F495303

General Info

Members Datasets Scaffolds Average Seq Length
1679 680 3358 251

Family's Representative Sequence

Representative Sequence 3300027512|Ga0209179_1024849|Ga0209179_10248492
Length 247
Sequence MTDAIRPLIAGNWKMNGLRASLGEFEAMRAGASEVADKADLLVCPPATLIAAFVERAGGSRTVAVGAQDCHPDASGPHTGDISAEMLADAGASAIIVGHSERRADHGETDVLVRQKTEAVWRAGLTAIVCIGETQRQRLDICRGQLNVSLPDGARADNLVVAYEPVWAIGTGLTPTAEDVEQIHRFIRELLAARFNQEGSRIRILYGGSVKPSNASELMAVANVNGALVGGASLKAADFLAIARSCP

Samples

Sample ID Description Type Environment
1 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
2 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
5 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
6 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
7 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
8 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
32 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
33 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
34 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
35 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
36 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
41 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
47 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
48 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
49 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
52 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
53 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
54 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
55 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
56 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
57 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
58 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
59 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
60 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
61 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
62 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
63 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
64 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
65 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
66 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
67 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
68 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
69 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
70 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
71 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
72 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
73 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
74 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
75 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
76 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
77 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
78 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
79 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
80 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
81 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
82 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
84 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
85 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
86 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
87 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
88 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
89 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
90 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
91 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
92 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
93 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
94 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
95 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
96 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
97 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
98 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
99 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
100 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
101 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
102 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
103 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
104 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
105 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
106 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
107 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
108 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
109 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
110 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
111 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
112 3300012505 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 Metagenome Rhizosphere
113 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
114 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
115 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
116 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
117 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
118 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
119 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
120 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
121 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
122 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
123 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
124 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
125 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
126 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
127 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
128 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
129 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
130 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
131 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
132 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
133 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
134 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
135 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
136 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
137 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
138 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
139 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
202 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
203 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
204 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
205 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
207 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
208 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
212 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
213 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
214 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
215 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
216 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
217 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
218 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
219 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
220 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
221 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
222 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
223 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
224 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
225 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
226 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
227 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
228 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
229 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
230 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
231 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
232 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
233 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
234 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
235 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
236 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
237 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
238 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
239 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
240 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
241 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
242 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
243 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
244 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
245 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
246 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
247 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
248 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
249 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
250 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
251 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
252 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
253 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
254 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
255 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
256 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
257 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
258 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
259 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
260 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
261 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
262 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
263 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
264 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
265 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
266 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
267 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
268 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
269 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
270 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
271 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
272 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
273 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
274 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
275 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
276 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
277 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
278 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
279 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
280 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
281 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
282 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
283 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
284 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
285 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
286 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
287 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
288 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
289 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
290 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
291 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
292 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
293 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
294 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
295 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
296 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
297 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
298 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
299 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
300 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
301 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
302 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
303 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
304 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
305 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
306 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
307 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
308 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
309 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
310 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
311 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
312 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
313 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
314 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
315 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
316 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
317 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
318 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
319 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
320 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
321 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
322 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
323 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
324 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
325 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
326 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
327 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
328 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
329 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
330 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
331 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
332 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
333 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
334 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
335 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
336 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
337 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
338 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
339 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
340 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
341 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
342 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
343 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
344 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
345 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
346 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
347 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
348 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
349 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
350 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
351 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
352 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
353 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
354 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
355 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
356 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
357 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
358 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
359 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
360 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
361 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
362 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
363 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
364 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
365 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
366 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
367 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
368 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
369 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
370 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
371 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
372 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
373 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
374 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
375 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
376 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
377 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
378 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
379 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
380 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
381 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
382 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
383 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
384 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
385 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
386 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
387 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
388 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
389 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
390 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
391 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
392 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
393 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
394 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
395 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
396 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
397 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
398 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
399 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
400 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
401 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
402 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
403 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
404 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
405 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
406 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
407 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
408 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
409 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
410 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
411 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
412 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
413 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
414 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
415 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
416 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
417 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
418 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
419 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
420 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
421 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
422 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
423 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
424 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
425 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
426 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
427 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
428 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
429 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
430 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
431 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
432 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
433 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
434 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
435 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
436 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
437 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
438 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
439 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
440 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
441 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
442 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
443 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
444 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
445 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
446 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
447 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
448 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
449 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
450 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
451 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
452 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
453 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
454 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
455 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
456 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
457 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
458 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
459 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
460 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
461 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
462 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
463 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
464 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
465 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
466 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
467 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
468 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
469 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
470 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
471 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
472 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
473 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
474 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
475 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
476 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
477 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
478 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
479 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
480 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
481 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
482 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
483 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
484 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
485 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
486 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
487 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
488 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
489 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
490 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
491 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
492 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
493 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
494 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
495 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
496 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
497 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
498 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
499 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
500 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
501 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
502 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
503 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
504 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
505 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
506 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
507 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
508 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
509 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
510 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
511 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
512 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
513 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
514 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
515 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
516 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
517 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
518 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
519 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified
520 2643221623 Aminobacter sp. DSM 101952 Root100 Isolate Unclassified
521 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
522 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
523 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
524 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
525 2791355199
526 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
527 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
528 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
529 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
530 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
531 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
532 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
533 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
534 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
535 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
536 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
537 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
538 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
539 2837651117 Pseudohoeflea suaedae YC6898 Isolate Unclassified
540 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
541 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
542 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
543 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
544 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
545 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
546 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
547 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
548 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
549 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
550 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
551 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
552 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
553 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
554 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
555 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
556 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
557 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
558 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
559 2883291878 Hypericibacter terrae R5913 Isolate Rhizosphere
560 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
561 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
562 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
563 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
564 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
565 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
566 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
567 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
568 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
569 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
570 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
571 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
572 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
573 2904699407
574 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
575 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
576 2906610324
577 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
578 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
579 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
580 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
581 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
582 2909042592 Labrys sp. LIt4 Isolate Nodule
583 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
584 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
585 2922368715
586 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
587 2922425934
588 2928531327 Caulobacter sp. 1776 Isolate Rhizosphere
589 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
590 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
591 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
592 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
593 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
594 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
595 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
596 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
597 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
598 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
599 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
600 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
601 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
602 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
603 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
604 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
605 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
606 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
607 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
608 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
609 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
610 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
611 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
612 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
613 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
614 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
615 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
616 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
617 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
618 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
619 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
620 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
621 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
622 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
623 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
624 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
625 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
626 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
627 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
628 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
629 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
630 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
631 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
632 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
633 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
634 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
635 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
636 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere
637 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
638 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
639 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
640 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
641 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
642 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
643 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
644 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
645 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
646 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
647 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
648 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
649 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
650 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
651 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
652 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
653 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
654 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
655 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
656 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
657 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
658 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
659 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
660 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
661 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
662 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
663 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
664 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
665 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
666 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
667 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
668 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
669 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
670 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
671 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
672 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
673 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
674 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
675 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
676 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
677 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
678 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
679 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
680 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 89.19
Metatranscriptomes 0.18
Isolates 10.63

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.03
Nodule 8.22
Rhizoplane 7.03
Rhizosphere 65.46
Stem 0
Stem Tuber 0
Unclassified 0.18

