | 3300046535 | Bacteria | 1909 |
| 873 | Ga0495586_0311371 | 3300046535 | Bacteria | 903 |
| 874 | Ga0495587_0010454 | 3300046536 | Bacteria | 5905 |
| 875 | Ga0495587_0035328 | 3300046536 | Bacteria | 3010 |
| 876 | Ga0495587_0037939 | 3300046536 | Bacteria | 2891 |
| 877 | Ga0495587_0197253 | 3300046536 | Bacteria | 1139 |
| 878 | Ga0495598_0006263 | 3300046537 | Bacteria | 2682 |
| 879 | Ga0495609_0142147 | 3300046538 | Bacteria | 1024 |
| 880 | Ga0495621_0012201 | 3300046539 | Bacteria | 2676 |
| 881 | Ga0495621_0091531 | 3300046539 | Bacteria | 1147 |
| 882 | Ga0495597_0046757 | 3300046542 | Bacteria | 1917 |
| 883 | Ga0495597_0053866 | 3300046542 | Bacteria | 1768 |
| 884 | Ga0495645_0061017 | 3300046543 | Bacteria | 2733 |
| 885 | Ga0495645_0137633 | 3300046543 | Bacteria | 1707 |
| 886 | Ga0495645_0263284 | 3300046543 | Bacteria | 1140 |
| 887 | Ga0495622_0010235 | 3300046557 | Bacteria | 4335 |
| 888 | Ga0495622_0038223 | 3300046557 | Bacteria | 2235 |
| 889 | Ga0495633_0003607 | 3300046558 | Bacteria | 10240 |
| 890 | Ga0495667_0000962 | 3300046559 | Bacteria | 18643 |
| 891 | Ga0495667_0044797 | 3300046559 | Bacteria | 2929 |
| 892 | Ga0495667_0110804 | 3300046559 | Bacteria | 1773 |
| 893 | Ga0495667_0165382 | 3300046559 | Bacteria | 1422 |
| 894 | Ga0495656_0001421 | 3300046615 | Bacteria | 7836 |
| 895 | Ga0495656_0039306 | 3300046615 | Bacteria | 1964 |
| 896 | Ga0495656_0091115 | 3300046615 | Bacteria | 1394 |
| 897 | Ga0495656_0170297 | 3300046615 | Bacteria | 1064 |
| 898 | Ga0495668_0000092 | 3300046616 | Bacteria | 142835 |
| 899 | Ga0495668_0075201 | 3300046616 | Bacteria | 1855 |
| 900 | Ga0495668_0166199 | 3300046616 | Bacteria | 1208 |
| 901 | Ga0495668_0216984 | 3300046616 | Bacteria | 1047 |
| 902 | Ga0495668_0298754 | 3300046616 | Bacteria | 883 |
| 903 | Ga0495634_0003268 | 3300046642 | Bacteria | 13081 |
| 904 | Ga0495634_0078652 | 3300046642 | Bacteria | 2160 |
| 905 | Ga0495634_0085665 | 3300046642 | Bacteria | 2053 |
| 906 | Ga0495634_0212154 | 3300046642 | Bacteria | 1198 |
| 907 | Ga0495634_0229210 | 3300046642 | Bacteria | 1143 |
| 908 | Ga0495611_0030565 | 3300046648 | Bacteria | 2369 |
| 909 | Ga0495611_0133890 | 3300046648 | Bacteria | 1156 |
| 910 | Ga0495625_0361214 | 3300046660 | Bacteria | 915 |
| 911 | Ga0495635_0000084 | 3300046663 | Bacteria | 56456 |
| 912 | Ga0495635_0003234 | 3300046663 | Bacteria | 11231 |
| 913 | Ga0495635_0041900 | 3300046663 | Bacteria | 3163 |
| 914 | Ga0495635_0164809 | 3300046663 | Bacteria | 1508 |
| 915 | Ga0495659_0007751 | 3300046664 | Bacteria | 3406 |
| 916 | Ga0495661_0019379 | 3300046665 | Bacteria | 4458 |
| 917 | Ga0495661_0063366 | 3300046665 | Bacteria | 2185 |
| 918 | Ga0495661_0294948 | 3300046665 | Bacteria | 813 |
| 919 | Ga0495588_0034752 | 3300046674 | Bacteria | 2551 |
| 920 | Ga0495588_0037169 | 3300046674 | Bacteria | 2473 |
| 921 | Ga0495588_0048031 | 3300046674 | Bacteria | 2192 |
| 922 | Ga0495588_0108846 | 3300046674 | Bacteria | 1459 |
| 923 | Ga0495657_0005107 | 3300046675 | Bacteria | 10419 |
| 924 | Ga0495657_0008437 | 3300046675 | Bacteria | 7880 |
| 925 | Ga0495657_0021841 | 3300046675 | Bacteria | 4591 |
| 926 | Ga0495657_0190027 | 3300046675 | Bacteria | 1256 |
| 927 | Ga0495657_0224104 | 3300046675 | Bacteria | 1139 |
| 928 | Ga0495599_0000457 | 3300046678 | Bacteria | 23252 |
| 929 | Ga0495599_0038768 | 3300046678 | Bacteria | 2994 |
| 930 | Ga0495599_0405425 | 3300046678 | Bacteria | 811 |
| 931 | Ga0495623_0008556 | 3300046679 | Bacteria | 6645 |
| 932 | Ga0495623_0107716 | 3300046679 | Bacteria | 1692 |
| 933 | Ga0495623_0113461 | 3300046679 | Bacteria | 1639 |
| 934 | Ga0495646_0042090 | 3300046680 | Bacteria | 2804 |
| 935 | Ga0495646_0064091 | 3300046680 | Bacteria | 2179 |
| 936 | Ga0495646_0153260 | 3300046680 | Bacteria | 1280 |
| 937 | Ga0495647_0000248 | 3300046681 | Bacteria | 14792 |
| 938 | Ga0495647_0010707 | 3300046681 | Bacteria | 3128 |
| 939 | Ga0495647_0017500 | 3300046681 | Bacteria | 2537 |
| 940 | Ga0495658_0001805 | 3300046683 | Bacteria | 11001 |
| 941 | Ga0495658_0007984 | 3300046683 | Bacteria | 5242 |
| 942 | Ga0495658_0106447 | 3300046683 | Bacteria | 1681 |
| 943 | Ga0495658_0112424 | 3300046683 | Bacteria | 1639 |
| 944 | Ga0495669_0050384 | 3300046684 | Bacteria | 1867 |
| 945 | Ga0495669_0278404 | 3300046684 | Bacteria | 805 |
| 946 | Ga0495613_0001580 | 3300046689 | Bacteria | 17285 |
| 947 | Ga0495613_0004954 | 3300046689 | Bacteria | 9999 |
| 948 | Ga0495613_0071751 | 3300046689 | Bacteria | 2524 |
| 949 | Ga0495613_0121915 | 3300046689 | Bacteria | 1872 |
| 950 | Ga0495624_0004094 | 3300046690 | Bacteria | 10725 |
| 951 | Ga0495624_0156067 | 3300046690 | Bacteria | 1395 |
| 952 | Ga0495670_0000787 | 3300046691 | Bacteria | 15234 |
| 953 | Ga0495670_0010416 | 3300046691 | Bacteria | 4567 |
| 954 | Ga0495670_0034134 | 3300046691 | Bacteria | 2533 |
| 955 | Ga0495671_0243761 | 3300046692 | Bacteria | 868 |
| 956 | Ga0495649_0094750 | 3300046694 | Bacteria | 1589 |
| 957 | Ga0495600_0003042 | 3300046809 | Bacteria | 9794 |
| 958 | Ga0495600_0004866 | 3300046809 | Bacteria | 8067 |
| 959 | Ga0495600_0051163 | 3300046809 | Bacteria | 2696 |
| 960 | Ga0495581_0000076 | 3300047315 | Bacteria | 39131 |
| 961 | Ga0495581_0043435 | 3300047315 | Bacteria | 2600 |
| 962 | Ga0495581_0114836 | 3300047315 | Bacteria | 1566 |
| 963 | Ga0495581_0139969 | 3300047315 | Bacteria | 1411 |
| 964 | Ga0495581_0203298 | 3300047315 | Bacteria | 1159 |
| 965 | Ga0495581_0270429 | 3300047315 | Bacteria | 994 |
| 966 | Ga0495581_0340779 | 3300047315 | Bacteria | 875 |
| 967 | Ga0495604_0010464 | 3300047317 | Bacteria | 7352 |
| 968 | Ga0495604_0102023 | 3300047317 | Bacteria | 2106 |
| 969 | Ga0495604_0124266 | 3300047317 | Bacteria | 1863 |
| 970 | Ga0495604_0133812 | 3300047317 | Bacteria | 1779 |
| 971 | Ga0495674_0001109 | 3300047319 | Bacteria | 25876 |
| 972 | Ga0495674_0009634 | 3300047319 | Bacteria | 9175 |
| 973 | Ga0495674_0063393 | 3300047319 | Bacteria | 3215 |
| 974 | Ga0495674_0070677 | 3300047319 | Bacteria | 3016 |
| 975 | Ga0495674_0072742 | 3300047319 | Bacteria | 2964 |
| 976 | Ga0495672_0010637 | 3300047320 | Bacteria | 6537 |
| 977 | Ga0495672_0028513 | 3300047320 | Bacteria | 3531 |
| 978 | Ga0495672_0242945 | 3300047320 | Bacteria | 878 |
| 979 | Ga0495672_0263016 | 3300047320 | Bacteria | 832 |
| 980 | Ga0495676_0036452 | 3300047321 | Bacteria | 4107 |
| 981 | Ga0495676_0227178 | 3300047321 | Bacteria | 1283 |
| 982 | Ga0495676_0283049 | 3300047321 | Bacteria | 1122 |
| 983 | Ga0495680_0007126 | 3300047322 | Bacteria | 10297 |
| 984 | Ga0495680_0010925 | 3300047322 | Bacteria | 8067 |
| 985 | Ga0495680_0021814 | 3300047322 | Bacteria | 5352 |
| 986 | Ga0495680_0065244 | 3300047322 | Bacteria | 2789 |
| 987 | Ga0495680_0270302 | 3300047322 | Bacteria | 1200 |
| 988 | Ga0495683_0166942 | 3300047323 | Bacteria | 1014 |
| 989 | Ga0495687_010366 | 3300047443 | Bacteria | 5115 |
| 990 | Ga0495675_0001533 | 3300047444 | Bacteria | 13942 |
| 991 | Ga0495677_0174134 | 3300047445 | Bacteria | 833 |
| 992 | Ga0495679_096931 | 3300047446 | Bacteria | 822 |
| 993 | Ga0495673_0117193 | 3300047469 | Bacteria | 1058 |
| 994 | Ga0495684_0001330 | 3300047471 | Bacteria | 19879 |
| 995 | Ga0495684_0001937 | 3300047471 | Bacteria | 16591 |
| 996 | Ga0495684_0010509 | 3300047471 | Bacteria | 7158 |
| 997 | Ga0495686_0076759 | 3300047472 | Bacteria | 2047 |
| 998 | Ga0495686_0142253 | 3300047472 | Bacteria | 1415 |
| 999 | Ga0495686_0169194 | 3300047472 | Bacteria | 1272 |
| 1000 | Ga0495686_0275060 | 3300047472 | Bacteria | 938 |
| 1001 | Ga0495593_0002160 | 3300047673 | Bacteria | 11757 |
| 1002 | Ga0495593_0002185 | 3300047673 | Bacteria | 11713 |
| 1003 | Ga0495593_0004247 | 3300047673 | Bacteria | 8522 |
| 1004 | Ga0495593_0048015 | 3300047673 | Bacteria | 2269 |
| 1005 | Ga0495602_0062123 | 3300048088 | Bacteria | 3242 |
| 1006 | Ga0495602_0084727 | 3300048088 | Bacteria | 2650 |
| 1007 | Ga0495614_0035738 | 3300048089 | Bacteria | 2134 |
| 1008 | Ga0495614_0045811 | 3300048089 | Bacteria | 1875 |
| 1009 | Ga0495614_0199292 | 3300048089 | Bacteria | 905 |
| 1010 | Ga0496100_0009708 | 3300048903 | Bacteria | 5416 |
| 1011 | Ga0496100_0032941 | 3300048903 | Bacteria | 3237 |
| 1012 | Ga0496100_0133547 | 3300048903 | Bacteria | 1751 |
| 1013 | Ga0496100_0186477 | 3300048903 | Bacteria | 1503 |
| 1014 | Ga0496100_0239403 | 3300048903 | Bacteria | 1338 |
| 1015 | Ga0496101_0062075 | 3300048904 | Bacteria | 2716 |
| 1016 | Ga0496101_0106071 | 3300048904 | Bacteria | 2109 |
| 1017 | Ga0496101_0124410 | 3300048904 | Bacteria | 1953 |
| 1018 | Ga0496101_0179040 | 3300048904 | Bacteria | 1632 |
| 1019 | Ga0496101_0234968 | 3300048904 | Bacteria | 1425 |
| 1020 | Ga0496101_0306525 | 3300048904 | Bacteria | 1244 |
| 1021 | Ga0496102_0004998 | 3300048905 | Bacteria | 11234 |
| 1022 | Ga0496102_0017053 | 3300048905 | Bacteria | 6356 |
| 1023 | Ga0496102_0029309 | 3300048905 | Bacteria | 4925 |
| 1024 | Ga0496102_0122324 | 3300048905 | Bacteria | 2431 |
| 1025 | Ga0496102_0123553 | 3300048905 | Bacteria | 2419 |
| 1026 | Ga0496102_0127267 | 3300048905 | Bacteria | 2382 |
| 1027 | Ga0496102_0253023 | 3300048905 | Bacteria | 1661 |
| 1028 | Ga0496103_0003807 | 3300048906 | Bacteria | 9179 |
| 1029 | Ga0496103_0024359 | 3300048906 | Bacteria | 3653 |
| 1030 | Ga0496103_0067753 | 3300048906 | Bacteria | 2230 |
| 1031 | Ga0496104_0000331 | 3300048907 | Bacteria | 42278 |
| 1032 | Ga0496104_0023465 | 3300048907 | Bacteria | 5672 |
| 1033 | Ga0496104_0026932 | 3300048907 | Bacteria | 5314 |
| 1034 | Ga0496104_0065839 | 3300048907 | Bacteria | 3439 |
| 1035 | Ga0496104_0092178 | 3300048907 | Bacteria | 2897 |
| 1036 | Ga0496104_0118811 | 3300048907 | Bacteria | 2538 |
| 1037 | Ga0496104_0131351 | 3300048907 | Bacteria | 2405 |
| 1038 | Ga0496104_0696809 | 3300048907 | Bacteria | 923 |
| 1039 | Ga0496105_0013669 | 3300048908 | Bacteria | 6445 |
| 1040 | Ga0496105_0027756 | 3300048908 | Bacteria | 4626 |
| 1041 | Ga0496105_0047246 | 3300048908 | Bacteria | 3552 |
| 1042 | Ga0496105_0104294 | 3300048908 | Bacteria | 2341 |
| 1043 | Ga0496105_0129992 | 3300048908 | Bacteria | 2076 |
| 1044 | Ga0496105_0193884 | 3300048908 | Bacteria | 1660 |
| 1045 | Ga0496105_0617885 | 3300048908 | Bacteria | 839 |
| 1046 | Ga0496106_0001453 | 3300048909 | Bacteria | 17793 |
| 1047 | Ga0496106_0007579 | 3300048909 | Bacteria | 8029 |
| 1048 | Ga0496106_0155397 | 3300048909 | Bacteria | 1806 |
| 1049 | Ga0496106_0548593 | 3300048909 | Bacteria | 927 |
| 1050 | Ga0496107_0012401 | 3300048910 | Bacteria | 5948 |
| 1051 | Ga0496107_0057233 | 3300048910 | Bacteria | 2818 |
| 1052 | Ga0496107_0074980 | 3300048910 | Bacteria | 2462 |
| 1053 | Ga0496107_0080430 | 3300048910 | Bacteria | 2376 |
| 1054 | Ga0496107_0131581 | 3300048910 | Bacteria | 1847 |
| 1055 | Ga0496107_0139865 | 3300048910 | Bacteria | 1789 |
| 1056 | Ga0496107_0140109 | 3300048910 | Bacteria | 1787 |
| 1057 | Ga0496108_0001656 | 3300048911 | Bacteria | 17657 |
| 1058 | Ga0496108_0007772 | 3300048911 | Bacteria | 8685 |
| 1059 | Ga0496108_0015489 | 3300048911 | Bacteria | 6218 |
| 1060 | Ga0496108_0081128 | 3300048911 | Bacteria | 2748 |
| 1061 | Ga0496108_0132976 | 3300048911 | Bacteria | 2138 |
| 1062 | Ga0496108_0279817 | 3300048911 | Bacteria | 1452 |
| 1063 | Ga0496108_0369861 | 3300048911 | Bacteria | 1251 |
| 1064 | Ga0496108_0389286 | 3300048911 | Bacteria | 1217 |
| 1065 | Ga0496108_0435246 | 3300048911 | Bacteria | 1145 |
| 1066 | Ga0496109_0002542 | 3300048912 | Bacteria | 15293 |
| 1067 | Ga0496109_0005517 | 3300048912 | Bacteria | 10593 |
| 1068 | Ga0496109_0037791 | 3300048912 | Bacteria | 4363 |
| 1069 | Ga0496109_0253461 | 3300048912 | Bacteria | 1657 |
| 1070 | Ga0496109_0296331 | 3300048912 | Bacteria | 1525 |
| 1071 | Ga0496109_0430639 | 3300048912 | Bacteria | 1246 |
| 1072 | Ga0496109_0548544 | 3300048912 | Bacteria | 1090 |
| 1073 | Ga0496109_1016602 | 3300048912 | Bacteria | 766 |
| 1074 | Ga0496110_0006911 | 3300048913 | Bacteria | 9025 |
| 1075 | Ga0496110_0011557 | 3300048913 | Bacteria | 7235 |
| 1076 | Ga0496110_0024579 | 3300048913 | Bacteria | 5136 |
| 1077 | Ga0496110_0050759 | 3300048913 | Bacteria | 3643 |
| 1078 | Ga0496110_0054426 | 3300048913 | Bacteria | 3520 |
| 1079 | Ga0496110_0108630 | 3300048913 | Bacteria | 2491 |
| 1080 | Ga0496110_0234218 | 3300048913 | Bacteria | 1670 |
| 1081 | Ga0496110_0350302 | 3300048913 | Bacteria | 1345 |
| 1082 | Ga0496110_0401456 | 3300048913 | Bacteria | 1249 |
| 1083 | Ga0496110_0700215 | 3300048913 | Bacteria | 914 |
| 1084 | Ga0496111_0001681 | 3300048914 | Bacteria | 12889 |
| 1085 | Ga0496111_0004178 | 3300048914 | Bacteria | 9086 |
| 1086 | Ga0496111_0020054 | 3300048914 | Bacteria | 4650 |
| 1087 | Ga0496111_0040057 | 3300048914 | Bacteria | 3361 |
| 1088 | Ga0496111_0049479 | 3300048914 | Bacteria | 3031 |
| 1089 | Ga0496111_0094980 | 3300048914 | Bacteria | 2187 |
| 1090 | Ga0496111_0265385 | 3300048914 | Bacteria | 1274 |
| 1091 | Ga0496111_0271124 | 3300048914 | Bacteria | 1259 |
| 1092 | Ga0496112_0000414 | 3300048915 | Bacteria | 28126 |
