F495238

General Info

Members Datasets Scaffolds Average Seq Length
1659 556 1568 291

Family's Representative Sequence

Representative Sequence 3300039450|Ga0436363_0985963|Ga0436363_0985963_731_1687
Length 318
Sequence MTSKDGRNAEIVLLAEKRKQMAESVDVDDLRRRLLGAGYVADAGLATALACAVSLERAVLLEGDAGVGKTDAARALASVFGATLLRLQCYEGLDLAAAAYDWNYGKQLLAIRAAEAVHDRAPDLYADEFLIRRPLLAALGATQARRIVLLIDEIDRADDEFEAFLLEFLSDFAISIPERGTVAAVHPPIVVLTSNRTRDLHDALKRRCFYHWIGHPSVEREIEILRLHLPDVEPALARDVARAAAALRTRDLRKVPGIAESLDWAQTLQLLGAQRLGEDVFDTSLGSVLKYPEDIELVRASAAAIVSTVRADDAAPSP

Samples

Sample ID Description Type Environment
1 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
2 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
3 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
4 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
5 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
6 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
7 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
8 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
9 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
10 2738543024 Aminobacter sp. AP02 Isolate Unclassified
11 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
12 2791355199
13 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
14 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
15 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
16 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
17 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
18 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
19 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
20 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
21 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
22 2876377896 Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 Isolate Nodule
23 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
24 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
25 2883291878 Hypericibacter terrae R5913 Isolate Rhizosphere
26 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
27 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
28 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
29 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
30 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
31 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
32 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
33 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
34 2904699407
35 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
36 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
37 2917554339 Chthonobacter rhizosphaerae yh7-1 Isolate Rhizosphere
38 2922368715
39 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
40 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
41 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
42 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
43 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
44 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
45 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
46 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
47 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
48 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
49 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
50 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
51 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
52 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
53 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
54 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
55 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
56 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
57 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
58 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
59 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
60 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
61 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
62 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
63 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
64 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
65 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
66 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
67 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
68 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
69 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
70 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
71 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
72 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
73 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
74 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
75 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
76 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
77 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
78 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
79 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
80 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
81 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
82 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
83 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
84 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
85 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
86 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
87 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
88 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
89 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
90 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
91 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
92 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
93 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
94 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
95 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
96 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
97 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
98 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
99 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
100 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
101 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
102 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
103 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
104 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
105 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
106 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
107 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
108 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
109 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
110 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
111 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
112 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
113 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
114 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
115 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
116 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
117 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
118 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
119 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
120 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
121 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
122 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
123 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
124 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
125 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
126 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
127 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
128 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
129 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
130 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
131 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
132 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
133 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
134 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
135 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
136 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
137 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
138 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