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0209179_1024849 3300027512 Bacteria 1191
2 JGI24738J21930_10006044 3300002075 Bacteria 2866
3 JGI25406J46586_10001492 3300003203 Bacteria 11045
4 JGI25153J46596_10009281 3300003215 Bacteria 4597
5 JGI25153J46596_10009680 3300003215 Bacteria 4439
6 JGI25153J46596_10014678 3300003215 Bacteria 3241
7 JGI25153J46596_10015191 3300003215 Bacteria 3153
8 JGI25160J50197_1008733 3300003354 Bacteria 3836
9 JGI25160J50197_1011756 3300003354 Bacteria 3078
10 JGI25404J52841_10015065 3300003659 Bacteria 1679
11 Ga0055530_10010917 3300003791 Bacteria 3305
12 Ga0055531_10001195 3300003794 Bacteria 19919
13 Ga0055531_10003993 3300003794 Bacteria 9150
14 Ga0070658_10338462 3300005327 Bacteria 1287
15 Ga0070658_10384769 3300005327 Bacteria 1204
16 Ga0070676_10013022 3300005328 Bacteria 4557
17 Ga0070683_100276774 3300005329 Bacteria 1597
18 Ga0070690_100331020 3300005330 Bacteria 1100
19 Ga0070670_100193124 3300005331 Bacteria 1769
20 Ga0070670_100350836 3300005331 Bacteria 1296
21 Ga0068869_100102291 3300005334 Bacteria 2168
22 Ga0068869_100114761 3300005334 Bacteria 2053
23 Ga0070680_100013526 3300005336 Bacteria 6357
24 Ga0070680_100016985 3300005336 Bacteria 5730
25 Ga0070680_100175148 3300005336 Bacteria 1806
26 Ga0070680_100435939 3300005336 Bacteria 1119
27 Ga0070682_100036640 3300005337 Bacteria 2999
28 Ga0070682_100264717 3300005337 Bacteria 1246
29 Ga0068868_100003958 3300005338 Bacteria 10340
30 Ga0068868_100011518 3300005338 Bacteria 6441
31 Ga0070660_100017870 3300005339 Bacteria 5173
32 Ga0070689_100064814 3300005340 Bacteria 2845
33 Ga0070691_10083779 3300005341 Bacteria 1565
34 Ga0070661_100101272 3300005344 Bacteria 2143
35 Ga0070668_100042528 3300005347 Bacteria 3483
36 Ga0070668_100153283 3300005347 Bacteria 1865
37 Ga0070668_100268800 3300005347 Bacteria 1420
38 Ga0070669_100090979 3300005353 Bacteria 2288
39 Ga0070669_100527332 3300005353 Bacteria 982
40 Ga0070675_100187545 3300005354 Bacteria 1791
41 Ga0070671_100011296 3300005355 Bacteria 7175
42 Ga0070671_100015678 3300005355 Bacteria 6124
43 Ga0070671_100086510 3300005355 Bacteria 2623
44 Ga0070674_100026165 3300005356 Bacteria 3808
45 Ga0070673_100425115 3300005364 Bacteria 1192
46 Ga0070688_100006780 3300005365 Bacteria 6141
47 Ga0070688_100028217 3300005365 Bacteria 3348
48 Ga0070659_100050790 3300005366 Bacteria 3260
49 Ga0070667_100028910 3300005367 Bacteria 4616
50 Ga0070667_100087889 3300005367 Bacteria 2668
51 Ga0070709_10005966 3300005434 Bacteria 6615
52 Ga0070709_10007727 3300005434 Bacteria 5904
53 Ga0070709_10015676 3300005434 Bacteria 4316
54 Ga0070709_10154349 3300005434 Bacteria 1590
55 Ga0070709_10611680 3300005434 Bacteria 840
56 Ga0070714_100009892 3300005435 Bacteria 7520
57 Ga0070714_100029375 3300005435 Bacteria 4571
58 Ga0070714_100036016 3300005435 Bacteria 4149
59 Ga0070714_100088688 3300005435 Bacteria 2707
60 Ga0070714_100130627 3300005435 Bacteria 2244
61 Ga0070713_100004379 3300005436 Bacteria 9485
62 Ga0070713_100010400 3300005436 Bacteria 6719
63 Ga0070713_100021269 3300005436 Bacteria 4986
64 Ga0070713_100074356 3300005436 Bacteria 2879
65 Ga0070713_100101791 3300005436 Bacteria 2489
66 Ga0070713_100467968 3300005436 Bacteria 1186
67 Ga0070710_10000344 3300005437 Bacteria 22093
68 Ga0070710_10000395 3300005437 Bacteria 20362
69 Ga0070710_10007756 3300005437 Bacteria 5207
70 Ga0070710_10013495 3300005437 Bacteria 4095
71 Ga0070701_10086418 3300005438 Bacteria 1709
72 Ga0070711_100000702 3300005439 Bacteria 17552
73 Ga0070711_100013855 3300005439 Bacteria 5072
74 Ga0070711_100054002 3300005439 Bacteria 2771
75 Ga0070711_100154357 3300005439 Bacteria 1734
76 Ga0070711_100263486 3300005439 Bacteria 1357
77 Ga0070663_100007150 3300005455 Bacteria 6777
78 Ga0070663_100027479 3300005455 Bacteria 3865
79 Ga0070663_100162013 3300005455 Bacteria 1722
80 Ga0070663_100227965 3300005455 Bacteria 1466
81 Ga0070678_100009881 3300005456 Bacteria 5799
82 Ga0070678_100034185 3300005456 Bacteria 3538
83 Ga0070678_100092332 3300005456 Bacteria 2325
84 Ga0070662_100117538 3300005457 Bacteria 2034
85 Ga0070662_100307659 3300005457 Bacteria 1289
86 Ga0070662_100323031 3300005457 Bacteria 1259
87 Ga0070681_10203620 3300005458 Bacteria 1897
88 Ga0070681_10209729 3300005458 Bacteria 1864
89 Ga0070681_10358218 3300005458 Bacteria 1369
90 Ga0070685_10007975 3300005466 Bacteria 5427
91 Ga0070685_10030623 3300005466 Bacteria 3000
92 Ga0070685_10201983 3300005466 Bacteria 1292
93 Ga0070679_100028788 3300005530 Bacteria 5479
94 Ga0070679_100056398 3300005530 Bacteria 3914
95 Ga0070679_100243480 3300005530 Bacteria 1756
96 Ga0070684_100021896 3300005535 Bacteria 5324
97 Ga0070684_100032076 3300005535 Bacteria 4475
98 Ga0070684_100141149 3300005535 Bacteria 2178
99 Ga0070684_100456791 3300005535 Bacteria 1181
100 Ga0068853_100007032 3300005539 Bacteria 8995
101 Ga0068853_100018974 3300005539 Bacteria 5697
102 Ga0068853_100290030 3300005539 Bacteria 1510
103 Ga0068853_100514028 3300005539 Bacteria 1132
104 Ga0070672_100115669 3300005543 Bacteria 2190
105 Ga0070672_100269487 3300005543 Bacteria 1437
106 Ga0070672_100414845 3300005543 Bacteria 1156
107 Ga0070672_100629406 3300005543 Bacteria 936
108 Ga0070686_100012110 3300005544 Bacteria 4908
109 Ga0070695_100267217 3300005545 Bacteria 1251
110 Ga0070696_100225617 3300005546 Bacteria 1407
111 Ga0070693_100034460 3300005547 Bacteria 2801
112 Ga0070665_100016641 3300005548 Bacteria 7369
113 Ga0070665_100099989 3300005548 Bacteria 2904
114 Ga0070665_100123757 3300005548 Bacteria 2588
115 Ga0070665_100259127 3300005548 Bacteria 1740
116 Ga0070665_100266730 3300005548 Bacteria 1713
117 Ga0070665_100392500 3300005548 Bacteria 1395
118 Ga0070665_100739589 3300005548 Bacteria 997
119 Ga0068855_100024338 3300005563 Bacteria 7247
120 Ga0068855_100043049 3300005563 Bacteria 5350
121 Ga0068855_100049847 3300005563 Bacteria 4936
122 Ga0068855_100076413 3300005563 Bacteria 3887
123 Ga0068855_100101580 3300005563 Bacteria 3310
124 Ga0068855_100132096 3300005563 Bacteria 2850
125 Ga0068855_100162720 3300005563 Bacteria 2531
126 Ga0068855_100482974 3300005563 Bacteria 1348
127 Ga0070664_100198428 3300005564 Bacteria 1790
128 Ga0068857_100024325 3300005577 Bacteria 5331
129 Ga0068857_100071597 3300005577 Bacteria 3088
130 Ga0068857_100192669 3300005577 Bacteria 1857
131 Ga0068857_100400913 3300005577 Bacteria 1276
132 Ga0068854_100015803 3300005578 Bacteria 5012
133 Ga0068856_100007904 3300005614 Bacteria 10390
134 Ga0068856_100063923 3300005614 Bacteria 3636
135 Ga0068856_100086868 3300005614 Bacteria 3108
136 Ga0068856_100153160 3300005614 Bacteria 2315
137 Ga0068856_100224895 3300005614 Bacteria 1892
138 Ga0068856_100549921 3300005614 Bacteria 1175
139 Ga0068852_100063265 3300005616 Bacteria 3222
140 Ga0068859_100058087 3300005617 Bacteria 3896
141 Ga0068859_100100410 3300005617 Bacteria 2949
142 Ga0068859_100978039 3300005617 Bacteria 929
143 Ga0068864_100050145 3300005618 Bacteria 3592
144 Ga0068864_100058520 3300005618 Bacteria 3331
145 Ga0068864_100186187 3300005618 Bacteria 1900
146 Ga0068864_100426410 3300005618 Bacteria 1264
147 Ga0068866_10111148 3300005718 Bacteria 1529
148 Ga0068866_10175444 3300005718 Bacteria 1261
149 Ga0068866_10186540 3300005718 Bacteria 1229
150 Ga0068866_10304992 3300005718 Bacteria 996
151 Ga0068861_100153715 3300005719 Bacteria 1890
152 Ga0068861_100180027 3300005719 Bacteria 1759
153 Ga0068861_100447729 3300005719 Bacteria 1156
154 Ga0068851_10006063 3300005834 Bacteria 5513
155 Ga0068863_100237338 3300005841 Bacteria 1760
156 Ga0068863_100273758 3300005841 Bacteria 1635
157 Ga0068858_100047295 3300005842 Bacteria 3988
158 Ga0068858_100406507 3300005842 Bacteria 1308
159 Ga0068858_100486121 3300005842 Bacteria 1192
160 Ga0068860_100000497 3300005843 Bacteria 48753
161 Ga0068860_100080702 3300005843 Bacteria 3093
162 Ga0068860_100211082 3300005843 Bacteria 1883
163 Ga0068860_100462526 3300005843 Bacteria 1262
164 Ga0068862_100245860 3300005844 Bacteria 1628
165 Ga0068862_100365685 3300005844 Bacteria 1341
166 Ga0081455_10001069 3300005937 Bacteria 34502
167 Ga0081455_10012384 3300005937 Bacteria 8511
168 Ga0081455_10016028 3300005937 Bacteria 7250
169 Ga0081455_10021328 3300005937 Bacteria 6079
170 Ga0081455_10026882 3300005937 Bacteria 5282
171 Ga0081455_10047175 3300005937 Bacteria 3733
172 Ga0081455_10057286 3300005937 Bacteria 3303
173 Ga0081538_10004388 3300005981 Bacteria 13027
174 Ga0081538_10038370 3300005981 Bacteria 3091
175 Ga0081538_10054726 3300005981 Bacteria 2356
176 Ga0081540_1002393 3300005983 Bacteria 15301
177 Ga0081540_1003961 3300005983 Bacteria 11505
178 Ga0081540_1005402 3300005983 Bacteria 9541
179 Ga0081540_1013623 3300005983 Bacteria 5273
180 Ga0081540_1016233 3300005983 Bacteria 4672
181 Ga0081540_1020841 3300005983 Bacteria 3927
182 Ga0081540_1025112 3300005983 Bacteria 3440
183 Ga0081540_1031237 3300005983 Bacteria 2933
184 Ga0081540_1034946 3300005983 Bacteria 2702
185 Ga0081540_1058821 3300005983 Bacteria 1848
186 Ga0081540_1136757 3300005983 Bacteria 991
187 Ga0081539_10000379 3300005985 Bacteria 97134
188 Ga0081539_10001555 3300005985 Bacteria 38208
189 Ga0081539_10018827 3300005985 Bacteria 4760
190 Ga0070717_10000224 3300006028 Bacteria 39308
191 Ga0070717_10002876 3300006028 Bacteria 12213
192 Ga0070717_10057087 3300006028 Bacteria 3227
193 Ga0070717_10072326 3300006028 Bacteria 2879
194 Ga0070717_10106427 3300006028 Bacteria 2388
195 Ga0070717_10107691 3300006028 Bacteria 2374
196 Ga0075365_10001527 3300006038 Bacteria 10583
197 Ga0075365_10031975 3300006038 Bacteria 3379
198 Ga0075365_10042446 3300006038 Bacteria 2973
199 Ga0075365_10066502 3300006038 Bacteria 2418
200 Ga0075365_10073284 3300006038 Bacteria 2308
201 Ga0075365_10118132 3300006038 Bacteria 1827
202 Ga0075365_10126379 3300006038 Bacteria 1767
203 Ga0075365_10258049 3300006038 Bacteria 1225
204 Ga0075368_10002837 3300006042 Bacteria 5719
205 Ga0075368_10005831 3300006042 Bacteria 4258
206 Ga0075368_10020493 3300006042 Bacteria 2505
207 Ga0075368_10032889 3300006042 Bacteria 2016
208 Ga0075368_10048271 3300006042 Bacteria 1687
209 Ga0075368_10080844 3300006042 Bacteria 1322
210 Ga0075363_100010269 3300006048 Bacteria 4436
211 Ga0075363_100017003 3300006048 Bacteria 3601
212 Ga0075363_100213795 3300006048 Bacteria 1104
213 Ga0075364_10039692 3300006051 Bacteria 3052
214 Ga0075364_10050143 3300006051 Bacteria 2724
215 Ga0075364_10060728 3300006051 Bacteria 2479
216 Ga0070715_10001633 3300006163 Bacteria 6629
217 Ga0070716_100004798 3300006173 Bacteria 6492
218 Ga0070716_100010255 3300006173 Bacteria 4694
219 Ga0070716_100013159 3300006173 Bacteria 4212
220 Ga0070716_100098727 3300006173 Bacteria 1785
221 Ga0070716_100108952 3300006173 Bacteria 1713
222 Ga0070716_100277977 3300006173 Bacteria 1154
223 Ga0070712_100009415 3300006175 Bacteria 6156
224 Ga0070712_100108299 3300006175 Bacteria 2069
225 Ga0070712_100181556 3300006175 Bacteria 1640
226 Ga0070712_100303697 3300006175 Bacteria 1292
227 Ga0070712_100633261 3300006175 Bacteria 908
228 Ga0075362_10005833 3300006177 Bacteria 4542
229 Ga0075367_10012090 3300006178 Bacteria 4590
230 Ga0075367_10240836 3300006178 Bacteria 1134
231 Ga0075367_10241596 3300006178 Bacteria 1132
232 Ga0075369_10049416 3300006186 Bacteria 1817
233 Ga0075366_10011006 3300006195 Bacteria 5093
234 Ga0075366_10068704 3300006195 Bacteria 2108
235 Ga0075366_10084529 3300006195 Bacteria 1897
236 Ga0075366_10095194 3300006195 Bacteria 1785
237 Ga0097621_100028885 3300006237 Bacteria 4375
238 Ga0097621_100348408 3300006237 Bacteria 1317
239 Ga0075370_10052522 3300006353 Bacteria 2312
240 Ga0075370_10089873 3300006353 Bacteria 1771
241 Ga0075370_10176574 3300006353 Bacteria 1256
242 Ga0068871_100042230 3300006358 Bacteria 3660
243 Ga0075428_100074465 3300006844 Bacteria 3709
244 Ga0075428_100897466 3300006844 Bacteria 940
245 Ga0075430_100024425 3300006846 Bacteria 5142
246 Ga0075434_100007100 3300006871 Bacteria 10345
247 Ga0075434_100330546 3300006871 Unclassified 1545
248 Ga0075434_100460050 3300006871 Bacteria 1293
249 Ga0075434_100613723 3300006871 Bacteria 1107
250 Ga0068865_100367686 3300006881 Bacteria 1169
251 Ga0075436_100081189 3300006914 Bacteria 2248
252 Ga0075436_100345800 3300006914 Bacteria 1071
253 Ga0097620_100058087 3300006931 Bacteria 3896
254 Ga0097620_100100398 3300006931 Bacteria 2949
255 Ga0097620_100977842 3300006931 Bacteria 929
256 Ga0099824_1003889 3300006942 Bacteria 21658
257 Ga0099822_1018677 3300006943 Bacteria 7180
258 Ga0099823_1024679 3300006944 Bacteria 5421
259 Ga0075435_100087656 3300007076 Bacteria 2565
260 Ga0099794_10003317 3300007265 Bacteria 6112
261 Ga0099794_10098671 3300007265 Bacteria 1456
262 Ga0099795_10003094 3300007788 Bacteria 4066
263 Ga0099795_10028013 3300007788 Bacteria 1911
264 Ga0105244_10074608 3300009036 Bacteria 1687
265 Ga0105240_10003456 3300009093 Bacteria 24510
266 Ga0105240_10012909 3300009093 Bacteria 11506
267 Ga0105240_10043532 3300009093 Bacteria 5712
268 Ga0105240_10071555 3300009093 Bacteria 4289
269 Ga0105240_10094483 3300009093 Bacteria 3647
270 Ga0105240_10209403 3300009093 Bacteria 2279
271 Ga0105240_10287268 3300009093 Bacteria 1887
272 Ga0105240_10354146 3300009093 Bacteria 1665
273 Ga0105240_10631035 3300009093 Bacteria 1176
274 Ga0111539_10041513 3300009094 Bacteria 5531
275 Ga0111539_10273642 3300009094 Bacteria 1965
276 Ga0111539_10288746 3300009094 Bacteria 1909
277 Ga0111539_10313558 3300009094 Bacteria 1826
278 Ga0111539_10656131 3300009094 Bacteria 1222
279 Ga0105245_10048518 3300009098 Bacteria 3799
280 Ga0105245_10062478 3300009098 Bacteria 3360
281 Ga0105245_10295203 3300009098 Bacteria 1588
282 Ga0105245_10898606 3300009098 Bacteria 927
283 Ga0105247_10033948 3300009101 Bacteria 3106
284 Ga0105247_10107324 3300009101 Bacteria 1793
285 Ga0105247_10310290 3300009101 Bacteria 1097
286 Ga0114129_10099524 3300009147 Bacteria 4024
287 Ga0114129_10100119 3300009147 Bacteria 4010
288 Ga0114129_10258935 3300009147 Bacteria 2333
289 Ga0105243_10042136 3300009148 Bacteria 3573
290 Ga0105241_10029805 3300009174 Bacteria 4074
291 Ga0105241_10082586 3300009174 Bacteria 2519
292 Ga0105241_10322680 3300009174 Bacteria 1332
293 Ga0105241_10375461 3300009174 Bacteria 1241
294 Ga0105241_10509816 3300009174 Bacteria 1074
295 Ga0105242_10278478 3300009176 Bacteria 1518
296 Ga0105242_10434735 3300009176 Bacteria 1233
297 Ga0105248_10032228 3300009177 Bacteria 5858
298 Ga0105248_10088266 3300009177 Bacteria 3490
299 Ga0105248_10221469 3300009177 Bacteria 2130
300 Ga0105248_10272994 3300009177 Bacteria 1904
301 Ga0105248_10299459 3300009177 Bacteria 1811
302 Ga0105237_10083404 3300009545 Bacteria 3188
303 Ga0105237_10205582 3300009545 Bacteria 1969
304 Ga0105237_10217788 3300009545 Bacteria 1909
305 Ga0105237_10247229 3300009545 Bacteria 1785
306 Ga0105237_10469786 3300009545 Bacteria 1264
307 Ga0105238_10015239 3300009551 Bacteria 7783
308 Ga0105238_10017873 3300009551 Bacteria 7209
309 Ga0105238_10039830 3300009551 Bacteria 4764
310 Ga0105238_10049070 3300009551 Bacteria 4253
311 Ga0105238_10056888 3300009551 Bacteria 3923
312 Ga0105238_10119143 3300009551 Bacteria 2620
313 Ga0105238_10126156 3300009551 Bacteria 2538
314 Ga0105238_10560042 3300009551 Bacteria 1148
315 Ga0105249_10088853 3300009553 Bacteria 2886
316 Ga0105249_10593228 3300009553 Bacteria 1162
317 Ga0105239_10007768 3300010375 Bacteria 12275
318 Ga0105239_10041053 3300010375 Bacteria 5070
319 Ga0105239_10047108 3300010375 Bacteria 4724
320 Ga0105239_10543654 3300010375 Bacteria 1323
321 Ga0105246_10027415 3300011119 Bacteria 3731
322 Ga0105246_10128931 3300011119 Bacteria 1886
323 Ga0105246_10142910 3300011119 Bacteria 1802
324 Ga0105246_10265888 3300011119 Bacteria 1369
325 Ga0105246_10319180 3300011119 Bacteria 1262
326 Ga0157339_1001999 3300012505 Bacteria 1330
327 Ga0157373_10054578 3300013100 Bacteria 2839
328 Ga0157373_10080298 3300013100 Bacteria 2300
329 Ga0157371_10087194 3300013102 Bacteria 2210
330 Ga0157370_10071166 3300013104 Bacteria 3282
331 Ga0157370_10245754 3300013104 Bacteria 1655
332 Ga0157369_10012284 3300013105 Bacteria 9726
333 Ga0157369_10047236 3300013105 Bacteria 4676
334 Ga0157369_10217338 3300013105 Bacteria 2001
335 Ga0157374_10038013 3300013296 Bacteria 4422
336 Ga0157374_10190078 3300013296 Bacteria 2008
337 Ga0157374_10733350 3300013296 Bacteria 1002
338 Ga0157378_10109936 3300013297 Bacteria 2525
339 Ga0157378_10438037 3300013297 Bacteria 1295
340 Ga0157378_10483300 3300013297 Bacteria 1234
341 Ga0163162_10117935 3300013306 Bacteria 2756
342 Ga0163162_10236196 3300013306 Bacteria 1958
343 Ga0157372_10061655 3300013307 Bacteria 4200
344 Ga0157372_10212623 3300013307 Bacteria 2241
345 Ga0157372_10462919 3300013307 Bacteria 1478
346 Ga0157375_10141087 3300013308 Bacteria 2537
347 Ga0157375_10195603 3300013308 Bacteria 2177
348 Ga0157375_10296391 3300013308 Bacteria 1780
349 Ga0157375_10514473 3300013308 Bacteria 1361
350 Ga0163163_10009676 3300014325 Bacteria 8623
351 Ga0163163_10036866 3300014325 Bacteria 4752
352 Ga0163163_10207624 3300014325 Bacteria 2007
353 Ga0163163_10288375 3300014325 Bacteria 1693
354 Ga0163163_10288660 3300014325 Bacteria 1693
355 Ga0157380_10080959 3300014326 Bacteria 2655
356 Ga0157380_10146325 3300014326 Bacteria 2037
357 Ga0157377_10189865 3300014745 Bacteria 1298
358 Ga0157377_10231667 3300014745 Bacteria 1188
359 Ga0157377_10270908 3300014745 Bacteria 1109
360 Ga0157379_10173043 3300014968 Bacteria 1949
361 Ga0157379_10249068 3300014968 Bacteria 1612
362 Ga0157379_10351511 3300014968 Bacteria 1349
363 Ga0157376_10059767 3300014969 Bacteria 3197
364 Ga0157376_10104151 3300014969 Bacteria 2486
365 Ga0157376_10116336 3300014969 Bacteria 2362
366 Ga0157376_10175130 3300014969 Bacteria 1956
367 Ga0163161_10113354 3300017792 Bacteria 2029
368 Ga0163161_10222549 3300017792 Bacteria 1462
369 Ga0163161_10239596 3300017792 Bacteria 1410
370 Ga0197907_11209949 3300020069 Bacteria 1419
371 Ga0206354_10920056 3300020081 Bacteria 920
372 Ga0206353_10108935 3300020082 Bacteria 874
373 Ga0209563_104891 3300025230 Bacteria 2501
374 Ga0209233_1002215 3300025261 Bacteria 7293
375 Ga0209676_1000327 3300025292 Bacteria 91596
376 Ga0209564_1001796 3300025295 Bacteria 19822
377 Ga0209564_1003203 3300025295 Bacteria 11497
378 Ga0209564_1047021 3300025295 Bacteria 1092
379 Ga0209758_1000371 3300025297 Bacteria 78923
380 Ga0209758_1001291 3300025297 Bacteria 30796
381 Ga0209758_1001559 3300025297 Bacteria 26277
382 Ga0209758_1003458 3300025297 Bacteria 14328
383 Ga0209758_1011126 3300025297 Bacteria 5256
384 Ga0209758_1014744 3300025297 Bacteria 4124
385 Ga0209758_1085607 3300025297 Bacteria 938
386 Ga0209050_1001093 3300025298 Bacteria 32922
387 Ga0207426_1000352 3300025302 Bacteria 84141
388 Ga0207426_1005546 3300025302 Bacteria 5737
389 Ga0209257_1000609 3300025304 Bacteria 58413
390 Ga0207697_10014505 3300025315 Bacteria 3268
391 Ga0207697_10070251 3300025315 Bacteria 1466
392 Ga0207656_10007348 3300025321 Bacteria 4007
393 Ga0207682_10003960 3300025893 Bacteria 6310
394 Ga0207692_10000724 3300025898 Bacteria 11629
395 Ga0207692_10010688 3300025898 Bacteria 3879
396 Ga0207692_10253297 3300025898 Bacteria 1056
397 Ga0207642_10149832 3300025899 Bacteria 1240
398 Ga0207710_10005547 3300025900 Bacteria 5429
399 Ga0207710_10216016 3300025900 Bacteria 951
400 Ga0207710_10235481 3300025900 Bacteria 912
401 Ga0207688_10033354 3300025901 Bacteria 2847
402 Ga0207688_10054478 3300025901 Bacteria 2244
403 Ga0207688_10062052 3300025901 Bacteria 2107
404 Ga0207688_10077716 3300025901 Bacteria 1892
405 Ga0207680_10052069 3300025903 Bacteria 2451
406 Ga0207680_10124672 3300025903 Bacteria 1689
407 Ga0207647_10004508 3300025904 Bacteria 10321
408 Ga0207647_10015943 3300025904 Bacteria 5137