| 1093 | Ga0496112_0010890 | 3300048915 | Bacteria | 8277 |
| 1094 | Ga0496112_0024803 | 3300048915 | Bacteria | 5751 |
| 1095 | Ga0496112_0041801 | 3300048915 | Bacteria | 4485 |
| 1096 | Ga0496112_0043885 | 3300048915 | Bacteria | 4378 |
| 1097 | Ga0496112_0189675 | 3300048915 | Bacteria | 2018 |
| 1098 | Ga0496112_0208418 | 3300048915 | Bacteria | 1912 |
| 1099 | Ga0496112_0216117 | 3300048915 | Bacteria | 1873 |
| 1100 | Ga0496112_0251390 | 3300048915 | Bacteria | 1718 |
| 1101 | Ga0496113_0001520 | 3300048916 | Bacteria | 12991 |
| 1102 | Ga0496113_0004601 | 3300048916 | Bacteria | 8508 |
| 1103 | Ga0496113_0008072 | 3300048916 | Bacteria | 6833 |
| 1104 | Ga0496113_0008091 | 3300048916 | Bacteria | 6827 |
| 1105 | Ga0496113_0114467 | 3300048916 | Bacteria | 2103 |
| 1106 | Ga0496113_0215699 | 3300048916 | Bacteria | 1528 |
| 1107 | Ga0496113_0555583 | 3300048916 | Bacteria | 921 |
| 1108 | Ga0496114_0005585 | 3300048917 | Bacteria | 9860 |
| 1109 | Ga0496114_0015990 | 3300048917 | Bacteria | 6038 |
| 1110 | Ga0496114_0065889 | 3300048917 | Bacteria | 3035 |
| 1111 | Ga0496114_0069511 | 3300048917 | Bacteria | 2957 |
| 1112 | Ga0496114_0114066 | 3300048917 | Bacteria | 2317 |
| 1113 | Ga0496114_0121398 | 3300048917 | Bacteria | 2247 |
| 1114 | Ga0496114_0136752 | 3300048917 | Bacteria | 2119 |
| 1115 | Ga0496114_0279601 | 3300048917 | Bacteria | 1471 |
| 1116 | Ga0496114_0451916 | 3300048917 | Bacteria | 1138 |
| 1117 | Ga0496115_0011102 | 3300048918 | Bacteria | 6750 |
| 1118 | Ga0496115_0019563 | 3300048918 | Bacteria | 5212 |
| 1119 | Ga0496115_0040397 | 3300048918 | Bacteria | 3709 |
| 1120 | Ga0496115_0041198 | 3300048918 | Bacteria | 3674 |
| 1121 | Ga0496115_0075176 | 3300048918 | Bacteria | 2744 |
| 1122 | Ga0496115_0089958 | 3300048918 | Bacteria | 2507 |
| 1123 | Ga0496115_0467285 | 3300048918 | Bacteria | 1017 |
| 1124 | Ga0496115_0541517 | 3300048918 | Bacteria | 931 |
| 1125 | Ga0496116_0002810 | 3300048919 | Bacteria | 17881 |
| 1126 | Ga0496116_0181951 | 3300048919 | Bacteria | 1124 |
| 1127 | Ga0496116_0254201 | 3300048919 | Bacteria | 872 |
| 1128 | Ga0496117_0064775 | 3300048920 | Bacteria | 2489 |
| 1129 | Ga0496117_0066143 | 3300048920 | Bacteria | 2453 |
| 1130 | Ga0496117_0085429 | 3300048920 | Bacteria | 2054 |
| 1131 | Ga0496118_0017101 | 3300048921 | Bacteria | 6620 |
| 1132 | Ga0496118_0075568 | 3300048921 | Bacteria | 2402 |
| 1133 | Ga0496118_0201703 | 3300048921 | Bacteria | 1177 |
| 1134 | Ga0496118_0214644 | 3300048921 | Bacteria | 1126 |
| 1135 | Ga0496119_0091345 | 3300048922 | Bacteria | 1729 |
| 1136 | Ga0496119_0094144 | 3300048922 | Bacteria | 1695 |
| 1137 | Ga0496119_0128632 | 3300048922 | Bacteria | 1383 |
| 1138 | Ga0496119_0149169 | 3300048922 | Bacteria | 1255 |
| 1139 | Ga0496119_0195140 | 3300048922 | Bacteria | 1052 |
| 1140 | Ga0496121_0005592 | 3300048924 | Bacteria | 16051 |
| 1141 | Ga0496121_0005961 | 3300048924 | Bacteria | 15401 |
| 1142 | Ga0496121_0025691 | 3300048924 | Bacteria | 5580 |
| 1143 | Ga0496121_0031537 | 3300048924 | Bacteria | 4838 |
| 1144 | Ga0496121_0075028 | 3300048924 | Bacteria | 2703 |
| 1145 | Ga0496121_0086316 | 3300048924 | Bacteria | 2466 |
| 1146 | Ga0496121_0102204 | 3300048924 | Bacteria | 2209 |
| 1147 | Ga0496121_0104069 | 3300048924 | Bacteria | 2182 |
| 1148 | Ga0496121_0114227 | 3300048924 | Bacteria | 2053 |
| 1149 | Ga0496121_0122569 | 3300048924 | Bacteria | 1960 |
| 1150 | Ga0496121_0151531 | 3300048924 | Bacteria | 1706 |
| 1151 | Ga0496121_0258853 | 3300048924 | Bacteria | 1202 |
| 1152 | Ga0496121_0260947 | 3300048924 | Bacteria | 1196 |
| 1153 | Ga0496122_0001850 | 3300048925 | Bacteria | 32258 |
| 1154 | Ga0496122_0024253 | 3300048925 | Bacteria | 5312 |
| 1155 | Ga0496122_0214035 | 3300048925 | Bacteria | 1113 |
| 1156 | Ga0496123_0000498 | 3300048926 | Bacteria | 68151 |
| 1157 | Ga0496123_0153571 | 3300048926 | Bacteria | 1238 |
| 1158 | Ga0496124_0039002 | 3300048927 | Bacteria | 4120 |
| 1159 | Ga0496124_0170336 | 3300048927 | Bacteria | 1687 |
| 1160 | Ga0496124_0176486 | 3300048927 | Bacteria | 1649 |
| 1161 | Ga0496125_0000850 | 3300048928 | Bacteria | 49000 |
| 1162 | Ga0496125_0006132 | 3300048928 | Bacteria | 13116 |
| 1163 | Ga0496125_0006453 | 3300048928 | Bacteria | 12678 |
| 1164 | Ga0496125_0038920 | 3300048928 | Bacteria | 4106 |
| 1165 | Ga0496125_0059762 | 3300048928 | Bacteria | 3068 |
| 1166 | Ga0496125_0379689 | 3300048928 | Bacteria | 833 |
| 1167 | Ga0496126_0003112 | 3300048929 | Bacteria | 21403 |
| 1168 | Ga0496126_0004886 | 3300048929 | Bacteria | 15669 |
| 1169 | Ga0496126_0008303 | 3300048929 | Bacteria | 11214 |
| 1170 | Ga0496126_0018879 | 3300048929 | Bacteria | 6813 |
| 1171 | Ga0496126_0066646 | 3300048929 | Bacteria | 3219 |
| 1172 | Ga0496126_0120048 | 3300048929 | Bacteria | 2281 |
| 1173 | Ga0496126_0138295 | 3300048929 | Bacteria | 2098 |
| 1174 | Ga0496126_0149822 | 3300048929 | Bacteria | 2000 |
| 1175 | Ga0496126_0159831 | 3300048929 | Bacteria | 1926 |
| 1176 | Ga0496126_0170358 | 3300048929 | Bacteria | 1855 |
| 1177 | Ga0496126_0207351 | 3300048929 | Bacteria | 1652 |
| 1178 | Ga0496126_0233659 | 3300048929 | Bacteria | 1539 |
| 1179 | Ga0496126_0251436 | 3300048929 | Bacteria | 1473 |
| 1180 | Ga0496126_0562002 | 3300048929 | Bacteria | 904 |
| 1181 | Ga0496126_0563447 | 3300048929 | Bacteria | 902 |
| 1182 | Ga0496126_0600538 | 3300048929 | Bacteria | 867 |
| 1183 | Ga0495682_0051559 | 3300049460 | Bacteria | 1497 |
| 1184 | Ga0495682_0089363 | 3300049460 | Bacteria | 1107 |
| 1185 | Ga0501031_0000253 | 3300049568 | Bacteria | 29955 |
| 1186 | Ga0501031_0019009 | 3300049568 | Bacteria | 4473 |
| 1187 | Ga0501031_0174039 | 3300049568 | Bacteria | 1406 |
| 1188 | Ga0501032_0000273 | 3300049569 | Bacteria | 43466 |
| 1189 | Ga0501032_0022067 | 3300049569 | Bacteria | 4419 |
| 1190 | Ga0501032_0038462 | 3300049569 | Bacteria | 3258 |
| 1191 | Ga0501032_0046242 | 3300049569 | Bacteria | 2942 |
| 1192 | Ga0501032_0051051 | 3300049569 | Bacteria | 2788 |
| 1193 | Ga0501032_0136588 | 3300049569 | Bacteria | 1616 |
| 1194 | Ga0501033_0000098 | 3300049570 | Bacteria | 82803 |
| 1195 | Ga0501033_0000332 | 3300049570 | Bacteria | 44949 |
| 1196 | Ga0501033_0055981 | 3300049570 | Bacteria | 2916 |
| 1197 | Ga0501033_0064916 | 3300049570 | Bacteria | 2685 |
| 1198 | Ga0501033_0453318 | 3300049570 | Bacteria | 891 |
| 1199 | Ga0501034_0000088 | 3300049571 | Bacteria | 166615 |
| 1200 | Ga0501034_0000175 | 3300049571 | Bacteria | 119465 |
| 1201 | Ga0501034_0019896 | 3300049571 | Bacteria | 6858 |
| 1202 | Ga0501034_0048469 | 3300049571 | Bacteria | 4287 |
| 1203 | Ga0501034_0078646 | 3300049571 | Bacteria | 3302 |
| 1204 | Ga0501034_0104633 | 3300049571 | Bacteria | 2824 |
| 1205 | Ga0501034_0269977 | 3300049571 | Bacteria | 1642 |
| 1206 | Ga0501034_0519603 | 3300049571 | Bacteria | 1102 |
| 1207 | Ga0501036_0000049 | 3300049572 | Bacteria | 75400 |
| 1208 | Ga0501036_0043499 | 3300049572 | Bacteria | 3804 |
| 1209 | Ga0501036_0076908 | 3300049572 | Bacteria | 2824 |
| 1210 | Ga0501036_0236704 | 3300049572 | Bacteria | 1531 |
| 1211 | Ga0501036_0281622 | 3300049572 | Bacteria | 1391 |
| 1212 | Ga0501037_0000069 | 3300049573 | Bacteria | 95277 |
| 1213 | Ga0501037_0003734 | 3300049573 | Bacteria | 11058 |
| 1214 | Ga0501037_0144821 | 3300049573 | Bacteria | 1700 |
| 1215 | Ga0501037_0199808 | 3300049573 | Bacteria | 1413 |
| 1216 | Ga0501038_0000034 | 3300049574 | Bacteria | 128854 |
| 1217 | Ga0501038_0008654 | 3300049574 | Bacteria | 9346 |
| 1218 | Ga0501038_0053758 | 3300049574 | Bacteria | 3465 |
| 1219 | Ga0501038_0072407 | 3300049574 | Bacteria | 2920 |
| 1220 | Ga0501038_0111941 | 3300049574 | Bacteria | 2260 |
| 1221 | Ga0501038_0144616 | 3300049574 | Bacteria | 1942 |
| 1222 | Ga0501038_0339867 | 3300049574 | Bacteria | 1171 |
| 1223 | Ga0501039_0000090 | 3300049575 | Bacteria | 63919 |
| 1224 | Ga0501039_0005577 | 3300049575 | Bacteria | 9525 |
| 1225 | Ga0501039_0108617 | 3300049575 | Bacteria | 2168 |
| 1226 | Ga0501039_0694764 | 3300049575 | Bacteria | 796 |
| 1227 | Ga0501040_0299360 | 3300049576 | Bacteria | 1150 |
| 1228 | Ga0501040_0527577 | 3300049576 | Bacteria | 852 |
| 1229 | Ga0501041_0280595 | 3300049577 | Bacteria | 1048 |
| 1230 | Ga0501042_0021749 | 3300049578 | Bacteria | 4472 |
| 1231 | Ga0501042_0111228 | 3300049578 | Bacteria | 1972 |
| 1232 | Ga0501043_0000130 | 3300049579 | Bacteria | 69795 |
| 1233 | Ga0501043_0010948 | 3300049579 | Bacteria | 7105 |
| 1234 | Ga0501043_0136910 | 3300049579 | Bacteria | 1918 |
| 1235 | Ga0501046_0000213 | 3300049580 | Bacteria | 60602 |
| 1236 | Ga0501046_0007792 | 3300049580 | Bacteria | 9395 |
| 1237 | Ga0501046_0020817 | 3300049580 | Bacteria | 5417 |
| 1238 | Ga0501046_0032084 | 3300049580 | Bacteria | 4255 |
| 1239 | Ga0501046_0181540 | 3300049580 | Bacteria | 1573 |
| 1240 | Ga0501047_0000255 | 3300049581 | Bacteria | 62993 |
| 1241 | Ga0501047_0016128 | 3300049581 | Bacteria | 7126 |
| 1242 | Ga0501047_0039630 | 3300049581 | Bacteria | 4556 |
| 1243 | Ga0501047_0074475 | 3300049581 | Bacteria | 3269 |
| 1244 | Ga0501047_0087080 | 3300049581 | Bacteria | 3001 |
| 1245 | Ga0501047_0087376 | 3300049581 | Bacteria | 2995 |
| 1246 | Ga0501047_0109419 | 3300049581 | Bacteria | 2646 |
| 1247 | Ga0501047_0329085 | 3300049581 | Bacteria | 1366 |
| 1248 | Ga0501047_0546852 | 3300049581 | Bacteria | 982 |
| 1249 | Ga0501048_0000252 | 3300049582 | Bacteria | 35941 |
| 1250 | Ga0501048_0138363 | 3300049582 | Bacteria | 1721 |
| 1251 | Ga0501067_0001929 | 3300049583 | Bacteria | 11405 |
| 1252 | Ga0501067_0021939 | 3300049583 | Bacteria | 3533 |
| 1253 | Ga0501067_0051104 | 3300049583 | Bacteria | 2292 |
| 1254 | Ga0501067_0060356 | 3300049583 | Bacteria | 2099 |
| 1255 | Ga0501067_0189962 | 3300049583 | Bacteria | 1144 |
| 1256 | Ga0501068_0000197 | 3300049584 | Bacteria | 28590 |
| 1257 | Ga0501068_0014839 | 3300049584 | Bacteria | 4461 |
| 1258 | Ga0501069_0000614 | 3300049585 | Bacteria | 16508 |
| 1259 | Ga0501069_0074684 | 3300049585 | Bacteria | 1903 |
| 1260 | Ga0501069_0093592 | 3300049585 | Bacteria | 1700 |
| 1261 | Ga0501069_0115171 | 3300049585 | Bacteria | 1533 |
| 1262 | Ga0501070_0017034 | 3300049586 | Bacteria | 6098 |
| 1263 | Ga0501070_0068644 | 3300049586 | Bacteria | 2934 |
| 1264 | Ga0501070_0171049 | 3300049586 | Bacteria | 1789 |
| 1265 | Ga0501070_0384853 | 3300049586 | Bacteria | 1136 |
| 1266 | Ga0501071_0008255 | 3300049587 | Bacteria | 6874 |
| 1267 | Ga0501071_0582273 | 3300049587 | Bacteria | 860 |
| 1268 | Ga0501072_0000146 | 3300049588 | Bacteria | 52958 |
| 1269 | Ga0501072_0245583 | 3300049588 | Bacteria | 1426 |
| 1270 | Ga0501073_0000035 | 3300049589 | Bacteria | 94077 |
| 1271 | Ga0501073_0023327 | 3300049589 | Bacteria | 4443 |
| 1272 | Ga0501073_0099446 | 3300049589 | Bacteria | 2020 |
| 1273 | Ga0501073_0117597 | 3300049589 | Bacteria | 1842 |
| 1274 | Ga0501074_0000512 | 3300049590 | Bacteria | 23801 |
| 1275 | Ga0501074_0059524 | 3300049590 | Bacteria | 2752 |
| 1276 | Ga0501075_0337399 | 3300049591 | Bacteria | 1149 |
| 1277 | Ga0501077_0084003 | 3300049593 | Bacteria | 2018 |
| 1278 | Ga0501079_0010497 | 3300049741 | Bacteria | 7040 |
| 1279 | Ga0501079_0087257 | 3300049741 | Bacteria | 2415 |
| 1280 | Ga0501079_0111763 | 3300049741 | Bacteria | 2123 |
| 1281 | Ga0501079_0364691 | 3300049741 | Bacteria | 1132 |
| 1282 | Ga0501080_0000379 | 3300049742 | Bacteria | 34215 |
| 1283 | Ga0501080_0049862 | 3300049742 | Bacteria | 3897 |
| 1284 | Ga0501080_0060413 | 3300049742 | Bacteria | 3528 |
| 1285 | Ga0501080_0363492 | 3300049742 | Bacteria | 1305 |
| 1286 | Ga0501080_0372895 | 3300049742 | Bacteria | 1287 |
| 1287 | Ga0501080_0548637 | 3300049742 | Bacteria | 1030 |
| 1288 | Ga0501081_0106847 | 3300049743 | Bacteria | 1984 |
| 1289 | Ga0501081_0366079 | 3300049743 | Bacteria | 1064 |
| 1290 | Ga0501083_0000740 | 3300049744 | Bacteria | 21322 |
| 1291 | Ga0501083_0007489 | 3300049744 | Bacteria | 7733 |
| 1292 | Ga0501083_0151374 | 3300049744 | Bacteria | 1519 |
| 1293 | Ga0501035_0000894 | 3300049822 | Bacteria | 31549 |
| 1294 | Ga0501035_0001058 | 3300049822 | Bacteria | 28847 |
| 1295 | Ga0501035_0043468 | 3300049822 | Bacteria | 4048 |
| 1296 | Ga0501035_0181629 | 3300049822 | Bacteria | 1812 |
| 1297 | Ga0501035_0240818 | 3300049822 | Bacteria | 1539 |
| 1298 | Ga0501035_0268517 | 3300049822 | Bacteria | 1444 |
| 1299 | Ga0501035_0277558 | 3300049822 | Bacteria | 1417 |
| 1300 | Ga0501044_0000461 | 3300049823 | Bacteria | 49470 |
| 1301 | Ga0501044_0021033 | 3300049823 | Bacteria | 6965 |
| 1302 | Ga0501044_0043353 | 3300049823 | Bacteria | 4674 |
| 1303 | Ga0501044_0077714 | 3300049823 | Bacteria | 3365 |
| 1304 | Ga0501044_0077856 | 3300049823 | Bacteria | 3362 |
| 1305 | Ga0501044_0118193 | 3300049823 | Bacteria | 2654 |
| 1306 | Ga0501044_0170847 | 3300049823 | Bacteria | 2146 |
| 1307 | Ga0501044_0189973 | 3300049823 | Bacteria | 2017 |
| 1308 | Ga0501044_0210104 | 3300049823 | Bacteria | 1901 |
| 1309 | Ga0501044_0247374 | 3300049823 | Bacteria | 1725 |
| 1310 | Ga0501045_0109171 | 3300049824 | Bacteria | 2051 |
| 1311 | nmdc:mga03683_17567_c1 | 3300050489 | Bacteria | 2709 |