139 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
140 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
141 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
142 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
143 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
144 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
145 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
146 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
147 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
148 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
149 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
150 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
151 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
152 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
153 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
154 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
155 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
156 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
157 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
158 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
159 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
160 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
161 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
162 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
163 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
164 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
165 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
166 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
167 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
168 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
169 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
170 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
171 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
172 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
173 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
174 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
175 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
176 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
177 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
178 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
179 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
180 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
181 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
182 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
183 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
184 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
185 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
186 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
187 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
188 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
189 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
190 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
191 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
192 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
193 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
194 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
195 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
196 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
197 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
198 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
199 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
200 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
201 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
202 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
203 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
204 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
205 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
206 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
207 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
208 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
209 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
210 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
211 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
212 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
213 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
214 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
215 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
216 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
217 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
218 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
219 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
220 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
221 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
222 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
223 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
224 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
241 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
242 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
243 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
244 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
245 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
246 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
247 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
248 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
249 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
250 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
251 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
252 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
253 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
254 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
255 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
256 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
257 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
258 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
259 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
260 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
261 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
262 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
263 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
264 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
265 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
266 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
267 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
268 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
269 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
270 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
271 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
272 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
273 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
274 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
275 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
276 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
277 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
278 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
279 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
280 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
281 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
282 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
283 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
284 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
285 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
286 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
287 3300028023 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 Metagenome Rhizosphere
288 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
289 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
290 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
291 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
292 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
293 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
294 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
295 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
296 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
297 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
298 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