409 Ga0207647_10166333 3300025904 Bacteria 1285
410 Ga0207685_10000490 3300025905 Bacteria 6723
411 Ga0207685_10046559 3300025905 Bacteria 1651
412 Ga0207699_10001497 3300025906 Bacteria 11087
413 Ga0207699_10002390 3300025906 Bacteria 8860
414 Ga0207699_10021380 3300025906 Bacteria 3486
415 Ga0207699_10094410 3300025906 Bacteria 1884
416 Ga0207643_10040058 3300025908 Bacteria 2637
417 Ga0207705_10100992 3300025909 Bacteria 2122
418 Ga0207705_10243255 3300025909 Bacteria 1371
419 Ga0207705_10352742 3300025909 Bacteria 1134
420 Ga0207684_10545295 3300025910 Bacteria 992
421 Ga0207654_10000344 3300025911 Bacteria 27758
422 Ga0207654_10034166 3300025911 Bacteria 2824
423 Ga0207654_10080204 3300025911 Bacteria 1962
424 Ga0207654_10200746 3300025911 Bacteria 1313
425 Ga0207707_10038828 3300025912 Bacteria 4161
426 Ga0207707_10103434 3300025912 Bacteria 2489
427 Ga0207707_10132454 3300025912 Bacteria 2180
428 Ga0207707_10387875 3300025912 Bacteria 1200
429 Ga0207695_10000015 3300025913 Bacteria 803205
430 Ga0207695_10000402 3300025913 Bacteria 96771
431 Ga0207695_10026603 3300025913 Bacteria 6456
432 Ga0207695_10037699 3300025913 Bacteria 5214
433 Ga0207695_10089621 3300025913 Bacteria 3093
434 Ga0207695_10148509 3300025913 Bacteria 2285
435 Ga0207671_10001316 3300025914 Bacteria 29070
436 Ga0207671_10053672 3300025914 Bacteria 2986
437 Ga0207693_10003086 3300025915 Bacteria 14356
438 Ga0207693_10018422 3300025915 Bacteria 5562
439 Ga0207693_10020465 3300025915 Bacteria 5262
440 Ga0207693_10035146 3300025915 Bacteria 3951
441 Ga0207693_10051463 3300025915 Bacteria 3232
442 Ga0207693_10346168 3300025915 Bacteria 1163
443 Ga0207663_10001974 3300025916 Bacteria 9722
444 Ga0207663_10005570 3300025916 Bacteria 6356
445 Ga0207663_10025028 3300025916 Bacteria 3444
446 Ga0207663_10057238 3300025916 Bacteria 2455
447 Ga0207663_10082371 3300025916 Bacteria 2110
448 Ga0207660_10002465 3300025917 Bacteria 12153
449 Ga0207660_10022470 3300025917 Bacteria 4250
450 Ga0207657_10019503 3300025919 Bacteria 6437
451 Ga0207657_10027909 3300025919 Bacteria 5161
452 Ga0207657_10066342 3300025919 Bacteria 3072
453 Ga0207657_10258441 3300025919 Bacteria 1386
454 Ga0207652_10002286 3300025921 Bacteria 16255
455 Ga0207652_10175524 3300025921 Bacteria 1924
456 Ga0207652_10533685 3300025921 Bacteria 1055
457 Ga0207681_10273578 3300025923 Bacteria 1327
458 Ga0207694_10000095 3300025924 Bacteria 99130
459 Ga0207694_10028380 3300025924 Bacteria 4266
460 Ga0207694_10040730 3300025924 Bacteria 3578
461 Ga0207694_10054256 3300025924 Bacteria 3109
462 Ga0207650_10054104 3300025925 Bacteria 2976
463 Ga0207650_10227353 3300025925 Bacteria 1504
464 Ga0207659_10152389 3300025926 Bacteria 1806
465 Ga0207687_10008392 3300025927 Bacteria 6758
466 Ga0207687_10077091 3300025927 Bacteria 2396
467 Ga0207687_10298241 3300025927 Bacteria 1297
468 Ga0207687_10316001 3300025927 Bacteria 1263
469 Ga0207687_10411048 3300025927 Bacteria 1115
470 Ga0207700_10004634 3300025928 Bacteria 8144
471 Ga0207700_10012786 3300025928 Bacteria 5428
472 Ga0207700_10017235 3300025928 Bacteria 4820
473 Ga0207700_10060010 3300025928 Bacteria 2879
474 Ga0207700_10071819 3300025928 Bacteria 2666
475 Ga0207700_10074945 3300025928 Bacteria 2620
476 Ga0207700_10092425 3300025928 Bacteria 2392
477 Ga0207700_10392555 3300025928 Bacteria 1215
478 Ga0207664_10005861 3300025929 Bacteria 8404
479 Ga0207664_10055230 3300025929 Bacteria 3151
480 Ga0207664_10060623 3300025929 Bacteria 3016
481 Ga0207664_10081041 3300025929 Bacteria 2640
482 Ga0207644_10010381 3300025931 Bacteria 6138
483 Ga0207644_10024814 3300025931 Bacteria 4118
484 Ga0207644_10284045 3300025931 Bacteria 1329
485 Ga0207644_10455504 3300025931 Bacteria 1051
486 Ga0207690_10080890 3300025932 Bacteria 2268
487 Ga0207690_10173761 3300025932 Bacteria 1616
488 Ga0207706_10012740 3300025933 Bacteria 7654
489 Ga0207706_10212076 3300025933 Bacteria 1697
490 Ga0207686_10012373 3300025934 Bacteria 4692
491 Ga0207686_10046906 3300025934 Bacteria 2668
492 Ga0207709_10052202 3300025935 Bacteria 2510
493 Ga0207670_10030422 3300025936 Bacteria 3450
494 Ga0207670_10317589 3300025936 Bacteria 1225
495 Ga0207670_10328262 3300025936 Bacteria 1205
496 Ga0207669_10033925 3300025937 Bacteria 2886
497 Ga0207669_10115076 3300025937 Bacteria 1812
498 Ga0207669_10351262 3300025937 Bacteria 1139
499 Ga0207704_10005807 3300025938 Bacteria 5708
500 Ga0207704_10050895 3300025938 Bacteria 2501
501 Ga0207704_10124949 3300025938 Bacteria 1769
502 Ga0207704_10673730 3300025938 Bacteria 854
503 Ga0207665_10000455 3300025939 Bacteria 28194
504 Ga0207665_10003636 3300025939 Bacteria 10301
505 Ga0207665_10011323 3300025939 Bacteria 5856
506 Ga0207665_10088607 3300025939 Bacteria 2141
507 Ga0207665_10292275 3300025939 Bacteria 1216
508 Ga0207691_10069954 3300025940 Bacteria 3169
509 Ga0207691_10131391 3300025940 Bacteria 2212
510 Ga0207711_10022195 3300025941 Bacteria 5307
511 Ga0207711_10095450 3300025941 Bacteria 2623
512 Ga0207689_10021472 3300025942 Bacteria 5427
513 Ga0207689_10030547 3300025942 Bacteria 4490
514 Ga0207661_10000227 3300025944 Bacteria 36896
515 Ga0207661_10043715 3300025944 Bacteria 3537
516 Ga0207661_10353844 3300025944 Bacteria 1325
517 Ga0207679_10140943 3300025945 Bacteria 1948
518 Ga0207679_10318224 3300025945 Bacteria 1346
519 Ga0207667_10037625 3300025949 Bacteria 5172
520 Ga0207667_10042452 3300025949 Bacteria 4833
521 Ga0207667_10069488 3300025949 Bacteria 3665
522 Ga0207667_10129097 3300025949 Bacteria 2603
523 Ga0207667_10258659 3300025949 Bacteria 1780
524 Ga0207667_10318937 3300025949 Bacteria 1587
525 Ga0207667_10400518 3300025949 Bacteria 1397
526 Ga0207651_10139634 3300025960 Bacteria 1869
527 Ga0207651_10155253 3300025960 Bacteria 1787
528 Ga0207651_10181556 3300025960 Bacteria 1670
529 Ga0207651_10224091 3300025960 Bacteria 1522
530 Ga0207712_10178151 3300025961 Bacteria 1667
531 Ga0207712_10203294 3300025961 Bacteria 1572
532 Ga0207668_10018976 3300025972 Bacteria 4336
533 Ga0207668_10050682 3300025972 Bacteria 2862
534 Ga0207668_10173452 3300025972 Bacteria 1693
535 Ga0207668_10252375 3300025972 Bacteria 1433
536 Ga0207640_10018371 3300025981 Bacteria 4109
537 Ga0207640_10143765 3300025981 Bacteria 1742
538 Ga0207658_10015698 3300025986 Bacteria 5199
539 Ga0207658_10018042 3300025986 Bacteria 4867
540 Ga0207658_10164950 3300025986 Bacteria 1819
541 Ga0207658_10315632 3300025986 Bacteria 1351
542 Ga0207658_10437314 3300025986 Bacteria 1156
543 Ga0207677_10009719 3300026023 Bacteria 5417
544 Ga0207677_10385440 3300026023 Bacteria 1184
545 Ga0207703_10228165 3300026035 Bacteria 1668
546 Ga0207703_10575241 3300026035 Bacteria 1064
547 Ga0207639_10049151 3300026041 Bacteria 3196
548 Ga0207639_10088929 3300026041 Bacteria 2466
549 Ga0207639_10276048 3300026041 Bacteria 1476
550 Ga0207639_10290452 3300026041 Bacteria 1441
551 Ga0207639_10647564 3300026041 Bacteria 977
552 Ga0207678_10016707 3300026067 Bacteria 6446
553 Ga0207678_10018224 3300026067 Bacteria 6166
554 Ga0207678_10144884 3300026067 Bacteria 2028
555 Ga0207678_10152456 3300026067 Bacteria 1974
556 Ga0207678_10165636 3300026067 Bacteria 1887
557 Ga0207678_10231459 3300026067 Bacteria 1582
558 Ga0207678_10243570 3300026067 Bacteria 1540
559 Ga0207678_10255834 3300026067 Bacteria 1500
560 Ga0207678_10285683 3300026067 Bacteria 1416
561 Ga0207678_10515968 3300026067 Bacteria 1043
562 Ga0207708_10347917 3300026075 Bacteria 1215
563 Ga0207702_10000025 3300026078 Bacteria 186312
564 Ga0207702_10000075 3300026078 Bacteria 112303
565 Ga0207702_10008399 3300026078 Bacteria 8713
566 Ga0207702_10139135 3300026078 Bacteria 2194
567 Ga0207702_10151415 3300026078 Bacteria 2110
568 Ga0207702_10159644 3300026078 Bacteria 2058
569 Ga0207702_10197843 3300026078 Bacteria 1861
570 Ga0207702_10614955 3300026078 Bacteria 1067
571 Ga0207641_10069289 3300026088 Bacteria 3027
572 Ga0207641_10246807 3300026088 Bacteria 1666
573 Ga0207641_10315497 3300026088 Bacteria 1481
574 Ga0207641_10493922 3300026088 Bacteria 1188
575 Ga0207676_10008170 3300026095 Bacteria 7443
576 Ga0207676_10071536 3300026095 Bacteria 2785
577 Ga0207676_10277560 3300026095 Bacteria 1520
578 Ga0207674_10022795 3300026116 Bacteria 6719
579 Ga0207674_10063245 3300026116 Bacteria 3735
580 Ga0207674_10078135 3300026116 Bacteria 3315
581 Ga0207674_10128285 3300026116 Bacteria 2501
582 Ga0207674_10176530 3300026116 Bacteria 2088
583 Ga0207674_10379881 3300026116 Bacteria 1366
584 Ga0207674_10510214 3300026116 Bacteria 1162
585 Ga0207675_100023527 3300026118 Bacteria 5731
586 Ga0207675_100148916 3300026118 Bacteria 2227
587 Ga0207675_100151263 3300026118 Bacteria 2209
588 Ga0207675_100240797 3300026118 Bacteria 1748
589 Ga0207683_10013509 3300026121 Bacteria 6968
590 Ga0207683_10020817 3300026121 Bacteria 5611
591 Ga0207683_10033981 3300026121 Bacteria 4430
592 Ga0207683_10034301 3300026121 Bacteria 4410
593 Ga0207683_10073168 3300026121 Bacteria 3031
594 Ga0207683_10079700 3300026121 Bacteria 2904
595 Ga0207683_10204096 3300026121 Bacteria 1797
596 Ga0207683_10690267 3300026121 Bacteria 946
597 Ga0207698_10011948 3300026142 Bacteria 5656
598 Ga0207698_10241062 3300026142 Bacteria 1648
599 Ga0207698_10592153 3300026142 Bacteria 1092
600 Ga0207698_10916301 3300026142 Bacteria 884
601 Ga0209389_1000132 3300027296 Bacteria 66230
602 Ga0209589_1000003 3300027357 Bacteria 629130
603 Ga0209489_100003 3300027361 Bacteria 663105
604 Ga0209489_103912 3300027361 Bacteria 28301
605 Ga0209700_100003 3300027363 Bacteria 663105
606 Ga0209700_100281 3300027363 Bacteria 90519
607 Ga0209588_1004688 3300027671 Bacteria 3876
608 Ga0209813_10004019 3300027866 Bacteria 3485
609 Ga0209813_10042829 3300027866 Bacteria 1385
610 Ga0209813_10097669 3300027866 Bacteria 995
611 Ga0207428_10149772 3300027907 Bacteria 1776
612 Ga0268266_10002093 3300028379 Bacteria 22080
613 Ga0268266_10003481 3300028379 Bacteria 15689
614 Ga0268266_10004788 3300028379 Bacteria 12854
615 Ga0268266_10010224 3300028379 Bacteria 8219
616 Ga0268266_10016552 3300028379 Bacteria 6303
617 Ga0268266_10071199 3300028379 Bacteria 3013
618 Ga0268266_10481587 3300028379 Bacteria 1183
619 Ga0268265_10060380 3300028380 Bacteria 2905
620 Ga0268265_10098647 3300028380 Bacteria 2353
621 Ga0268265_10451672 3300028380 Bacteria 1200
622 Ga0268265_10547078 3300028380 Bacteria 1098
623 Ga0268264_10000022 3300028381 Bacteria 476624
624 Ga0268264_10149643 3300028381 Bacteria 2091
625 Ga0265334_10035881 3300028573 Bacteria 1960
626 Ga0307517_10000111 3300028786 Bacteria 120304
627 Ga0307515_10198993 3300028794 Bacteria 1886
628 Ga0307511_10028875 3300030521 Bacteria 5022
629 Ga0265330_10015875 3300031235 Bacteria 3479
630 Ga0265330_10028009 3300031235 Bacteria 2542
631 Ga0265332_10005648 3300031238 Bacteria 5750
632 Ga0265332_10061076 3300031238 Bacteria 1611
633 Ga0265325_10000006 3300031241 Bacteria 255758
634 Ga0265325_10005078 3300031241 Bacteria 8189
635 Ga0265340_10001029 3300031247 Bacteria 15913
636 Ga0265316_10069202 3300031344 Bacteria 2724
637 Ga0265316_10397008 3300031344 Bacteria 994
638 Ga0265316_10428241 3300031344 Bacteria 951
639 Ga0307509_10083821 3300031507 Bacteria 3285
640 Ga0307509_10204439 3300031507 Bacteria 1807
641 Ga0307509_10235360 3300031507 Bacteria 1630
642 Ga0265313_10004211 3300031595 Bacteria 11152
643 Ga0265313_10038758 3300031595 Bacteria 2370
644 Ga0307508_10000001 3300031616 Bacteria 553635
645 Ga0265314_10007699 3300031711 Bacteria 9314
646 Ga0265314_10053368 3300031711 Bacteria 2804
647 Ga0265342_10062563 3300031712 Bacteria 2190
648 Ga0265342_10143952 3300031712 Bacteria 1328
649 Ga0307516_10080872 3300031730 Bacteria 3093
650 Ga0307412_10192022 3300031911 Bacteria 1545
651 Ga0307409_100031793 3300031995 Bacteria 3815
652 Ga0307411_10162698 3300032005 Bacteria 1674
653 Ga0307415_100088179 3300032126 Bacteria 2238
654 Ga0307415_100106386 3300032126 Bacteria 2071
655 Ga0307415_100301385 3300032126 Bacteria 1328
656 Ga0307510_10001748 3300033180 Bacteria 24223
657 Ga0307510_10214854 3300033180 Bacteria 1441
658 Ga0315911_1000001 3300033442 Bacteria 1088602
659 Ga0373930_0009477 3300034816 Bacteria 1723
660 Ga0373958_0050421 3300034819 Bacteria 878
661 Ga0373959_0004888 3300034820 Bacteria 2181
662 Ga0373938_0014855 3300034957 Bacteria 1500
663 Ga0373929_0004081 3300035085 Bacteria 2617
664 Ga0373934_0002524 3300035086 Bacteria 6733
665 Ga0373934_0043127 3300035086 Bacteria 1783
666 Ga0373934_0047487 3300035086 Bacteria 1698
667 Ga0373940_0005371 3300035088 Bacteria 2772
668 Ga0373952_0000703 3300035092 Bacteria 5962
669 Ga0373932_0004218 3300035112 Bacteria 3414
670 Ga0373936_0005474 3300035113 Bacteria 4790
671 Ga0373936_0036940 3300035113 Bacteria 1949
672 Ga0373936_0054933 3300035113 Bacteria 1616
673 Ga0373941_0009331 3300035115 Bacteria 2468
674 Ga0373941_0032545 3300035115 Bacteria 1561
675 Ga0373945_0012567 3300035116 Bacteria 2814
676 Ga0373945_0024502 3300035116 Bacteria 2091
677 Ga0373945_0103450 3300035116 Bacteria 1117
678 Ga0373953_0006545 3300035117 Bacteria 3845
679 Ga0373953_0130758 3300035117 Bacteria 1070
680 Ga0373954_0001369 3300035118 Bacteria 9839
681 Ga0373956_0028711 3300035119 Bacteria 2422
682 Ga0373956_0079479 3300035119 Bacteria 1503
683 Ga0373957_0040888 3300035120 Bacteria 1744
684 Ga0373960_0009007 3300035121 Bacteria 2408
685 Ga0373943_0007816 3300035170 Bacteria 4803
686 Ga0373943_0023765 3300035170 Bacteria 2852
687 Ga0373943_0026965 3300035170 Bacteria 2695
688 Ga0373943_0039720 3300035170 Bacteria 2269
689 Ga0373946_0014662 3300035171 Bacteria 2958
690 Ga0373946_0038028 3300035171 Bacteria 1958
691 Ga0373955_0001864 3300035172 Bacteria 9068
692 Ga0373955_0027869 3300035172 Bacteria 2924
693 Ga0373955_0048107 3300035172 Bacteria 2311
694 Ga0373961_0012551 3300035241 Bacteria 2123
695 Ga0373962_0005970 3300035242 Bacteria 2939
696 Ga0373924_0004443 3300035410 Bacteria 4896
697 Ga0373924_0031770 3300035410 Bacteria 2125
698 Ga0373931_0003730 3300035691 Bacteria 6894
699 Ga0373931_0013950 3300035691 Bacteria 3920
700 Ga0373931_0014396 3300035691 Bacteria 3865
701 Ga0373935_0000110 3300035692 Bacteria 37393
702 Ga0373935_0028868 3300035692 Bacteria 3429
703 Ga0373935_0041167 3300035692 Bacteria 2901
704 Ga0373935_0203993 3300035692 Bacteria 1367
705 Ga0373927_0002008 3300035695 Bacteria 14993
706 Ga0373927_0005256 3300035695 Bacteria 8954
707 Ga0373927_0038834 3300035695 Bacteria 3090
708 Ga0373933_0000117 3300035724 Bacteria 51348
709 Ga0373933_0000863 3300035724 Bacteria 18584
710 Ga0373933_0033912 3300035724 Bacteria 2972
711 Ga0373933_0056752 3300035724 Bacteria 2351
712 Ga0373933_0154366 3300035724 Bacteria 1455
713 Ga0373933_0205792 3300035724 Bacteria 1260
714 Ga0373947_0001449 3300035725 Bacteria 14598
715 Ga0373947_0012614 3300035725 Bacteria 4847
716 Ga0373947_0096855 3300035725 Bacteria 1848
717 Ga0373947_0203348 3300035725 Bacteria 1297
718 Ga0373947_0277508 3300035725 Bacteria 1113
719 Ga0373937_0007186 3300036401 Bacteria 9632
720 Ga0373937_0031239 3300036401 Bacteria 4824
721 Ga0373937_0080469 3300036401 Bacteria 3013
722 Ga0373937_0208724 3300036401 Bacteria 1837
723 Ga0373937_0373974 3300036401 Bacteria 1351
724 Ga0373925_0000748 3300037068 Bacteria 29849
725 Ga0373925_0004770 3300037068 Bacteria 10213
726 Ga0373925_0021180 3300037068 Bacteria 4737
727 Ga0373925_0082755 3300037068 Bacteria 2443
728 Ga0373925_0087242 3300037068 Bacteria 2381
729 Ga0373925_0148842 3300037068 Bacteria 1837
730 Ga0373925_0289015 3300037068 Bacteria 1322
731 Ga0373925_0567824 3300037068 Bacteria 933
732 Ga0395900_0001759 3300037418 Bacteria 24863
733 Ga0395900_0005207 3300037418 Bacteria 13642
734 Ga0395898_0001625 3300037466 Bacteria 30490
735 Ga0395898_0055146 3300037466 Bacteria 3877
736 Ga0395898_0063202 3300037466 Bacteria 3593
737 Ga0395898_0122535 3300037466 Bacteria 2491
738 Ga0395898_0395500 3300037466 Bacteria 1318
739 Ga0395905_0002799 3300037471 Bacteria 19109
740 Ga0395905_0174543 3300037471 Bacteria 2018
741 Ga0395905_0499771 3300037471 Bacteria 1116
742 Ga0436364_0539583 3300037853 Bacteria 4923
743 Ga0395901_0043346 3300038443 Bacteria 4668
744 Ga0395901_0102918 3300038443 Bacteria 2996
745 Ga0395901_0410686 3300038443 Bacteria 1390
746 Ga0400483_060836 3300039062 Bacteria 1154
747 Ga0436365_0257418 3300039437 Bacteria 2138
748 Ga0436365_1023002 3300039437 Bacteria 2389
749 Ga0436360_0096391 3300039438 Bacteria 2568
750 Ga0436361_0480907 3300039447 Bacteria 7901
751 Ga0436361_0862295 3300039447 Bacteria 1175
752 Ga0436363_0062258 3300039450 Bacteria 1042
753 Ga0436363_1628114 3300039450 Bacteria 2395
754 Ga0439453_0006931 3300041408 Bacteria 1780
755 Ga0439435_0001490 3300042436 Bacteria 4353
756 Ga0466969_0163530 3300044656 Bacteria 1022
757 Ga0466972_0000125 3300044658 Bacteria 65105
758 Ga0466965_0313425 3300044683 Bacteria 853
759 Ga0466966_0161906 3300044684 Bacteria 1362
760 Ga0466966_0168686 3300044684 Bacteria 1331
761 Ga0466966_0214125 3300044684 Bacteria 1164
762 Ga0466961_0023660 3300044693 Bacteria 3953
763 Ga0466961_0099657 3300044693 Bacteria 1831
764 Ga0466963_0016505 3300044694 Bacteria 4592
765 Ga0466963_0105572 3300044694 Bacteria 1931
766 Ga0466957_0322588 3300044842 Bacteria 1042
767 Ga0466960_0159631 3300044901 Bacteria 1210
768 Ga0466959_0018639 3300045049 Bacteria 5098
769 Ga0466959_0360311 3300045049 Bacteria 991
770 Ga0466958_0139995 3300045836 Bacteria 1523
771 Ga0466958_0328468 3300045836 Bacteria 983
772 Ga0466967_0002462 3300045976 Bacteria 11534
773 Ga0466967_0042275 3300045976 Bacteria 3937
774 Ga0466967_0468639 3300045976 Bacteria 1233
775 Ga0466967_0546005 3300045976 Bacteria 1140
776 Ga0495617_068258 3300046452 Bacteria 1170
777 Ga0495592_0003752 3300046454 Bacteria 10963
778 Ga0495592_0030096 3300046454 Bacteria 4106
779 Ga0495592_0054979 3300046454 Bacteria 2947
780 Ga0495592_0210847 3300046454 Bacteria 1304
781 Ga0495603_0000011 3300046455 Bacteria 69832
782 Ga0495603_0016002 3300046455 Bacteria 4535
783 Ga0495603_0018500 3300046455 Bacteria 4215
784 Ga0495603_0018693 3300046455 Bacteria 4193
785 Ga0495603_0029271 3300046455 Bacteria 3321
786 Ga0495603_0126687 3300046455 Bacteria 1488
787 Ga0495603_0145321 3300046455 Bacteria 1379
788 Ga0495629_0000251 3300046459 Bacteria 46643
789 Ga0495629_0000253 3300046459 Bacteria 46595
790 Ga0495629_0002122 3300046459 Bacteria 15363
791 Ga0495638_0009386 3300046460 Bacteria 6876
792 Ga0495638_0022362 3300046460 Bacteria 4151
793 Ga0495638_0036500 3300046460 Bacteria 3131
794 Ga0495638_0039823 3300046460 Bacteria 2981
795 Ga0495638_0056366 3300046460 Bacteria 2438
796 Ga0495641_0014674 3300046461 Bacteria 4228
797 Ga0495641_0017327 3300046461 Bacteria 3757
798 Ga0495641_0039165 3300046461 Bacteria 2211
799 Ga0495651_0015572 3300046462 Bacteria 5884
800 Ga0495651_0085167 3300046462 Bacteria 2380
801 Ga0495651_0120048 3300046462 Bacteria 1932
802 Ga0495653_0000473 3300046463 Bacteria 31165
803 Ga0495653_0113012 3300046463 Bacteria 1948
804 Ga0495650_0085380 3300046471 Bacteria 1209
805 Ga0495580_0015052 3300046472 Bacteria 5853
806 Ga0495580_0018909 3300046472 Bacteria 5125
807 Ga0495580_0533797 3300046472 Bacteria 780
808 Ga0495582_0000974 3300046473 Bacteria 16016
809 Ga0495582_0027990 3300046473 Bacteria 3092
810 Ga0495605_0032938 3300046474 Bacteria 2635
811 Ga0495639_0000017 3300046475 Bacteria 76508
812 Ga0495639_0060223 3300046475 Bacteria 1739
813 Ga0495639_0198543 3300046475 Bacteria 981
814 Ga0495662_0000179 3300046476 Bacteria 25483
815 Ga0495662_0129503 3300046476 Bacteria 1240
816 Ga0495662_0220546 3300046476 Bacteria 935
817 Ga0495662_0233079 3300046476 Bacteria 907
818 Ga0495664_0035477 3300046477 Bacteria 2937
819 Ga0495664_0089776 3300046477 Bacteria 1847
820 Ga0495664_0278364 3300046477 Bacteria 1011
821 Ga0495585_0004643 3300046492 Bacteria 8861