| 1312 | nmdc:mga03683_28652_c1 | 3300050489 | Bacteria | 2216 |
| 1313 | nmdc:mga03683_2952_c1 | 3300050489 | Bacteria | 5375 |
| 1314 | nmdc:mga03n38_15507_c1 | 3300050490 | Bacteria | 2944 |
| 1315 | nmdc:mga03n38_166170_c1 | 3300050490 | Bacteria | 1120 |
| 1316 | nmdc:mga03n38_20367_c1 | 3300050490 | Bacteria | 2653 |
| 1317 | nmdc:mga03n38_210100_c1 | 3300050490 | Bacteria | 1011 |
| 1318 | nmdc:mga03n38_613_c1 | 3300050490 | Bacteria | 9130 |
| 1319 | nmdc:mga03n38_88814_c1 | 3300050490 | Bacteria | 1467 |
| 1320 | nmdc:mga00v17_126620_c1 | 3300050491 | Bacteria | 1630 |
| 1321 | nmdc:mga00v17_21043_c1 | 3300050491 | Bacteria | 3746 |
| 1322 | nmdc:mga0yw44_124882_c1 | 3300050492 | Bacteria | 1661 |
| 1323 | nmdc:mga0yw44_140144_c1 | 3300050492 | Bacteria | 1571 |
| 1324 | nmdc:mga0yw44_15168_c1 | 3300050492 | Bacteria | 4119 |
| 1325 | nmdc:mga0yw44_20149_c1 | 3300050492 | Bacteria | 3695 |
| 1326 | nmdc:mga0yw44_202568_c1 | 3300050492 | Bacteria | 1311 |
| 1327 | nmdc:mga0yw44_215952_c1 | 3300050492 | Bacteria | 1270 |
| 1328 | nmdc:mga0yw44_28351_c1 | 3300050492 | Bacteria | 3220 |
| 1329 | nmdc:mga0yw44_29821_c1 | 3300050492 | Bacteria | 3154 |
| 1330 | nmdc:mga0yw44_32622_c1 | 3300050492 | Bacteria | 3036 |
| 1331 | nmdc:mga0yw44_49130_c1 | 3300050492 | Bacteria | 2545 |
| 1332 | nmdc:mga0k408_5224_c1 | 3300050493 | Bacteria | 6891 |
| 1333 | nmdc:mga0k408_59721_c1 | 3300050493 | Bacteria | 2216 |
| 1334 | nmdc:mga0k408_80127_c1 | 3300050493 | Bacteria | 1911 |
| 1335 | nmdc:mga0k408_9852_c1 | 3300050493 | Bacteria | 5158 |
| 1336 | nmdc:mga06z11_158494_c1 | 3300050494 | Bacteria | 1292 |
| 1337 | nmdc:mga06z11_195578_c1 | 3300050494 | Bacteria | 1172 |
| 1338 | nmdc:mga06z11_289298_c1 | 3300050494 | Bacteria | 972 |
| 1339 | nmdc:mga04h51_33437_c1 | 3300050495 | Bacteria | 1637 |
| 1340 | nmdc:mga04h51_5335_c1 | 3300050495 | Bacteria | 3271 |
| 1341 | nmdc:mga04h51_68922_c1 | 3300050495 | Bacteria | 1230 |
| 1342 | nmdc:mga07m45_102179_c1 | 3300050496 | Bacteria | 1646 |
| 1343 | nmdc:mga07m45_137511_c1 | 3300050496 | Bacteria | 1414 |
| 1344 | nmdc:mga07m45_1929_c1 | 3300050496 | Bacteria | 9590 |
| 1345 | nmdc:mga07m45_3911_c1 | 3300050496 | Bacteria | 7237 |
| 1346 | nmdc:mga05p37_4837_c1 | 3300050507 | Bacteria | 15753 |
| 1347 | nmdc:mga05p37_699874_c1 | 3300050507 | Bacteria | 1126 |
| 1348 | nmdc:mga0qj67_214647_c1 | 3300050509 | Bacteria | 1562 |
| 1349 | nmdc:mga06r32_231017_c1 | 3300050510 | Bacteria | 1838 |
| 1350 | nmdc:mga08y16_157905_c1 | 3300050511 | Bacteria | 2357 |
| 1351 | nmdc:mga08y16_300163_c1 | 3300050511 | Bacteria | 1655 |
| 1352 | nmdc:mga08y16_417681_c1 | 3300050511 | Bacteria | 1371 |
| 1353 | nmdc:mga08y16_440743_c1 | 3300050511 | Bacteria | 1329 |
| 1354 | nmdc:mga08y16_511091_c1 | 3300050511 | Bacteria | 1219 |
| 1355 | nmdc:mga0n895_537959_c1 | 3300050512 | Unclassified | 1175 |
| 1356 | nmdc:mga0n895_556268_c1 | 3300050512 | Bacteria | 1153 |
| 1357 | nmdc:mga0n895_72053_c1 | 3300050512 | Bacteria | 3427 |
| 1358 | nmdc:mga0rr50_123263_c1 | 3300050513 | Bacteria | 2066 |
| 1359 | nmdc:mga08x19_258482_c1 | 3300050514 | Unclassified | 1203 |
| 1360 | nmdc:mga08x19_32130_c1 | 3300050514 | Bacteria | 3306 |
| 1361 | nmdc:mga0a205_180274_c1 | 3300050515 | Bacteria | 2007 |
| 1362 | nmdc:mga0a205_311906_c1 | 3300050515 | Bacteria | 1445 |
| 1363 | nmdc:mga0a205_329637_c1 | 3300050515 | Bacteria | 1396 |
| 1364 | nmdc:mga0sz30_45978_c1 | 3300050516 | Bacteria | 1842 |
| 1365 | nmdc:mga0sz30_86912_c1 | 3300050516 | Bacteria | 1358 |
| 1366 | nmdc:mga0sz30_94549_c1 | 3300050516 | Bacteria | 1303 |
| 1367 | Ga0495601_0056249 | 3300053077 | Bacteria | 2491 |
| 1368 | Ga0495601_0099669 | 3300053077 | Bacteria | 1876 |
| 1369 | Ga0495601_0121479 | 3300053077 | Bacteria | 1696 |
| 1370 | Ga0495601_0167874 | 3300053077 | Bacteria | 1434 |
| 1371 | Ga0495601_0207292 | 3300053077 | Bacteria | 1281 |
| 1372 | Ga0495601_0268820 | 3300053077 | Bacteria | 1112 |
| 1373 | Ga0495612_0005170 | 3300053078 | Bacteria | 5392 |
| 1374 | Ga0495612_0005994 | 3300053078 | Bacteria | 5004 |
| 1375 | Ga0495612_0022238 | 3300053078 | Bacteria | 2543 |
| 1376 | Ga0495612_0137893 | 3300053078 | Bacteria | 1057 |
| 1377 | Ga0500635_0014749 | 3300053080 | Bacteria | 2296 |
| 1378 | Ga0495595_0000267 | 3300053084 | Bacteria | 20599 |
| 1379 | Ga0495595_0001389 | 3300053084 | Bacteria | 9386 |
| 1380 | Ga0495595_0048915 | 3300053084 | Bacteria | 1954 |
| 1381 | Ga0495619_0000434 | 3300053085 | Bacteria | 28423 |
| 1382 | Ga0495619_0000491 | 3300053085 | Bacteria | 26518 |
| 1383 | Ga0495619_0037925 | 3300053085 | Bacteria | 3143 |
| 1384 | Ga0495619_0055342 | 3300053085 | Bacteria | 2627 |
| 1385 | Ga0495619_0418464 | 3300053085 | Bacteria | 924 |
| 1386 | Ga0500643_000156 | 3300053087 | Bacteria | 68861 |
| 1387 | Ga0500643_011270 | 3300053087 | Bacteria | 3270 |
| 1388 | Ga0500643_032107 | 3300053087 | Bacteria | 1596 |
| 1389 | Ga0500581_083803 | 3300053089 | Bacteria | 1588 |
| 1390 | Ga0500646_0008643 | 3300053090 | Bacteria | 2607 |
| 1391 | Ga0500647_0067702 | 3300053091 | Bacteria | 1717 |
| 1392 | Ga0500651_0061060 | 3300053093 | Bacteria | 2355 |
| 1393 | Ga0500651_0087129 | 3300053093 | Bacteria | 1927 |
| 1394 | Ga0500651_0152455 | 3300053093 | Bacteria | 1387 |
| 1395 | Ga0500651_0189508 | 3300053093 | Bacteria | 1218 |
| 1396 | Ga0500566_0000091 | 3300053094 | Bacteria | 45305 |
| 1397 | Ga0500566_0000990 | 3300053094 | Bacteria | 16360 |
| 1398 | Ga0500566_0031382 | 3300053094 | Bacteria | 3098 |
| 1399 | Ga0500566_0095435 | 3300053094 | Bacteria | 1638 |
| 1400 | Ga0500566_0183280 | 3300053094 | Bacteria | 1072 |
| 1401 | Ga0500640_139350 | 3300053095 | Bacteria | 944 |
| 1402 | Ga0500641_0014068 | 3300053096 | Bacteria | 2948 |
| 1403 | Ga0500641_0034873 | 3300053096 | Bacteria | 2005 |
| 1404 | Ga0500641_0068022 | 3300053096 | Bacteria | 1494 |
| 1405 | Ga0500641_0151612 | 3300053096 | Bacteria | 1000 |
| 1406 | Ga0500650_0001832 | 3300053098 | Bacteria | 6668 |
| 1407 | Ga0500650_0172716 | 3300053098 | Bacteria | 993 |
| 1408 | Ga0500554_002104 | 3300053102 | Bacteria | 3861 |
| 1409 | Ga0500555_000933 | 3300053103 | Bacteria | 10224 |
| 1410 | Ga0500556_0000002 | 3300053104 | Bacteria | 773626 |
| 1411 | Ga0500556_0000048 | 3300053104 | Bacteria | 123558 |
| 1412 | Ga0500556_0004481 | 3300053104 | Bacteria | 3972 |
| 1413 | Ga0500556_0122004 | 3300053104 | Bacteria | 1017 |
| 1414 | Ga0500557_000024 | 3300053105 | Bacteria | 84960 |
| 1415 | Ga0500562_012516 | 3300053108 | Bacteria | 2158 |
| 1416 | Ga0500562_063985 | 3300053108 | Bacteria | 989 |
| 1417 | Ga0500562_071229 | 3300053108 | Bacteria | 938 |
| 1418 | Ga0500572_000309 | 3300053111 | Bacteria | 17365 |
| 1419 | Ga0500572_021886 | 3300053111 | Bacteria | 1698 |
| 1420 | Ga0500594_0023064 | 3300053118 | Bacteria | 1574 |
| 1421 | Ga0500594_0025817 | 3300053118 | Bacteria | 1509 |
| 1422 | Ga0500595_000698 | 3300053119 | Bacteria | 20065 |
| 1423 | Ga0500595_002243 | 3300053119 | Bacteria | 9798 |
| 1424 | Ga0500595_003813 | 3300053119 | Bacteria | 6931 |
| 1425 | Ga0500595_006478 | 3300053119 | Bacteria | 4961 |
| 1426 | Ga0500595_078728 | 3300053119 | Bacteria | 967 |
| 1427 | Ga0500607_030662 | 3300053121 | Bacteria | 2964 |
| 1428 | Ga0500607_118822 | 3300053121 | Bacteria | 1282 |
| 1429 | Ga0500608_000584 | 3300053122 | Bacteria | 13396 |
| 1430 | Ga0500614_012060 | 3300053123 | Bacteria | 1879 |
| 1431 | Ga0500642_0000093 | 3300053130 | Bacteria | 44347 |
| 1432 | Ga0500642_0000107 | 3300053130 | Bacteria | 40189 |
| 1433 | Ga0500642_0071711 | 3300053130 | Bacteria | 1577 |
| 1434 | Ga0500652_000219 | 3300053131 | Bacteria | 21936 |
| 1435 | Ga0500655_003619 | 3300053133 | Bacteria | 2784 |
| 1436 | Ga0500655_008426 | 3300053133 | Bacteria | 1856 |
| 1437 | Ga0500658_0038875 | 3300053134 | Bacteria | 1898 |
| 1438 | Ga0500658_0152483 | 3300053134 | Bacteria | 1042 |
| 1439 | Ga0500559_0000341 | 3300053136 | Bacteria | 34924 |
| 1440 | Ga0500559_0001261 | 3300053136 | Bacteria | 14832 |
| 1441 | Ga0500559_0058481 | 3300053136 | Bacteria | 1714 |
| 1442 | Ga0500568_0000835 | 3300053139 | Bacteria | 21662 |
| 1443 | Ga0500568_0001045 | 3300053139 | Bacteria | 18906 |
| 1444 | Ga0500568_0005007 | 3300053139 | Bacteria | 6946 |
| 1445 | Ga0500568_0020371 | 3300053139 | Bacteria | 2869 |
| 1446 | Ga0500568_0047844 | 3300053139 | Bacteria | 1693 |
| 1447 | Ga0500568_0068906 | 3300053139 | Bacteria | 1357 |
| 1448 | Ga0500577_0000212 | 3300053142 | Bacteria | 15416 |
| 1449 | Ga0500586_096995 | 3300053145 | Bacteria | 1033 |
| 1450 | Ga0500589_059000 | 3300053147 | Bacteria | 1762 |
| 1451 | Ga0500590_171896 | 3300053148 | Bacteria | 951 |
| 1452 | Ga0500603_031274 | 3300053150 | Bacteria | 1374 |
| 1453 | Ga0500604_0007304 | 3300053151 | Bacteria | 2926 |
| 1454 | Ga0500616_0000045 | 3300053153 | Bacteria | 339292 |
| 1455 | Ga0500616_0000069 | 3300053153 | Bacteria | 234334 |
| 1456 | Ga0500616_0051836 | 3300053153 | Bacteria | 2160 |
| 1457 | Ga0500616_0101308 | 3300053153 | Bacteria | 1407 |
| 1458 | Ga0500622_0001388 | 3300053156 | Bacteria | 19505 |
| 1459 | Ga0500622_0015344 | 3300053156 | Bacteria | 4102 |
| 1460 | Ga0500624_014333 | 3300053157 | Bacteria | 1198 |
| 1461 | Ga0500627_0007562 | 3300053158 | Bacteria | 3796 |
| 1462 | Ga0500627_0055077 | 3300053158 | Bacteria | 1740 |
| 1463 | Ga0500627_0090051 | 3300053158 | Bacteria | 1373 |
| 1464 | Ga0500627_0126335 | 3300053158 | Bacteria | 1154 |
| 1465 | Ga0500634_0013070 | 3300053161 | Bacteria | 4344 |
| 1466 | Ga0500634_0047748 | 3300053161 | Bacteria | 2311 |
| 1467 | Ga0500634_0102260 | 3300053161 | Bacteria | 1431 |
| 1468 | Ga0500634_0108303 | 3300053161 | Bacteria | 1376 |
| 1469 | Ga0500638_000254 | 3300053162 | Bacteria | 11662 |
| 1470 | Ga0500638_197403 | 3300053162 | Bacteria | 854 |
| 1471 | Ga0500636_0003270 | 3300053177 | Bacteria | 9084 |
| 1472 | Ga0500636_0009247 | 3300053177 | Bacteria | 5728 |
| 1473 | Ga0500636_0069854 | 3300053177 | Bacteria | 2038 |
| 1474 | Ga0500636_0111330 | 3300053177 | Bacteria | 1546 |
| 1475 | Ga0500636_0128535 | 3300053177 | Bacteria | 1414 |
| 1476 | Ga0500636_0241309 | 3300053177 | Bacteria | 928 |
| 1477 | Ga0500637_0000216 | 3300053178 | Bacteria | 21533 |
| 1478 | Ga0500637_0006416 | 3300053178 | Bacteria | 5791 |
| 1479 | Ga0500637_0175014 | 3300053178 | Bacteria | 1232 |
| 1480 | Ga0500576_054740 | 3300053725 | Bacteria | 1760 |
| 1481 | Ga0500611_005568 | 3300053727 | Bacteria | 1782 |
| 1482 | Ga0500611_021866 | 3300053727 | Bacteria | 1226 |
| 1483 | Ga0500645_046945 | 3300053730 | Bacteria | 1266 |
| 1484 | Ga0500645_077583 | 3300053730 | Bacteria | 949 |
| 1485 | Ga0500599_000719 | 3300053736 | Bacteria | 3586 |
| 1486 | Ga0500601_000724 | 3300053737 | Bacteria | 4349 |
| 1487 | Ga0501084_0001610 | 3300054114 | Bacteria | 17890 |
| 1488 | Ga0501084_0062496 | 3300054114 | Bacteria | 3117 |
| 1489 | Ga0501084_0151219 | 3300054114 | Bacteria | 1957 |
| 1490 | Ga0500661_019441 | 3300055283 | Bacteria | 1209 |
| 1491 | Ga0501082_0000084 | 3300060353 | Bacteria | 70644 |
| 1492 | Ga0501082_0015760 | 3300060353 | Bacteria | 6502 |
| 1493 | Ga0501082_0068493 | 3300060353 | Bacteria | 3055 |
| 1494 | Ga0501082_0260001 | 3300060353 | Bacteria | 1510 |
| 1495 | Ga0501082_0277094 | 3300060353 | Bacteria | 1460 |
| 1496 | Ga0530510_0063518 | 3300061734 | Bacteria | 2673 |
| 1497 | 2507509238 | 2507262055 | Bacteria | 8048963 |
| 1498 | 2508543307 | 2508501009 | Bacteria | 7784016 |
| 1499 | 2508690944 | 2508501042 | Bacteria | 8719808 |
| 1500 | 2509147412 | 2508501128 | Bacteria | 8613869 |
| 1501 | 2511397211 | 2511231028 | Bacteria | 8046582 |
| 1502 | 2513646771 | 2513237095 | Bacteria | 8976980 |
| 1503 | 2513656784 | 2513237096 | Bacteria | 8722461 |
| 1504 | 2513677825 | 2513237098 | Bacteria | 9902361 |
| 1505 | 2513691937 | 2513237101 | Bacteria | 7952346 |
| 1506 | 2513717246 | 2513237104 | Bacteria | 10034502 |
| 1507 | 2513857973 | 2513237137 | Bacteria | 9558895 |
| 1508 | 2513876592 | 2513237139 | Bacteria | 8737671 |
| 1509 | 2513892807 | 2513237141 | Bacteria | 8496279 |
| 1510 | 2513917969 | 2513237145 | Bacteria | 8979722 |
| 1511 | 2515626656 | 2515154112 | Bacteria | 8294334 |
| 1512 | 2517101891 | 2517093001 | Bacteria | 9002274 |
| 1513 | 2517892985 | 2517572143 | Bacteria | 9484767 |
| 1514 | 2524465192 | 2524023210 | Bacteria | 9029266 |
| 1515 | 2528852246 | 2528768022 | Bacteria | 10457665 |
| 1516 | 2599720702 | 2599185236 | Bacteria | 6875203 |
| 1517 | 2603858934 | 2602042107 | Bacteria | 6226103 |
| 1518 | 2643756320 | 2643221547 | Bacteria | 4740017 |
| 1519 | 2644132141 | 2643221623 | Bacteria | 5239945 |
| 1520 | 2671117610 | 2667528175 | Bacteria | 7532676 |
| 1521 | 2723845668 | 2721755755 | Bacteria | 8322773 |
| 1522 | 2728750442 | 2728368998 | Bacteria | 8720350 |
| 1523 | 2793073026 | 2791355197 | Bacteria | 8420563 |
| 1524 | 2793081777 | |||
| 1525 | 2805919847 | 2802429603 | Bacteria | 8777136 |
| 1526 | 2818242850 | 2816332527 | Bacteria | 8933356 |
| 1527 | 2824606036 | 2824600985 | Bacteria | 8488197 |