299 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
300 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
301 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
302 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
303 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
304 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
305 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
306 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
307 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
308 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
309 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
310 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
311 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
312 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
313 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
314 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
315 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
316 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
317 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
318 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
319 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
320 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
321 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
322 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
323 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
324 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
325 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
326 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
327 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
328 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
329 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
330 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
331 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
332 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
333 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
334 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
335 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
336 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
337 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
338 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
339 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
340 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
341 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
342 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
343 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
344 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
345 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
346 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
347 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
348 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
349 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
350 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
351 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
352 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
353 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
354 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
355 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
356 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
357 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
358 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
359 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
360 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
361 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
362 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
363 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
364 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
365 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
366 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
367 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
368 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
369 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
370 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
371 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
372 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
373 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
374 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
375 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
376 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
377 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
378 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
379 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
380 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
381 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
382 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
383 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
384 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
385 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
386 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
387 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
388 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
389 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
390 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
391 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
392 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
393 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
394 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
395 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
396 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
397 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
398 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
399 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
400 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
401 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
402 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
403 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
404 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
405 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
406 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
407 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
408 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
409 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
410 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
411 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
412 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
413 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
414 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
415 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
416 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
417 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
418 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
419 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
420 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
421 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
422 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
423 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
424 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
425 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
426 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
427 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
428 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
429 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
430 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
431 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
432 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
433 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
434 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
435 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
436 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
437 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
438 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
439 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
440 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
441 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
442 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
443 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