822 Ga0495585_0088116 3300046492 Bacteria 1674
823 Ga0495594_0000094 3300046499 Bacteria 41090
824 Ga0495594_0007078 3300046499 Bacteria 5769
825 Ga0495594_0079170 3300046499 Bacteria 1834
826 Ga0495594_0098064 3300046499 Bacteria 1647
827 Ga0495594_0102898 3300046499 Bacteria 1607
828 Ga0495606_0002138 3300046507 Bacteria 23850
829 Ga0495606_0102853 3300046507 Bacteria 1736
830 Ga0495608_0007400 3300046511 Bacteria 7752
831 Ga0495608_0060453 3300046511 Bacteria 2493
832 Ga0495610_0075749 3300046512 Bacteria 1557
833 Ga0495616_0043510 3300046513 Bacteria 2281
834 Ga0495616_0052942 3300046513 Bacteria 2019
835 Ga0495616_0107873 3300046513 Bacteria 1297
836 Ga0495618_0084293 3300046514 Bacteria 2031
837 Ga0495618_0095271 3300046514 Bacteria 1903
838 Ga0495618_0189316 3300046514 Bacteria 1305
839 Ga0495618_0430564 3300046514 Bacteria 803
840 Ga0495620_0024967 3300046515 Bacteria 2836
841 Ga0495620_0121661 3300046515 Bacteria 1028
842 Ga0495628_0027034 3300046516 Bacteria 4671
843 Ga0495628_0030482 3300046516 Bacteria 4367
844 Ga0495628_0064067 3300046516 Bacteria 2878
845 Ga0495628_0180064 3300046516 Bacteria 1599
846 Ga0495628_0244898 3300046516 Bacteria 1340
847 Ga0495630_0008181 3300046517 Bacteria 7511
848 Ga0495630_0036331 3300046517 Bacteria 3683
849 Ga0495632_0130764 3300046519 Bacteria 1168
850 Ga0495632_0157335 3300046519 Bacteria 1048
851 Ga0495644_0003084 3300046523 Bacteria 6594
852 Ga0495648_0000494 3300046524 Bacteria 42434
853 Ga0495648_0001433 3300046524 Bacteria 23346
854 Ga0495648_0060116 3300046524 Bacteria 2263
855 Ga0495666_0149246 3300046526 Bacteria 1087
856 Ga0495666_0191232 3300046526 Bacteria 943
857 Ga0495642_0129722 3300046528 Bacteria 1085
858 Ga0495652_0006106 3300046529 Bacteria 11263
859 Ga0495652_0013728 3300046529 Bacteria 7286
860 Ga0495652_0091230 3300046529 Bacteria 2491
861 Ga0495652_0113263 3300046529 Bacteria 2178
862 Ga0495652_0119722 3300046529 Bacteria 2102
863 Ga0495654_0005880 3300046530 Bacteria 7057
864 Ga0495654_0032938 3300046530 Bacteria 2625
865 Ga0495654_0165740 3300046530 Bacteria 967
866 Ga0495665_0000032 3300046531 Bacteria 53670
867 Ga0495665_0023158 3300046531 Bacteria 3335
868 Ga0495640_0001724 3300046533 Bacteria 17333
869 Ga0495640_0025020 3300046533 Bacteria 4336
870 Ga0495640_0033866 3300046533 Bacteria 3629
871 Ga0495640_0196234 3300046533 Bacteria 1281
872 Ga0495586_0070505 3300046535 Bacteria 1909
873 Ga0495586_0311371 3300046535 Bacteria 903
874 Ga0495587_0010454 3300046536 Bacteria 5905
875 Ga0495587_0035328 3300046536 Bacteria 3010
876 Ga0495587_0037939 3300046536 Bacteria 2891
877 Ga0495587_0197253 3300046536 Bacteria 1139
878 Ga0495598_0006263 3300046537 Bacteria 2682
879 Ga0495609_0142147 3300046538 Bacteria 1024
880 Ga0495621_0012201 3300046539 Bacteria 2676
881 Ga0495621_0091531 3300046539 Bacteria 1147
882 Ga0495597_0046757 3300046542 Bacteria 1917
883 Ga0495597_0053866 3300046542 Bacteria 1768
884 Ga0495645_0061017 3300046543 Bacteria 2733
885 Ga0495645_0137633 3300046543 Bacteria 1707
886 Ga0495645_0263284 3300046543 Bacteria 1140
887 Ga0495622_0010235 3300046557 Bacteria 4335
888 Ga0495622_0038223 3300046557 Bacteria 2235
889 Ga0495633_0003607 3300046558 Bacteria 10240
890 Ga0495667_0000962 3300046559 Bacteria 18643
891 Ga0495667_0044797 3300046559 Bacteria 2929
892 Ga0495667_0110804 3300046559 Bacteria 1773
893 Ga0495667_0165382 3300046559 Bacteria 1422
894 Ga0495656_0001421 3300046615 Bacteria 7836
895 Ga0495656_0039306 3300046615 Bacteria 1964
896 Ga0495656_0091115 3300046615 Bacteria 1394
897 Ga0495656_0170297 3300046615 Bacteria 1064
898 Ga0495668_0000092 3300046616 Bacteria 142835
899 Ga0495668_0075201 3300046616 Bacteria 1855
900 Ga0495668_0166199 3300046616 Bacteria 1208
901 Ga0495668_0216984 3300046616 Bacteria 1047
902 Ga0495668_0298754 3300046616 Bacteria 883
903 Ga0495634_0003268 3300046642 Bacteria 13081
904 Ga0495634_0078652 3300046642 Bacteria 2160
905 Ga0495634_0085665 3300046642 Bacteria 2053
906 Ga0495634_0212154 3300046642 Bacteria 1198
907 Ga0495634_0229210 3300046642 Bacteria 1143
908 Ga0495611_0030565 3300046648 Bacteria 2369
909 Ga0495611_0133890 3300046648 Bacteria 1156
910 Ga0495625_0361214 3300046660 Bacteria 915
911 Ga0495635_0000084 3300046663 Bacteria 56456
912 Ga0495635_0003234 3300046663 Bacteria 11231
913 Ga0495635_0041900 3300046663 Bacteria 3163
914 Ga0495635_0164809 3300046663 Bacteria 1508
915 Ga0495659_0007751 3300046664 Bacteria 3406
916 Ga0495661_0019379 3300046665 Bacteria 4458
917 Ga0495661_0063366 3300046665 Bacteria 2185
918 Ga0495661_0294948 3300046665 Bacteria 813
919 Ga0495588_0034752 3300046674 Bacteria 2551
920 Ga0495588_0037169 3300046674 Bacteria 2473
921 Ga0495588_0048031 3300046674 Bacteria 2192
922 Ga0495588_0108846 3300046674 Bacteria 1459
923 Ga0495657_0005107 3300046675 Bacteria 10419
924 Ga0495657_0008437 3300046675 Bacteria 7880
925 Ga0495657_0021841 3300046675 Bacteria 4591
926 Ga0495657_0190027 3300046675 Bacteria 1256
927 Ga0495657_0224104 3300046675 Bacteria 1139
928 Ga0495599_0000457 3300046678 Bacteria 23252
929 Ga0495599_0038768 3300046678 Bacteria 2994
930 Ga0495599_0405425 3300046678 Bacteria 811
931 Ga0495623_0008556 3300046679 Bacteria 6645
932 Ga0495623_0107716 3300046679 Bacteria 1692
933 Ga0495623_0113461 3300046679 Bacteria 1639
934 Ga0495646_0042090 3300046680 Bacteria 2804
935 Ga0495646_0064091 3300046680 Bacteria 2179
936 Ga0495646_0153260 3300046680 Bacteria 1280
937 Ga0495647_0000248 3300046681 Bacteria 14792
938 Ga0495647_0010707 3300046681 Bacteria 3128
939 Ga0495647_0017500 3300046681 Bacteria 2537
940 Ga0495658_0001805 3300046683 Bacteria 11001
941 Ga0495658_0007984 3300046683 Bacteria 5242
942 Ga0495658_0106447 3300046683 Bacteria 1681
943 Ga0495658_0112424 3300046683 Bacteria 1639
944 Ga0495669_0050384 3300046684 Bacteria 1867
945 Ga0495669_0278404 3300046684 Bacteria 805
946 Ga0495613_0001580 3300046689 Bacteria 17285
947 Ga0495613_0004954 3300046689 Bacteria 9999
948 Ga0495613_0071751 3300046689 Bacteria 2524
949 Ga0495613_0121915 3300046689 Bacteria 1872
950 Ga0495624_0004094 3300046690 Bacteria 10725
951 Ga0495624_0156067 3300046690 Bacteria 1395
952 Ga0495670_0000787 3300046691 Bacteria 15234
953 Ga0495670_0010416 3300046691 Bacteria 4567
954 Ga0495670_0034134 3300046691 Bacteria 2533
955 Ga0495671_0243761 3300046692 Bacteria 868
956 Ga0495649_0094750 3300046694 Bacteria 1589
957 Ga0495600_0003042 3300046809 Bacteria 9794
958 Ga0495600_0004866 3300046809 Bacteria 8067
959 Ga0495600_0051163 3300046809 Bacteria 2696
960 Ga0495581_0000076 3300047315 Bacteria 39131
961 Ga0495581_0043435 3300047315 Bacteria 2600
962 Ga0495581_0114836 3300047315 Bacteria 1566
963 Ga0495581_0139969 3300047315 Bacteria 1411
964 Ga0495581_0203298 3300047315 Bacteria 1159
965 Ga0495581_0270429 3300047315 Bacteria 994
966 Ga0495581_0340779 3300047315 Bacteria 875
967 Ga0495604_0010464 3300047317 Bacteria 7352
968 Ga0495604_0102023 3300047317 Bacteria 2106
969 Ga0495604_0124266 3300047317 Bacteria 1863
970 Ga0495604_0133812 3300047317 Bacteria 1779
971 Ga0495674_0001109 3300047319 Bacteria 25876
972 Ga0495674_0009634 3300047319 Bacteria 9175
973 Ga0495674_0063393 3300047319 Bacteria 3215
974 Ga0495674_0070677 3300047319 Bacteria 3016
975 Ga0495674_0072742 3300047319 Bacteria 2964
976 Ga0495672_0010637 3300047320 Bacteria 6537
977 Ga0495672_0028513 3300047320 Bacteria 3531
978 Ga0495672_0242945 3300047320 Bacteria 878
979 Ga0495672_0263016 3300047320 Bacteria 832
980 Ga0495676_0036452 3300047321 Bacteria 4107
981 Ga0495676_0227178 3300047321 Bacteria 1283
982 Ga0495676_0283049 3300047321 Bacteria 1122
983 Ga0495680_0007126 3300047322 Bacteria 10297
984 Ga0495680_0010925 3300047322 Bacteria 8067
985 Ga0495680_0021814 3300047322 Bacteria 5352
986 Ga0495680_0065244 3300047322 Bacteria 2789
987 Ga0495680_0270302 3300047322 Bacteria 1200
988 Ga0495683_0166942 3300047323 Bacteria 1014
989 Ga0495687_010366 3300047443 Bacteria 5115
990 Ga0495675_0001533 3300047444 Bacteria 13942
991 Ga0495677_0174134 3300047445 Bacteria 833
992 Ga0495679_096931 3300047446 Bacteria 822
993 Ga0495673_0117193 3300047469 Bacteria 1058
994 Ga0495684_0001330 3300047471 Bacteria 19879
995 Ga0495684_0001937 3300047471 Bacteria 16591
996 Ga0495684_0010509 3300047471 Bacteria 7158
997 Ga0495686_0076759 3300047472 Bacteria 2047
998 Ga0495686_0142253 3300047472 Bacteria 1415
999 Ga0495686_0169194 3300047472 Bacteria 1272
1000 Ga0495686_0275060 3300047472 Bacteria 938
1001 Ga0495593_0002160 3300047673 Bacteria 11757
1002 Ga0495593_0002185 3300047673 Bacteria 11713
1003 Ga0495593_0004247 3300047673 Bacteria 8522
1004 Ga0495593_0048015 3300047673 Bacteria 2269
1005 Ga0495602_0062123 3300048088 Bacteria 3242
1006 Ga0495602_0084727 3300048088 Bacteria 2650
1007 Ga0495614_0035738 3300048089 Bacteria 2134
1008 Ga0495614_0045811 3300048089 Bacteria 1875
1009 Ga0495614_0199292 3300048089 Bacteria 905
1010 Ga0496100_0009708 3300048903 Bacteria 5416
1011 Ga0496100_0032941 3300048903 Bacteria 3237
1012 Ga0496100_0133547 3300048903 Bacteria 1751
1013 Ga0496100_0186477 3300048903 Bacteria 1503
1014 Ga0496100_0239403 3300048903 Bacteria 1338
1015 Ga0496101_0062075 3300048904 Bacteria 2716
1016 Ga0496101_0106071 3300048904 Bacteria 2109
1017 Ga0496101_0124410 3300048904 Bacteria 1953
1018 Ga0496101_0179040 3300048904 Bacteria 1632
1019 Ga0496101_0234968 3300048904 Bacteria 1425
1020 Ga0496101_0306525 3300048904 Bacteria 1244
1021 Ga0496102_0004998 3300048905 Bacteria 11234
1022 Ga0496102_0017053 3300048905 Bacteria 6356
1023 Ga0496102_0029309 3300048905 Bacteria 4925
1024 Ga0496102_0122324 3300048905 Bacteria 2431
1025 Ga0496102_0123553 3300048905 Bacteria 2419
1026 Ga0496102_0127267 3300048905 Bacteria 2382
1027 Ga0496102_0253023 3300048905 Bacteria 1661
1028 Ga0496103_0003807 3300048906 Bacteria 9179
1029 Ga0496103_0024359 3300048906 Bacteria 3653
1030 Ga0496103_0067753 3300048906 Bacteria 2230
1031 Ga0496104_0000331 3300048907 Bacteria 42278
1032 Ga0496104_0023465 3300048907 Bacteria 5672
1033 Ga0496104_0026932 3300048907 Bacteria 5314
1034 Ga0496104_0065839 3300048907 Bacteria 3439
1035 Ga0496104_0092178 3300048907 Bacteria 2897
1036 Ga0496104_0118811 3300048907 Bacteria 2538
1037 Ga0496104_0131351 3300048907 Bacteria 2405
1038 Ga0496104_0696809 3300048907 Bacteria 923
1039 Ga0496105_0013669 3300048908 Bacteria 6445
1040 Ga0496105_0027756 3300048908 Bacteria 4626
1041 Ga0496105_0047246 3300048908 Bacteria 3552
1042 Ga0496105_0104294 3300048908 Bacteria 2341
1043 Ga0496105_0129992 3300048908 Bacteria 2076
1044 Ga0496105_0193884 3300048908 Bacteria 1660
1045 Ga0496105_0617885 3300048908 Bacteria 839
1046 Ga0496106_0001453 3300048909 Bacteria 17793
1047 Ga0496106_0007579 3300048909 Bacteria 8029
1048 Ga0496106_0155397 3300048909 Bacteria 1806
1049 Ga0496106_0548593 3300048909 Bacteria 927
1050 Ga0496107_0012401 3300048910 Bacteria 5948
1051 Ga0496107_0057233 3300048910 Bacteria 2818
1052 Ga0496107_0074980 3300048910 Bacteria 2462
1053 Ga0496107_0080430 3300048910 Bacteria 2376
1054 Ga0496107_0131581 3300048910 Bacteria 1847
1055 Ga0496107_0139865 3300048910 Bacteria 1789
1056 Ga0496107_0140109 3300048910 Bacteria 1787
1057 Ga0496108_0001656 3300048911 Bacteria 17657
1058 Ga0496108_0007772 3300048911 Bacteria 8685
1059 Ga0496108_0015489 3300048911 Bacteria 6218
1060 Ga0496108_0081128 3300048911 Bacteria 2748
1061 Ga0496108_0132976 3300048911 Bacteria 2138
1062 Ga0496108_0279817 3300048911 Bacteria 1452
1063 Ga0496108_0369861 3300048911 Bacteria 1251
1064 Ga0496108_0389286 3300048911 Bacteria 1217
1065 Ga0496108_0435246 3300048911 Bacteria 1145
1066 Ga0496109_0002542 3300048912 Bacteria 15293
1067 Ga0496109_0005517 3300048912 Bacteria 10593
1068 Ga0496109_0037791 3300048912 Bacteria 4363
1069 Ga0496109_0253461 3300048912 Bacteria 1657
1070 Ga0496109_0296331 3300048912 Bacteria 1525
1071 Ga0496109_0430639 3300048912 Bacteria 1246
1072 Ga0496109_0548544 3300048912 Bacteria 1090
1073 Ga0496109_1016602 3300048912 Bacteria 766
1074 Ga0496110_0006911 3300048913 Bacteria 9025
1075 Ga0496110_0011557 3300048913 Bacteria 7235
1076 Ga0496110_0024579 3300048913 Bacteria 5136
1077 Ga0496110_0050759 3300048913 Bacteria 3643
1078 Ga0496110_0054426 3300048913 Bacteria 3520
1079 Ga0496110_0108630 3300048913 Bacteria 2491
1080 Ga0496110_0234218 3300048913 Bacteria 1670
1081 Ga0496110_0350302 3300048913 Bacteria 1345
1082 Ga0496110_0401456 3300048913 Bacteria 1249
1083 Ga0496110_0700215 3300048913 Bacteria 914
1084 Ga0496111_0001681 3300048914 Bacteria 12889
1085 Ga0496111_0004178 3300048914 Bacteria 9086
1086 Ga0496111_0020054 3300048914 Bacteria 4650
1087 Ga0496111_0040057 3300048914 Bacteria 3361
1088 Ga0496111_0049479 3300048914 Bacteria 3031
1089 Ga0496111_0094980 3300048914 Bacteria 2187
1090 Ga0496111_0265385 3300048914 Bacteria 1274
1091 Ga0496111_0271124 3300048914 Bacteria 1259
1092 Ga0496112_0000414 3300048915 Bacteria 28126
1093 Ga0496112_0010890 3300048915 Bacteria 8277
1094 Ga0496112_0024803 3300048915 Bacteria 5751
1095 Ga0496112_0041801 3300048915 Bacteria 4485
1096 Ga0496112_0043885 3300048915 Bacteria 4378
1097 Ga0496112_0189675 3300048915 Bacteria 2018
1098 Ga0496112_0208418 3300048915 Bacteria 1912
1099 Ga0496112_0216117 3300048915 Bacteria 1873
1100 Ga0496112_0251390 3300048915 Bacteria 1718
1101 Ga0496113_0001520 3300048916 Bacteria 12991
1102 Ga0496113_0004601 3300048916 Bacteria 8508
1103 Ga0496113_0008072 3300048916 Bacteria 6833
1104 Ga0496113_0008091 3300048916 Bacteria 6827
1105 Ga0496113_0114467 3300048916 Bacteria 2103
1106 Ga0496113_0215699 3300048916 Bacteria 1528
1107 Ga0496113_0555583 3300048916 Bacteria 921
1108 Ga0496114_0005585 3300048917 Bacteria 9860
1109 Ga0496114_0015990 3300048917 Bacteria 6038
1110 Ga0496114_0065889 3300048917 Bacteria 3035
1111 Ga0496114_0069511 3300048917 Bacteria 2957
1112 Ga0496114_0114066 3300048917 Bacteria 2317
1113 Ga0496114_0121398 3300048917 Bacteria 2247
1114 Ga0496114_0136752 3300048917 Bacteria 2119
1115 Ga0496114_0279601 3300048917 Bacteria 1471
1116 Ga0496114_0451916 3300048917 Bacteria 1138
1117 Ga0496115_0011102 3300048918 Bacteria 6750
1118 Ga0496115_0019563 3300048918 Bacteria 5212
1119 Ga0496115_0040397 3300048918 Bacteria 3709
1120 Ga0496115_0041198 3300048918 Bacteria 3674
1121 Ga0496115_0075176 3300048918 Bacteria 2744
1122 Ga0496115_0089958 3300048918 Bacteria 2507
1123 Ga0496115_0467285 3300048918 Bacteria 1017
1124 Ga0496115_0541517 3300048918 Bacteria 931
1125 Ga0496116_0002810 3300048919 Bacteria 17881
1126 Ga0496116_0181951 3300048919 Bacteria 1124
1127 Ga0496116_0254201 3300048919 Bacteria 872
1128 Ga0496117_0064775 3300048920 Bacteria 2489
1129 Ga0496117_0066143 3300048920 Bacteria 2453
1130 Ga0496117_0085429 3300048920 Bacteria 2054
1131 Ga0496118_0017101 3300048921 Bacteria 6620
1132 Ga0496118_0075568 3300048921 Bacteria 2402
1133 Ga0496118_0201703 3300048921 Bacteria 1177
1134 Ga0496118_0214644 3300048921 Bacteria 1126
1135 Ga0496119_0091345 3300048922 Bacteria 1729
1136 Ga0496119_0094144 3300048922 Bacteria 1695
1137 Ga0496119_0128632 3300048922 Bacteria 1383
1138 Ga0496119_0149169 3300048922 Bacteria 1255
1139 Ga0496119_0195140 3300048922 Bacteria 1052
1140 Ga0496121_0005592 3300048924 Bacteria 16051
1141 Ga0496121_0005961 3300048924 Bacteria 15401
1142 Ga0496121_0025691 3300048924 Bacteria 5580
1143 Ga0496121_0031537 3300048924 Bacteria 4838
1144 Ga0496121_0075028 3300048924 Bacteria 2703
1145 Ga0496121_0086316 3300048924 Bacteria 2466
1146 Ga0496121_0102204 3300048924 Bacteria 2209
1147 Ga0496121_0104069 3300048924 Bacteria 2182
1148 Ga0496121_0114227 3300048924 Bacteria 2053
1149 Ga0496121_0122569 3300048924 Bacteria 1960
1150 Ga0496121_0151531 3300048924 Bacteria 1706
1151 Ga0496121_0258853 3300048924 Bacteria 1202
1152 Ga0496121_0260947 3300048924 Bacteria 1196
1153 Ga0496122_0001850 3300048925 Bacteria 32258
1154 Ga0496122_0024253 3300048925 Bacteria 5312
1155 Ga0496122_0214035 3300048925 Bacteria 1113
1156 Ga0496123_0000498 3300048926 Bacteria 68151
1157 Ga0496123_0153571 3300048926 Bacteria 1238
1158 Ga0496124_0039002 3300048927 Bacteria 4120
1159 Ga0496124_0170336 3300048927 Bacteria 1687
1160 Ga0496124_0176486 3300048927 Bacteria 1649
1161 Ga0496125_0000850 3300048928 Bacteria 49000
1162 Ga0496125_0006132 3300048928 Bacteria 13116
1163 Ga0496125_0006453 3300048928 Bacteria 12678
1164 Ga0496125_0038920 3300048928 Bacteria 4106
1165 Ga0496125_0059762 3300048928 Bacteria 3068
1166 Ga0496125_0379689 3300048928 Bacteria 833
1167 Ga0496126_0003112 3300048929 Bacteria 21403
1168 Ga0496126_0004886 3300048929 Bacteria 15669
1169 Ga0496126_0008303 3300048929 Bacteria 11214
1170 Ga0496126_0018879 3300048929 Bacteria 6813
1171 Ga0496126_0066646 3300048929 Bacteria 3219
1172 Ga0496126_0120048 3300048929 Bacteria 2281
1173 Ga0496126_0138295 3300048929 Bacteria 2098
1174 Ga0496126_0149822 3300048929 Bacteria 2000
1175 Ga0496126_0159831 3300048929 Bacteria 1926
1176 Ga0496126_0170358 3300048929 Bacteria 1855
1177 Ga0496126_0207351 3300048929 Bacteria 1652
1178 Ga0496126_0233659 3300048929 Bacteria 1539
1179 Ga0496126_0251436 3300048929 Bacteria 1473
1180 Ga0496126_0562002 3300048929 Bacteria 904
1181 Ga0496126_0563447 3300048929 Bacteria 902
1182 Ga0496126_0600538 3300048929 Bacteria 867
1183 Ga0495682_0051559 3300049460 Bacteria 1497
1184 Ga0495682_0089363 3300049460 Bacteria 1107
1185 Ga0501031_0000253 3300049568 Bacteria 29955
1186 Ga0501031_0019009 3300049568 Bacteria 4473
1187 Ga0501031_0174039 3300049568 Bacteria 1406
1188 Ga0501032_0000273 3300049569 Bacteria 43466
1189 Ga0501032_0022067 3300049569 Bacteria 4419
1190 Ga0501032_0038462 3300049569 Bacteria 3258
1191 Ga0501032_0046242 3300049569 Bacteria 2942
1192 Ga0501032_0051051 3300049569 Bacteria 2788
1193 Ga0501032_0136588 3300049569 Bacteria 1616
1194 Ga0501033_0000098 3300049570 Bacteria 82803
1195 Ga0501033_0000332 3300049570 Bacteria 44949
1196 Ga0501033_0055981 3300049570 Bacteria 2916
1197 Ga0501033_0064916 3300049570 Bacteria 2685
1198 Ga0501033_0453318 3300049570 Bacteria 891
1199 Ga0501034_0000088 3300049571 Bacteria 166615
1200 Ga0501034_0000175 3300049571 Bacteria 119465
1201 Ga0501034_0019896 3300049571 Bacteria 6858
1202 Ga0501034_0048469 3300049571 Bacteria 4287
1203 Ga0501034_0078646 3300049571 Bacteria 3302
1204 Ga0501034_0104633 3300049571 Bacteria 2824
1205 Ga0501034_0269977 3300049571 Bacteria 1642
1206 Ga0501034_0519603 3300049571 Bacteria 1102
1207 Ga0501036_0000049 3300049572 Bacteria 75400
1208 Ga0501036_0043499 3300049572 Bacteria 3804
1209 Ga0501036_0076908 3300049572 Bacteria 2824
1210 Ga0501036_0236704 3300049572 Bacteria 1531
1211 Ga0501036_0281622 3300049572 Bacteria 1391
1212 Ga0501037_0000069 3300049573 Bacteria 95277
1213 Ga0501037_0003734 3300049573 Bacteria 11058
1214 Ga0501037_0144821 3300049573 Bacteria 1700
1215 Ga0501037_0199808 3300049573 Bacteria 1413
1216 Ga0501038_0000034 3300049574 Bacteria 128854
1217 Ga0501038_0008654 3300049574 Bacteria 9346
1218 Ga0501038_0053758 3300049574 Bacteria 3465
1219 Ga0501038_0072407 3300049574 Bacteria 2920
1220 Ga0501038_0111941 3300049574 Bacteria 2260
1221 Ga0501038_0144616 3300049574 Bacteria 1942
1222 Ga0501038_0339867 3300049574 Bacteria 1171
1223 Ga0501039_0000090 3300049575 Bacteria 63919
1224 Ga0501039_0005577 3300049575 Bacteria 9525
1225 Ga0501039_0108617 3300049575 Bacteria 2168
1226 Ga0501039_0694764 3300049575 Bacteria 796
1227 Ga0501040_0299360 3300049576 Bacteria 1150
1228 Ga0501040_0527577 3300049576 Bacteria 852
1229 Ga0501041_0280595 3300049577 Bacteria 1048
1230 Ga0501042_0021749 3300049578 Bacteria 4472
1231 Ga0501042_0111228 3300049578 Bacteria 1972
1232 Ga0501043_0000130 3300049579 Bacteria 69795
1233 Ga0501043_0010948 3300049579 Bacteria 7105
1234 Ga0501043_0136910 3300049579 Bacteria 1918
1235 Ga0501046_0000213 3300049580 Bacteria 60602