| 1528 | 2824615975 | 2824609381 | Bacteria | 8672835 |
| 1529 | 2824658878 | 2824653114 | Bacteria | 8493680 |
| 1530 | 2824667765 | 2824661429 | Bacteria | 9877870 |
| 1531 | 2824676155 | 2824671348 | Bacteria | 8369588 |
| 1532 | 2824691828 | 2824687955 | Bacteria | 8360029 |
| 1533 | 2824699443 | 2824696289 | Bacteria | 8335049 |
| 1534 | 2824710419 | 2824704595 | Bacteria | 9667483 |
| 1535 | 2824761129 | 2824753945 | Bacteria | 9787441 |
| 1536 | 2824771181 | 2824763712 | Bacteria | 9792355 |
| 1537 | 2824779335 | 2824773399 | Bacteria | 8360218 |
| 1538 | 2837653779 | 2837651117 | Bacteria | 3772164 |
| 1539 | 2841958093 | 2841957949 | Bacteria | 8652217 |
| 1540 | 2844318476 | 2844315083 | Bacteria | 8138177 |
| 1541 | 2847935366 | 2847930680 | Bacteria | 9342022 |
| 1542 | 2847945974 | 2847939898 | Bacteria | 8606328 |
| 1543 | 2857513691 | 2857509624 | Bacteria | 7472071 |
| 1544 | 2857527959 | 2857524615 | Bacteria | 6615449 |
| 1545 | 2874597363 | 2874590934 | Bacteria | 8299676 |
| 1546 | 2874609710 | 2874604998 | Bacteria | 7834745 |
| 1547 | 2874626732 | 2874620515 | Bacteria | 8290088 |
| 1548 | 2874649304 | 2874645413 | Bacteria | 8214782 |
| 1549 | 2876777840 | 2876771140 | Bacteria | 8287509 |
| 1550 | 2876811821 | 2876808645 | Bacteria | 8824342 |
| 1551 | 2876823139 | 2876818435 | Bacteria | 8274608 |
| 1552 | 2879078597 | 2879074833 | Bacteria | 8279565 |
| 1553 | 2879088559 | 2879083081 | Bacteria | 8587928 |
| 1554 | 2879108058 | 2879099564 | Bacteria | 10442239 |
| 1555 | 2879118417 | 2879110137 | Bacteria | 8907982 |
| 1556 | 2879132926 | 2879127579 | Bacteria | 8294491 |
| 1557 | 2879148725 | 2879142872 | Bacteria | 8267021 |
| 1558 | 2883294375 | 2883291878 | Bacteria | 5894118 |
| 1559 | 2885371909 | 2885366525 | Bacteria | 8326213 |
| 1560 | 2885377401 | 2885374607 | Bacteria | 8927485 |
| 1561 | 2885387649 | 2885383462 | Bacteria | 9473874 |
| 1562 | 2888383436 | 2888378607 | Bacteria | 9652610 |
| 1563 | 2888394501 | 2888388044 | Bacteria | 7304136 |
| 1564 | 2888423823 | 2888419890 | Bacteria | 7857137 |
| 1565 | 2889040474 | 2889033259 | Bacteria | 9099371 |
| 1566 | 2893068376 | 2893066018 | Bacteria | 6158120 |
| 1567 | 2903730159 | 2903727486 | Bacteria | 8281579 |
| 1568 | 2903751990 | 2903748898 | Bacteria | 9972761 |
| 1569 | 2903778328 | 2903768456 | Bacteria | 9749579 |
| 1570 | 2904668310 | 2904666416 | Bacteria | 8226587 |
| 1571 | 2904696335 | 2904690495 | Bacteria | 9412302 |
| 1572 | 2904703152 | |||
| 1573 | 2904717271 | 2904711408 | Bacteria | 9771557 |
| 1574 | 2906603544 | 2906602504 | Bacteria | 8295279 |
| 1575 | 2906618021 | |||
| 1576 | 2906632451 | 2906626472 | Bacteria | 8826946 |
| 1577 | 2906636048 | 2906635258 | Bacteria | 8601019 |
| 1578 | 2906646302 | 2906643746 | Bacteria | 8722424 |
| 1579 | 2906661508 | 2906660503 | Bacteria | 8595048 |
| 1580 | 2908760882 | 2908756301 | Bacteria | 8864324 |
| 1581 | 2909043908 | 2909042592 | Bacteria | 6499737 |
| 1582 | 2919075360 | 2919073203 | Bacteria | 6531949 |
| 1583 | 2922368355 | 2922361189 | Bacteria | 7436256 |
| 1584 | 2922373619 | |||
| 1585 | 2922388196 | 2922386360 | Bacteria | 7017218 |
| 1586 | 2922429518 | |||
| 1587 | 2928535341 | 2928531327 | Bacteria | 5101314 |
| 1588 | 2929617354 | 2929615660 | Bacteria | 9193770 |
| 1589 | 2929627059 | 2929624759 | Bacteria | 9339455 |
| 1590 | 2932787610 | 2932784394 | Bacteria | 9704911 |
| 1591 | 2932813209 | 2932809354 | Bacteria | 9135765 |
| 1592 | 2932820876 | 2932818245 | Bacteria | 9955613 |
| 1593 | 2932834757 | 2932828146 | Bacteria | 9745859 |
| 1594 | 2933579311 | 2933577622 | Bacteria | 9116884 |
| 1595 | 2935611874 | 2935608549 | Bacteria | 8203142 |
| 1596 | 2935621716 | 2935616580 | Bacteria | 9032984 |
| 1597 | 2935642666 | 2935638405 | Bacteria | 10015038 |
| 1598 | 2935667768 | 2935665750 | Bacteria | 9571747 |
| 1599 | 2935682258 | 2935675223 | Bacteria | 9928132 |
| 1600 | 2935688513 | 2935684952 | Bacteria | 9590419 |
| 1601 | 2935695863 | 2935694250 | Bacteria | 9291695 |
| 1602 | 2935706608 | 2935703347 | Bacteria | 10242284 |
| 1603 | 2935715532 | 2935713505 | Bacteria | 9608509 |
| 1604 | 2935725904 | 2935722832 | Bacteria | 9608746 |
| 1605 | 2935734351 | 2935732158 | Bacteria | 9706831 |
| 1606 | 2935743730 | 2935741537 | Bacteria | 9707219 |
| 1607 | 2935754233 | 2935750917 | Bacteria | 9590372 |
| 1608 | 2935768407 | 2935760218 | Bacteria | 9817913 |
| 1609 | 2935772647 | 2935769743 | Bacteria | 7878163 |
| 1610 | 2935783197 | 2935777560 | Bacteria | 8077691 |
| 1611 | 2935790940 | 2935785616 | Bacteria | 7962367 |
| 1612 | 2935799359 | 2935793552 | Bacteria | 8012592 |
| 1613 | 2935806425 | 2935801545 | Bacteria | 9301974 |
| 1614 | 2935813017 | 2935810662 | Bacteria | 9401221 |
| 1615 | 2935821354 | 2935819856 | Bacteria | 8261050 |
| 1616 | 2935830669 | 2935827899 | Bacteria | 10038562 |
| 1617 | 2935840698 | 2935837841 | Bacteria | 9454360 |
| 1618 | 2935850387 | 2935847175 | Bacteria | 8228321 |
| 1619 | 2935859963 | 2935855204 | Bacteria | 9035059 |
| 1620 | 2935869402 | 2935864058 | Bacteria | 9784707 |
| 1621 | 2935880437 | 2935873716 | Bacteria | 9632195 |
| 1622 | 2935914003 | 2935908558 | Bacteria | 8568796 |
| 1623 | 2935921145 | 2935916978 | Bacteria | 9113783 |
| 1624 | 2935931809 | 2935926038 | Bacteria | 8601059 |
| 1625 | 2935940256 | 2935934488 | Bacteria | 8602579 |
| 1626 | 2935947919 | 2935942939 | Bacteria | 8599779 |
| 1627 | 2935956540 | 2935951376 | Bacteria | 8602333 |
| 1628 | 2935960349 | 2935959822 | Bacteria | 7869783 |
| 1629 | 2935973334 | 2935967501 | Bacteria | 8603075 |
| 1630 | 2935977585 | 2935975950 | Bacteria | 8347125 |
| 1631 | 2935989495 | 2935984226 | Bacteria | 8302647 |
| 1632 | 2935999491 | 2935992306 | Bacteria | 9802711 |
| 1633 | 2936006526 | 2936002035 | Bacteria | 9362176 |
| 1634 | 2936041605 | 2936037263 | Bacteria | 9446081 |
| 1635 | 2937846136 | 2937843397 | Bacteria | 5256375 |
| 1636 | 2940560391 | 2940556831 | Bacteria | 9590747 |
| 1637 | 2941510505 | 2941507105 | Bacteria | 8166816 |
| 1638 | 2941517757 | 2941515067 | Bacteria | 8166720 |
| 1639 | 2941525774 | 2941523033 | Bacteria | 8169134 |
| 1640 | 2941534225 | 2941531003 | Bacteria | 7653939 |
| 1641 | 2941541172 | 2941538514 | Bacteria | 9402094 |
| 1642 | 3005479675 | 3005474847 | Bacteria | 9259049 |
| 1643 | 3005714248 | 3005710791 | Bacteria | 7622528 |
| 1644 | 8006929340 | 8006926726 | Bacteria | 6749210 |
| 1645 | 8006967303 | 8006964411 | Bacteria | 8966052 |
| 1646 | 8006990210 | 8006984368 | Bacteria | 9651211 |
| 1647 | 8006997541 | 8006994254 | Bacteria | 8309700 |
| 1648 | 8016514064 | 8016511872 | Bacteria | 9921665 |
| 1649 | 8016530249 | 8016522445 | Bacteria | 8156687 |
| 1650 | 8016535508 | 8016530956 | Bacteria | 8155261 |
| 1651 | 8016548703 | 8016539877 | Bacteria | 8155419 |
| 1652 | 8016553431 | 8016548790 | Bacteria | 8155074 |
| 1653 | 8016561807 | 8016557553 | Bacteria | 8154380 |
| 1654 | 8016577964 | 8016575299 | Bacteria | 8154085 |
| 1655 | 8016599642 | 8016595262 | Bacteria | 8149947 |
| 1656 | 8016622429 | 8016613128 | Bacteria | 8794220 |
| 1657 | 8016627356 | 8016622563 | Bacteria | 7999408 |
| 1658 | 8016631658 | 8016630954 | Bacteria | 9217207 |
| 1659 | 8017062347 | 8017057580 | Bacteria | 10023680 |
| 1660 | 8019535240 | 8019530166 | Bacteria | 8155624 |
| 1661 | 8019544242 | 8019538911 | Bacteria | 7872763 |
| 1662 | 8019554460 | 8019547302 | Bacteria | 7996444 |
| 1663 | 8019557347 | 8019555841 | Bacteria | 9642137 |
| 1664 | 8019567952 | 8019565922 | Bacteria | 9639779 |
| 1665 | 8019581802 | 8019576017 | Bacteria | 10049540 |
| 1666 | 8019589476 | 8019586578 | Bacteria | 10212056 |
| 1667 | 8019616762 | 8019608314 | Bacteria | 10042931 |
| 1668 | 8019627453 | 8019619141 | Bacteria | 9218857 |
| 1669 | 8019635121 | 8019629233 | Bacteria | 8687553 |
| 1670 | 8019644607 | 8019638758 | Bacteria | 9062356 |
| 1671 | 8019657628 | 8019648815 | Bacteria | 10014479 |
| 1672 | 8019662963 | 8019659431 | Bacteria | 8577854 |
| 1673 | 8019672562 | 8019668869 | Bacteria | 8791617 |
| 1674 | 8019683596 | 8019678201 | Bacteria | 8863603 |
| 1675 | 8019689340 | 8019687851 | Bacteria | 8712826 |
| 1676 | 8055747031 | 8055742211 | Bacteria | 9226248 |
| 1677 | 8056674415 | 8056673599 | Bacteria | 7871253 |
| 1678 | 8056683323 | 8056681323 | Bacteria | 8472857 |
| 1679 | 8056690093 | 8056689827 | Bacteria | 6712655 |
| 1680 | Ga0209179_1024849 | |||
| 1681 | JGI24738J21930_10006044 | |||
| 1682 | JGI25406J46586_10001492 | |||
| 1683 | JGI25153J46596_10009281 | |||
| 1684 | JGI25153J46596_10009680 | |||
| 1685 | JGI25153J46596_10014678 | |||
| 1686 | JGI25153J46596_10015191 | |||
| 1687 | JGI25160J50197_1008733 | |||
| 1688 | JGI25160J50197_1011756 | |||
| 1689 | JGI25404J52841_10015065 | |||
| 1690 | Ga0055530_10010917 | |||
| 1691 | Ga0055531_10001195 | |||
| 1692 | Ga0055531_10003993 | |||
| 1693 | Ga0070658_10338462 | |||
| 1694 | Ga0070658_10384769 | |||
| 1695 | Ga0070676_10013022 | |||
| 1696 | Ga0070683_100276774 | |||
| 1697 | Ga0070690_100331020 | |||
| 1698 | Ga0070670_100193124 | |||
| 1699 | Ga0070670_100350836 | |||
| 1700 | Ga0068869_100102291 | |||
| 1701 | Ga0068869_100114761 | |||
| 1702 | Ga0070680_100013526 | |||
| 1703 | Ga0070680_100016985 | |||
| 1704 | Ga0070680_100175148 | |||
| 1705 | Ga0070680_100435939 | |||
| 1706 | Ga0070682_100036640 | |||
| 1707 | Ga0070682_100264717 | |||
| 1708 | Ga0068868_100003958 | |||
| 1709 | Ga0068868_100011518 | |||
| 1710 | Ga0070660_100017870 | |||
| 1711 | Ga0070689_100064814 | |||
| 1712 | Ga0070691_10083779 | |||
| 1713 | Ga0070661_100101272 | |||
| 1714 | Ga0070668_100042528 | |||
| 1715 | Ga0070668_100153283 | |||
| 1716 | Ga0070668_100268800 | |||
| 1717 | Ga0070669_100090979 | |||
| 1718 | Ga0070669_100527332 | |||
| 1719 | Ga0070675_100187545 | |||
| 1720 | Ga0070671_100011296 | |||
| 1721 | Ga0070671_100015678 | |||
| 1722 | Ga0070671_100086510 | |||
| 1723 | Ga0070674_100026165 | |||
| 1724 | Ga0070673_100425115 | |||
| 1725 | Ga0070688_100006780 | |||
| 1726 | Ga0070688_100028217 | |||
| 1727 | Ga0070659_100050790 | |||
| 1728 | Ga0070667_100028910 | |||
| 1729 | Ga0070667_100087889 | |||
| 1730 | Ga0070709_10005966 | |||
| 1731 | Ga0070709_10007727 | |||
| 1732 | Ga0070709_10015676 | |||
| 1733 | Ga0070709_10154349 | |||
| 1734 | Ga0070709_10611680 | |||
| 1735 | Ga0070714_100009892 | |||
| 1736 | Ga0070714_100029375 | |||
| 1737 | Ga0070714_100036016 | |||
| 1738 | Ga0070714_100088688 | |||
| 1739 | Ga0070714_100130627 | |||
| 1740 | Ga0070713_100004379 | |||
| 1741 | Ga0070713_100010400 | |||
| 1742 | Ga0070713_100021269 | |||
| 1743 | Ga0070713_100074356 | |||
| 1744 | Ga0070713_100101791 | |||
| 1745 | Ga0070713_100467968 | |||
| 1746 | Ga0070710_10000344 | |||
| 1747 | Ga0070710_10000395 | |||
| 1748 | Ga0070710_10007756 | |||
| 1749 | Ga0070710_10013495 | |||
| 1750 | Ga0070701_10086418 | |||
| 1751 | Ga0070711_100000702 | |||
| 1752 | Ga0070711_100013855 | |||
| 1753 | Ga0070711_100054002 | |||
| 1754 | Ga0070711_100154357 | |||
| 1755 | Ga0070711_100263486 | |||
| 1756 | Ga0070663_100007150 | |||
| 1757 | Ga0070663_100027479 | |||
| 1758 | Ga0070663_100162013 | |||
| 1759 | Ga0070663_100227965 | |||
| 1760 | Ga0070678_100009881 | |||
| 1761 | Ga0070678_100034185 | |||
| 1762 | Ga0070678_100092332 | |||
| 1763 | Ga0070662_100117538 | |||
| 1764 | Ga0070662_100307659 | |||
| 1765 | Ga0070662_100323031 | |||
| 1766 | Ga0070681_10203620 | |||
| 1767 | Ga0070681_10209729 | |||
| 1768 | Ga0070681_10358218 | |||
| 1769 | Ga0070685_10007975 | |||
| 1770 | Ga0070685_10030623 | |||
| 1771 | Ga0070685_10201983 | |||
| 1772 | Ga0070679_100028788 | |||
| 1773 | Ga0070679_100056398 | |||
| 1774 | Ga0070679_100243480 | |||
| 1775 | Ga0070684_100021896 | |||
| 1776 | Ga0070684_100032076 | |||
| 1777 | Ga0070684_100141149 | |||
| 1778 | Ga0070684_100456791 | |||
| 1779 | Ga0068853_100007032 | |||
| 1780 | Ga0068853_100018974 | |||
| 1781 | Ga0068853_100290030 | |||
| 1782 | Ga0068853_100514028 | |||
| 1783 | Ga0070672_100115669 | |||
| 1784 | Ga0070672_100269487 | |||
| 1785 | Ga0070672_100414845 | |||
| 1786 | Ga0070672_100629406 | |||
| 1787 | Ga0070686_100012110 | |||
| 1788 | Ga0070695_100267217 | |||
| 1789 | Ga0070696_100225617 | |||
| 1790 | Ga0070693_100034460 | |||
| 1791 | Ga0070665_100016641 | |||
| 1792 | Ga0070665_100099989 | |||
| 1793 | Ga0070665_100123757 | |||
| 1794 | Ga0070665_100259127 | |||
| 1795 | Ga0070665_100266730 | |||
| 1796 | Ga0070665_100392500 | |||
| 1797 | Ga0070665_100739589 | |||
| 1798 | Ga0068855_100024338 | |||
| 1799 | Ga0068855_100043049 | |||
| 1800 | Ga0068855_100049847 | |||
| 1801 | Ga0068855_100076413 | |||
| 1802 | Ga0068855_100101580 | |||
| 1803 | Ga0068855_100132096 | |||
| 1804 | Ga0068855_100162720 | |||
| 1805 | Ga0068855_100482974 | |||
| 1806 | Ga0070664_100198428 | |||
| 1807 | Ga0068857_100024325 | |||
| 1808 | Ga0068857_100071597 | |||
| 1809 | Ga0068857_100192669 | |||
| 1810 | Ga0068857_100400913 | |||
| 1811 | Ga0068854_100015803 | |||
| 1812 | Ga0068856_100007904 | |||
| 1813 | Ga0068856_100063923 | |||
| 1814 | Ga0068856_100086868 | |||