444 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
445 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
446 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
447 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
448 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
449 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
450 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
451 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
452 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
453 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
454 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
455 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
456 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
457 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
458 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
459 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
460 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
461 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
462 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
463 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
464 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
465 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
466 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
467 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
468 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
469 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
470 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
471 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
472 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
473 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
474 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
475 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
476 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
477 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
478 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
479 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
480 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
481 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
482 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
483 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
484 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
485 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
486 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
487 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
488 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
489 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
490 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
491 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
492 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
493 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
494 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
495 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
496 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
497 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
498 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
499 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
500 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
501 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
502 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
503 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
504 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
505 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
506 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
507 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
508 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
509 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
510 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
511 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
512 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
513 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
514 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
515 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
516 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
517 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
518 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
519 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
520 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
521 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
522 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
523 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
524 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
525 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
526 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
527 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
528 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
529 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
530 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
531 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
532 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
533 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
534 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
535 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
536 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
537 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
538 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
539 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
540 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
541 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
542 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
543 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
544 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
545 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
546 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
547 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
548 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
549 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
550 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
551 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
552 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
553 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
554 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
555 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule
556 8057575449 Rhizobium mayense CCGE526 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 94.44
Metatranscriptomes 0.24
Isolates 5.31

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.42
Nodule 3.68
Rhizoplane 7.66
Rhizosphere 76.55
Stem 0
Stem Tuber 0
Unclassified 6.69

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24744J21845_10028950 3300002077 Bacteria 1066
2 JGI24742J22300_10026243 3300002244 Bacteria 1008
3 JGI25406J46586_10006913 3300003203 Bacteria 5207
4 JGI25404J52841_10006038 3300003659 Bacteria 2520
5 JGI25404J52841_10009246 3300003659 Bacteria 2106
6 JGI25404J52841_10010659 3300003659 Unclassified 1976
7 JGI25404J52841_10013873 3300003659 Bacteria 1748
8 JGI25404J52841_10023519 3300003659 Bacteria 1329
9 JGI25404J52841_10040163 3300003659 Bacteria 990
10 JGI25405J52794_10008242 3300003911 Bacteria 1942
11 Ga0065165_1002212 3300005262 Bacteria 17380
12 Ga0065715_10067341 3300005293 Bacteria 1026
13 Ga0070683_100077937 3300005329 Bacteria 3100
14 Ga0070683_100079617 3300005329 Bacteria 3066
15 Ga0070690_100134299 3300005330 Bacteria 1674
16 Ga0070670_100101876 3300005331 Bacteria 2472
17 Ga0070670_100321506 3300005331 Bacteria 1356
18 Ga0070670_100498547 3300005331 Bacteria 1082
19 Ga0068869_100189293 3300005334 Bacteria 1617
20 Ga0068869_100422914 3300005334 Bacteria 1099
21 Ga0070666_10014526 3300005335 Bacteria 5015
22 Ga0070680_100002387 3300005336 Bacteria 13899
23 Ga0070680_100008875 3300005336 Bacteria 7706
24 Ga0070680_100313883 3300005336 Bacteria 1330
25 Ga0070682_100186328 3300005337 Bacteria 1454
26 Ga0070682_100386906 3300005337 Bacteria 1054
27 Ga0068868_100046913 3300005338 Bacteria 3382
28 Ga0068868_100054926 3300005338 Bacteria 3141
29 Ga0068868_100240067 3300005338 Bacteria 1522
30 Ga0070660_100146491 3300005339 Bacteria 1897
31 Ga0070660_100395861 3300005339 Bacteria 1141
32 Ga0070689_100040447 3300005340 Bacteria 3575