1236 Ga0501046_0007792 3300049580 Bacteria 9395
1237 Ga0501046_0020817 3300049580 Bacteria 5417
1238 Ga0501046_0032084 3300049580 Bacteria 4255
1239 Ga0501046_0181540 3300049580 Bacteria 1573
1240 Ga0501047_0000255 3300049581 Bacteria 62993
1241 Ga0501047_0016128 3300049581 Bacteria 7126
1242 Ga0501047_0039630 3300049581 Bacteria 4556
1243 Ga0501047_0074475 3300049581 Bacteria 3269
1244 Ga0501047_0087080 3300049581 Bacteria 3001
1245 Ga0501047_0087376 3300049581 Bacteria 2995
1246 Ga0501047_0109419 3300049581 Bacteria 2646
1247 Ga0501047_0329085 3300049581 Bacteria 1366
1248 Ga0501047_0546852 3300049581 Bacteria 982
1249 Ga0501048_0000252 3300049582 Bacteria 35941
1250 Ga0501048_0138363 3300049582 Bacteria 1721
1251 Ga0501067_0001929 3300049583 Bacteria 11405
1252 Ga0501067_0021939 3300049583 Bacteria 3533
1253 Ga0501067_0051104 3300049583 Bacteria 2292
1254 Ga0501067_0060356 3300049583 Bacteria 2099
1255 Ga0501067_0189962 3300049583 Bacteria 1144
1256 Ga0501068_0000197 3300049584 Bacteria 28590
1257 Ga0501068_0014839 3300049584 Bacteria 4461
1258 Ga0501069_0000614 3300049585 Bacteria 16508
1259 Ga0501069_0074684 3300049585 Bacteria 1903
1260 Ga0501069_0093592 3300049585 Bacteria 1700
1261 Ga0501069_0115171 3300049585 Bacteria 1533
1262 Ga0501070_0017034 3300049586 Bacteria 6098
1263 Ga0501070_0068644 3300049586 Bacteria 2934
1264 Ga0501070_0171049 3300049586 Bacteria 1789
1265 Ga0501070_0384853 3300049586 Bacteria 1136
1266 Ga0501071_0008255 3300049587 Bacteria 6874
1267 Ga0501071_0582273 3300049587 Bacteria 860
1268 Ga0501072_0000146 3300049588 Bacteria 52958
1269 Ga0501072_0245583 3300049588 Bacteria 1426
1270 Ga0501073_0000035 3300049589 Bacteria 94077
1271 Ga0501073_0023327 3300049589 Bacteria 4443
1272 Ga0501073_0099446 3300049589 Bacteria 2020
1273 Ga0501073_0117597 3300049589 Bacteria 1842
1274 Ga0501074_0000512 3300049590 Bacteria 23801
1275 Ga0501074_0059524 3300049590 Bacteria 2752
1276 Ga0501075_0337399 3300049591 Bacteria 1149
1277 Ga0501077_0084003 3300049593 Bacteria 2018
1278 Ga0501079_0010497 3300049741 Bacteria 7040
1279 Ga0501079_0087257 3300049741 Bacteria 2415
1280 Ga0501079_0111763 3300049741 Bacteria 2123
1281 Ga0501079_0364691 3300049741 Bacteria 1132
1282 Ga0501080_0000379 3300049742 Bacteria 34215
1283 Ga0501080_0049862 3300049742 Bacteria 3897
1284 Ga0501080_0060413 3300049742 Bacteria 3528
1285 Ga0501080_0363492 3300049742 Bacteria 1305
1286 Ga0501080_0372895 3300049742 Bacteria 1287
1287 Ga0501080_0548637 3300049742 Bacteria 1030
1288 Ga0501081_0106847 3300049743 Bacteria 1984
1289 Ga0501081_0366079 3300049743 Bacteria 1064
1290 Ga0501083_0000740 3300049744 Bacteria 21322
1291 Ga0501083_0007489 3300049744 Bacteria 7733
1292 Ga0501083_0151374 3300049744 Bacteria 1519
1293 Ga0501035_0000894 3300049822 Bacteria 31549
1294 Ga0501035_0001058 3300049822 Bacteria 28847
1295 Ga0501035_0043468 3300049822 Bacteria 4048
1296 Ga0501035_0181629 3300049822 Bacteria 1812
1297 Ga0501035_0240818 3300049822 Bacteria 1539
1298 Ga0501035_0268517 3300049822 Bacteria 1444
1299 Ga0501035_0277558 3300049822 Bacteria 1417
1300 Ga0501044_0000461 3300049823 Bacteria 49470
1301 Ga0501044_0021033 3300049823 Bacteria 6965
1302 Ga0501044_0043353 3300049823 Bacteria 4674
1303 Ga0501044_0077714 3300049823 Bacteria 3365
1304 Ga0501044_0077856 3300049823 Bacteria 3362
1305 Ga0501044_0118193 3300049823 Bacteria 2654
1306 Ga0501044_0170847 3300049823 Bacteria 2146
1307 Ga0501044_0189973 3300049823 Bacteria 2017
1308 Ga0501044_0210104 3300049823 Bacteria 1901
1309 Ga0501044_0247374 3300049823 Bacteria 1725
1310 Ga0501045_0109171 3300049824 Bacteria 2051
1311 nmdc:mga03683_17567_c1 3300050489 Bacteria 2709
1312 nmdc:mga03683_28652_c1 3300050489 Bacteria 2216
1313 nmdc:mga03683_2952_c1 3300050489 Bacteria 5375
1314 nmdc:mga03n38_15507_c1 3300050490 Bacteria 2944
1315 nmdc:mga03n38_166170_c1 3300050490 Bacteria 1120
1316 nmdc:mga03n38_20367_c1 3300050490 Bacteria 2653
1317 nmdc:mga03n38_210100_c1 3300050490 Bacteria 1011
1318 nmdc:mga03n38_613_c1 3300050490 Bacteria 9130
1319 nmdc:mga03n38_88814_c1 3300050490 Bacteria 1467
1320 nmdc:mga00v17_126620_c1 3300050491 Bacteria 1630
1321 nmdc:mga00v17_21043_c1 3300050491 Bacteria 3746
1322 nmdc:mga0yw44_124882_c1 3300050492 Bacteria 1661
1323 nmdc:mga0yw44_140144_c1 3300050492 Bacteria 1571
1324 nmdc:mga0yw44_15168_c1 3300050492 Bacteria 4119
1325 nmdc:mga0yw44_20149_c1 3300050492 Bacteria 3695
1326 nmdc:mga0yw44_202568_c1 3300050492 Bacteria 1311
1327 nmdc:mga0yw44_215952_c1 3300050492 Bacteria 1270
1328 nmdc:mga0yw44_28351_c1 3300050492 Bacteria 3220
1329 nmdc:mga0yw44_29821_c1 3300050492 Bacteria 3154
1330 nmdc:mga0yw44_32622_c1 3300050492 Bacteria 3036
1331 nmdc:mga0yw44_49130_c1 3300050492 Bacteria 2545
1332 nmdc:mga0k408_5224_c1 3300050493 Bacteria 6891
1333 nmdc:mga0k408_59721_c1 3300050493 Bacteria 2216
1334 nmdc:mga0k408_80127_c1 3300050493 Bacteria 1911
1335 nmdc:mga0k408_9852_c1 3300050493 Bacteria 5158
1336 nmdc:mga06z11_158494_c1 3300050494 Bacteria 1292
1337 nmdc:mga06z11_195578_c1 3300050494 Bacteria 1172
1338 nmdc:mga06z11_289298_c1 3300050494 Bacteria 972
1339 nmdc:mga04h51_33437_c1 3300050495 Bacteria 1637
1340 nmdc:mga04h51_5335_c1 3300050495 Bacteria 3271
1341 nmdc:mga04h51_68922_c1 3300050495 Bacteria 1230
1342 nmdc:mga07m45_102179_c1 3300050496 Bacteria 1646
1343 nmdc:mga07m45_137511_c1 3300050496 Bacteria 1414
1344 nmdc:mga07m45_1929_c1 3300050496 Bacteria 9590
1345 nmdc:mga07m45_3911_c1 3300050496 Bacteria 7237
1346 nmdc:mga05p37_4837_c1 3300050507 Bacteria 15753
1347 nmdc:mga05p37_699874_c1 3300050507 Bacteria 1126
1348 nmdc:mga0qj67_214647_c1 3300050509 Bacteria 1562
1349 nmdc:mga06r32_231017_c1 3300050510 Bacteria 1838
1350 nmdc:mga08y16_157905_c1 3300050511 Bacteria 2357
1351 nmdc:mga08y16_300163_c1 3300050511 Bacteria 1655
1352 nmdc:mga08y16_417681_c1 3300050511 Bacteria 1371
1353 nmdc:mga08y16_440743_c1 3300050511 Bacteria 1329
1354 nmdc:mga08y16_511091_c1 3300050511 Bacteria 1219
1355 nmdc:mga0n895_537959_c1 3300050512 Unclassified 1175
1356 nmdc:mga0n895_556268_c1 3300050512 Bacteria 1153
1357 nmdc:mga0n895_72053_c1 3300050512 Bacteria 3427
1358 nmdc:mga0rr50_123263_c1 3300050513 Bacteria 2066
1359 nmdc:mga08x19_258482_c1 3300050514 Unclassified 1203
1360 nmdc:mga08x19_32130_c1 3300050514 Bacteria 3306
1361 nmdc:mga0a205_180274_c1 3300050515 Bacteria 2007
1362 nmdc:mga0a205_311906_c1 3300050515 Bacteria 1445
1363 nmdc:mga0a205_329637_c1 3300050515 Bacteria 1396
1364 nmdc:mga0sz30_45978_c1 3300050516 Bacteria 1842
1365 nmdc:mga0sz30_86912_c1 3300050516 Bacteria 1358
1366 nmdc:mga0sz30_94549_c1 3300050516 Bacteria 1303
1367 Ga0495601_0056249 3300053077 Bacteria 2491
1368 Ga0495601_0099669 3300053077 Bacteria 1876
1369 Ga0495601_0121479 3300053077 Bacteria 1696
1370 Ga0495601_0167874 3300053077 Bacteria 1434
1371 Ga0495601_0207292 3300053077 Bacteria 1281
1372 Ga0495601_0268820 3300053077 Bacteria 1112
1373 Ga0495612_0005170 3300053078 Bacteria 5392
1374 Ga0495612_0005994 3300053078 Bacteria 5004
1375 Ga0495612_0022238 3300053078 Bacteria 2543
1376 Ga0495612_0137893 3300053078 Bacteria 1057
1377 Ga0500635_0014749 3300053080 Bacteria 2296
1378 Ga0495595_0000267 3300053084 Bacteria 20599
1379 Ga0495595_0001389 3300053084 Bacteria 9386
1380 Ga0495595_0048915 3300053084 Bacteria 1954
1381 Ga0495619_0000434 3300053085 Bacteria 28423
1382 Ga0495619_0000491 3300053085 Bacteria 26518
1383 Ga0495619_0037925 3300053085 Bacteria 3143
1384 Ga0495619_0055342 3300053085 Bacteria 2627
1385 Ga0495619_0418464 3300053085 Bacteria 924
1386 Ga0500643_000156 3300053087 Bacteria 68861
1387 Ga0500643_011270 3300053087 Bacteria 3270
1388 Ga0500643_032107 3300053087 Bacteria 1596
1389 Ga0500581_083803 3300053089 Bacteria 1588
1390 Ga0500646_0008643 3300053090 Bacteria 2607
1391 Ga0500647_0067702 3300053091 Bacteria 1717
1392 Ga0500651_0061060 3300053093 Bacteria 2355
1393 Ga0500651_0087129 3300053093 Bacteria 1927
1394 Ga0500651_0152455 3300053093 Bacteria 1387
1395 Ga0500651_0189508 3300053093 Bacteria 1218
1396 Ga0500566_0000091 3300053094 Bacteria 45305
1397 Ga0500566_0000990 3300053094 Bacteria 16360
1398 Ga0500566_0031382 3300053094 Bacteria 3098
1399 Ga0500566_0095435 3300053094 Bacteria 1638
1400 Ga0500566_0183280 3300053094 Bacteria 1072
1401 Ga0500640_139350 3300053095 Bacteria 944
1402 Ga0500641_0014068 3300053096 Bacteria 2948
1403 Ga0500641_0034873 3300053096 Bacteria 2005
1404 Ga0500641_0068022 3300053096 Bacteria 1494
1405 Ga0500641_0151612 3300053096 Bacteria 1000
1406 Ga0500650_0001832 3300053098 Bacteria 6668
1407 Ga0500650_0172716 3300053098 Bacteria 993
1408 Ga0500554_002104 3300053102 Bacteria 3861
1409 Ga0500555_000933 3300053103 Bacteria 10224
1410 Ga0500556_0000002 3300053104 Bacteria 773626
1411 Ga0500556_0000048 3300053104 Bacteria 123558
1412 Ga0500556_0004481 3300053104 Bacteria 3972
1413 Ga0500556_0122004 3300053104 Bacteria 1017
1414 Ga0500557_000024 3300053105 Bacteria 84960
1415 Ga0500562_012516 3300053108 Bacteria 2158
1416 Ga0500562_063985 3300053108 Bacteria 989
1417 Ga0500562_071229 3300053108 Bacteria 938
1418 Ga0500572_000309 3300053111 Bacteria 17365
1419 Ga0500572_021886 3300053111 Bacteria 1698
1420 Ga0500594_0023064 3300053118 Bacteria 1574
1421 Ga0500594_0025817 3300053118 Bacteria 1509
1422 Ga0500595_000698 3300053119 Bacteria 20065
1423 Ga0500595_002243 3300053119 Bacteria 9798
1424 Ga0500595_003813 3300053119 Bacteria 6931
1425 Ga0500595_006478 3300053119 Bacteria 4961
1426 Ga0500595_078728 3300053119 Bacteria 967
1427 Ga0500607_030662 3300053121 Bacteria 2964
1428 Ga0500607_118822 3300053121 Bacteria 1282
1429 Ga0500608_000584 3300053122 Bacteria 13396
1430 Ga0500614_012060 3300053123 Bacteria 1879
1431 Ga0500642_0000093 3300053130 Bacteria 44347
1432 Ga0500642_0000107 3300053130 Bacteria 40189
1433 Ga0500642_0071711 3300053130 Bacteria 1577
1434 Ga0500652_000219 3300053131 Bacteria 21936
1435 Ga0500655_003619 3300053133 Bacteria 2784
1436 Ga0500655_008426 3300053133 Bacteria 1856
1437 Ga0500658_0038875 3300053134 Bacteria 1898
1438 Ga0500658_0152483 3300053134 Bacteria 1042
1439 Ga0500559_0000341 3300053136 Bacteria 34924
1440 Ga0500559_0001261 3300053136 Bacteria 14832
1441 Ga0500559_0058481 3300053136 Bacteria 1714
1442 Ga0500568_0000835 3300053139 Bacteria 21662
1443 Ga0500568_0001045 3300053139 Bacteria 18906
1444 Ga0500568_0005007 3300053139 Bacteria 6946
1445 Ga0500568_0020371 3300053139 Bacteria 2869
1446 Ga0500568_0047844 3300053139 Bacteria 1693
1447 Ga0500568_0068906 3300053139 Bacteria 1357
1448 Ga0500577_0000212 3300053142 Bacteria 15416
1449 Ga0500586_096995 3300053145 Bacteria 1033
1450 Ga0500589_059000 3300053147 Bacteria 1762
1451 Ga0500590_171896 3300053148 Bacteria 951
1452 Ga0500603_031274 3300053150 Bacteria 1374
1453 Ga0500604_0007304 3300053151 Bacteria 2926
1454 Ga0500616_0000045 3300053153 Bacteria 339292
1455 Ga0500616_0000069 3300053153 Bacteria 234334
1456 Ga0500616_0051836 3300053153 Bacteria 2160
1457 Ga0500616_0101308 3300053153 Bacteria 1407
1458 Ga0500622_0001388 3300053156 Bacteria 19505
1459 Ga0500622_0015344 3300053156 Bacteria 4102
1460 Ga0500624_014333 3300053157 Bacteria 1198
1461 Ga0500627_0007562 3300053158 Bacteria 3796
1462 Ga0500627_0055077 3300053158 Bacteria 1740
1463 Ga0500627_0090051 3300053158 Bacteria 1373
1464 Ga0500627_0126335 3300053158 Bacteria 1154
1465 Ga0500634_0013070 3300053161 Bacteria 4344
1466 Ga0500634_0047748 3300053161 Bacteria 2311
1467 Ga0500634_0102260 3300053161 Bacteria 1431
1468 Ga0500634_0108303 3300053161 Bacteria 1376
1469 Ga0500638_000254 3300053162 Bacteria 11662
1470 Ga0500638_197403 3300053162 Bacteria 854
1471 Ga0500636_0003270 3300053177 Bacteria 9084
1472 Ga0500636_0009247 3300053177 Bacteria 5728
1473 Ga0500636_0069854 3300053177 Bacteria 2038
1474 Ga0500636_0111330 3300053177 Bacteria 1546
1475 Ga0500636_0128535 3300053177 Bacteria 1414
1476 Ga0500636_0241309 3300053177 Bacteria 928
1477 Ga0500637_0000216 3300053178 Bacteria 21533
1478 Ga0500637_0006416 3300053178 Bacteria 5791
1479 Ga0500637_0175014 3300053178 Bacteria 1232
1480 Ga0500576_054740 3300053725 Bacteria 1760
1481 Ga0500611_005568 3300053727 Bacteria 1782
1482 Ga0500611_021866 3300053727 Bacteria 1226
1483 Ga0500645_046945 3300053730 Bacteria 1266
1484 Ga0500645_077583 3300053730 Bacteria 949
1485 Ga0500599_000719 3300053736 Bacteria 3586
1486 Ga0500601_000724 3300053737 Bacteria 4349
1487 Ga0501084_0001610 3300054114 Bacteria 17890
1488 Ga0501084_0062496 3300054114 Bacteria 3117
1489 Ga0501084_0151219 3300054114 Bacteria 1957
1490 Ga0500661_019441 3300055283 Bacteria 1209
1491 Ga0501082_0000084 3300060353 Bacteria 70644
1492 Ga0501082_0015760 3300060353 Bacteria 6502
1493 Ga0501082_0068493 3300060353 Bacteria 3055
1494 Ga0501082_0260001 3300060353 Bacteria 1510
1495 Ga0501082_0277094 3300060353 Bacteria 1460
1496 Ga0530510_0063518 3300061734 Bacteria 2673
1497 2507509238 2507262055 Bacteria 8048963
1498 2508543307 2508501009 Bacteria 7784016
1499 2508690944 2508501042 Bacteria 8719808
1500 2509147412 2508501128 Bacteria 8613869
1501 2511397211 2511231028 Bacteria 8046582
1502 2513646771 2513237095 Bacteria 8976980
1503 2513656784 2513237096 Bacteria 8722461
1504 2513677825 2513237098 Bacteria 9902361
1505 2513691937 2513237101 Bacteria 7952346
1506 2513717246 2513237104 Bacteria 10034502
1507 2513857973 2513237137 Bacteria 9558895
1508 2513876592 2513237139 Bacteria 8737671
1509 2513892807 2513237141 Bacteria 8496279
1510 2513917969 2513237145 Bacteria 8979722
1511 2515626656 2515154112 Bacteria 8294334
1512 2517101891 2517093001 Bacteria 9002274
1513 2517892985 2517572143 Bacteria 9484767
1514 2524465192 2524023210 Bacteria 9029266
1515 2528852246 2528768022 Bacteria 10457665
1516 2599720702 2599185236 Bacteria 6875203
1517 2603858934 2602042107 Bacteria 6226103
1518 2643756320 2643221547 Bacteria 4740017
1519 2644132141 2643221623 Bacteria 5239945
1520 2671117610 2667528175 Bacteria 7532676
1521 2723845668 2721755755 Bacteria 8322773
1522 2728750442 2728368998 Bacteria 8720350
1523 2793073026 2791355197 Bacteria 8420563
1524 2793081777
1525 2805919847 2802429603 Bacteria 8777136
1526 2818242850 2816332527 Bacteria 8933356
1527 2824606036 2824600985 Bacteria 8488197
1528 2824615975 2824609381 Bacteria 8672835
1529 2824658878 2824653114 Bacteria 8493680
1530 2824667765 2824661429 Bacteria 9877870
1531 2824676155 2824671348 Bacteria 8369588
1532 2824691828 2824687955 Bacteria 8360029
1533 2824699443 2824696289 Bacteria 8335049
1534 2824710419 2824704595 Bacteria 9667483
1535 2824761129 2824753945 Bacteria 9787441
1536 2824771181 2824763712 Bacteria 9792355
1537 2824779335 2824773399 Bacteria 8360218
1538 2837653779 2837651117 Bacteria 3772164
1539 2841958093 2841957949 Bacteria 8652217
1540 2844318476 2844315083 Bacteria 8138177
1541 2847935366 2847930680 Bacteria 9342022
1542 2847945974 2847939898 Bacteria 8606328
1543 2857513691 2857509624 Bacteria 7472071
1544 2857527959 2857524615 Bacteria 6615449
1545 2874597363 2874590934 Bacteria 8299676
1546 2874609710 2874604998 Bacteria 7834745
1547 2874626732 2874620515 Bacteria 8290088
1548 2874649304 2874645413 Bacteria 8214782
1549 2876777840 2876771140 Bacteria 8287509
1550 2876811821 2876808645 Bacteria 8824342
1551 2876823139 2876818435 Bacteria 8274608
1552 2879078597 2879074833 Bacteria 8279565
1553 2879088559 2879083081 Bacteria 8587928
1554 2879108058 2879099564 Bacteria 10442239
1555 2879118417 2879110137 Bacteria 8907982
1556 2879132926 2879127579 Bacteria 8294491
1557 2879148725 2879142872 Bacteria 8267021
1558 2883294375 2883291878 Bacteria 5894118
1559 2885371909 2885366525 Bacteria 8326213
1560 2885377401 2885374607 Bacteria 8927485
1561 2885387649 2885383462 Bacteria 9473874
1562 2888383436 2888378607 Bacteria 9652610
1563 2888394501 2888388044 Bacteria 7304136
1564 2888423823 2888419890 Bacteria 7857137
1565 2889040474 2889033259 Bacteria 9099371
1566 2893068376 2893066018 Bacteria 6158120
1567 2903730159 2903727486 Bacteria 8281579
1568 2903751990 2903748898 Bacteria 9972761
1569 2903778328 2903768456 Bacteria 9749579
1570 2904668310 2904666416 Bacteria 8226587
1571 2904696335 2904690495 Bacteria 9412302
1572 2904703152
1573 2904717271 2904711408 Bacteria 9771557
1574 2906603544 2906602504 Bacteria 8295279
1575 2906618021
1576 2906632451 2906626472 Bacteria 8826946
1577 2906636048 2906635258 Bacteria 8601019
1578 2906646302 2906643746 Bacteria 8722424
1579 2906661508 2906660503 Bacteria 8595048
1580 2908760882 2908756301 Bacteria 8864324
1581 2909043908 2909042592 Bacteria 6499737
1582 2919075360 2919073203 Bacteria 6531949
1583 2922368355 2922361189 Bacteria 7436256
1584 2922373619
1585 2922388196 2922386360 Bacteria 7017218
1586 2922429518
1587 2928535341 2928531327 Bacteria 5101314
1588 2929617354 2929615660 Bacteria 9193770
1589 2929627059 2929624759 Bacteria 9339455
1590 2932787610 2932784394 Bacteria 9704911
1591 2932813209 2932809354 Bacteria 9135765
1592 2932820876 2932818245 Bacteria 9955613
1593 2932834757 2932828146 Bacteria 9745859
1594 2933579311 2933577622 Bacteria 9116884
1595 2935611874 2935608549 Bacteria 8203142
1596 2935621716 2935616580 Bacteria 9032984
1597 2935642666 2935638405 Bacteria 10015038
1598 2935667768 2935665750 Bacteria 9571747
1599 2935682258 2935675223 Bacteria 9928132
1600 2935688513 2935684952 Bacteria 9590419
1601 2935695863 2935694250 Bacteria 9291695
1602 2935706608 2935703347 Bacteria 10242284
1603 2935715532 2935713505 Bacteria 9608509
1604 2935725904 2935722832 Bacteria 9608746
1605 2935734351 2935732158 Bacteria 9706831
1606 2935743730 2935741537 Bacteria 9707219
1607 2935754233 2935750917 Bacteria 9590372
1608 2935768407 2935760218 Bacteria 9817913
1609 2935772647 2935769743 Bacteria 7878163
1610 2935783197 2935777560 Bacteria 8077691
1611 2935790940 2935785616 Bacteria 7962367
1612 2935799359 2935793552 Bacteria 8012592
1613 2935806425 2935801545 Bacteria 9301974
1614 2935813017 2935810662 Bacteria 9401221
1615 2935821354 2935819856 Bacteria 8261050
1616 2935830669 2935827899 Bacteria 10038562
1617 2935840698 2935837841 Bacteria 9454360
1618 2935850387 2935847175 Bacteria 8228321
1619 2935859963 2935855204 Bacteria 9035059
1620 2935869402 2935864058 Bacteria 9784707
1621 2935880437 2935873716 Bacteria 9632195
1622 2935914003 2935908558 Bacteria 8568796
1623 2935921145 2935916978 Bacteria 9113783
1624 2935931809 2935926038 Bacteria 8601059
1625 2935940256 2935934488 Bacteria 8602579
1626 2935947919 2935942939 Bacteria 8599779
1627 2935956540 2935951376 Bacteria 8602333
1628 2935960349 2935959822 Bacteria 7869783
1629 2935973334 2935967501 Bacteria 8603075
1630 2935977585 2935975950 Bacteria 8347125
1631 2935989495 2935984226 Bacteria 8302647
1632 2935999491 2935992306 Bacteria 9802711
1633 2936006526 2936002035 Bacteria 9362176
1634 2936041605 2936037263 Bacteria 9446081
1635 2937846136 2937843397 Bacteria 5256375
1636 2940560391 2940556831 Bacteria 9590747
1637 2941510505 2941507105 Bacteria 8166816
1638 2941517757 2941515067 Bacteria 8166720
1639 2941525774 2941523033 Bacteria 8169134
1640 2941534225 2941531003 Bacteria 7653939
1641 2941541172 2941538514 Bacteria 9402094
1642 3005479675 3005474847 Bacteria 9259049
1643 3005714248 3005710791 Bacteria 7622528
1644 8006929340 8006926726 Bacteria 6749210
1645 8006967303 8006964411 Bacteria 8966052
1646 8006990210 8006984368 Bacteria 9651211
1647 8006997541 8006994254 Bacteria 8309700
1648 8016514064 8016511872 Bacteria 9921665
1649 8016530249 8016522445 Bacteria 8156687
1650 8016535508 8016530956 Bacteria 8155261
1651 8016548703 8016539877 Bacteria 8155419
1652 8016553431 8016548790 Bacteria 8155074
1653 8016561807 8016557553 Bacteria 8154380
1654 8016577964 8016575299 Bacteria 8154085
1655 8016599642 8016595262 Bacteria 8149947
1656 8016622429 8016613128 Bacteria 8794220