| 1815 | Ga0068856_100153160 | |||
| 1816 | Ga0068856_100224895 | |||
| 1817 | Ga0068856_100549921 | |||
| 1818 | Ga0068852_100063265 | |||
| 1819 | Ga0068859_100058087 | |||
| 1820 | Ga0068859_100100410 | |||
| 1821 | Ga0068859_100978039 | |||
| 1822 | Ga0068864_100050145 | |||
| 1823 | Ga0068864_100058520 | |||
| 1824 | Ga0068864_100186187 | |||
| 1825 | Ga0068864_100426410 | |||
| 1826 | Ga0068866_10111148 | |||
| 1827 | Ga0068866_10175444 | |||
| 1828 | Ga0068866_10186540 | |||
| 1829 | Ga0068866_10304992 | |||
| 1830 | Ga0068861_100153715 | |||
| 1831 | Ga0068861_100180027 | |||
| 1832 | Ga0068861_100447729 | |||
| 1833 | Ga0068851_10006063 | |||
| 1834 | Ga0068863_100237338 | |||
| 1835 | Ga0068863_100273758 | |||
| 1836 | Ga0068858_100047295 | |||
| 1837 | Ga0068858_100406507 | |||
| 1838 | Ga0068858_100486121 | |||
| 1839 | Ga0068860_100000497 | |||
| 1840 | Ga0068860_100080702 | |||
| 1841 | Ga0068860_100211082 | |||
| 1842 | Ga0068860_100462526 | |||
| 1843 | Ga0068862_100245860 | |||
| 1844 | Ga0068862_100365685 | |||
| 1845 | Ga0081455_10001069 | |||
| 1846 | Ga0081455_10012384 | |||
| 1847 | Ga0081455_10016028 | |||
| 1848 | Ga0081455_10021328 | |||
| 1849 | Ga0081455_10026882 | |||
| 1850 | Ga0081455_10047175 | |||
| 1851 | Ga0081455_10057286 | |||
| 1852 | Ga0081538_10004388 | |||
| 1853 | Ga0081538_10038370 | |||
| 1854 | Ga0081538_10054726 | |||
| 1855 | Ga0081540_1002393 | |||
| 1856 | Ga0081540_1003961 | |||
| 1857 | Ga0081540_1005402 | |||
| 1858 | Ga0081540_1013623 | |||
| 1859 | Ga0081540_1016233 | |||
| 1860 | Ga0081540_1020841 | |||
| 1861 | Ga0081540_1025112 | |||
| 1862 | Ga0081540_1031237 | |||
| 1863 | Ga0081540_1034946 | |||
| 1864 | Ga0081540_1058821 | |||
| 1865 | Ga0081540_1136757 | |||
| 1866 | Ga0081539_10000379 | |||
| 1867 | Ga0081539_10001555 | |||
| 1868 | Ga0081539_10018827 | |||
| 1869 | Ga0070717_10000224 | |||
| 1870 | Ga0070717_10002876 | |||
| 1871 | Ga0070717_10057087 | |||
| 1872 | Ga0070717_10072326 | |||
| 1873 | Ga0070717_10106427 | |||
| 1874 | Ga0070717_10107691 | |||
| 1875 | Ga0075365_10001527 | |||
| 1876 | Ga0075365_10031975 | |||
| 1877 | Ga0075365_10042446 | |||
| 1878 | Ga0075365_10066502 | |||
| 1879 | Ga0075365_10073284 | |||
| 1880 | Ga0075365_10118132 | |||
| 1881 | Ga0075365_10126379 | |||
| 1882 | Ga0075365_10258049 | |||
| 1883 | Ga0075368_10002837 | |||
| 1884 | Ga0075368_10005831 | |||
| 1885 | Ga0075368_10020493 | |||
| 1886 | Ga0075368_10032889 | |||
| 1887 | Ga0075368_10048271 | |||
| 1888 | Ga0075368_10080844 | |||
| 1889 | Ga0075363_100010269 | |||
| 1890 | Ga0075363_100017003 | |||
| 1891 | Ga0075363_100213795 | |||
| 1892 | Ga0075364_10039692 | |||
| 1893 | Ga0075364_10050143 | |||
| 1894 | Ga0075364_10060728 | |||
| 1895 | Ga0070715_10001633 | |||
| 1896 | Ga0070716_100004798 | |||
| 1897 | Ga0070716_100010255 | |||
| 1898 | Ga0070716_100013159 | |||
| 1899 | Ga0070716_100098727 | |||
| 1900 | Ga0070716_100108952 | |||
| 1901 | Ga0070716_100277977 | |||
| 1902 | Ga0070712_100009415 | |||
| 1903 | Ga0070712_100108299 | |||
| 1904 | Ga0070712_100181556 | |||
| 1905 | Ga0070712_100303697 | |||
| 1906 | Ga0070712_100633261 | |||
| 1907 | Ga0075362_10005833 | |||
| 1908 | Ga0075367_10012090 | |||
| 1909 | Ga0075367_10240836 | |||
| 1910 | Ga0075367_10241596 | |||
| 1911 | Ga0075369_10049416 | |||
| 1912 | Ga0075366_10011006 | |||
| 1913 | Ga0075366_10068704 | |||
| 1914 | Ga0075366_10084529 | |||
| 1915 | Ga0075366_10095194 | |||
| 1916 | Ga0097621_100028885 | |||
| 1917 | Ga0097621_100348408 | |||
| 1918 | Ga0075370_10052522 | |||
| 1919 | Ga0075370_10089873 | |||
| 1920 | Ga0075370_10176574 | |||
| 1921 | Ga0068871_100042230 | |||
| 1922 | Ga0075428_100074465 | |||
| 1923 | Ga0075428_100897466 | |||
| 1924 | Ga0075430_100024425 | |||
| 1925 | Ga0075434_100007100 | |||
| 1926 | Ga0075434_100330546 | |||
| 1927 | Ga0075434_100460050 | |||
| 1928 | Ga0075434_100613723 | |||
| 1929 | Ga0068865_100367686 | |||
| 1930 | Ga0075436_100081189 | |||
| 1931 | Ga0075436_100345800 | |||
| 1932 | Ga0097620_100058087 | |||
| 1933 | Ga0097620_100100398 | |||
| 1934 | Ga0097620_100977842 | |||
| 1935 | Ga0099824_1003889 | |||
| 1936 | Ga0099822_1018677 | |||
| 1937 | Ga0099823_1024679 | |||
| 1938 | Ga0075435_100087656 | |||
| 1939 | Ga0099794_10003317 | |||
| 1940 | Ga0099794_10098671 | |||
| 1941 | Ga0099795_10003094 | |||
| 1942 | Ga0099795_10028013 | |||
| 1943 | Ga0105244_10074608 | |||
| 1944 | Ga0105240_10003456 | |||
| 1945 | Ga0105240_10012909 | |||
| 1946 | Ga0105240_10043532 | |||
| 1947 | Ga0105240_10071555 | |||
| 1948 | Ga0105240_10094483 | |||
| 1949 | Ga0105240_10209403 | |||
| 1950 | Ga0105240_10287268 | |||
| 1951 | Ga0105240_10354146 | |||
| 1952 | Ga0105240_10631035 | |||
| 1953 | Ga0111539_10041513 | |||
| 1954 | Ga0111539_10273642 | |||
| 1955 | Ga0111539_10288746 | |||
| 1956 | Ga0111539_10313558 | |||
| 1957 | Ga0111539_10656131 | |||
| 1958 | Ga0105245_10048518 | |||
| 1959 | Ga0105245_10062478 | |||
| 1960 | Ga0105245_10295203 | |||
| 1961 | Ga0105245_10898606 | |||
| 1962 | Ga0105247_10033948 | |||
| 1963 | Ga0105247_10107324 | |||
| 1964 | Ga0105247_10310290 | |||
| 1965 | Ga0114129_10099524 | |||
| 1966 | Ga0114129_10100119 | |||
| 1967 | Ga0114129_10258935 | |||
| 1968 | Ga0105243_10042136 | |||
| 1969 | Ga0105241_10029805 | |||
| 1970 | Ga0105241_10082586 | |||
| 1971 | Ga0105241_10322680 | |||
| 1972 | Ga0105241_10375461 | |||
| 1973 | Ga0105241_10509816 | |||
| 1974 | Ga0105242_10278478 | |||
| 1975 | Ga0105242_10434735 | |||
| 1976 | Ga0105248_10032228 | |||
| 1977 | Ga0105248_10088266 | |||
| 1978 | Ga0105248_10221469 | |||
| 1979 | Ga0105248_10272994 | |||
| 1980 | Ga0105248_10299459 | |||
| 1981 | Ga0105237_10083404 | |||
| 1982 | Ga0105237_10205582 | |||
| 1983 | Ga0105237_10217788 | |||
| 1984 | Ga0105237_10247229 | |||
| 1985 | Ga0105237_10469786 | |||
| 1986 | Ga0105238_10015239 | |||
| 1987 | Ga0105238_10017873 | |||
| 1988 | Ga0105238_10039830 | |||
| 1989 | Ga0105238_10049070 | |||
| 1990 | Ga0105238_10056888 | |||
| 1991 | Ga0105238_10119143 | |||
| 1992 | Ga0105238_10126156 | |||
| 1993 | Ga0105238_10560042 | |||
| 1994 | Ga0105249_10088853 | |||
| 1995 | Ga0105249_10593228 | |||
| 1996 | Ga0105239_10007768 | |||
| 1997 | Ga0105239_10041053 | |||
| 1998 | Ga0105239_10047108 | |||
| 1999 | Ga0105239_10543654 | |||
| 2000 | Ga0105246_10027415 | |||
| 2001 | Ga0105246_10128931 | |||
| 2002 | Ga0105246_10142910 | |||
| 2003 | Ga0105246_10265888 | |||
| 2004 | Ga0105246_10319180 | |||
| 2005 | Ga0157339_1001999 | |||
| 2006 | Ga0157373_10054578 | |||
| 2007 | Ga0157373_10080298 | |||
| 2008 | Ga0157371_10087194 | |||
| 2009 | Ga0157370_10071166 | |||
| 2010 | Ga0157370_10245754 | |||
| 2011 | Ga0157369_10012284 | |||
| 2012 | Ga0157369_10047236 | |||
| 2013 | Ga0157369_10217338 | |||
| 2014 | Ga0157374_10038013 | |||
| 2015 | Ga0157374_10190078 | |||
| 2016 | Ga0157374_10733350 | |||
| 2017 | Ga0157378_10109936 | |||
| 2018 | Ga0157378_10438037 | |||
| 2019 | Ga0157378_10483300 | |||
| 2020 | Ga0163162_10117935 | |||
| 2021 | Ga0163162_10236196 | |||
| 2022 | Ga0157372_10061655 | |||
| 2023 | Ga0157372_10212623 | |||
| 2024 | Ga0157372_10462919 | |||
| 2025 | Ga0157375_10141087 | |||
| 2026 | Ga0157375_10195603 | |||
| 2027 | Ga0157375_10296391 | |||
| 2028 | Ga0157375_10514473 | |||
| 2029 | Ga0163163_10009676 | |||
| 2030 | Ga0163163_10036866 | |||
| 2031 | Ga0163163_10207624 | |||
| 2032 | Ga0163163_10288375 | |||
| 2033 | Ga0163163_10288660 | |||
| 2034 | Ga0157380_10080959 | |||
| 2035 | Ga0157380_10146325 | |||
| 2036 | Ga0157377_10189865 | |||
| 2037 | Ga0157377_10231667 | |||
| 2038 | Ga0157377_10270908 | |||
| 2039 | Ga0157379_10173043 | |||
| 2040 | Ga0157379_10249068 | |||
| 2041 | Ga0157379_10351511 | |||
| 2042 | Ga0157376_10059767 | |||
| 2043 | Ga0157376_10104151 | |||
| 2044 | Ga0157376_10116336 | |||
| 2045 | Ga0157376_10175130 | |||
| 2046 | Ga0163161_10113354 | |||
| 2047 | Ga0163161_10222549 | |||
| 2048 | Ga0163161_10239596 | |||
| 2049 | Ga0197907_11209949 | |||
| 2050 | Ga0206354_10920056 | |||
| 2051 | Ga0206353_10108935 | |||
| 2052 | Ga0209563_104891 | |||
| 2053 | Ga0209233_1002215 | |||
| 2054 | Ga0209676_1000327 | |||
| 2055 | Ga0209564_1001796 | |||
| 2056 | Ga0209564_1003203 | |||
| 2057 | Ga0209564_1047021 | |||
| 2058 | Ga0209758_1000371 | |||
| 2059 | Ga0209758_1001291 | |||
| 2060 | Ga0209758_1001559 | |||
| 2061 | Ga0209758_1003458 | |||
| 2062 | Ga0209758_1011126 | |||
| 2063 | Ga0209758_1014744 | |||
| 2064 | Ga0209758_1085607 | |||
| 2065 | Ga0209050_1001093 | |||
| 2066 | Ga0207426_1000352 | |||
| 2067 | Ga0207426_1005546 | |||
| 2068 | Ga0209257_1000609 | |||
| 2069 | Ga0207697_10014505 | |||
| 2070 | Ga0207697_10070251 | |||
| 2071 | Ga0207656_10007348 | |||
| 2072 | Ga0207682_10003960 | |||
| 2073 | Ga0207692_10000724 | |||
| 2074 | Ga0207692_10010688 | |||
| 2075 | Ga0207692_10253297 | |||
| 2076 | Ga0207642_10149832 | |||
| 2077 | Ga0207710_10005547 | |||
| 2078 | Ga0207710_10216016 | |||
| 2079 | Ga0207710_10235481 | |||
| 2080 | Ga0207688_10033354 | |||
| 2081 | Ga0207688_10054478 | |||
| 2082 | Ga0207688_10062052 | |||
| 2083 | Ga0207688_10077716 | |||
| 2084 | Ga0207680_10052069 | |||
| 2085 | Ga0207680_10124672 | |||
| 2086 | Ga0207647_10004508 | |||
| 2087 | Ga0207647_10015943 | |||
| 2088 | Ga0207647_10166333 | |||
| 2089 | Ga0207685_10000490 | |||
| 2090 | Ga0207685_10046559 | |||
| 2091 | Ga0207699_10001497 | |||
| 2092 | Ga0207699_10002390 | |||
| 2093 | Ga0207699_10021380 | |||
| 2094 | Ga0207699_10094410 | |||
| 2095 | Ga0207643_10040058 | |||
| 2096 | Ga0207705_10100992 | |||
| 2097 | Ga0207705_10243255 | |||
| 2098 | Ga0207705_10352742 | |||
| 2099 | Ga0207684_10545295 | |||
| 2100 | Ga0207654_10000344 | |||
| 2101 | Ga0207654_10034166 | |||
| 2102 | Ga0207654_10080204 | |||
| 2103 | Ga0207654_10200746 | |||
| 2104 | Ga0207707_10038828 | |||
| 2105 | Ga0207707_10103434 | |||
| 2106 | Ga0207707_10132454 | |||
| 2107 | Ga0207707_10387875 | |||
| 2108 | Ga0207695_10000015 | |||
| 2109 | Ga0207695_10000402 | |||
| 2110 | Ga0207695_10026603 | |||
| 2111 | Ga0207695_10037699 | |||
| 2112 | Ga0207695_10089621 | |||
| 2113 | Ga0207695_10148509 | |||
| 2114 | Ga0207671_10001316 | |||
| 2115 | Ga0207671_10053672 | |||
| 2116 | Ga0207693_10003086 | |||
| 2117 | Ga0207693_10018422 | |||
| 2118 | Ga0207693_10020465 | |||
| 2119 | Ga0207693_10035146 | |||
| 2120 | Ga0207693_10051463 | |||
| 2121 | Ga0207693_10346168 | |||
| 2122 | Ga0207663_10001974 | |||
| 2123 | Ga0207663_10005570 | |||
| 2124 | Ga0207663_10025028 | |||
| 2125 | Ga0207663_10057238 | |||
| 2126 | Ga0207663_10082371 | |||
| 2127 | Ga0207660_10002465 | |||
| 2128 | Ga0207660_10022470 | |||
| 2129 | Ga0207657_10019503 | |||
| 2130 | Ga0207657_10027909 | |||
| 2131 | Ga0207657_10066342 | |||
| 2132 | Ga0207657_10258441 | |||
| 2133 | Ga0207652_10002286 | |||
| 2134 | Ga0207652_10175524 | |||
| 2135 | Ga0207652_10533685 | |||
| 2136 | Ga0207681_10273578 | |||
| 2137 | Ga0207694_10000095 | |||
| 2138 | Ga0207694_10028380 | |||
| 2139 | Ga0207694_10040730 | |||
| 2140 | Ga0207694_10054256 | |||
| 2141 | Ga0207650_10054104 | |||
| 2142 | Ga0207650_10227353 | |||
| 2143 | Ga0207659_10152389 | |||
| 2144 | Ga0207687_10008392 | |||
| 2145 | Ga0207687_10077091 | |||
| 2146 | Ga0207687_10298241 | |||
| 2147 | Ga0207687_10316001 | |||
| 2148 | Ga0207687_10411048 | |||
| 2149 | Ga0207700_10004634 | |||
| 2150 | Ga0207700_10012786 | |||
| 2151 | Ga0207700_10017235 | |||
| 2152 | Ga0207700_10060010 | |||
| 2153 | Ga0207700_10071819 | |||
| 2154 | Ga0207700_10074945 | |||
| 2155 | Ga0207700_10092425 | |||
| 2156 | Ga0207700_10392555 | |||
| 2157 | Ga0207664_10005861 | |||
| 2158 | Ga0207664_10055230 | |||
| 2159 | Ga0207664_10060623 | |||
| 2160 | Ga0207664_10081041 | |||
| 2161 | Ga0207644_10010381 | |||
| 2162 | Ga0207644_10024814 | |||
| 2163 | Ga0207644_10284045 | |||
| 2164 | Ga0207644_10455504 | |||
| 2165 | Ga0207690_10080890 | |||
| 2166 | Ga0207690_10173761 | |||
| 2167 | Ga0207706_10012740 | |||
| 2168 | Ga0207706_10212076 | |||
| 2169 | Ga0207686_10012373 | |||
| 2170 | Ga0207686_10046906 | |||
| 2171 | Ga0207709_10052202 | |||
| 2172 | Ga0207670_10030422 | |||
| 2173 | Ga0207670_10317589 | |||
| 2174 | Ga0207670_10328262 | |||
| 2175 | Ga0207669_10033925 | |||
| 2176 | Ga0207669_10115076 | |||
| 2177 | Ga0207669_10351262 | |||
| 2178 | Ga0207704_10005807 | |||
| 2179 | Ga0207704_10050895 | |||
| 2180 | Ga0207704_10124949 | |||
| 2181 | Ga0207704_10673730 | |||
| 2182 | Ga0207665_10000455 | |||
| 2183 | Ga0207665_10003636 | |||
| 2184 | Ga0207665_10011323 | |||
| 2185 | Ga0207665_10088607 | |||
| 2186 | Ga0207665_10292275 | |||
| 2187 | Ga0207691_10069954 | |||
| 2188 | Ga0207691_10131391 | |||
| 2189 | Ga0207711_10022195 | |||
| 2190 | Ga0207711_10095450 | |||
| 2191 | Ga0207689_10021472 | |||
| 2192 | Ga0207689_10030547 | |||
| 2193 | Ga0207661_10000227 | |||
| 2194 | Ga0207661_10043715 | |||
| 2195 | Ga0207661_10353844 | |||
| 2196 | Ga0207679_10140943 | |||
| 2197 | Ga0207679_10318224 | |||
| 2198 | Ga0207667_10037625 | |||
| 2199 | Ga0207667_10042452 | |||
| 2200 | Ga0207667_10069488 | |||