33 Ga0070689_100092897 3300005340 Bacteria 2381
34 Ga0070689_100122141 3300005340 Bacteria 2081
35 Ga0070689_100380273 3300005340 Bacteria 1190
36 Ga0070689_100399150 3300005340 Bacteria 1162
37 Ga0070691_10004562 3300005341 Bacteria 6291
38 Ga0070691_10021948 3300005341 Bacteria 2958
39 Ga0070661_100042539 3300005344 Bacteria 3316
40 Ga0070692_10056400 3300005345 Bacteria 2057
41 Ga0070668_100043086 3300005347 Bacteria 3461
42 Ga0070668_100099844 3300005347 Bacteria 2299
43 Ga0070668_100114349 3300005347 Bacteria 2150
44 Ga0070668_100275915 3300005347 Bacteria 1403
45 Ga0070669_100077618 3300005353 Bacteria 2468
46 Ga0070669_100144241 3300005353 Bacteria 1839
47 Ga0070669_100153719 3300005353 Bacteria 1783
48 Ga0070669_100395455 3300005353 Bacteria 1130
49 Ga0070675_100068056 3300005354 Bacteria 2948
50 Ga0070675_100099709 3300005354 Bacteria 2445
51 Ga0070675_100172344 3300005354 Bacteria 1867
52 Ga0070671_100018411 3300005355 Bacteria 5672
53 Ga0070671_100026397 3300005355 Bacteria 4772
54 Ga0070671_100046054 3300005355 Bacteria 3626
55 Ga0070671_100047574 3300005355 Bacteria 3566
56 Ga0070674_100044758 3300005356 Bacteria 3020
57 Ga0070673_100040843 3300005364 Bacteria 3562
58 Ga0070673_100325562 3300005364 Bacteria 1358
59 Ga0070688_100017531 3300005365 Bacteria 4112
60 Ga0070688_100343462 3300005365 Bacteria 1091
61 Ga0070667_100365844 3300005367 Bacteria 1308
62 Ga0070703_10013169 3300005406 Bacteria 2346
63 Ga0070709_10001107 3300005434 Bacteria 14866
64 Ga0070709_10001190 3300005434 Bacteria 14311
65 Ga0070709_10011552 3300005434 Bacteria 4925
66 Ga0070709_10220365 3300005434 Bacteria 1353
67 Ga0070714_100007037 3300005435 Bacteria 8719
68 Ga0070714_100018431 3300005435 Bacteria 5670
69 Ga0070714_100031504 3300005435 Bacteria 4425
70 Ga0070714_100038045 3300005435 Bacteria 4046
71 Ga0070714_100423236 3300005435 Bacteria 1262
72 Ga0070713_100006481 3300005436 Bacteria 8119
73 Ga0070713_100006665 3300005436 Bacteria 8035
74 Ga0070713_100020309 3300005436 Bacteria 5090
75 Ga0070713_100030054 3300005436 Bacteria 4310
76 Ga0070713_100036360 3300005436 Bacteria 3973
77 Ga0070713_100040690 3300005436 Bacteria 3780
78 Ga0070713_100045828 3300005436 Bacteria 3585
79 Ga0070713_100315435 3300005436 Bacteria 1443
80 Ga0070713_100426136 3300005436 Bacteria 1243
81 Ga0070710_10001782 3300005437 Bacteria 10188
82 Ga0070710_10008606 3300005437 Bacteria 4970
83 Ga0070710_10182842 3300005437 Bacteria 1314
84 Ga0070711_100028466 3300005439 Bacteria 3678
85 Ga0070711_100067363 3300005439 Bacteria 2511
86 Ga0070711_100111956 3300005439 Bacteria 2005
87 Ga0070711_100133385 3300005439 Bacteria 1852
88 Ga0070711_100165926 3300005439 Bacteria 1678
89 Ga0070711_100193063 3300005439 Bacteria 1566
90 Ga0070711_100226822 3300005439 Bacteria 1455
91 Ga0070711_100427723 3300005439 Bacteria 1080
92 Ga0070705_100001178 3300005440 Bacteria 14306
93 Ga0070705_100213462 3300005440 Bacteria 1332
94 Ga0070700_100036945 3300005441 Bacteria 2967
95 Ga0070700_100133208 3300005441 Bacteria 1680
96 Ga0070694_100002039 3300005444 Bacteria 11988
97 Ga0070708_100345006 3300005445 Bacteria 1403
98 Ga0070663_100029050 3300005455 Bacteria 3772
99 Ga0070663_100049849 3300005455 Bacteria 2976
100 Ga0070663_100091518 3300005455 Bacteria 2254
101 Ga0070663_100096946 3300005455 Bacteria 2194
102 Ga0070663_100208689 3300005455 Bacteria 1528
103 Ga0070678_100006358 3300005456 Bacteria 6931
104 Ga0070678_100025181 3300005456 Bacteria 3998
105 Ga0070662_100014882 3300005457 Bacteria 5202
106 Ga0070662_100279391 3300005457 Bacteria 1351
107 Ga0070681_10028980 3300005458 Bacteria 5560
108 Ga0070681_10069392 3300005458 Bacteria 3491
109 Ga0070681_10077104 3300005458 Bacteria 3291
110 Ga0070681_10078659 3300005458 Bacteria 3254
111 Ga0070681_10358733 3300005458 Bacteria 1368
112 Ga0070681_10521681 3300005458 Bacteria 1101
113 Ga0068867_100016601 3300005459 Bacteria 5228
114 Ga0068867_100081408 3300005459 Bacteria 2441
115 Ga0068867_100121570 3300005459 Bacteria 2019
116 Ga0070685_10024915 3300005466 Bacteria 3290
117 Ga0070706_100119281 3300005467 Bacteria 2458
118 Ga0070706_100162988 3300005467 Bacteria 2082
119 Ga0070706_100217469 3300005467 Bacteria 1784
120 Ga0070698_100035867 3300005471 Bacteria 5126
121 Ga0070699_100002351 3300005518 Bacteria 16987
122 Ga0070699_100002421 3300005518 Bacteria 16748
123 Ga0070679_100374278 3300005530 Bacteria 1371
124 Ga0070679_100385856 3300005530 Bacteria 1347
125 Ga0070684_100019618 3300005535 Bacteria 5595
126 Ga0070684_100026386 3300005535 Bacteria 4893
127 Ga0070684_100086984 3300005535 Bacteria 2774
128 Ga0070697_100028213 3300005536 Bacteria 4494
129 Ga0070697_100089478 3300005536 Bacteria 2543
130 Ga0070697_100211930 3300005536 Bacteria 1649
131 Ga0068853_100030114 3300005539 Bacteria 4582
132 Ga0070686_100235422 3300005544 Bacteria 1330
133 Ga0070695_100001069 3300005545 Bacteria 14975
134 Ga0070695_100002352 3300005545 Bacteria 10843
135 Ga0070695_100453832 3300005545 Bacteria 983
136 Ga0070696_100000904 3300005546 Bacteria 19271
137 Ga0070696_100101258 3300005546 Bacteria 2064
138 Ga0070693_100180406 3300005547 Bacteria 1359
139 Ga0070665_100025774 3300005548 Bacteria 5923
140 Ga0070665_100028015 3300005548 Bacteria 5675
141 Ga0070665_100063637 3300005548 Bacteria 3699
142 Ga0070665_100084650 3300005548 Bacteria 3176
143 Ga0070665_100091697 3300005548 Bacteria 3043
144 Ga0070665_100092135 3300005548 Bacteria 3035
145 Ga0070665_100120566 3300005548 Bacteria 2624
146 Ga0070665_100181512 3300005548 Bacteria 2105
147 Ga0070665_100189682 3300005548 Bacteria 2056
148 Ga0070704_100013643 3300005549 Bacteria 5052
149 Ga0068855_100078606 3300005563 Bacteria 3827
150 Ga0068855_100147620 3300005563 Bacteria 2676
151 Ga0068855_100444395 3300005563 Bacteria 1416
152 Ga0070664_100098086 3300005564 Bacteria 2545
153 Ga0070664_100216192 3300005564 Bacteria 1714
154 Ga0070664_100281910 3300005564 Bacteria 1499
155 Ga0068857_100020859 3300005577 Bacteria 5764
156 Ga0068857_100026434 3300005577 Bacteria 5116
157 Ga0068857_100359814 3300005577 Bacteria 1349
158 Ga0068854_100451225 3300005578 Bacteria 1074
159 Ga0070702_100016060 3300005615 Bacteria 3835
160 Ga0070702_100042973 3300005615 Bacteria 2544
161 Ga0068852_100084171 3300005616 Bacteria 2830
162 Ga0068852_100109302 3300005616 Bacteria 2511
163 Ga0068859_100010100 3300005617 Bacteria 9513
164 Ga0068859_100329691 3300005617 Bacteria 1620
165 Ga0068859_100562279 3300005617 Bacteria 1235
166 Ga0068864_100098231 3300005618 Bacteria 2593
167 Ga0068864_100175018 3300005618 Bacteria 1959
168 Ga0068864_100192783 3300005618 Bacteria 1869
169 Ga0068866_10107406 3300005718 Bacteria 1551
170 Ga0068861_100078426 3300005719 Bacteria 2579
171 Ga0068861_100185090 3300005719 Bacteria 1736
172 Ga0068851_10142837 3300005834 Bacteria 1303
173 Ga0068863_100097041 3300005841 Bacteria 2798
174 Ga0068863_100139683 3300005841 Bacteria 2315
175 Ga0068863_100152554 3300005841 Bacteria 2211
176 Ga0068863_100275226 3300005841 Bacteria 1630
177 Ga0068863_100761100 3300005841 Bacteria 965
178 Ga0068858_100047793 3300005842 Bacteria 3966
179 Ga0068858_100083398 3300005842 Bacteria 2972
180 Ga0068858_100656091 3300005842 Bacteria 1020
181 Ga0068860_100001648 3300005843 Bacteria 23877
182 Ga0068860_100005313 3300005843 Bacteria 13076
183 Ga0068860_100047304 3300005843 Bacteria 4100
184 Ga0068860_100184631 3300005843 Bacteria 2016
185 Ga0068860_100221060 3300005843 Bacteria 1839
186 Ga0068862_100003877 3300005844 Bacteria 12726
187 Ga0068862_100224320 3300005844 Bacteria 1702
188 Ga0081455_10010152 3300005937 Bacteria 9592
189 Ga0081455_10014384 3300005937 Bacteria 7764
190 Ga0081455_10015293 3300005937 Bacteria 7462
191 Ga0081455_10018759 3300005937 Bacteria 6566
192 Ga0081455_10033485 3300005937 Bacteria 4617
193 Ga0081455_10045589 3300005937 Bacteria 3814
194 Ga0081455_10168088 3300005937 Bacteria 1674
195 Ga0081455_10201116 3300005937 Bacteria 1492
196 Ga0081455_10395835 3300005937 Bacteria 960
197 Ga0081538_10039013 3300005981 Bacteria 3052
198 Ga0081538_10050047 3300005981 Bacteria 2528
199 Ga0081540_1000099 3300005983 Bacteria 91686
200 Ga0081540_1000439 3300005983 Bacteria 41151
201 Ga0081540_1002134 3300005983 Bacteria 16458
202 Ga0081540_1006679 3300005983 Bacteria 8346
203 Ga0081540_1006760 3300005983 Bacteria 8292
204 Ga0081540_1007315 3300005983 Bacteria 7896
205 Ga0081540_1014061 3300005983 Bacteria 5157