1657 8016627356 8016622563 Bacteria 7999408
1658 8016631658 8016630954 Bacteria 9217207
1659 8017062347 8017057580 Bacteria 10023680
1660 8019535240 8019530166 Bacteria 8155624
1661 8019544242 8019538911 Bacteria 7872763
1662 8019554460 8019547302 Bacteria 7996444
1663 8019557347 8019555841 Bacteria 9642137
1664 8019567952 8019565922 Bacteria 9639779
1665 8019581802 8019576017 Bacteria 10049540
1666 8019589476 8019586578 Bacteria 10212056
1667 8019616762 8019608314 Bacteria 10042931
1668 8019627453 8019619141 Bacteria 9218857
1669 8019635121 8019629233 Bacteria 8687553
1670 8019644607 8019638758 Bacteria 9062356
1671 8019657628 8019648815 Bacteria 10014479
1672 8019662963 8019659431 Bacteria 8577854
1673 8019672562 8019668869 Bacteria 8791617
1674 8019683596 8019678201 Bacteria 8863603
1675 8019689340 8019687851 Bacteria 8712826
1676 8055747031 8055742211 Bacteria 9226248
1677 8056674415 8056673599 Bacteria 7871253
1678 8056683323 8056681323 Bacteria 8472857
1679 8056690093 8056689827 Bacteria 6712655
1680 Ga0209179_1024849
1681 JGI24738J21930_10006044
1682 JGI25406J46586_10001492
1683 JGI25153J46596_10009281
1684 JGI25153J46596_10009680
1685 JGI25153J46596_10014678
1686 JGI25153J46596_10015191
1687 JGI25160J50197_1008733
1688 JGI25160J50197_1011756
1689 JGI25404J52841_10015065
1690 Ga0055530_10010917
1691 Ga0055531_10001195
1692 Ga0055531_10003993
1693 Ga0070658_10338462
1694 Ga0070658_10384769
1695 Ga0070676_10013022
1696 Ga0070683_100276774
1697 Ga0070690_100331020
1698 Ga0070670_100193124
1699 Ga0070670_100350836
1700 Ga0068869_100102291
1701 Ga0068869_100114761
1702 Ga0070680_100013526
1703 Ga0070680_100016985
1704 Ga0070680_100175148
1705 Ga0070680_100435939
1706 Ga0070682_100036640
1707 Ga0070682_100264717
1708 Ga0068868_100003958
1709 Ga0068868_100011518
1710 Ga0070660_100017870
1711 Ga0070689_100064814
1712 Ga0070691_10083779
1713 Ga0070661_100101272
1714 Ga0070668_100042528
1715 Ga0070668_100153283
1716 Ga0070668_100268800
1717 Ga0070669_100090979
1718 Ga0070669_100527332
1719 Ga0070675_100187545
1720 Ga0070671_100011296
1721 Ga0070671_100015678
1722 Ga0070671_100086510
1723 Ga0070674_100026165
1724 Ga0070673_100425115
1725 Ga0070688_100006780
1726 Ga0070688_100028217
1727 Ga0070659_100050790
1728 Ga0070667_100028910
1729 Ga0070667_100087889
1730 Ga0070709_10005966
1731 Ga0070709_10007727
1732 Ga0070709_10015676
1733 Ga0070709_10154349
1734 Ga0070709_10611680
1735 Ga0070714_100009892
1736 Ga0070714_100029375
1737 Ga0070714_100036016
1738 Ga0070714_100088688
1739 Ga0070714_100130627
1740 Ga0070713_100004379
1741 Ga0070713_100010400
1742 Ga0070713_100021269
1743 Ga0070713_100074356
1744 Ga0070713_100101791
1745 Ga0070713_100467968
1746 Ga0070710_10000344
1747 Ga0070710_10000395
1748 Ga0070710_10007756
1749 Ga0070710_10013495
1750 Ga0070701_10086418
1751 Ga0070711_100000702
1752 Ga0070711_100013855
1753 Ga0070711_100054002
1754 Ga0070711_100154357
1755 Ga0070711_100263486
1756 Ga0070663_100007150
1757 Ga0070663_100027479
1758 Ga0070663_100162013
1759 Ga0070663_100227965
1760 Ga0070678_100009881
1761 Ga0070678_100034185
1762 Ga0070678_100092332
1763 Ga0070662_100117538
1764 Ga0070662_100307659
1765 Ga0070662_100323031
1766 Ga0070681_10203620
1767 Ga0070681_10209729
1768 Ga0070681_10358218
1769 Ga0070685_10007975
1770 Ga0070685_10030623
1771 Ga0070685_10201983
1772 Ga0070679_100028788
1773 Ga0070679_100056398
1774 Ga0070679_100243480
1775 Ga0070684_100021896
1776 Ga0070684_100032076
1777 Ga0070684_100141149
1778 Ga0070684_100456791
1779 Ga0068853_100007032
1780 Ga0068853_100018974
1781 Ga0068853_100290030
1782 Ga0068853_100514028
1783 Ga0070672_100115669
1784 Ga0070672_100269487
1785 Ga0070672_100414845
1786 Ga0070672_100629406
1787 Ga0070686_100012110
1788 Ga0070695_100267217
1789 Ga0070696_100225617
1790 Ga0070693_100034460
1791 Ga0070665_100016641
1792 Ga0070665_100099989
1793 Ga0070665_100123757
1794 Ga0070665_100259127
1795 Ga0070665_100266730
1796 Ga0070665_100392500
1797 Ga0070665_100739589
1798 Ga0068855_100024338
1799 Ga0068855_100043049
1800 Ga0068855_100049847
1801 Ga0068855_100076413
1802 Ga0068855_100101580
1803 Ga0068855_100132096
1804 Ga0068855_100162720
1805 Ga0068855_100482974
1806 Ga0070664_100198428
1807 Ga0068857_100024325
1808 Ga0068857_100071597
1809 Ga0068857_100192669
1810 Ga0068857_100400913
1811 Ga0068854_100015803
1812 Ga0068856_100007904
1813 Ga0068856_100063923
1814 Ga0068856_100086868
1815 Ga0068856_100153160
1816 Ga0068856_100224895
1817 Ga0068856_100549921
1818 Ga0068852_100063265
1819 Ga0068859_100058087
1820 Ga0068859_100100410
1821 Ga0068859_100978039
1822 Ga0068864_100050145
1823 Ga0068864_100058520
1824 Ga0068864_100186187
1825 Ga0068864_100426410
1826 Ga0068866_10111148
1827 Ga0068866_10175444
1828 Ga0068866_10186540
1829 Ga0068866_10304992
1830 Ga0068861_100153715
1831 Ga0068861_100180027
1832 Ga0068861_100447729
1833 Ga0068851_10006063
1834 Ga0068863_100237338
1835 Ga0068863_100273758
1836 Ga0068858_100047295
1837 Ga0068858_100406507
1838 Ga0068858_100486121
1839 Ga0068860_100000497
1840 Ga0068860_100080702
1841 Ga0068860_100211082
1842 Ga0068860_100462526
1843 Ga0068862_100245860
1844 Ga0068862_100365685
1845 Ga0081455_10001069
1846 Ga0081455_10012384
1847 Ga0081455_10016028
1848 Ga0081455_10021328
1849 Ga0081455_10026882
1850 Ga0081455_10047175
1851 Ga0081455_10057286
1852 Ga0081538_10004388
1853 Ga0081538_10038370
1854 Ga0081538_10054726
1855 Ga0081540_1002393
1856 Ga0081540_1003961
1857 Ga0081540_1005402
1858 Ga0081540_1013623
1859 Ga0081540_1016233
1860 Ga0081540_1020841
1861 Ga0081540_1025112
1862 Ga0081540_1031237
1863 Ga0081540_1034946
1864 Ga0081540_1058821
1865 Ga0081540_1136757
1866 Ga0081539_10000379
1867 Ga0081539_10001555
1868 Ga0081539_10018827
1869 Ga0070717_10000224
1870 Ga0070717_10002876
1871 Ga0070717_10057087
1872 Ga0070717_10072326
1873 Ga0070717_10106427
1874 Ga0070717_10107691
1875 Ga0075365_10001527
1876 Ga0075365_10031975
1877 Ga0075365_10042446
1878 Ga0075365_10066502
1879 Ga0075365_10073284
1880 Ga0075365_10118132
1881 Ga0075365_10126379
1882 Ga0075365_10258049
1883 Ga0075368_10002837
1884 Ga0075368_10005831
1885 Ga0075368_10020493
1886 Ga0075368_10032889
1887 Ga0075368_10048271
1888 Ga0075368_10080844
1889 Ga0075363_100010269
1890 Ga0075363_100017003
1891 Ga0075363_100213795
1892 Ga0075364_10039692
1893 Ga0075364_10050143
1894 Ga0075364_10060728
1895 Ga0070715_10001633
1896 Ga0070716_100004798
1897 Ga0070716_100010255
1898 Ga0070716_100013159
1899 Ga0070716_100098727
1900 Ga0070716_100108952
1901 Ga0070716_100277977
1902 Ga0070712_100009415
1903 Ga0070712_100108299
1904 Ga0070712_100181556
1905 Ga0070712_100303697
1906 Ga0070712_100633261
1907 Ga0075362_10005833
1908 Ga0075367_10012090
1909 Ga0075367_10240836
1910 Ga0075367_10241596
1911 Ga0075369_10049416
1912 Ga0075366_10011006
1913 Ga0075366_10068704
1914 Ga0075366_10084529
1915 Ga0075366_10095194
1916 Ga0097621_100028885
1917 Ga0097621_100348408
1918 Ga0075370_10052522
1919 Ga0075370_10089873
1920 Ga0075370_10176574
1921 Ga0068871_100042230
1922 Ga0075428_100074465
1923 Ga0075428_100897466
1924 Ga0075430_100024425
1925 Ga0075434_100007100
1926 Ga0075434_100330546
1927 Ga0075434_100460050
1928 Ga0075434_100613723
1929 Ga0068865_100367686
1930 Ga0075436_100081189
1931 Ga0075436_100345800
1932 Ga0097620_100058087
1933 Ga0097620_100100398
1934 Ga0097620_100977842
1935 Ga0099824_1003889
1936 Ga0099822_1018677
1937 Ga0099823_1024679
1938 Ga0075435_100087656
1939 Ga0099794_10003317
1940 Ga0099794_10098671
1941 Ga0099795_10003094
1942 Ga0099795_10028013
1943 Ga0105244_10074608
1944 Ga0105240_10003456
1945 Ga0105240_10012909
1946 Ga0105240_10043532
1947 Ga0105240_10071555
1948 Ga0105240_10094483
1949 Ga0105240_10209403
1950 Ga0105240_10287268
1951 Ga0105240_10354146
1952 Ga0105240_10631035
1953 Ga0111539_10041513
1954 Ga0111539_10273642
1955 Ga0111539_10288746
1956 Ga0111539_10313558
1957 Ga0111539_10656131
1958 Ga0105245_10048518
1959 Ga0105245_10062478
1960 Ga0105245_10295203
1961 Ga0105245_10898606
1962 Ga0105247_10033948
1963 Ga0105247_10107324
1964 Ga0105247_10310290
1965 Ga0114129_10099524
1966 Ga0114129_10100119
1967 Ga0114129_10258935
1968 Ga0105243_10042136
1969 Ga0105241_10029805
1970 Ga0105241_10082586
1971 Ga0105241_10322680
1972 Ga0105241_10375461
1973 Ga0105241_10509816
1974 Ga0105242_10278478
1975 Ga0105242_10434735
1976 Ga0105248_10032228
1977 Ga0105248_10088266
1978 Ga0105248_10221469
1979 Ga0105248_10272994
1980 Ga0105248_10299459
1981 Ga0105237_10083404
1982 Ga0105237_10205582
1983 Ga0105237_10217788
1984 Ga0105237_10247229
1985 Ga0105237_10469786
1986 Ga0105238_10015239
1987 Ga0105238_10017873
1988 Ga0105238_10039830
1989 Ga0105238_10049070
1990 Ga0105238_10056888
1991 Ga0105238_10119143
1992 Ga0105238_10126156
1993 Ga0105238_10560042
1994 Ga0105249_10088853
1995 Ga0105249_10593228
1996 Ga0105239_10007768
1997 Ga0105239_10041053
1998 Ga0105239_10047108
1999 Ga0105239_10543654
2000 Ga0105246_10027415
2001 Ga0105246_10128931
2002 Ga0105246_10142910
2003 Ga0105246_10265888
2004 Ga0105246_10319180
2005 Ga0157339_1001999
2006 Ga0157373_10054578
2007 Ga0157373_10080298
2008 Ga0157371_10087194
2009 Ga0157370_10071166
2010 Ga0157370_10245754
2011 Ga0157369_10012284
2012 Ga0157369_10047236
2013 Ga0157369_10217338
2014 Ga0157374_10038013
2015 Ga0157374_10190078
2016 Ga0157374_10733350
2017 Ga0157378_10109936
2018 Ga0157378_10438037
2019 Ga0157378_10483300
2020 Ga0163162_10117935
2021 Ga0163162_10236196
2022 Ga0157372_10061655
2023 Ga0157372_10212623
2024 Ga0157372_10462919
2025 Ga0157375_10141087
2026 Ga0157375_10195603
2027 Ga0157375_10296391
2028 Ga0157375_10514473
2029 Ga0163163_10009676
2030 Ga0163163_10036866
2031 Ga0163163_10207624
2032 Ga0163163_10288375
2033 Ga0163163_10288660
2034 Ga0157380_10080959
2035 Ga0157380_10146325
2036 Ga0157377_10189865
2037 Ga0157377_10231667
2038 Ga0157377_10270908
2039 Ga0157379_10173043
2040 Ga0157379_10249068
2041 Ga0157379_10351511
2042 Ga0157376_10059767
2043 Ga0157376_10104151
2044 Ga0157376_10116336
2045 Ga0157376_10175130
2046 Ga0163161_10113354
2047 Ga0163161_10222549
2048 Ga0163161_10239596
2049 Ga0197907_11209949
2050 Ga0206354_10920056
2051 Ga0206353_10108935
2052 Ga0209563_104891
2053 Ga0209233_1002215
2054 Ga0209676_1000327
2055 Ga0209564_1001796
2056 Ga0209564_1003203
2057 Ga0209564_1047021
2058 Ga0209758_1000371
2059 Ga0209758_1001291
2060 Ga0209758_1001559
2061 Ga0209758_1003458
2062 Ga0209758_1011126
2063 Ga0209758_1014744
2064 Ga0209758_1085607
2065 Ga0209050_1001093
2066 Ga0207426_1000352
2067 Ga0207426_1005546
2068 Ga0209257_1000609
2069 Ga0207697_10014505
2070 Ga0207697_10070251
2071 Ga0207656_10007348
2072 Ga0207682_10003960
2073 Ga0207692_10000724
2074 Ga0207692_10010688
2075 Ga0207692_10253297
2076 Ga0207642_10149832
2077 Ga0207710_10005547
2078 Ga0207710_10216016
2079 Ga0207710_10235481
2080 Ga0207688_10033354
2081 Ga0207688_10054478
2082 Ga0207688_10062052
2083 Ga0207688_10077716
2084 Ga0207680_10052069
2085 Ga0207680_10124672
2086 Ga0207647_10004508
2087 Ga0207647_10015943
2088 Ga0207647_10166333
2089 Ga0207685_10000490
2090 Ga0207685_10046559
2091 Ga0207699_10001497
2092 Ga0207699_10002390
2093 Ga0207699_10021380
2094 Ga0207699_10094410
2095 Ga0207643_10040058
2096 Ga0207705_10100992
2097 Ga0207705_10243255
2098 Ga0207705_10352742
2099 Ga0207684_10545295
2100 Ga0207654_10000344
2101 Ga0207654_10034166
2102 Ga0207654_10080204
2103 Ga0207654_10200746
2104 Ga0207707_10038828
2105 Ga0207707_10103434
2106 Ga0207707_10132454
2107 Ga0207707_10387875
2108 Ga0207695_10000015
2109 Ga0207695_10000402
2110 Ga0207695_10026603
2111 Ga0207695_10037699
2112 Ga0207695_10089621
2113 Ga0207695_10148509
2114 Ga0207671_10001316
2115 Ga0207671_10053672
2116 Ga0207693_10003086
2117 Ga0207693_10018422
2118 Ga0207693_10020465
2119 Ga0207693_10035146
2120 Ga0207693_10051463
2121 Ga0207693_10346168
2122 Ga0207663_10001974
2123 Ga0207663_10005570
2124 Ga0207663_10025028
2125 Ga0207663_10057238
2126 Ga0207663_10082371
2127 Ga0207660_10002465
2128 Ga0207660_10022470
2129 Ga0207657_10019503
2130 Ga0207657_10027909
2131 Ga0207657_10066342
2132 Ga0207657_10258441
2133 Ga0207652_10002286
2134 Ga0207652_10175524
2135 Ga0207652_10533685
2136 Ga0207681_10273578
2137 Ga0207694_10000095
2138 Ga0207694_10028380
2139 Ga0207694_10040730
2140 Ga0207694_10054256
2141 Ga0207650_10054104
2142 Ga0207650_10227353
2143 Ga0207659_10152389
2144 Ga0207687_10008392
2145 Ga0207687_10077091
2146 Ga0207687_10298241
2147 Ga0207687_10316001
2148 Ga0207687_10411048
2149 Ga0207700_10004634
2150 Ga0207700_10012786
2151 Ga0207700_10017235
2152 Ga0207700_10060010
2153 Ga0207700_10071819
2154 Ga0207700_10074945
2155 Ga0207700_10092425
2156 Ga0207700_10392555
2157 Ga0207664_10005861
2158 Ga0207664_10055230
2159 Ga0207664_10060623
2160 Ga0207664_10081041
2161 Ga0207644_10010381
2162 Ga0207644_10024814
2163 Ga0207644_10284045
2164 Ga0207644_10455504
2165 Ga0207690_10080890
2166 Ga0207690_10173761
2167 Ga0207706_10012740
2168 Ga0207706_10212076
2169 Ga0207686_10012373
2170 Ga0207686_10046906
2171 Ga0207709_10052202
2172 Ga0207670_10030422
2173 Ga0207670_10317589
2174 Ga0207670_10328262
2175 Ga0207669_10033925
2176 Ga0207669_10115076
2177 Ga0207669_10351262
2178 Ga0207704_10005807
2179 Ga0207704_10050895
2180 Ga0207704_10124949
2181 Ga0207704_10673730
2182 Ga0207665_10000455
2183 Ga0207665_10003636
2184 Ga0207665_10011323
2185 Ga0207665_10088607
2186 Ga0207665_10292275
2187 Ga0207691_10069954
2188 Ga0207691_10131391
2189 Ga0207711_10022195
2190 Ga0207711_10095450
2191 Ga0207689_10021472
2192 Ga0207689_10030547
2193 Ga0207661_10000227
2194 Ga0207661_10043715
2195 Ga0207661_10353844
2196 Ga0207679_10140943
2197 Ga0207679_10318224
2198 Ga0207667_10037625
2199 Ga0207667_10042452
2200 Ga0207667_10069488
2201 Ga0207667_10129097
2202 Ga0207667_10258659
2203 Ga0207667_10318937
2204 Ga0207667_10400518
2205 Ga0207651_10139634
2206 Ga0207651_10155253
2207 Ga0207651_10181556
2208 Ga0207651_10224091
2209 Ga0207712_10178151
2210 Ga0207712_10203294
2211 Ga0207668_10018976
2212 Ga0207668_10050682
2213 Ga0207668_10173452
2214 Ga0207668_10252375
2215 Ga0207640_10018371
2216 Ga0207640_10143765
2217 Ga0207658_10015698
2218 Ga0207658_10018042
2219 Ga0207658_10164950
2220 Ga0207658_10315632
2221 Ga0207658_10437314
2222 Ga0207677_10009719
2223 Ga0207677_10385440
2224 Ga0207703_10228165
2225 Ga0207703_10575241
2226 Ga0207639_10049151
2227 Ga0207639_10088929
2228 Ga0207639_10276048
2229 Ga0207639_10290452
2230 Ga0207639_10647564
2231 Ga0207678_10016707
2232 Ga0207678_10018224
2233 Ga0207678_10144884
2234 Ga0207678_10152456
2235 Ga0207678_10165636
2236 Ga0207678_10231459
2237 Ga0207678_10243570
2238 Ga0207678_10255834
2239 Ga0207678_10285683
2240 Ga0207678_10515968
2241 Ga0207708_10347917
2242 Ga0207702_10000025
2243 Ga0207702_10000075
2244 Ga0207702_10008399
2245 Ga0207702_10139135
2246 Ga0207702_10151415
2247 Ga0207702_10159644
2248 Ga0207702_10197843
2249 Ga0207702_10614955
2250 Ga0207641_10069289
2251 Ga0207641_10246807
2252 Ga0207641_10315497
2253 Ga0207641_10493922
2254 Ga0207676_10008170
2255 Ga0207676_10071536
2256 Ga0207676_10277560
2257 Ga0207674_10022795
2258 Ga0207674_10063245
2259 Ga0207674_10078135
2260 Ga0207674_10128285
2261 Ga0207674_10176530
2262 Ga0207674_10379881
2263 Ga0207674_10510214
2264 Ga0207675_100023527
2265 Ga0207675_100148916
2266 Ga0207675_100151263
2267 Ga0207675_100240797
2268 Ga0207683_10013509
2269 Ga0207683_10020817
2270 Ga0207683_10033981
2271 Ga0207683_10034301
2272 Ga0207683_10073168
2273 Ga0207683_10079700
2274 Ga0207683_10204096
2275 Ga0207683_10690267
2276 Ga0207698_10011948
2277 Ga0207698_10241062
2278 Ga0207698_10592153
2279 Ga0207698_10916301
2280 Ga0209389_1000132
2281 Ga0209589_1000003
2282 Ga0209489_100003
2283 Ga0209489_103912
2284 Ga0209700_100003
2285 Ga0209700_100281
2286 Ga0209588_1004688
2287 Ga0209813_10004019
2288 Ga0209813_10042829
2289 Ga0209813_10097669
2290 Ga0207428_10149772
2291 Ga0268266_10002093
2292 Ga0268266_10003481
2293 Ga0268266_10004788
2294 Ga0268266_10010224
2295 Ga0268266_10016552
2296 Ga0268266_10071199
2297 Ga0268266_10481587
2298 Ga0268265_10060380
2299 Ga0268265_10098647
2300 Ga0268265_10451672
2301 Ga0268265_10547078
2302 Ga0268264_10000022
2303 Ga0268264_10149643
2304 Ga0265334_10035881
2305 Ga0307517_10000111
2306 Ga0307515_10198993
2307 Ga0307511_10028875
2308 Ga0265330_10015875
2309 Ga0265330_10028009
2310 Ga0265332_10005648
2311 Ga0265332_10061076
2312 Ga0265325_10000006
2313 Ga0265325_10005078
2314 Ga0265340_10001029
2315 Ga0265316_10069202
2316 Ga0265316_10397008
2317 Ga0265316_10428241
2318 Ga0307509_10083821
2319 Ga0307509_10204439
2320 Ga0307509_10235360
2321 Ga0265313_10004211
2322 Ga0265313_10038758
2323 Ga0307508_10000001
2324 Ga0265314_10007699
2325 Ga0265314_10053368
2326 Ga0265342_10062563
2327 Ga0265342_10143952
2328 Ga0307516_10080872
2329 Ga0307412_10192022
2330 Ga0307409_100031793
2331 Ga0307411_10162698
2332 Ga0307415_100088179
2333 Ga0307415_100106386
2334 Ga0307415_100301385
2335 Ga0307510_10001748
2336 Ga0307510_10214854
2337 Ga0315911_1000001
2338 Ga0373930_0009477
2339 Ga0373958_0050421
2340 Ga0373959_0004888
2341 Ga0373938_0014855
2342 Ga0373929_0004081
2343 Ga0373934_0002524
2344 Ga0373934_0043127
2345 Ga0373934_0047487
2346 Ga0373940_0005371
2347 Ga0373952_0000703
2348 Ga0373932_0004218
2349 Ga0373936_0005474
2350 Ga0373936_0036940
2351 Ga0373936_0054933
2352 Ga0373941_0009331
2353 Ga0373941_0032545
2354 Ga0373945_0012567
2355 Ga0373945_0024502
2356 Ga0373945_0103450
2357 Ga0373953_0006545
2358 Ga0373953_0130758
2359 Ga0373954_0001369
2360 Ga0373956_0028711
2361 Ga0373956_0079479
2362 Ga0373957_0040888
2363 Ga0373960_0009007
2364 Ga0373943_0007816
2365 Ga0373943_0023765
2366 Ga0373943_0026965
2367 Ga0373943_0039720
2368 Ga0373946_0014662
2369 Ga0373946_0038028
2370 Ga0373955_0001864
2371 Ga0373955_0027869
2372 Ga0373955_0048107
2373 Ga0373961_0012551
2374 Ga0373962_0005970
2375 Ga0373924_0004443
2376 Ga0373924_0031770
2377 Ga0373931_0003730
2378 Ga0373931_0013950
2379 Ga0373931_0014396
2380 Ga0373935_0000110
2381 Ga0373935_0028868
2382 Ga0373935_0041167
2383 Ga0373935_0203993
2384 Ga0373927_0002008
2385 Ga0373927_0005256
2386 Ga0373927_0038834
2387 Ga0373933_0000117
2388 Ga0373933_0000863
2389 Ga0373933_0033912
2390 Ga0373933_0056752
2391 Ga0373933_0154366
2392 Ga0373933_0205792
2393 Ga0373947_0001449
2394 Ga0373947_0012614
2395 Ga0373947_0096855
2396 Ga0373947_0203348
2397 Ga0373947_0277508
2398 Ga0373937_0007186
2399 Ga0373937_0031239
2400 Ga0373937_0080469
2401 Ga0373937_0208724
2402 Ga0373937_0373974
2403 Ga0373925_0000748
2404 Ga0373925_0004770
2405 Ga0373925_0021180
2406 Ga0373925_0082755
2407 Ga0373925_0087242
2408 Ga0373925_0148842
2409 Ga0373925_0289015
2410 Ga0373925_0567824
2411 Ga0395900_0001759
2412 Ga0395900_0005207
2413 Ga0395898_0001625
2414 Ga0395898_0055146
2415 Ga0395898_0063202
2416 Ga0395898_0122535
2417 Ga0395898_0395500
2418 Ga0395905_0002799
2419 Ga0395905_0174543
2420 Ga0395905_0499771
2421 Ga0436364_0539583
2422 Ga0395901_0043346
2423 Ga0395901_0102918
2424 Ga0395901_0410686
2425 Ga0400483_060836
2426 Ga0436365_0257418
2427 Ga0436365_1023002
2428 Ga0436360_0096391
2429 Ga0436361_0480907
2430 Ga0436361_0862295
2431 Ga0436363_0062258
2432 Ga0436363_1628114
2433 Ga0439453_0006931
2434 Ga0439435_0001490
2435 Ga0466969_0163530
2436 Ga0466972_0000125
2437 Ga0466965_0313425
2438 Ga0466966_0161906
2439 Ga0466966_0168686
2440 Ga0466966_0214125
2441 Ga0466961_0023660
2442 Ga0466961_0099657
2443 Ga0466963_0016505
2444 Ga0466963_0105572
2445 Ga0466957_0322588
2446 Ga0466960_0159631
2447 Ga0466959_0018639
2448 Ga0466959_0360311
2449 Ga0466958_0139995
2450 Ga0466958_0328468
2451 Ga0466967_0002462
2452 Ga0466967_0042275
2453 Ga0466967_0468639
2454 Ga0466967_0546005
2455 Ga0495617_068258
2456 Ga0495592_0003752