| 2201 | Ga0207667_10129097 | |||
| 2202 | Ga0207667_10258659 | |||
| 2203 | Ga0207667_10318937 | |||
| 2204 | Ga0207667_10400518 | |||
| 2205 | Ga0207651_10139634 | |||
| 2206 | Ga0207651_10155253 | |||
| 2207 | Ga0207651_10181556 | |||
| 2208 | Ga0207651_10224091 | |||
| 2209 | Ga0207712_10178151 | |||
| 2210 | Ga0207712_10203294 | |||
| 2211 | Ga0207668_10018976 | |||
| 2212 | Ga0207668_10050682 | |||
| 2213 | Ga0207668_10173452 | |||
| 2214 | Ga0207668_10252375 | |||
| 2215 | Ga0207640_10018371 | |||
| 2216 | Ga0207640_10143765 | |||
| 2217 | Ga0207658_10015698 | |||
| 2218 | Ga0207658_10018042 | |||
| 2219 | Ga0207658_10164950 | |||
| 2220 | Ga0207658_10315632 | |||
| 2221 | Ga0207658_10437314 | |||
| 2222 | Ga0207677_10009719 | |||
| 2223 | Ga0207677_10385440 | |||
| 2224 | Ga0207703_10228165 | |||
| 2225 | Ga0207703_10575241 | |||
| 2226 | Ga0207639_10049151 | |||
| 2227 | Ga0207639_10088929 | |||
| 2228 | Ga0207639_10276048 | |||
| 2229 | Ga0207639_10290452 | |||
| 2230 | Ga0207639_10647564 | |||
| 2231 | Ga0207678_10016707 | |||
| 2232 | Ga0207678_10018224 | |||
| 2233 | Ga0207678_10144884 | |||
| 2234 | Ga0207678_10152456 | |||
| 2235 | Ga0207678_10165636 | |||
| 2236 | Ga0207678_10231459 | |||
| 2237 | Ga0207678_10243570 | |||
| 2238 | Ga0207678_10255834 | |||
| 2239 | Ga0207678_10285683 | |||
| 2240 | Ga0207678_10515968 | |||
| 2241 | Ga0207708_10347917 | |||
| 2242 | Ga0207702_10000025 | |||
| 2243 | Ga0207702_10000075 | |||
| 2244 | Ga0207702_10008399 | |||
| 2245 | Ga0207702_10139135 | |||
| 2246 | Ga0207702_10151415 | |||
| 2247 | Ga0207702_10159644 | |||
| 2248 | Ga0207702_10197843 | |||
| 2249 | Ga0207702_10614955 | |||
| 2250 | Ga0207641_10069289 | |||
| 2251 | Ga0207641_10246807 | |||
| 2252 | Ga0207641_10315497 | |||
| 2253 | Ga0207641_10493922 | |||
| 2254 | Ga0207676_10008170 | |||
| 2255 | Ga0207676_10071536 | |||
| 2256 | Ga0207676_10277560 | |||
| 2257 | Ga0207674_10022795 | |||
| 2258 | Ga0207674_10063245 | |||
| 2259 | Ga0207674_10078135 | |||
| 2260 | Ga0207674_10128285 | |||
| 2261 | Ga0207674_10176530 | |||
| 2262 | Ga0207674_10379881 | |||
| 2263 | Ga0207674_10510214 | |||
| 2264 | Ga0207675_100023527 | |||
| 2265 | Ga0207675_100148916 | |||
| 2266 | Ga0207675_100151263 | |||
| 2267 | Ga0207675_100240797 | |||
| 2268 | Ga0207683_10013509 | |||
| 2269 | Ga0207683_10020817 | |||
| 2270 | Ga0207683_10033981 | |||
| 2271 | Ga0207683_10034301 | |||
| 2272 | Ga0207683_10073168 | |||
| 2273 | Ga0207683_10079700 | |||
| 2274 | Ga0207683_10204096 | |||
| 2275 | Ga0207683_10690267 | |||
| 2276 | Ga0207698_10011948 | |||
| 2277 | Ga0207698_10241062 | |||
| 2278 | Ga0207698_10592153 | |||
| 2279 | Ga0207698_10916301 | |||
| 2280 | Ga0209389_1000132 | |||
| 2281 | Ga0209589_1000003 | |||
| 2282 | Ga0209489_100003 | |||
| 2283 | Ga0209489_103912 | |||
| 2284 | Ga0209700_100003 | |||
| 2285 | Ga0209700_100281 | |||
| 2286 | Ga0209588_1004688 | |||
| 2287 | Ga0209813_10004019 | |||
| 2288 | Ga0209813_10042829 | |||
| 2289 | Ga0209813_10097669 | |||
| 2290 | Ga0207428_10149772 | |||
| 2291 | Ga0268266_10002093 | |||
| 2292 | Ga0268266_10003481 | |||
| 2293 | Ga0268266_10004788 | |||
| 2294 | Ga0268266_10010224 | |||
| 2295 | Ga0268266_10016552 | |||
| 2296 | Ga0268266_10071199 | |||
| 2297 | Ga0268266_10481587 | |||
| 2298 | Ga0268265_10060380 | |||
| 2299 | Ga0268265_10098647 | |||
| 2300 | Ga0268265_10451672 | |||
| 2301 | Ga0268265_10547078 | |||
| 2302 | Ga0268264_10000022 | |||
| 2303 | Ga0268264_10149643 | |||
| 2304 | Ga0265334_10035881 | |||
| 2305 | Ga0307517_10000111 | |||
| 2306 | Ga0307515_10198993 | |||
| 2307 | Ga0307511_10028875 | |||
| 2308 | Ga0265330_10015875 | |||
| 2309 | Ga0265330_10028009 | |||
| 2310 | Ga0265332_10005648 | |||
| 2311 | Ga0265332_10061076 | |||
| 2312 | Ga0265325_10000006 | |||
| 2313 | Ga0265325_10005078 | |||
| 2314 | Ga0265340_10001029 | |||
| 2315 | Ga0265316_10069202 | |||
| 2316 | Ga0265316_10397008 | |||
| 2317 | Ga0265316_10428241 | |||
| 2318 | Ga0307509_10083821 | |||
| 2319 | Ga0307509_10204439 | |||
| 2320 | Ga0307509_10235360 | |||
| 2321 | Ga0265313_10004211 | |||
| 2322 | Ga0265313_10038758 | |||
| 2323 | Ga0307508_10000001 | |||
| 2324 | Ga0265314_10007699 | |||
| 2325 | Ga0265314_10053368 | |||
| 2326 | Ga0265342_10062563 | |||
| 2327 | Ga0265342_10143952 | |||
| 2328 | Ga0307516_10080872 | |||
| 2329 | Ga0307412_10192022 | |||
| 2330 | Ga0307409_100031793 | |||
| 2331 | Ga0307411_10162698 | |||
| 2332 | Ga0307415_100088179 | |||
| 2333 | Ga0307415_100106386 | |||
| 2334 | Ga0307415_100301385 | |||
| 2335 | Ga0307510_10001748 | |||
| 2336 | Ga0307510_10214854 | |||
| 2337 | Ga0315911_1000001 | |||
| 2338 | Ga0373930_0009477 | |||
| 2339 | Ga0373958_0050421 | |||
| 2340 | Ga0373959_0004888 | |||
| 2341 | Ga0373938_0014855 | |||
| 2342 | Ga0373929_0004081 | |||
| 2343 | Ga0373934_0002524 | |||
| 2344 | Ga0373934_0043127 | |||
| 2345 | Ga0373934_0047487 | |||
| 2346 | Ga0373940_0005371 | |||
| 2347 | Ga0373952_0000703 | |||
| 2348 | Ga0373932_0004218 | |||
| 2349 | Ga0373936_0005474 | |||
| 2350 | Ga0373936_0036940 | |||
| 2351 | Ga0373936_0054933 | |||
| 2352 | Ga0373941_0009331 | |||
| 2353 | Ga0373941_0032545 | |||
| 2354 | Ga0373945_0012567 | |||
| 2355 | Ga0373945_0024502 | |||
| 2356 | Ga0373945_0103450 | |||
| 2357 | Ga0373953_0006545 | |||
| 2358 | Ga0373953_0130758 | |||
| 2359 | Ga0373954_0001369 | |||
| 2360 | Ga0373956_0028711 | |||
| 2361 | Ga0373956_0079479 | |||
| 2362 | Ga0373957_0040888 | |||
| 2363 | Ga0373960_0009007 | |||
| 2364 | Ga0373943_0007816 | |||
| 2365 | Ga0373943_0023765 | |||
| 2366 | Ga0373943_0026965 | |||
| 2367 | Ga0373943_0039720 | |||
| 2368 | Ga0373946_0014662 | |||
| 2369 | Ga0373946_0038028 | |||
| 2370 | Ga0373955_0001864 | |||
| 2371 | Ga0373955_0027869 | |||
| 2372 | Ga0373955_0048107 | |||
| 2373 | Ga0373961_0012551 | |||
| 2374 | Ga0373962_0005970 | |||
| 2375 | Ga0373924_0004443 | |||
| 2376 | Ga0373924_0031770 | |||
| 2377 | Ga0373931_0003730 | |||
| 2378 | Ga0373931_0013950 | |||
| 2379 | Ga0373931_0014396 | |||
| 2380 | Ga0373935_0000110 | |||
| 2381 | Ga0373935_0028868 | |||
| 2382 | Ga0373935_0041167 | |||
| 2383 | Ga0373935_0203993 | |||
| 2384 | Ga0373927_0002008 | |||
| 2385 | Ga0373927_0005256 | |||
| 2386 | Ga0373927_0038834 | |||
| 2387 | Ga0373933_0000117 | |||
| 2388 | Ga0373933_0000863 | |||
| 2389 | Ga0373933_0033912 | |||
| 2390 | Ga0373933_0056752 | |||
| 2391 | Ga0373933_0154366 | |||
| 2392 | Ga0373933_0205792 | |||
| 2393 | Ga0373947_0001449 | |||
| 2394 | Ga0373947_0012614 | |||
| 2395 | Ga0373947_0096855 | |||
| 2396 | Ga0373947_0203348 | |||
| 2397 | Ga0373947_0277508 | |||
| 2398 | Ga0373937_0007186 | |||
| 2399 | Ga0373937_0031239 | |||
| 2400 | Ga0373937_0080469 | |||
| 2401 | Ga0373937_0208724 | |||
| 2402 | Ga0373937_0373974 | |||
| 2403 | Ga0373925_0000748 | |||
| 2404 | Ga0373925_0004770 | |||
| 2405 | Ga0373925_0021180 | |||
| 2406 | Ga0373925_0082755 | |||
| 2407 | Ga0373925_0087242 | |||
| 2408 | Ga0373925_0148842 | |||
| 2409 | Ga0373925_0289015 | |||
| 2410 | Ga0373925_0567824 | |||
| 2411 | Ga0395900_0001759 | |||
| 2412 | Ga0395900_0005207 | |||
| 2413 | Ga0395898_0001625 | |||
| 2414 | Ga0395898_0055146 | |||
| 2415 | Ga0395898_0063202 | |||
| 2416 | Ga0395898_0122535 | |||
| 2417 | Ga0395898_0395500 | |||
| 2418 | Ga0395905_0002799 | |||
| 2419 | Ga0395905_0174543 | |||
| 2420 | Ga0395905_0499771 | |||
| 2421 | Ga0436364_0539583 | |||
| 2422 | Ga0395901_0043346 | |||
| 2423 | Ga0395901_0102918 | |||
| 2424 | Ga0395901_0410686 | |||
| 2425 | Ga0400483_060836 | |||
| 2426 | Ga0436365_0257418 | |||
| 2427 | Ga0436365_1023002 | |||
| 2428 | Ga0436360_0096391 | |||
| 2429 | Ga0436361_0480907 | |||
| 2430 | Ga0436361_0862295 | |||
| 2431 | Ga0436363_0062258 | |||
| 2432 | Ga0436363_1628114 | |||
| 2433 | Ga0439453_0006931 | |||
| 2434 | Ga0439435_0001490 | |||
| 2435 | Ga0466969_0163530 | |||
| 2436 | Ga0466972_0000125 | |||
| 2437 | Ga0466965_0313425 | |||
| 2438 | Ga0466966_0161906 | |||
| 2439 | Ga0466966_0168686 | |||
| 2440 | Ga0466966_0214125 | |||
| 2441 | Ga0466961_0023660 | |||
| 2442 | Ga0466961_0099657 | |||
| 2443 | Ga0466963_0016505 | |||
| 2444 | Ga0466963_0105572 | |||
| 2445 | Ga0466957_0322588 | |||
| 2446 | Ga0466960_0159631 | |||
| 2447 | Ga0466959_0018639 | |||
| 2448 | Ga0466959_0360311 | |||
| 2449 | Ga0466958_0139995 | |||
| 2450 | Ga0466958_0328468 | |||
| 2451 | Ga0466967_0002462 | |||
| 2452 | Ga0466967_0042275 | |||
| 2453 | Ga0466967_0468639 | |||
| 2454 | Ga0466967_0546005 | |||
| 2455 | Ga0495617_068258 | |||
| 2456 | Ga0495592_0003752 | |||
| 2457 | Ga0495592_0030096 | |||
| 2458 | Ga0495592_0054979 | |||
| 2459 | Ga0495592_0210847 | |||
| 2460 | Ga0495603_0000011 | |||
| 2461 | Ga0495603_0016002 | |||
| 2462 | Ga0495603_0018500 | |||
| 2463 | Ga0495603_0018693 | |||
| 2464 | Ga0495603_0029271 | |||
| 2465 | Ga0495603_0126687 | |||
| 2466 | Ga0495603_0145321 | |||
| 2467 | Ga0495629_0000251 | |||
| 2468 | Ga0495629_0000253 | |||
| 2469 | Ga0495629_0002122 | |||
| 2470 | Ga0495638_0009386 | |||
| 2471 | Ga0495638_0022362 | |||
| 2472 | Ga0495638_0036500 | |||
| 2473 | Ga0495638_0039823 | |||
| 2474 | Ga0495638_0056366 | |||
| 2475 | Ga0495641_0014674 | |||
| 2476 | Ga0495641_0017327 | |||
| 2477 | Ga0495641_0039165 | |||
| 2478 | Ga0495651_0015572 | |||
| 2479 | Ga0495651_0085167 | |||
| 2480 | Ga0495651_0120048 | |||
| 2481 | Ga0495653_0000473 | |||
| 2482 | Ga0495653_0113012 | |||
| 2483 | Ga0495650_0085380 | |||
| 2484 | Ga0495580_0015052 | |||
| 2485 | Ga0495580_0018909 | |||
| 2486 | Ga0495580_0533797 | |||
| 2487 | Ga0495582_0000974 | |||
| 2488 | Ga0495582_0027990 | |||
| 2489 | Ga0495605_0032938 | |||
| 2490 | Ga0495639_0000017 | |||
| 2491 | Ga0495639_0060223 | |||
| 2492 | Ga0495639_0198543 | |||
| 2493 | Ga0495662_0000179 | |||
| 2494 | Ga0495662_0129503 | |||
| 2495 | Ga0495662_0220546 | |||
| 2496 | Ga0495662_0233079 | |||
| 2497 | Ga0495664_0035477 | |||
| 2498 | Ga0495664_0089776 | |||
| 2499 | Ga0495664_0278364 | |||
| 2500 | Ga0495585_0004643 | |||
| 2501 | Ga0495585_0088116 | |||
| 2502 | Ga0495594_0000094 | |||
| 2503 | Ga0495594_0007078 | |||
| 2504 | Ga0495594_0079170 | |||
| 2505 | Ga0495594_0098064 | |||
| 2506 | Ga0495594_0102898 | |||
| 2507 | Ga0495606_0002138 | |||
| 2508 | Ga0495606_0102853 | |||
| 2509 | Ga0495608_0007400 | |||
| 2510 | Ga0495608_0060453 | |||
| 2511 | Ga0495610_0075749 | |||
| 2512 | Ga0495616_0043510 | |||
| 2513 | Ga0495616_0052942 | |||
| 2514 | Ga0495616_0107873 | |||
| 2515 | Ga0495618_0084293 | |||
| 2516 | Ga0495618_0095271 | |||
| 2517 | Ga0495618_0189316 | |||
| 2518 | Ga0495618_0430564 | |||
| 2519 | Ga0495620_0024967 | |||
| 2520 | Ga0495620_0121661 | |||
| 2521 | Ga0495628_0027034 | |||
| 2522 | Ga0495628_0030482 | |||
| 2523 | Ga0495628_0064067 | |||
| 2524 | Ga0495628_0180064 | |||
| 2525 | Ga0495628_0244898 | |||
| 2526 | Ga0495630_0008181 | |||
| 2527 | Ga0495630_0036331 | |||
| 2528 | Ga0495632_0130764 | |||
| 2529 | Ga0495632_0157335 | |||
| 2530 | Ga0495644_0003084 | |||
| 2531 | Ga0495648_0000494 | |||
| 2532 | Ga0495648_0001433 | |||
| 2533 | Ga0495648_0060116 | |||
| 2534 | Ga0495666_0149246 | |||
| 2535 | Ga0495666_0191232 | |||
| 2536 | Ga0495642_0129722 | |||
| 2537 | Ga0495652_0006106 | |||
| 2538 | Ga0495652_0013728 | |||
| 2539 | Ga0495652_0091230 | |||
| 2540 | Ga0495652_0113263 | |||
| 2541 | Ga0495652_0119722 | |||
| 2542 | Ga0495654_0005880 | |||
| 2543 | Ga0495654_0032938 | |||
| 2544 | Ga0495654_0165740 | |||
| 2545 | Ga0495665_0000032 | |||
| 2546 | Ga0495665_0023158 | |||
| 2547 | Ga0495640_0001724 | |||
| 2548 | Ga0495640_0025020 | |||
| 2549 | Ga0495640_0033866 | |||
| 2550 | Ga0495640_0196234 | |||
| 2551 | Ga0495586_0070505 | |||
| 2552 | Ga0495586_0311371 | |||
| 2553 | Ga0495587_0010454 | |||
| 2554 | Ga0495587_0035328 | |||
| 2555 | Ga0495587_0037939 | |||
| 2556 | Ga0495587_0197253 | |||
| 2557 | Ga0495598_0006263 | |||
| 2558 | Ga0495609_0142147 | |||
| 2559 | Ga0495621_0012201 | |||
| 2560 | Ga0495621_0091531 | |||
| 2561 | Ga0495597_0046757 | |||
| 2562 | Ga0495597_0053866 | |||
| 2563 | Ga0495645_0061017 | |||
| 2564 | Ga0495645_0137633 | |||
| 2565 | Ga0495645_0263284 | |||
| 2566 | Ga0495622_0010235 | |||
| 2567 | Ga0495622_0038223 | |||
| 2568 | Ga0495633_0003607 | |||
| 2569 | Ga0495667_0000962 | |||
| 2570 | Ga0495667_0044797 | |||
| 2571 | Ga0495667_0110804 | |||
| 2572 | Ga0495667_0165382 | |||
| 2573 | Ga0495656_0001421 | |||
| 2574 | Ga0495656_0039306 | |||
| 2575 | Ga0495656_0091115 | |||
| 2576 | Ga0495656_0170297 | |||
| 2577 | Ga0495668_0000092 | |||
| 2578 | Ga0495668_0075201 | |||
| 2579 | Ga0495668_0166199 | |||
| 2580 | Ga0495668_0216984 | |||
| 2581 | Ga0495668_0298754 | |||
| 2582 | Ga0495634_0003268 | |||
| 2583 | Ga0495634_0078652 | |||
| 2584 | Ga0495634_0085665 | |||
| 2585 | Ga0495634_0212154 | |||
| 2586 | Ga0495634_0229210 | |||
| 2587 | Ga0495611_0030565 | |||
| 2588 | Ga0495611_0133890 | |||
| 2589 | Ga0495625_0361214 | |||
| 2590 | Ga0495635_0000084 | |||
| 2591 | Ga0495635_0003234 | |||
| 2592 | Ga0495635_0041900 | |||
| 2593 | Ga0495635_0164809 | |||
| 2594 | Ga0495659_0007751 | |||