206 Ga0081540_1019482 3300005983 Bacteria 4119
207 Ga0081540_1021005 3300005983 Bacteria 3906
208 Ga0081540_1041618 3300005983 Bacteria 2380
209 Ga0081540_1048258 3300005983 Bacteria 2134
210 Ga0081540_1055168 3300005983 Bacteria 1937
211 Ga0081540_1056140 3300005983 Bacteria 1914
212 Ga0081540_1056927 3300005983 Bacteria 1894
213 Ga0081540_1059056 3300005983 Bacteria 1844
214 Ga0081540_1076376 3300005983 Bacteria 1527
215 Ga0081540_1101944 3300005983 Bacteria 1234
216 Ga0081539_10004774 3300005985 Bacteria 14620
217 Ga0081539_10120320 3300005985 Bacteria 1305
218 Ga0070717_10000716 3300006028 Bacteria 21542
219 Ga0070717_10001486 3300006028 Bacteria 16226
220 Ga0070717_10010234 3300006028 Bacteria 7067
221 Ga0070717_10016760 3300006028 Bacteria 5687
222 Ga0070717_10104266 3300006028 Bacteria 2412
223 Ga0070717_10596851 3300006028 Bacteria 1001
224 Ga0075365_10053793 3300006038 Bacteria 2667
225 Ga0075365_10071632 3300006038 Bacteria 2334
226 Ga0075365_10074908 3300006038 Bacteria 2283
227 Ga0075363_100007902 3300006048 Bacteria 4924
228 Ga0075363_100139405 3300006048 Bacteria 1364
229 Ga0075364_10152646 3300006051 Bacteria 1557
230 Ga0075432_10006290 3300006058 Bacteria 4036
231 Ga0070715_10001917 3300006163 Bacteria 6257
232 Ga0070715_10021949 3300006163 Bacteria 2483
233 Ga0070715_10063554 3300006163 Bacteria 1627
234 Ga0070716_100001746 3300006173 Bacteria 9816
235 Ga0070716_100013222 3300006173 Bacteria 4203
236 Ga0070716_100016254 3300006173 Bacteria 3835
237 Ga0070716_100180112 3300006173 Bacteria 1387
238 Ga0070716_100182933 3300006173 Bacteria 1378
239 Ga0070712_100006624 3300006175 Bacteria 7198
240 Ga0070712_100018711 3300006175 Bacteria 4504
241 Ga0070712_100028909 3300006175 Bacteria 3712
242 Ga0070712_100048244 3300006175 Bacteria 2951
243 Ga0070712_100060755 3300006175 Bacteria 2667
244 Ga0070712_100109396 3300006175 Bacteria 2060
245 Ga0070712_100214012 3300006175 Bacteria 1521
246 Ga0075362_10025069 3300006177 Bacteria 2535
247 Ga0075362_10079503 3300006177 Bacteria 1510
248 Ga0075367_10008644 3300006178 Bacteria 5283
249 Ga0075367_10158107 3300006178 Bacteria 1409
250 Ga0075369_10026101 3300006186 Bacteria 2433
251 Ga0097621_100031404 3300006237 Bacteria 4215
252 Ga0097621_100097759 3300006237 Bacteria 2465
253 Ga0097621_100101102 3300006237 Bacteria 2426
254 Ga0068871_100070746 3300006358 Bacteria 2868
255 Ga0068871_100074844 3300006358 Bacteria 2794
256 Ga0068871_100507413 3300006358 Bacteria 1088
257 Ga0075428_100024342 3300006844 Bacteria 6698
258 Ga0075428_100026550 3300006844 Bacteria 6410
259 Ga0075428_100029409 3300006844 Bacteria 6079
260 Ga0075428_100071671 3300006844 Bacteria 3787
261 Ga0075428_100099359 3300006844 Bacteria 3173
262 Ga0075428_100214644 3300006844 Bacteria 2079
263 Ga0075428_100302649 3300006844 Bacteria 1719
264 Ga0075430_100000545 3300006846 Bacteria 28557
265 Ga0075430_100009092 3300006846 Bacteria 8394
266 Ga0075430_100045141 3300006846 Bacteria 3724
267 Ga0075430_100063402 3300006846 Bacteria 3104
268 Ga0075431_100001204 3300006847 Bacteria 23367
269 Ga0075431_100006331 3300006847 Bacteria 11759
270 Ga0075431_100030443 3300006847 Bacteria 5559
271 Ga0075431_100120799 3300006847 Bacteria 2703
272 Ga0075433_10001094 3300006852 Bacteria 19553
273 Ga0075433_10346986 3300006852 Bacteria 1312
274 Ga0075434_100007552 3300006871 Bacteria 10072
275 Ga0075434_100036695 3300006871 Bacteria 4849
276 Ga0075434_100307196 3300006871 Bacteria 1606
277 Ga0075434_100332235 3300006871 Bacteria 1540
278 Ga0075429_100000060 3300006880 Bacteria 53026
279 Ga0075429_100007094 3300006880 Bacteria 9731
280 Ga0075429_100249672 3300006880 Bacteria 1554
281 Ga0075429_100453415 3300006880 Bacteria 1124
282 Ga0068865_100029469 3300006881 Bacteria 3642
283 Ga0068865_100194860 3300006881 Bacteria 1569
284 Ga0075436_100011021 3300006914 Bacteria 6204
285 Ga0075436_100125725 3300006914 Bacteria 1796
286 Ga0075436_100250904 3300006914 Bacteria 1260
287 Ga0097620_100010100 3300006931 Bacteria 9513
288 Ga0097620_100329683 3300006931 Bacteria 1620
289 Ga0097620_100562333 3300006931 Bacteria 1235
290 Ga0075435_100013192 3300007076 Bacteria 6140
291 Ga0075435_100037354 3300007076 Bacteria 3867
292 Ga0075435_100039490 3300007076 Bacteria 3767
293 Ga0075435_100046304 3300007076 Bacteria 3488
294 Ga0075435_100149568 3300007076 Bacteria 1962
295 Ga0075435_100362339 3300007076 Bacteria 1244
296 Ga0099794_10017538 3300007265 Bacteria 3193
297 Ga0099794_10165188 3300007265 Bacteria 1127
298 Ga0105250_10042938 3300009092 Bacteria 1812
299 Ga0105240_10084004 3300009093 Bacteria 3905
300 Ga0105240_10120765 3300009093 Bacteria 3155
301 Ga0105240_10198305 3300009093 Bacteria 2354
302 Ga0105240_10226329 3300009093 Bacteria 2176
303 Ga0105240_10451598 3300009093 Bacteria 1438
304 Ga0111539_10001967 3300009094 Bacteria 27436
305 Ga0111539_10002950 3300009094 Bacteria 22577
306 Ga0111539_10037843 3300009094 Bacteria 5821
307 Ga0111539_10061372 3300009094 Bacteria 4454
308 Ga0111539_10093964 3300009094 Bacteria 3523
309 Ga0111539_10201726 3300009094 Bacteria 2319
310 Ga0111539_10353449 3300009094 Bacteria 1710
311 Ga0105245_10034851 3300009098 Bacteria 4465
312 Ga0105245_10039646 3300009098 Bacteria 4193
313 Ga0105245_10083141 3300009098 Bacteria 2930
314 Ga0105245_10087805 3300009098 Bacteria 2855
315 Ga0105245_10100413 3300009098 Bacteria 2676
316 Ga0105245_10245477 3300009098 Bacteria 1738
317 Ga0105245_10578883 3300009098 Bacteria 1147
318 Ga0105247_10008161 3300009101 Bacteria 6395
319 Ga0105247_10058347 3300009101 Bacteria 2388
320 Ga0105247_10103109 3300009101 Bacteria 1826
321 Ga0105247_10181066 3300009101 Bacteria 1406
322 Ga0105247_10197791 3300009101 Bacteria 1349
323 Ga0105247_10391573 3300009101 Bacteria 988
324 Ga0114129_10002096 3300009147 Bacteria 27434
325 Ga0114129_10010577 3300009147 Bacteria 13155
326 Ga0114129_10038551 3300009147 Bacteria 6739
327 Ga0114129_10048312 3300009147 Bacteria 5979
328 Ga0114129_10087092 3300009147 Bacteria 4332
329 Ga0114129_10092140 3300009147 Bacteria 4199
330 Ga0114129_10119530 3300009147 Bacteria 3629
331 Ga0114129_10148949 3300009147 Bacteria 3203
332 Ga0114129_10287324 3300009147 Bacteria 2196
333 Ga0114129_10439943 3300009147 Bacteria 1712
334 Ga0114129_11199642 3300009147 Bacteria 945
335 Ga0105243_10065654 3300009148 Bacteria 2916
336 Ga0105243_10151050 3300009148 Bacteria 1993
337 Ga0105243_10693252 3300009148 Bacteria 992
338 Ga0105241_10045672 3300009174 Bacteria 3325
339 Ga0105241_10077945 3300009174 Bacteria 2588
340 Ga0105241_10091369 3300009174 Bacteria 2402
341 Ga0105241_10160193 3300009174 Bacteria 1849
342 Ga0105241_10220417 3300009174 Bacteria 1594
343 Ga0105242_10009244 3300009176 Bacteria 7563
344 Ga0105242_10012738 3300009176 Bacteria 6476
345 Ga0105242_10130030 3300009176 Bacteria 2172
346 Ga0105248_10076298 3300009177 Bacteria 3767
347 Ga0105248_10099014 3300009177 Bacteria 3285
348 Ga0105248_10120209 3300009177 Bacteria 2963
349 Ga0105248_10512442 3300009177 Bacteria 1353
350 Ga0105237_10001334 3300009545 Bacteria 32733
351 Ga0105237_10029474 3300009545 Bacteria 5579
352 Ga0105237_10039007 3300009545 Bacteria 4796
353 Ga0105237_10167796 3300009545 Bacteria 2194
354 Ga0105237_10291704 3300009545 Bacteria 1634
355 Ga0105237_10364318 3300009545 Bacteria 1450
356 Ga0105238_10018857 3300009551 Bacteria 7023
357 Ga0105238_10029584 3300009551 Bacteria 5579
358 Ga0105238_10074721 3300009551 Bacteria 3382
359 Ga0105238_10429705 3300009551 Bacteria 1316
360 Ga0105238_10436033 3300009551 Bacteria 1306
361 Ga0105249_10002492 3300009553 Bacteria 15954
362 Ga0105249_10249831 3300009553 Bacteria 1758
363 Ga0105249_10268799 3300009553 Bacteria 1698
364 Ga0105249_10272211 3300009553 Bacteria 1687
365 Ga0099796_10056148 3300010159 Bacteria 1381
366 Ga0099796_10071151 3300010159 Bacteria 1256
367 Ga0105239_10050181 3300010375 Bacteria 4577
368 Ga0105239_10067319 3300010375 Bacteria 3934
369 Ga0105239_10074953 3300010375 Bacteria 3720
370 Ga0105239_10128998 3300010375 Bacteria 2811
371 Ga0105239_10227048 3300010375 Bacteria 2095
372 Ga0105239_10334965 3300010375 Bacteria 1707
373 Ga0105239_10534696 3300010375 Bacteria 1334
374 Ga0105239_10833802 3300010375 Bacteria 1057
375 Ga0105246_10010656 3300011119 Bacteria 5693
376 Ga0105246_10069972 3300011119 Bacteria 2466
377 Ga0105246_10072514 3300011119 Bacteria 2428
378 Ga0105246_10203154 3300011119 Bacteria 1542
379 Ga0157373_10246102 3300013100 Bacteria 1264