2457 Ga0495592_0030096
2458 Ga0495592_0054979
2459 Ga0495592_0210847
2460 Ga0495603_0000011
2461 Ga0495603_0016002
2462 Ga0495603_0018500
2463 Ga0495603_0018693
2464 Ga0495603_0029271
2465 Ga0495603_0126687
2466 Ga0495603_0145321
2467 Ga0495629_0000251
2468 Ga0495629_0000253
2469 Ga0495629_0002122
2470 Ga0495638_0009386
2471 Ga0495638_0022362
2472 Ga0495638_0036500
2473 Ga0495638_0039823
2474 Ga0495638_0056366
2475 Ga0495641_0014674
2476 Ga0495641_0017327
2477 Ga0495641_0039165
2478 Ga0495651_0015572
2479 Ga0495651_0085167
2480 Ga0495651_0120048
2481 Ga0495653_0000473
2482 Ga0495653_0113012
2483 Ga0495650_0085380
2484 Ga0495580_0015052
2485 Ga0495580_0018909
2486 Ga0495580_0533797
2487 Ga0495582_0000974
2488 Ga0495582_0027990
2489 Ga0495605_0032938
2490 Ga0495639_0000017
2491 Ga0495639_0060223
2492 Ga0495639_0198543
2493 Ga0495662_0000179
2494 Ga0495662_0129503
2495 Ga0495662_0220546
2496 Ga0495662_0233079
2497 Ga0495664_0035477
2498 Ga0495664_0089776
2499 Ga0495664_0278364
2500 Ga0495585_0004643
2501 Ga0495585_0088116
2502 Ga0495594_0000094
2503 Ga0495594_0007078
2504 Ga0495594_0079170
2505 Ga0495594_0098064
2506 Ga0495594_0102898
2507 Ga0495606_0002138
2508 Ga0495606_0102853
2509 Ga0495608_0007400
2510 Ga0495608_0060453
2511 Ga0495610_0075749
2512 Ga0495616_0043510
2513 Ga0495616_0052942
2514 Ga0495616_0107873
2515 Ga0495618_0084293
2516 Ga0495618_0095271
2517 Ga0495618_0189316
2518 Ga0495618_0430564
2519 Ga0495620_0024967
2520 Ga0495620_0121661
2521 Ga0495628_0027034
2522 Ga0495628_0030482
2523 Ga0495628_0064067
2524 Ga0495628_0180064
2525 Ga0495628_0244898
2526 Ga0495630_0008181
2527 Ga0495630_0036331
2528 Ga0495632_0130764
2529 Ga0495632_0157335
2530 Ga0495644_0003084
2531 Ga0495648_0000494
2532 Ga0495648_0001433
2533 Ga0495648_0060116
2534 Ga0495666_0149246
2535 Ga0495666_0191232
2536 Ga0495642_0129722
2537 Ga0495652_0006106
2538 Ga0495652_0013728
2539 Ga0495652_0091230
2540 Ga0495652_0113263
2541 Ga0495652_0119722
2542 Ga0495654_0005880
2543 Ga0495654_0032938
2544 Ga0495654_0165740
2545 Ga0495665_0000032
2546 Ga0495665_0023158
2547 Ga0495640_0001724
2548 Ga0495640_0025020
2549 Ga0495640_0033866
2550 Ga0495640_0196234
2551 Ga0495586_0070505
2552 Ga0495586_0311371
2553 Ga0495587_0010454
2554 Ga0495587_0035328
2555 Ga0495587_0037939
2556 Ga0495587_0197253
2557 Ga0495598_0006263
2558 Ga0495609_0142147
2559 Ga0495621_0012201
2560 Ga0495621_0091531
2561 Ga0495597_0046757
2562 Ga0495597_0053866
2563 Ga0495645_0061017
2564 Ga0495645_0137633
2565 Ga0495645_0263284
2566 Ga0495622_0010235
2567 Ga0495622_0038223
2568 Ga0495633_0003607
2569 Ga0495667_0000962
2570 Ga0495667_0044797
2571 Ga0495667_0110804
2572 Ga0495667_0165382
2573 Ga0495656_0001421
2574 Ga0495656_0039306
2575 Ga0495656_0091115
2576 Ga0495656_0170297
2577 Ga0495668_0000092
2578 Ga0495668_0075201
2579 Ga0495668_0166199
2580 Ga0495668_0216984
2581 Ga0495668_0298754
2582 Ga0495634_0003268
2583 Ga0495634_0078652
2584 Ga0495634_0085665
2585 Ga0495634_0212154
2586 Ga0495634_0229210
2587 Ga0495611_0030565
2588 Ga0495611_0133890
2589 Ga0495625_0361214
2590 Ga0495635_0000084
2591 Ga0495635_0003234
2592 Ga0495635_0041900
2593 Ga0495635_0164809
2594 Ga0495659_0007751
2595 Ga0495661_0019379
2596 Ga0495661_0063366
2597 Ga0495661_0294948
2598 Ga0495588_0034752
2599 Ga0495588_0037169
2600 Ga0495588_0048031
2601 Ga0495588_0108846
2602 Ga0495657_0005107
2603 Ga0495657_0008437
2604 Ga0495657_0021841
2605 Ga0495657_0190027
2606 Ga0495657_0224104
2607 Ga0495599_0000457
2608 Ga0495599_0038768
2609 Ga0495599_0405425
2610 Ga0495623_0008556
2611 Ga0495623_0107716
2612 Ga0495623_0113461
2613 Ga0495646_0042090
2614 Ga0495646_0064091
2615 Ga0495646_0153260
2616 Ga0495647_0000248
2617 Ga0495647_0010707
2618 Ga0495647_0017500
2619 Ga0495658_0001805
2620 Ga0495658_0007984
2621 Ga0495658_0106447
2622 Ga0495658_0112424
2623 Ga0495669_0050384
2624 Ga0495669_0278404
2625 Ga0495613_0001580
2626 Ga0495613_0004954
2627 Ga0495613_0071751
2628 Ga0495613_0121915
2629 Ga0495624_0004094
2630 Ga0495624_0156067
2631 Ga0495670_0000787
2632 Ga0495670_0010416
2633 Ga0495670_0034134
2634 Ga0495671_0243761
2635 Ga0495649_0094750
2636 Ga0495600_0003042
2637 Ga0495600_0004866
2638 Ga0495600_0051163
2639 Ga0495581_0000076
2640 Ga0495581_0043435
2641 Ga0495581_0114836
2642 Ga0495581_0139969
2643 Ga0495581_0203298
2644 Ga0495581_0270429
2645 Ga0495581_0340779
2646 Ga0495604_0010464
2647 Ga0495604_0102023
2648 Ga0495604_0124266
2649 Ga0495604_0133812
2650 Ga0495674_0001109
2651 Ga0495674_0009634
2652 Ga0495674_0063393
2653 Ga0495674_0070677
2654 Ga0495674_0072742
2655 Ga0495672_0010637
2656 Ga0495672_0028513
2657 Ga0495672_0242945
2658 Ga0495672_0263016
2659 Ga0495676_0036452
2660 Ga0495676_0227178
2661 Ga0495676_0283049
2662 Ga0495680_0007126
2663 Ga0495680_0010925
2664 Ga0495680_0021814
2665 Ga0495680_0065244
2666 Ga0495680_0270302
2667 Ga0495683_0166942
2668 Ga0495687_010366
2669 Ga0495675_0001533
2670 Ga0495677_0174134
2671 Ga0495679_096931
2672 Ga0495673_0117193
2673 Ga0495684_0001330
2674 Ga0495684_0001937
2675 Ga0495684_0010509
2676 Ga0495686_0076759
2677 Ga0495686_0142253
2678 Ga0495686_0169194
2679 Ga0495686_0275060
2680 Ga0495593_0002160
2681 Ga0495593_0002185
2682 Ga0495593_0004247
2683 Ga0495593_0048015
2684 Ga0495602_0062123
2685 Ga0495602_0084727
2686 Ga0495614_0035738
2687 Ga0495614_0045811
2688 Ga0495614_0199292
2689 Ga0496100_0009708
2690 Ga0496100_0032941
2691 Ga0496100_0133547
2692 Ga0496100_0186477
2693 Ga0496100_0239403
2694 Ga0496101_0062075
2695 Ga0496101_0106071
2696 Ga0496101_0124410
2697 Ga0496101_0179040
2698 Ga0496101_0234968
2699 Ga0496101_0306525
2700 Ga0496102_0004998
2701 Ga0496102_0017053
2702 Ga0496102_0029309
2703 Ga0496102_0122324
2704 Ga0496102_0123553
2705 Ga0496102_0127267
2706 Ga0496102_0253023
2707 Ga0496103_0003807
2708 Ga0496103_0024359
2709 Ga0496103_0067753
2710 Ga0496104_0000331
2711 Ga0496104_0023465
2712 Ga0496104_0026932
2713 Ga0496104_0065839
2714 Ga0496104_0092178
2715 Ga0496104_0118811
2716 Ga0496104_0131351
2717 Ga0496104_0696809
2718 Ga0496105_0013669
2719 Ga0496105_0027756
2720 Ga0496105_0047246
2721 Ga0496105_0104294
2722 Ga0496105_0129992
2723 Ga0496105_0193884
2724 Ga0496105_0617885
2725 Ga0496106_0001453
2726 Ga0496106_0007579
2727 Ga0496106_0155397
2728 Ga0496106_0548593
2729 Ga0496107_0012401
2730 Ga0496107_0057233
2731 Ga0496107_0074980
2732 Ga0496107_0080430
2733 Ga0496107_0131581
2734 Ga0496107_0139865
2735 Ga0496107_0140109
2736 Ga0496108_0001656
2737 Ga0496108_0007772
2738 Ga0496108_0015489
2739 Ga0496108_0081128
2740 Ga0496108_0132976
2741 Ga0496108_0279817
2742 Ga0496108_0369861
2743 Ga0496108_0389286
2744 Ga0496108_0435246
2745 Ga0496109_0002542
2746 Ga0496109_0005517
2747 Ga0496109_0037791
2748 Ga0496109_0253461
2749 Ga0496109_0296331
2750 Ga0496109_0430639
2751 Ga0496109_0548544
2752 Ga0496109_1016602
2753 Ga0496110_0006911
2754 Ga0496110_0011557
2755 Ga0496110_0024579
2756 Ga0496110_0050759
2757 Ga0496110_0054426
2758 Ga0496110_0108630
2759 Ga0496110_0234218
2760 Ga0496110_0350302
2761 Ga0496110_0401456
2762 Ga0496110_0700215
2763 Ga0496111_0001681
2764 Ga0496111_0004178
2765 Ga0496111_0020054
2766 Ga0496111_0040057
2767 Ga0496111_0049479
2768 Ga0496111_0094980
2769 Ga0496111_0265385
2770 Ga0496111_0271124
2771 Ga0496112_0000414
2772 Ga0496112_0010890
2773 Ga0496112_0024803
2774 Ga0496112_0041801
2775 Ga0496112_0043885
2776 Ga0496112_0189675
2777 Ga0496112_0208418
2778 Ga0496112_0216117
2779 Ga0496112_0251390
2780 Ga0496113_0001520
2781 Ga0496113_0004601
2782 Ga0496113_0008072
2783 Ga0496113_0008091
2784 Ga0496113_0114467
2785 Ga0496113_0215699
2786 Ga0496113_0555583
2787 Ga0496114_0005585
2788 Ga0496114_0015990
2789 Ga0496114_0065889
2790 Ga0496114_0069511
2791 Ga0496114_0114066
2792 Ga0496114_0121398
2793 Ga0496114_0136752
2794 Ga0496114_0279601
2795 Ga0496114_0451916
2796 Ga0496115_0011102
2797 Ga0496115_0019563
2798 Ga0496115_0040397
2799 Ga0496115_0041198
2800 Ga0496115_0075176
2801 Ga0496115_0089958
2802 Ga0496115_0467285
2803 Ga0496115_0541517
2804 Ga0496116_0002810
2805 Ga0496116_0181951
2806 Ga0496116_0254201
2807 Ga0496117_0064775
2808 Ga0496117_0066143
2809 Ga0496117_0085429
2810 Ga0496118_0017101
2811 Ga0496118_0075568
2812 Ga0496118_0201703
2813 Ga0496118_0214644
2814 Ga0496119_0091345
2815 Ga0496119_0094144
2816 Ga0496119_0128632
2817 Ga0496119_0149169
2818 Ga0496119_0195140
2819 Ga0496121_0005592
2820 Ga0496121_0005961
2821 Ga0496121_0025691
2822 Ga0496121_0031537
2823 Ga0496121_0075028
2824 Ga0496121_0086316
2825 Ga0496121_0102204
2826 Ga0496121_0104069
2827 Ga0496121_0114227
2828 Ga0496121_0122569
2829 Ga0496121_0151531
2830 Ga0496121_0258853
2831 Ga0496121_0260947
2832 Ga0496122_0001850
2833 Ga0496122_0024253
2834 Ga0496122_0214035
2835 Ga0496123_0000498
2836 Ga0496123_0153571
2837 Ga0496124_0039002
2838 Ga0496124_0170336
2839 Ga0496124_0176486
2840 Ga0496125_0000850
2841 Ga0496125_0006132
2842 Ga0496125_0006453
2843 Ga0496125_0038920
2844 Ga0496125_0059762
2845 Ga0496125_0379689
2846 Ga0496126_0003112
2847 Ga0496126_0004886
2848 Ga0496126_0008303
2849 Ga0496126_0018879
2850 Ga0496126_0066646
2851 Ga0496126_0120048
2852 Ga0496126_0138295
2853 Ga0496126_0149822
2854 Ga0496126_0159831
2855 Ga0496126_0170358
2856 Ga0496126_0207351
2857 Ga0496126_0233659
2858 Ga0496126_0251436
2859 Ga0496126_0562002
2860 Ga0496126_0563447
2861 Ga0496126_0600538
2862 Ga0495682_0051559
2863 Ga0495682_0089363
2864 Ga0501031_0000253
2865 Ga0501031_0019009
2866 Ga0501031_0174039
2867 Ga0501032_0000273
2868 Ga0501032_0022067
2869 Ga0501032_0038462
2870 Ga0501032_0046242
2871 Ga0501032_0051051
2872 Ga0501032_0136588
2873 Ga0501033_0000098
2874 Ga0501033_0000332
2875 Ga0501033_0055981
2876 Ga0501033_0064916
2877 Ga0501033_0453318
2878 Ga0501034_0000088
2879 Ga0501034_0000175
2880 Ga0501034_0019896
2881 Ga0501034_0048469
2882 Ga0501034_0078646
2883 Ga0501034_0104633
2884 Ga0501034_0269977
2885 Ga0501034_0519603
2886 Ga0501036_0000049
2887 Ga0501036_0043499
2888 Ga0501036_0076908
2889 Ga0501036_0236704
2890 Ga0501036_0281622
2891 Ga0501037_0000069
2892 Ga0501037_0003734
2893 Ga0501037_0144821
2894 Ga0501037_0199808
2895 Ga0501038_0000034
2896 Ga0501038_0008654
2897 Ga0501038_0053758
2898 Ga0501038_0072407
2899 Ga0501038_0111941
2900 Ga0501038_0144616
2901 Ga0501038_0339867
2902 Ga0501039_0000090
2903 Ga0501039_0005577
2904 Ga0501039_0108617
2905 Ga0501039_0694764
2906 Ga0501040_0299360
2907 Ga0501040_0527577
2908 Ga0501041_0280595
2909 Ga0501042_0021749
2910 Ga0501042_0111228
2911 Ga0501043_0000130
2912 Ga0501043_0010948
2913 Ga0501043_0136910
2914 Ga0501046_0000213
2915 Ga0501046_0007792
2916 Ga0501046_0020817
2917 Ga0501046_0032084
2918 Ga0501046_0181540
2919 Ga0501047_0000255
2920 Ga0501047_0016128
2921 Ga0501047_0039630
2922 Ga0501047_0074475
2923 Ga0501047_0087080
2924 Ga0501047_0087376
2925 Ga0501047_0109419
2926 Ga0501047_0329085
2927 Ga0501047_0546852
2928 Ga0501048_0000252
2929 Ga0501048_0138363
2930 Ga0501067_0001929
2931 Ga0501067_0021939
2932 Ga0501067_0051104
2933 Ga0501067_0060356
2934 Ga0501067_0189962
2935 Ga0501068_0000197
2936 Ga0501068_0014839
2937 Ga0501069_0000614
2938 Ga0501069_0074684
2939 Ga0501069_0093592
2940 Ga0501069_0115171
2941 Ga0501070_0017034
2942 Ga0501070_0068644
2943 Ga0501070_0171049
2944 Ga0501070_0384853
2945 Ga0501071_0008255
2946 Ga0501071_0582273
2947 Ga0501072_0000146
2948 Ga0501072_0245583
2949 Ga0501073_0000035
2950 Ga0501073_0023327
2951 Ga0501073_0099446
2952 Ga0501073_0117597
2953 Ga0501074_0000512
2954 Ga0501074_0059524
2955 Ga0501075_0337399
2956 Ga0501077_0084003
2957 Ga0501079_0010497
2958 Ga0501079_0087257
2959 Ga0501079_0111763
2960 Ga0501079_0364691
2961 Ga0501080_0000379
2962 Ga0501080_0049862
2963 Ga0501080_0060413
2964 Ga0501080_0363492
2965 Ga0501080_0372895
2966 Ga0501080_0548637
2967 Ga0501081_0106847
2968 Ga0501081_0366079
2969 Ga0501083_0000740
2970 Ga0501083_0007489
2971 Ga0501083_0151374
2972 Ga0501035_0000894
2973 Ga0501035_0001058
2974 Ga0501035_0043468
2975 Ga0501035_0181629
2976 Ga0501035_0240818
2977 Ga0501035_0268517
2978 Ga0501035_0277558
2979 Ga0501044_0000461
2980 Ga0501044_0021033
2981 Ga0501044_0043353
2982 Ga0501044_0077714
2983 Ga0501044_0077856
2984 Ga0501044_0118193
2985 Ga0501044_0170847
2986 Ga0501044_0189973
2987 Ga0501044_0210104
2988 Ga0501044_0247374
2989 Ga0501045_0109171
2990 nmdc:mga03683_17567_c1
2991 nmdc:mga03683_28652_c1
2992 nmdc:mga03683_2952_c1
2993 nmdc:mga03n38_15507_c1
2994 nmdc:mga03n38_166170_c1
2995 nmdc:mga03n38_20367_c1
2996 nmdc:mga03n38_210100_c1
2997 nmdc:mga03n38_613_c1
2998 nmdc:mga03n38_88814_c1
2999 nmdc:mga00v17_126620_c1
3000 nmdc:mga00v17_21043_c1
3001 nmdc:mga0yw44_124882_c1
3002 nmdc:mga0yw44_140144_c1
3003 nmdc:mga0yw44_15168_c1
3004 nmdc:mga0yw44_20149_c1
3005 nmdc:mga0yw44_202568_c1
3006 nmdc:mga0yw44_215952_c1
3007 nmdc:mga0yw44_28351_c1
3008 nmdc:mga0yw44_29821_c1
3009 nmdc:mga0yw44_32622_c1
3010 nmdc:mga0yw44_49130_c1
3011 nmdc:mga0k408_5224_c1
3012 nmdc:mga0k408_59721_c1
3013 nmdc:mga0k408_80127_c1
3014 nmdc:mga0k408_9852_c1
3015 nmdc:mga06z11_158494_c1
3016 nmdc:mga06z11_195578_c1
3017 nmdc:mga06z11_289298_c1
3018 nmdc:mga04h51_33437_c1
3019 nmdc:mga04h51_5335_c1
3020 nmdc:mga04h51_68922_c1
3021 nmdc:mga07m45_102179_c1
3022 nmdc:mga07m45_137511_c1
3023 nmdc:mga07m45_1929_c1
3024 nmdc:mga07m45_3911_c1
3025 nmdc:mga05p37_4837_c1
3026 nmdc:mga05p37_699874_c1
3027 nmdc:mga0qj67_214647_c1
3028 nmdc:mga06r32_231017_c1
3029 nmdc:mga08y16_157905_c1
3030 nmdc:mga08y16_300163_c1
3031 nmdc:mga08y16_417681_c1
3032 nmdc:mga08y16_440743_c1
3033 nmdc:mga08y16_511091_c1
3034 nmdc:mga0n895_537959_c1
3035 nmdc:mga0n895_556268_c1
3036 nmdc:mga0n895_72053_c1
3037 nmdc:mga0rr50_123263_c1
3038 nmdc:mga08x19_258482_c1
3039 nmdc:mga08x19_32130_c1
3040 nmdc:mga0a205_180274_c1
3041 nmdc:mga0a205_311906_c1
3042 nmdc:mga0a205_329637_c1
3043 nmdc:mga0sz30_45978_c1
3044 nmdc:mga0sz30_86912_c1
3045 nmdc:mga0sz30_94549_c1
3046 Ga0495601_0056249
3047 Ga0495601_0099669
3048 Ga0495601_0121479
3049 Ga0495601_0167874
3050 Ga0495601_0207292
3051 Ga0495601_0268820
3052 Ga0495612_0005170
3053 Ga0495612_0005994
3054 Ga0495612_0022238
3055 Ga0495612_0137893
3056 Ga0500635_0014749
3057 Ga0495595_0000267
3058 Ga0495595_0001389
3059 Ga0495595_0048915
3060 Ga0495619_0000434
3061 Ga0495619_0000491
3062 Ga0495619_0037925
3063 Ga0495619_0055342
3064 Ga0495619_0418464
3065 Ga0500643_000156
3066 Ga0500643_011270
3067 Ga0500643_032107
3068 Ga0500581_083803
3069 Ga0500646_0008643
3070 Ga0500647_0067702
3071 Ga0500651_0061060
3072 Ga0500651_0087129
3073 Ga0500651_0152455
3074 Ga0500651_0189508
3075 Ga0500566_0000091
3076 Ga0500566_0000990
3077 Ga0500566_0031382
3078 Ga0500566_0095435
3079 Ga0500566_0183280
3080 Ga0500640_139350
3081 Ga0500641_0014068
3082 Ga0500641_0034873
3083 Ga0500641_0068022
3084 Ga0500641_0151612
3085 Ga0500650_0001832
3086 Ga0500650_0172716
3087 Ga0500554_002104
3088 Ga0500555_000933
3089 Ga0500556_0000002
3090 Ga0500556_0000048
3091 Ga0500556_0004481
3092 Ga0500556_0122004
3093 Ga0500557_000024
3094 Ga0500562_012516
3095 Ga0500562_063985
3096 Ga0500562_071229
3097 Ga0500572_000309
3098 Ga0500572_021886
3099 Ga0500594_0023064
3100 Ga0500594_0025817
3101 Ga0500595_000698
3102 Ga0500595_002243
3103 Ga0500595_003813
3104 Ga0500595_006478
3105 Ga0500595_078728
3106 Ga0500607_030662
3107 Ga0500607_118822
3108 Ga0500608_000584
3109 Ga0500614_012060
3110 Ga0500642_0000093
3111 Ga0500642_0000107
3112 Ga0500642_0071711
3113 Ga0500652_000219
3114 Ga0500655_003619
3115 Ga0500655_008426
3116 Ga0500658_0038875
3117 Ga0500658_0152483
3118 Ga0500559_0000341
3119 Ga0500559_0001261
3120 Ga0500559_0058481
3121 Ga0500568_0000835
3122 Ga0500568_0001045
3123 Ga0500568_0005007
3124 Ga0500568_0020371
3125 Ga0500568_0047844
3126 Ga0500568_0068906
3127 Ga0500577_0000212
3128 Ga0500586_096995
3129 Ga0500589_059000
3130 Ga0500590_171896
3131 Ga0500603_031274
3132 Ga0500604_0007304
3133 Ga0500616_0000045
3134 Ga0500616_0000069
3135 Ga0500616_0051836
3136 Ga0500616_0101308
3137 Ga0500622_0001388
3138 Ga0500622_0015344
3139 Ga0500624_014333
3140 Ga0500627_0007562
3141 Ga0500627_0055077
3142 Ga0500627_0090051
3143 Ga0500627_0126335
3144 Ga0500634_0013070
3145 Ga0500634_0047748
3146 Ga0500634_0102260
3147 Ga0500634_0108303
3148 Ga0500638_000254
3149 Ga0500638_197403
3150 Ga0500636_0003270
3151 Ga0500636_0009247
3152 Ga0500636_0069854
3153 Ga0500636_0111330
3154 Ga0500636_0128535
3155 Ga0500636_0241309
3156 Ga0500637_0000216
3157 Ga0500637_0006416
3158 Ga0500637_0175014
3159 Ga0500576_054740
3160 Ga0500611_005568
3161 Ga0500611_021866
3162 Ga0500645_046945
3163 Ga0500645_077583
3164 Ga0500599_000719
3165 Ga0500601_000724
3166 Ga0501084_0001610
3167 Ga0501084_0062496
3168 Ga0501084_0151219
3169 Ga0500661_019441
3170 Ga0501082_0000084
3171 Ga0501082_0015760
3172 Ga0501082_0068493
3173 Ga0501082_0260001
3174 Ga0501082_0277094
3175 Ga0530510_0063518
3176 2507509238
3177 2508543307
3178 2508690944
3179 2509147412
3180 2511397211
3181 2513646771
3182 2513656784
3183 2513677825
3184 2513691937
3185 2513717246
3186 2513857973
3187 2513876592
3188 2513892807
3189 2513917969
3190 2515626656
3191 2517101891
3192 2517892985
3193 2524465192
3194 2528852246
3195 2599720702
3196 2603858934
3197 2643756320
3198 2644132141
3199 2671117610
3200 2723845668
3201 2728750442
3202 2793073026
3203 2793081777
3204 2805919847
3205 2818242850
3206 2824606036
3207 2824615975
3208 2824658878
3209 2824667765
3210 2824676155
3211 2824691828
3212 2824699443
3213 2824710419
3214 2824761129
3215 2824771181
3216 2824779335
3217 2837653779
3218 2841958093
3219 2844318476
3220 2847935366
3221 2847945974
3222 2857513691
3223 2857527959
3224 2874597363
3225 2874609710
3226 2874626732
3227 2874649304
3228 2876777840
3229 2876811821
3230 2876823139
3231 2879078597
3232 2879088559
3233 2879108058
3234 2879118417
3235 2879132926
3236 2879148725
3237 2883294375
3238 2885371909
3239 2885377401
3240 2885387649
3241 2888383436
3242 2888394501
3243 2888423823
3244 2889040474
3245 2893068376
3246 2903730159
3247 2903751990
3248 2903778328
3249 2904668310
3250 2904696335
3251 2904703152
3252 2904717271
3253 2906603544
3254 2906618021
3255 2906632451
3256 2906636048
3257 2906646302
3258 2906661508
3259 2908760882
3260 2909043908
3261 2919075360
3262 2922368355
3263 2922373619
3264 2922388196
3265 2922429518
3266 2928535341
3267 2929617354
3268 2929627059
3269 2932787610
3270 2932813209
3271 2932820876
3272 2932834757
3273 2933579311
3274 2935611874
3275 2935621716
3276 2935642666
3277 2935667768
3278 2935682258
3279 2935688513
3280 2935695863
3281 2935706608
3282 2935715532
3283 2935725904
3284 2935734351
3285 2935743730
3286 2935754233
3287 2935768407
3288 2935772647
3289 2935783197
3290 2935790940
3291 2935799359
3292 2935806425
3293 2935813017
3294 2935821354
3295 2935830669
3296 2935840698
3297 2935850387
3298 2935859963
3299 2935869402
3300 2935880437
3301 2935914003
3302 2935921145
3303 2935931809
3304 2935940256
3305 2935947919
3306 2935956540
3307 2935960349
3308 2935973334
3309 2935977585
3310 2935989495
3311 2935999491
3312 2936006526
3313 2936041605
3314 2937846136
3315 2940560391
3316 2941510505
3317 2941517757
3318 2941525774
3319 2941534225
3320 2941541172
3321 3005479675
3322 3005714248
3323 8006929340
3324 8006967303
3325 8006990210
3326 8006997541
3327 8016514064
3328 8016530249
3329 8016535508
3330 8016548703
3331 8016553431
3332 8016561807
3333 8016577964
3334 8016599642
3335 8016622429
3336 8016627356
3337 8016631658
3338 8017062347
3339 8019535240
3340 8019544242
3341 8019554460
3342 8019557347
3343 8019567952
3344 8019581802
3345 8019589476
3346 8019616762
3347 8019627453
3348 8019635121
3349 8019644607
3350 8019657628
3351 8019662963
3352 8019672562
3353 8019683596
3354 8019689340
3355 8055747031
3356 8056674415
3357 8056683323
3358 8056690093