| 2595 | Ga0495661_0019379 | |||
| 2596 | Ga0495661_0063366 | |||
| 2597 | Ga0495661_0294948 | |||
| 2598 | Ga0495588_0034752 | |||
| 2599 | Ga0495588_0037169 | |||
| 2600 | Ga0495588_0048031 | |||
| 2601 | Ga0495588_0108846 | |||
| 2602 | Ga0495657_0005107 | |||
| 2603 | Ga0495657_0008437 | |||
| 2604 | Ga0495657_0021841 | |||
| 2605 | Ga0495657_0190027 | |||
| 2606 | Ga0495657_0224104 | |||
| 2607 | Ga0495599_0000457 | |||
| 2608 | Ga0495599_0038768 | |||
| 2609 | Ga0495599_0405425 | |||
| 2610 | Ga0495623_0008556 | |||
| 2611 | Ga0495623_0107716 | |||
| 2612 | Ga0495623_0113461 | |||
| 2613 | Ga0495646_0042090 | |||
| 2614 | Ga0495646_0064091 | |||
| 2615 | Ga0495646_0153260 | |||
| 2616 | Ga0495647_0000248 | |||
| 2617 | Ga0495647_0010707 | |||
| 2618 | Ga0495647_0017500 | |||
| 2619 | Ga0495658_0001805 | |||
| 2620 | Ga0495658_0007984 | |||
| 2621 | Ga0495658_0106447 | |||
| 2622 | Ga0495658_0112424 | |||
| 2623 | Ga0495669_0050384 | |||
| 2624 | Ga0495669_0278404 | |||
| 2625 | Ga0495613_0001580 | |||
| 2626 | Ga0495613_0004954 | |||
| 2627 | Ga0495613_0071751 | |||
| 2628 | Ga0495613_0121915 | |||
| 2629 | Ga0495624_0004094 | |||
| 2630 | Ga0495624_0156067 | |||
| 2631 | Ga0495670_0000787 | |||
| 2632 | Ga0495670_0010416 | |||
| 2633 | Ga0495670_0034134 | |||
| 2634 | Ga0495671_0243761 | |||
| 2635 | Ga0495649_0094750 | |||
| 2636 | Ga0495600_0003042 | |||
| 2637 | Ga0495600_0004866 | |||
| 2638 | Ga0495600_0051163 | |||
| 2639 | Ga0495581_0000076 | |||
| 2640 | Ga0495581_0043435 | |||
| 2641 | Ga0495581_0114836 | |||
| 2642 | Ga0495581_0139969 | |||
| 2643 | Ga0495581_0203298 | |||
| 2644 | Ga0495581_0270429 | |||
| 2645 | Ga0495581_0340779 | |||
| 2646 | Ga0495604_0010464 | |||
| 2647 | Ga0495604_0102023 | |||
| 2648 | Ga0495604_0124266 | |||
| 2649 | Ga0495604_0133812 | |||
| 2650 | Ga0495674_0001109 | |||
| 2651 | Ga0495674_0009634 | |||
| 2652 | Ga0495674_0063393 | |||
| 2653 | Ga0495674_0070677 | |||
| 2654 | Ga0495674_0072742 | |||
| 2655 | Ga0495672_0010637 | |||
| 2656 | Ga0495672_0028513 | |||
| 2657 | Ga0495672_0242945 | |||
| 2658 | Ga0495672_0263016 | |||
| 2659 | Ga0495676_0036452 | |||
| 2660 | Ga0495676_0227178 | |||
| 2661 | Ga0495676_0283049 | |||
| 2662 | Ga0495680_0007126 | |||
| 2663 | Ga0495680_0010925 | |||
| 2664 | Ga0495680_0021814 | |||
| 2665 | Ga0495680_0065244 | |||
| 2666 | Ga0495680_0270302 | |||
| 2667 | Ga0495683_0166942 | |||
| 2668 | Ga0495687_010366 | |||
| 2669 | Ga0495675_0001533 | |||
| 2670 | Ga0495677_0174134 | |||
| 2671 | Ga0495679_096931 | |||
| 2672 | Ga0495673_0117193 | |||
| 2673 | Ga0495684_0001330 | |||
| 2674 | Ga0495684_0001937 | |||
| 2675 | Ga0495684_0010509 | |||
| 2676 | Ga0495686_0076759 | |||
| 2677 | Ga0495686_0142253 | |||
| 2678 | Ga0495686_0169194 | |||
| 2679 | Ga0495686_0275060 | |||
| 2680 | Ga0495593_0002160 | |||
| 2681 | Ga0495593_0002185 | |||
| 2682 | Ga0495593_0004247 | |||
| 2683 | Ga0495593_0048015 | |||
| 2684 | Ga0495602_0062123 | |||
| 2685 | Ga0495602_0084727 | |||
| 2686 | Ga0495614_0035738 | |||
| 2687 | Ga0495614_0045811 | |||
| 2688 | Ga0495614_0199292 | |||
| 2689 | Ga0496100_0009708 | |||
| 2690 | Ga0496100_0032941 | |||
| 2691 | Ga0496100_0133547 | |||
| 2692 | Ga0496100_0186477 | |||
| 2693 | Ga0496100_0239403 | |||
| 2694 | Ga0496101_0062075 | |||
| 2695 | Ga0496101_0106071 | |||
| 2696 | Ga0496101_0124410 | |||
| 2697 | Ga0496101_0179040 | |||
| 2698 | Ga0496101_0234968 | |||
| 2699 | Ga0496101_0306525 | |||
| 2700 | Ga0496102_0004998 | |||
| 2701 | Ga0496102_0017053 | |||
| 2702 | Ga0496102_0029309 | |||
| 2703 | Ga0496102_0122324 | |||
| 2704 | Ga0496102_0123553 | |||
| 2705 | Ga0496102_0127267 | |||
| 2706 | Ga0496102_0253023 | |||
| 2707 | Ga0496103_0003807 | |||
| 2708 | Ga0496103_0024359 | |||
| 2709 | Ga0496103_0067753 | |||
| 2710 | Ga0496104_0000331 | |||
| 2711 | Ga0496104_0023465 | |||
| 2712 | Ga0496104_0026932 | |||
| 2713 | Ga0496104_0065839 | |||
| 2714 | Ga0496104_0092178 | |||
| 2715 | Ga0496104_0118811 | |||
| 2716 | Ga0496104_0131351 | |||
| 2717 | Ga0496104_0696809 | |||
| 2718 | Ga0496105_0013669 | |||
| 2719 | Ga0496105_0027756 | |||
| 2720 | Ga0496105_0047246 | |||
| 2721 | Ga0496105_0104294 | |||
| 2722 | Ga0496105_0129992 | |||
| 2723 | Ga0496105_0193884 | |||
| 2724 | Ga0496105_0617885 | |||
| 2725 | Ga0496106_0001453 | |||
| 2726 | Ga0496106_0007579 | |||
| 2727 | Ga0496106_0155397 | |||
| 2728 | Ga0496106_0548593 | |||
| 2729 | Ga0496107_0012401 | |||
| 2730 | Ga0496107_0057233 | |||
| 2731 | Ga0496107_0074980 | |||
| 2732 | Ga0496107_0080430 | |||
| 2733 | Ga0496107_0131581 | |||
| 2734 | Ga0496107_0139865 | |||
| 2735 | Ga0496107_0140109 | |||
| 2736 | Ga0496108_0001656 | |||
| 2737 | Ga0496108_0007772 | |||
| 2738 | Ga0496108_0015489 | |||
| 2739 | Ga0496108_0081128 | |||
| 2740 | Ga0496108_0132976 | |||
| 2741 | Ga0496108_0279817 | |||
| 2742 | Ga0496108_0369861 | |||
| 2743 | Ga0496108_0389286 | |||
| 2744 | Ga0496108_0435246 | |||
| 2745 | Ga0496109_0002542 | |||
| 2746 | Ga0496109_0005517 | |||
| 2747 | Ga0496109_0037791 | |||
| 2748 | Ga0496109_0253461 | |||
| 2749 | Ga0496109_0296331 | |||
| 2750 | Ga0496109_0430639 | |||
| 2751 | Ga0496109_0548544 | |||
| 2752 | Ga0496109_1016602 | |||
| 2753 | Ga0496110_0006911 | |||
| 2754 | Ga0496110_0011557 | |||
| 2755 | Ga0496110_0024579 | |||
| 2756 | Ga0496110_0050759 | |||
| 2757 | Ga0496110_0054426 | |||
| 2758 | Ga0496110_0108630 | |||
| 2759 | Ga0496110_0234218 | |||
| 2760 | Ga0496110_0350302 | |||
| 2761 | Ga0496110_0401456 | |||
| 2762 | Ga0496110_0700215 | |||
| 2763 | Ga0496111_0001681 | |||
| 2764 | Ga0496111_0004178 | |||
| 2765 | Ga0496111_0020054 | |||
| 2766 | Ga0496111_0040057 | |||
| 2767 | Ga0496111_0049479 | |||
| 2768 | Ga0496111_0094980 | |||
| 2769 | Ga0496111_0265385 | |||
| 2770 | Ga0496111_0271124 | |||
| 2771 | Ga0496112_0000414 | |||
| 2772 | Ga0496112_0010890 | |||
| 2773 | Ga0496112_0024803 | |||
| 2774 | Ga0496112_0041801 | |||
| 2775 | Ga0496112_0043885 | |||
| 2776 | Ga0496112_0189675 | |||
| 2777 | Ga0496112_0208418 | |||
| 2778 | Ga0496112_0216117 | |||
| 2779 | Ga0496112_0251390 | |||
| 2780 | Ga0496113_0001520 | |||
| 2781 | Ga0496113_0004601 | |||
| 2782 | Ga0496113_0008072 | |||
| 2783 | Ga0496113_0008091 | |||
| 2784 | Ga0496113_0114467 | |||
| 2785 | Ga0496113_0215699 | |||
| 2786 | Ga0496113_0555583 | |||
| 2787 | Ga0496114_0005585 | |||
| 2788 | Ga0496114_0015990 | |||
| 2789 | Ga0496114_0065889 | |||
| 2790 | Ga0496114_0069511 | |||
| 2791 | Ga0496114_0114066 | |||
| 2792 | Ga0496114_0121398 | |||
| 2793 | Ga0496114_0136752 | |||
| 2794 | Ga0496114_0279601 | |||
| 2795 | Ga0496114_0451916 | |||
| 2796 | Ga0496115_0011102 | |||
| 2797 | Ga0496115_0019563 | |||
| 2798 | Ga0496115_0040397 | |||
| 2799 | Ga0496115_0041198 | |||
| 2800 | Ga0496115_0075176 | |||
| 2801 | Ga0496115_0089958 | |||
| 2802 | Ga0496115_0467285 | |||
| 2803 | Ga0496115_0541517 | |||
| 2804 | Ga0496116_0002810 | |||
| 2805 | Ga0496116_0181951 | |||
| 2806 | Ga0496116_0254201 | |||
| 2807 | Ga0496117_0064775 | |||
| 2808 | Ga0496117_0066143 | |||
| 2809 | Ga0496117_0085429 | |||
| 2810 | Ga0496118_0017101 | |||
| 2811 | Ga0496118_0075568 | |||
| 2812 | Ga0496118_0201703 | |||
| 2813 | Ga0496118_0214644 | |||
| 2814 | Ga0496119_0091345 | |||
| 2815 | Ga0496119_0094144 | |||
| 2816 | Ga0496119_0128632 | |||
| 2817 | Ga0496119_0149169 | |||
| 2818 | Ga0496119_0195140 | |||
| 2819 | Ga0496121_0005592 | |||
| 2820 | Ga0496121_0005961 | |||
| 2821 | Ga0496121_0025691 | |||
| 2822 | Ga0496121_0031537 | |||
| 2823 | Ga0496121_0075028 | |||
| 2824 | Ga0496121_0086316 | |||
| 2825 | Ga0496121_0102204 | |||
| 2826 | Ga0496121_0104069 | |||
| 2827 | Ga0496121_0114227 | |||
| 2828 | Ga0496121_0122569 | |||
| 2829 | Ga0496121_0151531 | |||
| 2830 | Ga0496121_0258853 | |||
| 2831 | Ga0496121_0260947 | |||
| 2832 | Ga0496122_0001850 | |||
| 2833 | Ga0496122_0024253 | |||
| 2834 | Ga0496122_0214035 | |||
| 2835 | Ga0496123_0000498 | |||
| 2836 | Ga0496123_0153571 | |||
| 2837 | Ga0496124_0039002 | |||
| 2838 | Ga0496124_0170336 | |||
| 2839 | Ga0496124_0176486 | |||
| 2840 | Ga0496125_0000850 | |||
| 2841 | Ga0496125_0006132 | |||
| 2842 | Ga0496125_0006453 | |||
| 2843 | Ga0496125_0038920 | |||
| 2844 | Ga0496125_0059762 | |||
| 2845 | Ga0496125_0379689 | |||
| 2846 | Ga0496126_0003112 | |||
| 2847 | Ga0496126_0004886 | |||
| 2848 | Ga0496126_0008303 | |||
| 2849 | Ga0496126_0018879 | |||
| 2850 | Ga0496126_0066646 | |||
| 2851 | Ga0496126_0120048 | |||
| 2852 | Ga0496126_0138295 | |||
| 2853 | Ga0496126_0149822 | |||
| 2854 | Ga0496126_0159831 | |||
| 2855 | Ga0496126_0170358 | |||
| 2856 | Ga0496126_0207351 | |||
| 2857 | Ga0496126_0233659 | |||
| 2858 | Ga0496126_0251436 | |||
| 2859 | Ga0496126_0562002 | |||
| 2860 | Ga0496126_0563447 | |||
| 2861 | Ga0496126_0600538 | |||
| 2862 | Ga0495682_0051559 | |||
| 2863 | Ga0495682_0089363 | |||
| 2864 | Ga0501031_0000253 | |||
| 2865 | Ga0501031_0019009 | |||
| 2866 | Ga0501031_0174039 | |||
| 2867 | Ga0501032_0000273 | |||
| 2868 | Ga0501032_0022067 | |||
| 2869 | Ga0501032_0038462 | |||
| 2870 | Ga0501032_0046242 | |||
| 2871 | Ga0501032_0051051 | |||
| 2872 | Ga0501032_0136588 | |||
| 2873 | Ga0501033_0000098 | |||
| 2874 | Ga0501033_0000332 | |||
| 2875 | Ga0501033_0055981 | |||
| 2876 | Ga0501033_0064916 | |||
| 2877 | Ga0501033_0453318 | |||
| 2878 | Ga0501034_0000088 | |||
| 2879 | Ga0501034_0000175 | |||
| 2880 | Ga0501034_0019896 | |||
| 2881 | Ga0501034_0048469 | |||
| 2882 | Ga0501034_0078646 | |||
| 2883 | Ga0501034_0104633 | |||
| 2884 | Ga0501034_0269977 | |||
| 2885 | Ga0501034_0519603 | |||
| 2886 | Ga0501036_0000049 | |||
| 2887 | Ga0501036_0043499 | |||
| 2888 | Ga0501036_0076908 | |||
| 2889 | Ga0501036_0236704 | |||
| 2890 | Ga0501036_0281622 | |||
| 2891 | Ga0501037_0000069 | |||
| 2892 | Ga0501037_0003734 | |||
| 2893 | Ga0501037_0144821 | |||
| 2894 | Ga0501037_0199808 | |||
| 2895 | Ga0501038_0000034 | |||
| 2896 | Ga0501038_0008654 | |||
| 2897 | Ga0501038_0053758 | |||
| 2898 | Ga0501038_0072407 | |||
| 2899 | Ga0501038_0111941 | |||
| 2900 | Ga0501038_0144616 | |||
| 2901 | Ga0501038_0339867 | |||
| 2902 | Ga0501039_0000090 | |||
| 2903 | Ga0501039_0005577 | |||
| 2904 | Ga0501039_0108617 | |||
| 2905 | Ga0501039_0694764 | |||
| 2906 | Ga0501040_0299360 | |||
| 2907 | Ga0501040_0527577 | |||
| 2908 | Ga0501041_0280595 | |||
| 2909 | Ga0501042_0021749 | |||
| 2910 | Ga0501042_0111228 | |||
| 2911 | Ga0501043_0000130 | |||
| 2912 | Ga0501043_0010948 | |||
| 2913 | Ga0501043_0136910 | |||
| 2914 | Ga0501046_0000213 | |||
| 2915 | Ga0501046_0007792 | |||
| 2916 | Ga0501046_0020817 | |||
| 2917 | Ga0501046_0032084 | |||
| 2918 | Ga0501046_0181540 | |||
| 2919 | Ga0501047_0000255 | |||
| 2920 | Ga0501047_0016128 | |||
| 2921 | Ga0501047_0039630 | |||
| 2922 | Ga0501047_0074475 | |||
| 2923 | Ga0501047_0087080 | |||
| 2924 | Ga0501047_0087376 | |||
| 2925 | Ga0501047_0109419 | |||
| 2926 | Ga0501047_0329085 | |||
| 2927 | Ga0501047_0546852 | |||
| 2928 | Ga0501048_0000252 | |||
| 2929 | Ga0501048_0138363 | |||
| 2930 | Ga0501067_0001929 | |||
| 2931 | Ga0501067_0021939 | |||
| 2932 | Ga0501067_0051104 | |||
| 2933 | Ga0501067_0060356 | |||
| 2934 | Ga0501067_0189962 | |||
| 2935 | Ga0501068_0000197 | |||
| 2936 | Ga0501068_0014839 | |||
| 2937 | Ga0501069_0000614 | |||
| 2938 | Ga0501069_0074684 | |||
| 2939 | Ga0501069_0093592 | |||
| 2940 | Ga0501069_0115171 | |||
| 2941 | Ga0501070_0017034 | |||
| 2942 | Ga0501070_0068644 | |||
| 2943 | Ga0501070_0171049 | |||
| 2944 | Ga0501070_0384853 | |||
| 2945 | Ga0501071_0008255 | |||
| 2946 | Ga0501071_0582273 | |||
| 2947 | Ga0501072_0000146 | |||
| 2948 | Ga0501072_0245583 | |||
| 2949 | Ga0501073_0000035 | |||
| 2950 | Ga0501073_0023327 | |||
| 2951 | Ga0501073_0099446 | |||
| 2952 | Ga0501073_0117597 | |||
| 2953 | Ga0501074_0000512 | |||
| 2954 | Ga0501074_0059524 | |||
| 2955 | Ga0501075_0337399 | |||
| 2956 | Ga0501077_0084003 | |||
| 2957 | Ga0501079_0010497 | |||
| 2958 | Ga0501079_0087257 | |||
| 2959 | Ga0501079_0111763 | |||
| 2960 | Ga0501079_0364691 | |||
| 2961 | Ga0501080_0000379 | |||
| 2962 | Ga0501080_0049862 | |||
| 2963 | Ga0501080_0060413 | |||
| 2964 | Ga0501080_0363492 | |||
| 2965 | Ga0501080_0372895 | |||
| 2966 | Ga0501080_0548637 | |||
| 2967 | Ga0501081_0106847 | |||
| 2968 | Ga0501081_0366079 | |||
| 2969 | Ga0501083_0000740 | |||
| 2970 | Ga0501083_0007489 | |||
| 2971 | Ga0501083_0151374 | |||
| 2972 | Ga0501035_0000894 | |||
| 2973 | Ga0501035_0001058 | |||
| 2974 | Ga0501035_0043468 | |||
| 2975 | Ga0501035_0181629 | |||
| 2976 | Ga0501035_0240818 | |||
| 2977 | Ga0501035_0268517 | |||
| 2978 | Ga0501035_0277558 | |||
| 2979 | Ga0501044_0000461 | |||
| 2980 | Ga0501044_0021033 | |||
| 2981 | Ga0501044_0043353 | |||
| 2982 | Ga0501044_0077714 | |||
| 2983 | Ga0501044_0077856 | |||
| 2984 | Ga0501044_0118193 | |||
| 2985 | Ga0501044_0170847 | |||
| 2986 | Ga0501044_0189973 | |||
| 2987 | Ga0501044_0210104 | |||
| 2988 | Ga0501044_0247374 | |||
| 2989 | Ga0501045_0109171 | |||
| 2990 | nmdc:mga03683_17567_c1 | |||
| 2991 | nmdc:mga03683_28652_c1 | |||