380 Ga0157370_10090104 3300013104 Bacteria 2880
381 Ga0157369_10015777 3300013105 Bacteria 8513
382 Ga0157369_10493497 3300013105 Bacteria 1267
383 Ga0157374_10297987 3300013296 Bacteria 1595
384 Ga0157374_10379432 3300013296 Bacteria 1408
385 Ga0157374_10550822 3300013296 Bacteria 1161
386 Ga0157378_10035910 3300013297 Bacteria 4386
387 Ga0157378_10081083 3300013297 Bacteria 2932
388 Ga0157378_10408274 3300013297 Bacteria 1340
389 Ga0163162_10052221 3300013306 Bacteria 4105
390 Ga0163162_10161498 3300013306 Bacteria 2362
391 Ga0163162_10169824 3300013306 Bacteria 2306
392 Ga0163162_10623683 3300013306 Bacteria 1203
393 Ga0157375_10018359 3300013308 Bacteria 6342
394 Ga0157375_10031765 3300013308 Bacteria 4998
395 Ga0157375_10062186 3300013308 Bacteria 3709
396 Ga0157375_10147670 3300013308 Bacteria 2483
397 Ga0157375_10294960 3300013308 Bacteria 1784
398 Ga0163163_10030168 3300014325 Bacteria 5221
399 Ga0163163_10033361 3300014325 Bacteria 4979
400 Ga0163163_10044632 3300014325 Bacteria 4349
401 Ga0163163_10068097 3300014325 Bacteria 3541
402 Ga0163163_10099668 3300014325 Bacteria 2927
403 Ga0163163_10174962 3300014325 Bacteria 2193
404 Ga0163163_10189779 3300014325 Bacteria 2103
405 Ga0157380_10101789 3300014326 Bacteria 2394
406 Ga0157380_10456982 3300014326 Bacteria 1228
407 Ga0157377_10155719 3300014745 Bacteria 1417
408 Ga0157379_10013466 3300014968 Bacteria 7166
409 Ga0157379_10019591 3300014968 Bacteria 5977
410 Ga0157379_10038470 3300014968 Bacteria 4268
411 Ga0157379_10117733 3300014968 Bacteria 2390
412 Ga0157379_10169935 3300014968 Bacteria 1968
413 Ga0157376_10064418 3300014969 Bacteria 3091
414 Ga0157376_10160051 3300014969 Bacteria 2040
415 Ga0157376_10180347 3300014969 Bacteria 1930
416 Ga0163161_10021302 3300017792 Bacteria 4557
417 Ga0163161_10247286 3300017792 Bacteria 1389
418 Ga0206353_10185676 3300020082 Bacteria 1599
419 Ga0206353_11937846 3300020082 Bacteria 1476
420 Ga0213872_10031730 3300021361 Bacteria 2422
421 Ga0213874_10009302 3300021377 Bacteria 2425
422 Ga0213874_10047224 3300021377 Bacteria 1309
423 Ga0213874_10055302 3300021377 Bacteria 1229
424 Ga0213876_10004341 3300021384 Bacteria 7943
425 Ga0213876_10055424 3300021384 Bacteria 2093
426 Ga0213876_10146842 3300021384 Bacteria 1254
427 Ga0213875_10104231 3300021388 Bacteria 1324
428 Ga0213871_10001534 3300021441 Bacteria 3917
429 Ga0228598_1005985 3300024227 Bacteria 2528
430 Ga0209563_102374 3300025230 Bacteria 4290
431 Ga0209677_105468 3300025253 Bacteria 3306
432 Ga0209148_1000232 3300025254 Bacteria 90923
433 Ga0209233_1004124 3300025261 Bacteria 5006
434 Ga0209233_1005430 3300025261 Bacteria 4230
435 Ga0209233_1014462 3300025261 Bacteria 2221
436 Ga0209455_1001619 3300025272 Bacteria 9859
437 Ga0209455_1003297 3300025272 Bacteria 5797
438 Ga0209455_1004104 3300025272 Bacteria 4895
439 Ga0209130_1027165 3300025284 Bacteria 1219
440 Ga0209758_1016277 3300025297 Bacteria 3786
441 Ga0209758_1024538 3300025297 Bacteria 2684
442 Ga0209256_1015886 3300025299 Bacteria 2604
443 Ga0207426_1002604 3300025302 Bacteria 11200
444 Ga0207697_10057106 3300025315 Bacteria 1620
445 Ga0207653_10002710 3300025885 Bacteria 5631
446 Ga0207682_10000909 3300025893 Bacteria 13718
447 Ga0207692_10000223 3300025898 Bacteria 19217
448 Ga0207692_10007542 3300025898 Bacteria 4459
449 Ga0207692_10016246 3300025898 Bacteria 3291
450 Ga0207692_10034977 3300025898 Bacteria 2437
451 Ga0207692_10140586 3300025898 Bacteria 1373
452 Ga0207642_10094144 3300025899 Bacteria 1488
453 Ga0207710_10015027 3300025900 Bacteria 3270
454 Ga0207710_10016158 3300025900 Bacteria 3158
455 Ga0207710_10089064 3300025900 Bacteria 1442
456 Ga0207688_10107588 3300025901 Bacteria 1616
457 Ga0207688_10108152 3300025901 Bacteria 1612
458 Ga0207680_10004200 3300025903 Bacteria 6817
459 Ga0207647_10100979 3300025904 Bacteria 1712
460 Ga0207647_10130307 3300025904 Bacteria 1478
461 Ga0207685_10005632 3300025905 Bacteria 3330
462 Ga0207685_10085326 3300025905 Bacteria 1317
463 Ga0207699_10002413 3300025906 Bacteria 8824
464 Ga0207699_10025942 3300025906 Bacteria 3225
465 Ga0207699_10062568 3300025906 Bacteria 2244
466 Ga0207645_10072744 3300025907 Bacteria 2201
467 Ga0207645_10075743 3300025907 Bacteria 2154
468 Ga0207684_10079331 3300025910 Bacteria 2793
469 Ga0207684_10277433 3300025910 Bacteria 1446
470 Ga0207654_10031132 3300025911 Bacteria 2936
471 Ga0207654_10057274 3300025911 Bacteria 2264
472 Ga0207654_10128775 3300025911 Bacteria 1599
473 Ga0207707_10003051 3300025912 Bacteria 14884
474 Ga0207707_10045116 3300025912 Bacteria 3841
475 Ga0207707_10230297 3300025912 Bacteria 1612
476 Ga0207695_10000123 3300025913 Bacteria 232059
477 Ga0207695_10360175 3300025913 Bacteria 1341
478 Ga0207695_10373416 3300025913 Bacteria 1312
479 Ga0207671_10003762 3300025914 Bacteria 14939
480 Ga0207671_10024043 3300025914 Bacteria 4586
481 Ga0207671_10068901 3300025914 Bacteria 2637
482 Ga0207671_10124669 3300025914 Bacteria 1972
483 Ga0207671_10228502 3300025914 Bacteria 1459
484 Ga0207693_10001798 3300025915 Bacteria 18803
485 Ga0207693_10016409 3300025915 Bacteria 5920
486 Ga0207693_10030529 3300025915 Bacteria 4257
487 Ga0207693_10033811 3300025915 Bacteria 4033
488 Ga0207693_10039685 3300025915 Bacteria 3707
489 Ga0207693_10041551 3300025915 Bacteria 3620
490 Ga0207693_10077542 3300025915 Bacteria 2602
491 Ga0207693_10173812 3300025915 Bacteria 1695
492 Ga0207693_10209791 3300025915 Bacteria 1531
493 Ga0207693_10254724 3300025915 Bacteria 1377
494 Ga0207693_10305049 3300025915 Bacteria 1247
495 Ga0207693_10377643 3300025915 Bacteria 1108
496 Ga0207693_10394101 3300025915 Bacteria 1083
497 Ga0207663_10000363 3300025916 Bacteria 19735
498 Ga0207663_10035261 3300025916 Bacteria 2999
499 Ga0207663_10049105 3300025916 Bacteria 2615
500 Ga0207663_10106146 3300025916 Bacteria 1898
501 Ga0207663_10106986 3300025916 Bacteria 1891
502 Ga0207663_10195863 3300025916 Bacteria 1454
503 Ga0207663_10203638 3300025916 Bacteria 1429
504 Ga0207663_10247096 3300025916 Bacteria 1311
505 Ga0207663_10430922 3300025916 Bacteria 1014
506 Ga0207663_10443032 3300025916 Bacteria 1001
507 Ga0207660_10012977 3300025917 Bacteria 5457
508 Ga0207660_10042759 3300025917 Bacteria 3181
509 Ga0207660_10044180 3300025917 Bacteria 3134
510 Ga0207662_10018518 3300025918 Bacteria 3953
511 Ga0207662_10170773 3300025918 Bacteria 1394
512 Ga0207657_10136092 3300025919 Bacteria 2010
513 Ga0207657_10350131 3300025919 Bacteria 1165
514 Ga0207649_10011963 3300025920 Bacteria 4800
515 Ga0207649_10081444 3300025920 Bacteria 2096
516 Ga0207649_10103684 3300025920 Bacteria 1887
517 Ga0207649_10132264 3300025920 Bacteria 1696
518 Ga0207652_10014356 3300025921 Bacteria 6416
519 Ga0207652_10177188 3300025921 Bacteria 1915
520 Ga0207646_10087213 3300025922 Bacteria 2793
521 Ga0207681_10230809 3300025923 Bacteria 1436
522 Ga0207694_10160110 3300025924 Bacteria 1818
523 Ga0207694_10208078 3300025924 Bacteria 1593
524 Ga0207650_10036345 3300025925 Bacteria 3583
525 Ga0207650_10047592 3300025925 Bacteria 3160
526 Ga0207650_10245304 3300025925 Bacteria 1449
527 Ga0207650_10276004 3300025925 Bacteria 1367
528 Ga0207650_10327989 3300025925 Bacteria 1255
529 Ga0207687_10010758 3300025927 Bacteria 5978
530 Ga0207687_10077579 3300025927 Bacteria 2389
531 Ga0207687_10127810 3300025927 Bacteria 1911
532 Ga0207687_10170033 3300025927 Bacteria 1680
533 Ga0207687_10309640 3300025927 Bacteria 1275
534 Ga0207700_10014450 3300025928 Bacteria 5173
535 Ga0207700_10032525 3300025928 Bacteria 3721
536 Ga0207700_10084608 3300025928 Bacteria 2487
537 Ga0207700_10100022 3300025928 Bacteria 2310
538 Ga0207700_10227954 3300025928 Bacteria 1583
539 Ga0207700_10255207 3300025928 Bacteria 1499
540 Ga0207700_10281663 3300025928 Bacteria 1430
541 Ga0207700_10437971 3300025928 Bacteria 1150
542 Ga0207700_10622186 3300025928 Bacteria 962
543 Ga0207664_10006243 3300025929 Bacteria 8186
544 Ga0207664_10046942 3300025929 Bacteria 3391
545 Ga0207664_10053269 3300025929 Bacteria 3202
546 Ga0207644_10005617 3300025931 Bacteria 8169
547 Ga0207644_10312479 3300025931 Bacteria 1269
548 Ga0207644_10323757 3300025931 Bacteria 1247
549 Ga0207706_10042321 3300025933 Bacteria 4037
550 Ga0207706_10071560 3300025933 Bacteria 3050
551 Ga0207706_10294951 3300025933 Bacteria 1413
552 Ga0207706_10328764 3300025933 Bacteria 1330
553 Ga0207686_10007615 3300025934 Bacteria 5834
554 Ga0207686_10091080 3300025934 Bacteria 2013