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00121

TIM

Triosephosphate isomerase

7

246

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
3kxq-assembly1.cif.gz_A crystal structure of triosephosphate isomerase from bartonella henselae at 1.6a resolution 0.9819 5 249
4nvt-assembly2.cif.gz_B crystal structure of triosephosphate isomerase from brucella melitensis 0.9816 5 249
3kxq-assembly1.cif.gz_B crystal structure of triosephosphate isomerase from bartonella henselae at 1.6a resolution 0.9795 5 249
4nvt-assembly2.cif.gz_C crystal structure of triosephosphate isomerase from brucella melitensis 0.9781 5 249
4nvt-assembly2.cif.gz_B crystal structure of triosephosphate isomerase from brucella melitensis 0.966 5 249
ID Description Score Start End Superfamily
4nvtA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9805 5 249 3.20.20.70
4nvtA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9611 5 249 3.20.20.70
6bveB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9494 4 251 3.20.20.70
af_P0A858_1_255_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9484 6 249 3.20.20.70
4g1kC00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9458 4 251 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A1X3GA60-F1-model_v4 Triosephosphate isomerase (TIM) (TPI) (EC 5.3.1.1) (Triose-phosphate isomerase) 0.9953 1 251 GO:0004807
GO:0005829
GO:0006094
GO:0006096
GO:0019563
GO:0046166
AF-A0A2M6UJ64-F1-model_v4 Triosephosphate isomerase (TIM) (TPI) (EC 5.3.1.1) (Triose-phosphate isomerase) 0.9943 1 251 GO:0004807
GO:0005829
GO:0006094
GO:0006096
GO:0019563
GO:0046166
AF-K0VYF7-F1-model_v4 Triosephosphate isomerase (EC 5.3.1.1) 0.9916 63 249 GO:0004807
GO:0005829
GO:0006094
GO:0006096
GO:0019563
GO:0046166
AF-A0A1X3GA60-F1-model_v4 Triosephosphate isomerase (TIM) (TPI) (EC 5.3.1.1) (Triose-phosphate isomerase) 0.9914 1 251 GO:0004807
GO:0005829
GO:0006094
GO:0006096
GO:0019563
GO:0046166
AF-A0A435EAS4-F1-model_v4 deleted 0.9887 46 249

Map