| 2992 | nmdc:mga03683_2952_c1 | |||
| 2993 | nmdc:mga03n38_15507_c1 | |||
| 2994 | nmdc:mga03n38_166170_c1 | |||
| 2995 | nmdc:mga03n38_20367_c1 | |||
| 2996 | nmdc:mga03n38_210100_c1 | |||
| 2997 | nmdc:mga03n38_613_c1 | |||
| 2998 | nmdc:mga03n38_88814_c1 | |||
| 2999 | nmdc:mga00v17_126620_c1 | |||
| 3000 | nmdc:mga00v17_21043_c1 | |||
| 3001 | nmdc:mga0yw44_124882_c1 | |||
| 3002 | nmdc:mga0yw44_140144_c1 | |||
| 3003 | nmdc:mga0yw44_15168_c1 | |||
| 3004 | nmdc:mga0yw44_20149_c1 | |||
| 3005 | nmdc:mga0yw44_202568_c1 | |||
| 3006 | nmdc:mga0yw44_215952_c1 | |||
| 3007 | nmdc:mga0yw44_28351_c1 | |||
| 3008 | nmdc:mga0yw44_29821_c1 | |||
| 3009 | nmdc:mga0yw44_32622_c1 | |||
| 3010 | nmdc:mga0yw44_49130_c1 | |||
| 3011 | nmdc:mga0k408_5224_c1 | |||
| 3012 | nmdc:mga0k408_59721_c1 | |||
| 3013 | nmdc:mga0k408_80127_c1 | |||
| 3014 | nmdc:mga0k408_9852_c1 | |||
| 3015 | nmdc:mga06z11_158494_c1 | |||
| 3016 | nmdc:mga06z11_195578_c1 | |||
| 3017 | nmdc:mga06z11_289298_c1 | |||
| 3018 | nmdc:mga04h51_33437_c1 | |||
| 3019 | nmdc:mga04h51_5335_c1 | |||
| 3020 | nmdc:mga04h51_68922_c1 | |||
| 3021 | nmdc:mga07m45_102179_c1 | |||
| 3022 | nmdc:mga07m45_137511_c1 | |||
| 3023 | nmdc:mga07m45_1929_c1 | |||
| 3024 | nmdc:mga07m45_3911_c1 | |||
| 3025 | nmdc:mga05p37_4837_c1 | |||
| 3026 | nmdc:mga05p37_699874_c1 | |||
| 3027 | nmdc:mga0qj67_214647_c1 | |||
| 3028 | nmdc:mga06r32_231017_c1 | |||
| 3029 | nmdc:mga08y16_157905_c1 | |||
| 3030 | nmdc:mga08y16_300163_c1 | |||
| 3031 | nmdc:mga08y16_417681_c1 | |||
| 3032 | nmdc:mga08y16_440743_c1 | |||
| 3033 | nmdc:mga08y16_511091_c1 | |||
| 3034 | nmdc:mga0n895_537959_c1 | |||
| 3035 | nmdc:mga0n895_556268_c1 | |||
| 3036 | nmdc:mga0n895_72053_c1 | |||
| 3037 | nmdc:mga0rr50_123263_c1 | |||
| 3038 | nmdc:mga08x19_258482_c1 | |||
| 3039 | nmdc:mga08x19_32130_c1 | |||
| 3040 | nmdc:mga0a205_180274_c1 | |||
| 3041 | nmdc:mga0a205_311906_c1 | |||
| 3042 | nmdc:mga0a205_329637_c1 | |||
| 3043 | nmdc:mga0sz30_45978_c1 | |||
| 3044 | nmdc:mga0sz30_86912_c1 | |||
| 3045 | nmdc:mga0sz30_94549_c1 | |||
| 3046 | Ga0495601_0056249 | |||
| 3047 | Ga0495601_0099669 | |||
| 3048 | Ga0495601_0121479 | |||
| 3049 | Ga0495601_0167874 | |||
| 3050 | Ga0495601_0207292 | |||
| 3051 | Ga0495601_0268820 | |||
| 3052 | Ga0495612_0005170 | |||
| 3053 | Ga0495612_0005994 | |||
| 3054 | Ga0495612_0022238 | |||
| 3055 | Ga0495612_0137893 | |||
| 3056 | Ga0500635_0014749 | |||
| 3057 | Ga0495595_0000267 | |||
| 3058 | Ga0495595_0001389 | |||
| 3059 | Ga0495595_0048915 | |||
| 3060 | Ga0495619_0000434 | |||
| 3061 | Ga0495619_0000491 | |||
| 3062 | Ga0495619_0037925 | |||
| 3063 | Ga0495619_0055342 | |||
| 3064 | Ga0495619_0418464 | |||
| 3065 | Ga0500643_000156 | |||
| 3066 | Ga0500643_011270 | |||
| 3067 | Ga0500643_032107 | |||
| 3068 | Ga0500581_083803 | |||
| 3069 | Ga0500646_0008643 | |||
| 3070 | Ga0500647_0067702 | |||
| 3071 | Ga0500651_0061060 | |||
| 3072 | Ga0500651_0087129 | |||
| 3073 | Ga0500651_0152455 | |||
| 3074 | Ga0500651_0189508 | |||
| 3075 | Ga0500566_0000091 | |||
| 3076 | Ga0500566_0000990 | |||
| 3077 | Ga0500566_0031382 | |||
| 3078 | Ga0500566_0095435 | |||
| 3079 | Ga0500566_0183280 | |||
| 3080 | Ga0500640_139350 | |||
| 3081 | Ga0500641_0014068 | |||
| 3082 | Ga0500641_0034873 | |||
| 3083 | Ga0500641_0068022 | |||
| 3084 | Ga0500641_0151612 | |||
| 3085 | Ga0500650_0001832 | |||
| 3086 | Ga0500650_0172716 | |||
| 3087 | Ga0500554_002104 | |||
| 3088 | Ga0500555_000933 | |||
| 3089 | Ga0500556_0000002 | |||
| 3090 | Ga0500556_0000048 | |||
| 3091 | Ga0500556_0004481 | |||
| 3092 | Ga0500556_0122004 | |||
| 3093 | Ga0500557_000024 | |||
| 3094 | Ga0500562_012516 | |||
| 3095 | Ga0500562_063985 | |||
| 3096 | Ga0500562_071229 | |||
| 3097 | Ga0500572_000309 | |||
| 3098 | Ga0500572_021886 | |||
| 3099 | Ga0500594_0023064 | |||
| 3100 | Ga0500594_0025817 | |||
| 3101 | Ga0500595_000698 | |||
| 3102 | Ga0500595_002243 | |||
| 3103 | Ga0500595_003813 | |||
| 3104 | Ga0500595_006478 | |||
| 3105 | Ga0500595_078728 | |||
| 3106 | Ga0500607_030662 | |||
| 3107 | Ga0500607_118822 | |||
| 3108 | Ga0500608_000584 | |||
| 3109 | Ga0500614_012060 | |||
| 3110 | Ga0500642_0000093 | |||
| 3111 | Ga0500642_0000107 | |||
| 3112 | Ga0500642_0071711 | |||
| 3113 | Ga0500652_000219 | |||
| 3114 | Ga0500655_003619 | |||
| 3115 | Ga0500655_008426 | |||
| 3116 | Ga0500658_0038875 | |||
| 3117 | Ga0500658_0152483 | |||
| 3118 | Ga0500559_0000341 | |||
| 3119 | Ga0500559_0001261 | |||
| 3120 | Ga0500559_0058481 | |||
| 3121 | Ga0500568_0000835 | |||
| 3122 | Ga0500568_0001045 | |||
| 3123 | Ga0500568_0005007 | |||
| 3124 | Ga0500568_0020371 | |||
| 3125 | Ga0500568_0047844 | |||
| 3126 | Ga0500568_0068906 | |||
| 3127 | Ga0500577_0000212 | |||
| 3128 | Ga0500586_096995 | |||
| 3129 | Ga0500589_059000 | |||
| 3130 | Ga0500590_171896 | |||
| 3131 | Ga0500603_031274 | |||
| 3132 | Ga0500604_0007304 | |||
| 3133 | Ga0500616_0000045 | |||
| 3134 | Ga0500616_0000069 | |||
| 3135 | Ga0500616_0051836 | |||
| 3136 | Ga0500616_0101308 | |||
| 3137 | Ga0500622_0001388 | |||
| 3138 | Ga0500622_0015344 | |||
| 3139 | Ga0500624_014333 | |||
| 3140 | Ga0500627_0007562 | |||
| 3141 | Ga0500627_0055077 | |||
| 3142 | Ga0500627_0090051 | |||
| 3143 | Ga0500627_0126335 | |||
| 3144 | Ga0500634_0013070 | |||
| 3145 | Ga0500634_0047748 | |||
| 3146 | Ga0500634_0102260 | |||
| 3147 | Ga0500634_0108303 | |||
| 3148 | Ga0500638_000254 | |||
| 3149 | Ga0500638_197403 | |||
| 3150 | Ga0500636_0003270 | |||
| 3151 | Ga0500636_0009247 | |||
| 3152 | Ga0500636_0069854 | |||
| 3153 | Ga0500636_0111330 | |||
| 3154 | Ga0500636_0128535 | |||
| 3155 | Ga0500636_0241309 | |||
| 3156 | Ga0500637_0000216 | |||
| 3157 | Ga0500637_0006416 | |||
| 3158 | Ga0500637_0175014 | |||
| 3159 | Ga0500576_054740 | |||
| 3160 | Ga0500611_005568 | |||
| 3161 | Ga0500611_021866 | |||
| 3162 | Ga0500645_046945 | |||
| 3163 | Ga0500645_077583 | |||
| 3164 | Ga0500599_000719 | |||
| 3165 | Ga0500601_000724 | |||
| 3166 | Ga0501084_0001610 | |||
| 3167 | Ga0501084_0062496 | |||
| 3168 | Ga0501084_0151219 | |||
| 3169 | Ga0500661_019441 | |||
| 3170 | Ga0501082_0000084 | |||
| 3171 | Ga0501082_0015760 | |||
| 3172 | Ga0501082_0068493 | |||
| 3173 | Ga0501082_0260001 | |||
| 3174 | Ga0501082_0277094 | |||
| 3175 | Ga0530510_0063518 | |||
| 3176 | 2507509238 | |||
| 3177 | 2508543307 | |||
| 3178 | 2508690944 | |||
| 3179 | 2509147412 | |||
| 3180 | 2511397211 | |||
| 3181 | 2513646771 | |||
| 3182 | 2513656784 | |||
| 3183 | 2513677825 | |||
| 3184 | 2513691937 | |||
| 3185 | 2513717246 | |||
| 3186 | 2513857973 | |||
| 3187 | 2513876592 | |||
| 3188 | 2513892807 | |||
| 3189 | 2513917969 | |||
| 3190 | 2515626656 | |||
| 3191 | 2517101891 | |||
| 3192 | 2517892985 | |||
| 3193 | 2524465192 | |||
| 3194 | 2528852246 | |||
| 3195 | 2599720702 | |||
| 3196 | 2603858934 | |||
| 3197 | 2643756320 | |||
| 3198 | 2644132141 | |||
| 3199 | 2671117610 | |||
| 3200 | 2723845668 | |||
| 3201 | 2728750442 | |||
| 3202 | 2793073026 | |||
| 3203 | 2793081777 | |||
| 3204 | 2805919847 | |||
| 3205 | 2818242850 | |||
| 3206 | 2824606036 | |||
| 3207 | 2824615975 | |||
| 3208 | 2824658878 | |||
| 3209 | 2824667765 | |||
| 3210 | 2824676155 | |||
| 3211 | 2824691828 | |||
| 3212 | 2824699443 | |||
| 3213 | 2824710419 | |||
| 3214 | 2824761129 | |||
| 3215 | 2824771181 | |||
| 3216 | 2824779335 | |||
| 3217 | 2837653779 | |||
| 3218 | 2841958093 | |||
| 3219 | 2844318476 | |||
| 3220 | 2847935366 | |||
| 3221 | 2847945974 | |||
| 3222 | 2857513691 | |||
| 3223 | 2857527959 | |||
| 3224 | 2874597363 | |||
| 3225 | 2874609710 | |||
| 3226 | 2874626732 | |||
| 3227 | 2874649304 | |||
| 3228 | 2876777840 | |||
| 3229 | 2876811821 | |||
| 3230 | 2876823139 | |||
| 3231 | 2879078597 | |||
| 3232 | 2879088559 | |||
| 3233 | 2879108058 | |||
| 3234 | 2879118417 | |||
| 3235 | 2879132926 | |||
| 3236 | 2879148725 | |||
| 3237 | 2883294375 | |||
| 3238 | 2885371909 | |||
| 3239 | 2885377401 | |||
| 3240 | 2885387649 | |||
| 3241 | 2888383436 | |||
| 3242 | 2888394501 | |||
| 3243 | 2888423823 | |||
| 3244 | 2889040474 | |||
| 3245 | 2893068376 | |||
| 3246 | 2903730159 | |||
| 3247 | 2903751990 | |||
| 3248 | 2903778328 | |||
| 3249 | 2904668310 | |||
| 3250 | 2904696335 | |||
| 3251 | 2904703152 | |||
| 3252 | 2904717271 | |||
| 3253 | 2906603544 | |||
| 3254 | 2906618021 | |||
| 3255 | 2906632451 | |||
| 3256 | 2906636048 | |||
| 3257 | 2906646302 | |||
| 3258 | 2906661508 | |||
| 3259 | 2908760882 | |||
| 3260 | 2909043908 | |||
| 3261 | 2919075360 | |||
| 3262 | 2922368355 | |||
| 3263 | 2922373619 | |||
| 3264 | 2922388196 | |||
| 3265 | 2922429518 | |||
| 3266 | 2928535341 | |||
| 3267 | 2929617354 | |||
| 3268 | 2929627059 | |||
| 3269 | 2932787610 | |||
| 3270 | 2932813209 | |||
| 3271 | 2932820876 | |||
| 3272 | 2932834757 | |||
| 3273 | 2933579311 | |||
| 3274 | 2935611874 | |||
| 3275 | 2935621716 | |||
| 3276 | 2935642666 | |||
| 3277 | 2935667768 | |||
| 3278 | 2935682258 | |||
| 3279 | 2935688513 | |||
| 3280 | 2935695863 | |||
| 3281 | 2935706608 | |||
| 3282 | 2935715532 | |||
| 3283 | 2935725904 | |||
| 3284 | 2935734351 | |||
| 3285 | 2935743730 | |||
| 3286 | 2935754233 | |||
| 3287 | 2935768407 | |||
| 3288 | 2935772647 | |||
| 3289 | 2935783197 | |||
| 3290 | 2935790940 | |||
| 3291 | 2935799359 | |||
| 3292 | 2935806425 | |||
| 3293 | 2935813017 | |||
| 3294 | 2935821354 | |||
| 3295 | 2935830669 | |||
| 3296 | 2935840698 | |||
| 3297 | 2935850387 | |||
| 3298 | 2935859963 | |||
| 3299 | 2935869402 | |||
| 3300 | 2935880437 | |||
| 3301 | 2935914003 | |||
| 3302 | 2935921145 | |||
| 3303 | 2935931809 | |||
| 3304 | 2935940256 | |||
| 3305 | 2935947919 | |||
| 3306 | 2935956540 | |||
| 3307 | 2935960349 | |||
| 3308 | 2935973334 | |||
| 3309 | 2935977585 | |||
| 3310 | 2935989495 | |||
| 3311 | 2935999491 | |||
| 3312 | 2936006526 | |||
| 3313 | 2936041605 | |||
| 3314 | 2937846136 | |||
| 3315 | 2940560391 | |||
| 3316 | 2941510505 | |||
| 3317 | 2941517757 | |||
| 3318 | 2941525774 | |||
| 3319 | 2941534225 | |||
| 3320 | 2941541172 | |||
| 3321 | 3005479675 | |||
| 3322 | 3005714248 | |||
| 3323 | 8006929340 | |||
| 3324 | 8006967303 | |||
| 3325 | 8006990210 | |||
| 3326 | 8006997541 | |||
| 3327 | 8016514064 | |||
| 3328 | 8016530249 | |||
| 3329 | 8016535508 | |||
| 3330 | 8016548703 | |||
| 3331 | 8016553431 | |||
| 3332 | 8016561807 | |||
| 3333 | 8016577964 | |||
| 3334 | 8016599642 | |||
| 3335 | 8016622429 | |||
| 3336 | 8016627356 | |||
| 3337 | 8016631658 | |||
| 3338 | 8017062347 | |||
| 3339 | 8019535240 | |||
| 3340 | 8019544242 | |||
| 3341 | 8019554460 | |||
| 3342 | 8019557347 | |||
| 3343 | 8019567952 | |||
| 3344 | 8019581802 | |||
| 3345 | 8019589476 | |||
| 3346 | 8019616762 | |||
| 3347 | 8019627453 | |||
| 3348 | 8019635121 | |||
| 3349 | 8019644607 | |||
| 3350 | 8019657628 | |||
| 3351 | 8019662963 | |||
| 3352 | 8019672562 | |||
| 3353 | 8019683596 | |||
| 3354 | 8019689340 | |||
| 3355 | 8055747031 | |||
| 3356 | 8056674415 | |||
| 3357 | 8056683323 | |||
| 3358 | 8056690093 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3kxq-assembly1.cif.gz_A | crystal structure of triosephosphate isomerase from bartonella henselae at 1.6a resolution | 0.9819 | 5 | 249 |
| 4nvt-assembly2.cif.gz_B | crystal structure of triosephosphate isomerase from brucella melitensis | 0.9816 | 5 | 249 |
| 3kxq-assembly1.cif.gz_B | crystal structure of triosephosphate isomerase from bartonella henselae at 1.6a resolution | 0.9795 | 5 | 249 |
| 4nvt-assembly2.cif.gz_C | crystal structure of triosephosphate isomerase from brucella melitensis | 0.9781 | 5 | 249 |
| 4nvt-assembly2.cif.gz_B | crystal structure of triosephosphate isomerase from brucella melitensis | 0.966 | 5 | 249 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4nvtA00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9805 | 5 | 249 | 3.20.20.70 |
| 4nvtA00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9611 | 5 | 249 | 3.20.20.70 |
| 6bveB00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9494 | 4 | 251 | 3.20.20.70 |
| af_P0A858_1_255_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9484 | 6 | 249 | 3.20.20.70 |
| 4g1kC00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9458 | 4 | 251 | 3.20.20.70 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1X3GA60-F1-model_v4 | Triosephosphate isomerase (TIM) (TPI) (EC 5.3.1.1) (Triose-phosphate isomerase) | 0.9953 | 1 | 251 |
GO:0004807
GO:0005829 GO:0006094 GO:0006096 GO:0019563 GO:0046166 |
| AF-A0A2M6UJ64-F1-model_v4 | Triosephosphate isomerase (TIM) (TPI) (EC 5.3.1.1) (Triose-phosphate isomerase) | 0.9943 | 1 | 251 |
GO:0004807
GO:0005829 GO:0006094 GO:0006096 GO:0019563 GO:0046166 |
| AF-K0VYF7-F1-model_v4 | Triosephosphate isomerase (EC 5.3.1.1) | 0.9916 | 63 | 249 |
GO:0004807
GO:0005829 GO:0006094 GO:0006096 GO:0019563 GO:0046166 |
| AF-A0A1X3GA60-F1-model_v4 | Triosephosphate isomerase (TIM) (TPI) (EC 5.3.1.1) (Triose-phosphate isomerase) | 0.9914 | 1 | 251 |
GO:0004807
GO:0005829 GO:0006094 GO:0006096 GO:0019563 GO:0046166 |
| AF-A0A435EAS4-F1-model_v4 | deleted | 0.9887 | 46 | 249 |
|