555 Ga0207686_10094088 3300025934 Bacteria 1986
556 Ga0207709_10017654 3300025935 Bacteria 3985
557 Ga0207670_10052761 3300025936 Bacteria 2735
558 Ga0207670_10141732 3300025936 Bacteria 1773
559 Ga0207670_10198233 3300025936 Bacteria 1524
560 Ga0207670_10392385 3300025936 Bacteria 1108
561 Ga0207665_10000530 3300025939 Bacteria 25694
562 Ga0207665_10003497 3300025939 Bacteria 10491
563 Ga0207665_10057055 3300025939 Bacteria 2637
564 Ga0207665_10091882 3300025939 Bacteria 2105
565 Ga0207665_10119678 3300025939 Bacteria 1859
566 Ga0207665_10145156 3300025939 Bacteria 1695
567 Ga0207665_10209970 3300025939 Bacteria 1422
568 Ga0207665_10341723 3300025939 Bacteria 1128
569 Ga0207691_10006531 3300025940 Bacteria 11257
570 Ga0207711_10010809 3300025941 Bacteria 7587
571 Ga0207711_10039259 3300025941 Bacteria 4027
572 Ga0207711_10157825 3300025941 Bacteria 2051
573 Ga0207711_10541709 3300025941 Bacteria 1086
574 Ga0207689_10027444 3300025942 Bacteria 4765
575 Ga0207689_10226442 3300025942 Bacteria 1545
576 Ga0207661_10071272 3300025944 Bacteria 2839
577 Ga0207679_10080904 3300025945 Bacteria 2482
578 Ga0207679_10557763 3300025945 Bacteria 1028
579 Ga0207667_10120809 3300025949 Bacteria 2700
580 Ga0207651_10006504 3300025960 Bacteria 6129
581 Ga0207651_10046021 3300025960 Bacteria 2930
582 Ga0207712_10066378 3300025961 Bacteria 2579
583 Ga0207712_10134412 3300025961 Bacteria 1889
584 Ga0207712_10157808 3300025961 Bacteria 1759
585 Ga0207668_10019178 3300025972 Bacteria 4318
586 Ga0207668_10064448 3300025972 Bacteria 2590
587 Ga0207668_10080478 3300025972 Bacteria 2360
588 Ga0207668_10093584 3300025972 Bacteria 2214
589 Ga0207668_10104998 3300025972 Bacteria 2107
590 Ga0207668_10364311 3300025972 Bacteria 1212
591 Ga0207668_10453373 3300025972 Bacteria 1095
592 Ga0207658_10040399 3300025986 Bacteria 3372
593 Ga0207658_10235743 3300025986 Bacteria 1547
594 Ga0207677_10153739 3300026023 Bacteria 1779
595 Ga0207677_10154747 3300026023 Bacteria 1774
596 Ga0207703_10073127 3300026035 Bacteria 2835
597 Ga0207703_10074966 3300026035 Bacteria 2802
598 Ga0207703_10092906 3300026035 Bacteria 2540
599 Ga0207703_10141221 3300026035 Bacteria 2090
600 Ga0207639_10020584 3300026041 Bacteria 4724
601 Ga0207639_10197927 3300026041 Bacteria 1721
602 Ga0207639_10318719 3300026041 Bacteria 1380
603 Ga0207678_10003243 3300026067 Bacteria 14697
604 Ga0207678_10065786 3300026067 Bacteria 3113
605 Ga0207678_10070260 3300026067 Bacteria 3002
606 Ga0207678_10200532 3300026067 Bacteria 1706
607 Ga0207678_10231862 3300026067 Bacteria 1581
608 Ga0207678_10337209 3300026067 Bacteria 1299
609 Ga0207678_10343993 3300026067 Bacteria 1285
610 Ga0207678_10476070 3300026067 Bacteria 1087
611 Ga0207708_10001021 3300026075 Bacteria 20946
612 Ga0207708_10043912 3300026075 Bacteria 3407
613 Ga0207708_10149014 3300026075 Bacteria 1840
614 Ga0207702_10160193 3300026078 Bacteria 2055
615 Ga0207702_10280212 3300026078 Bacteria 1576
616 Ga0207702_10581584 3300026078 Bacteria 1098
617 Ga0207641_10009341 3300026088 Bacteria 8088
618 Ga0207641_10122942 3300026088 Bacteria 2319
619 Ga0207641_10241829 3300026088 Bacteria 1682
620 Ga0207641_10247231 3300026088 Bacteria 1664
621 Ga0207641_10386860 3300026088 Bacteria 1341
622 Ga0207648_10021386 3300026089 Bacteria 5815
623 Ga0207648_10033864 3300026089 Bacteria 4505
624 Ga0207648_10149759 3300026089 Bacteria 2059
625 Ga0207676_10084872 3300026095 Bacteria 2582
626 Ga0207676_10154058 3300026095 Bacteria 1983
627 Ga0207674_10015333 3300026116 Bacteria 8422
628 Ga0207674_10054872 3300026116 Bacteria 4055
629 Ga0207674_10077574 3300026116 Bacteria 3328
630 Ga0207675_100277353 3300026118 Bacteria 1628
631 Ga0207683_10002435 3300026121 Bacteria 16234
632 Ga0207683_10006018 3300026121 Bacteria 10385
633 Ga0207683_10013955 3300026121 Bacteria 6851
634 Ga0207683_10015216 3300026121 Bacteria 6548
635 Ga0207683_10338969 3300026121 Bacteria 1379
636 Ga0207698_10106079 3300026142 Bacteria 2342
637 Ga0209179_1001947 3300027512 Bacteria 2677
638 Ga0209179_1015941 3300027512 Bacteria 1403
639 Ga0209588_1014672 3300027671 Bacteria 2402
640 Ga0207428_10000219 3300027907 Bacteria 79717
641 Ga0207428_10019378 3300027907 Bacteria 5802
642 Ga0207428_10200086 3300027907 Bacteria 1503
643 Ga0265357_1000114 3300028023 Bacteria 3240
644 Ga0268266_10003841 3300028379 Bacteria 14671
645 Ga0268266_10006378 3300028379 Bacteria 10802
646 Ga0268266_10016905 3300028379 Bacteria 6233
647 Ga0268266_10021214 3300028379 Bacteria 5533
648 Ga0268266_10056608 3300028379 Bacteria 3373
649 Ga0268266_10071381 3300028379 Bacteria 3009
650 Ga0268266_10139538 3300028379 Bacteria 2175
651 Ga0268266_10147700 3300028379 Bacteria 2115
652 Ga0268266_10203243 3300028379 Bacteria 1814
653 Ga0268265_10000692 3300028380 Bacteria 33137
654 Ga0268265_10591370 3300028380 Bacteria 1059
655 Ga0268264_10000042 3300028381 Bacteria 372069
656 Ga0268264_10001498 3300028381 Bacteria 21784
657 Ga0268264_10150232 3300028381 Bacteria 2088
658 Ga0268264_10182918 3300028381 Bacteria 1905
659 Ga0268264_10217979 3300028381 Bacteria 1755
660 Ga0265337_1052684 3300028556 Bacteria 1142
661 Ga0265319_1021564 3300028563 Bacteria 2362
662 Ga0265334_10001691 3300028573 Bacteria 10542
663 Ga0265318_10076142 3300028577 Bacteria 1241
664 Ga0265323_10000604 3300028653 Bacteria 19768
665 Ga0265322_10016967 3300028654 Bacteria 2100
666 Ga0265336_10000679 3300028666 Bacteria 18401
667 Ga0307515_10000950 3300028794 Bacteria 66308
668 Ga0265338_10000271 3300028800 Bacteria 94819
669 Ga0265324_10010126 3300029957 Bacteria 3651
670 Ga0307511_10097238 3300030521 Bacteria 1956
671 Ga0265760_10041513 3300031090 Bacteria 1372
672 Ga0265330_10007601 3300031235 Bacteria 5270
673 Ga0265330_10037789 3300031235 Bacteria 2148
674 Ga0265330_10050657 3300031235 Bacteria 1821
675 Ga0265332_10075635 3300031238 Bacteria 1432
676 Ga0265340_10007354 3300031247 Bacteria 5983
677 Ga0265340_10011210 3300031247 Bacteria 4773
678 Ga0265340_10046320 3300031247 Bacteria 2122
679 Ga0265340_10103391 3300031247 Bacteria 1322
680 Ga0265339_10020140 3300031249 Bacteria 3901
681 Ga0265331_10002519 3300031250 Bacteria 12347
682 Ga0265316_10065277 3300031344 Bacteria 2819
683 Ga0265316_10271717 3300031344 Bacteria 1240
684 Ga0307513_10158629 3300031456 Bacteria 2158
685 Ga0307513_10381425 3300031456 Bacteria 1149
686 Ga0307509_10104342 3300031507 Bacteria 2860
687 Ga0307509_10170607 3300031507 Bacteria 2055
688 Ga0307509_10363692 3300031507 Bacteria 1165
689 Ga0265313_10000832 3300031595 Bacteria 31227
690 Ga0307508_10000063 3300031616 Bacteria 122536
691 Ga0307508_10102794 3300031616 Bacteria 2454
692 Ga0307508_10287808 3300031616 Bacteria 1236
693 Ga0316579_10159814 3300031691 Bacteria 1088
694 Ga0265314_10006217 3300031711 Bacteria 10603
695 Ga0265342_10003354 3300031712 Bacteria 13229
696 Ga0265342_10021002 3300031712 Bacteria 4176
697 Ga0265342_10099237 3300031712 Bacteria 1661
698 Ga0307516_10016366 3300031730 Bacteria 7759
699 Ga0307413_10165516 3300031824 Bacteria 1559
700 Ga0307415_100437034 3300032126 Bacteria 1127
701 Ga0307507_10039462 3300033179 Bacteria 4765
702 Ga0307510_10012742 3300033180 Bacteria 9977
703 Ga0307510_10065915 3300033180 Bacteria 3661
704 Ga0307510_10153347 3300033180 Bacteria 1917
705 Ga0307510_10251707 3300033180 Bacteria 1254
706 Ga0373926_0008015 3300035083 Bacteria 3518
707 Ga0373926_0091784 3300035083 Bacteria 1129
708 Ga0373934_0005104 3300035086 Bacteria 4866
709 Ga0373934_0012245 3300035086 Bacteria 3238
710 Ga0373934_0082672 3300035086 Bacteria 1291
711 Ga0373940_0045662 3300035088 Bacteria 1217
712 Ga0373944_0009913 3300035089 Bacteria 2590
713 Ga0373944_0017924 3300035089 Bacteria 2016
714 Ga0373923_0000876 3300035111 Bacteria 7993
715 Ga0373923_0011115 3300035111 Bacteria 3294
716 Ga0373923_0021126 3300035111 Bacteria 2538
717 Ga0373936_0011157 3300035113 Bacteria 3395
718 Ga0373936_0042165 3300035113 Bacteria 1831
719 Ga0373936_0091709 3300035113 Bacteria 1274
720 Ga0373939_0013155 3300035114 Bacteria 2123
721 Ga0373939_0042092 3300035114 Bacteria 1380
722 Ga0373945_0002606 3300035116 Bacteria 5650
723 Ga0373945_0010586 3300035116 Bacteria 3039
724 Ga0373945_0030076 3300035116 Bacteria 1912
725 Ga0373945_0059362 3300035116 Bacteria 1424
726 Ga0373953_0002671 3300035117 Bacteria 5403
727 Ga0373953_0034308 3300035117 Bacteria 1988
728 Ga0373954_0006599 3300035118 Bacteria 5063
729 Ga0373954_0007974 3300035118 Bacteria 4640
730 Ga0373954_0016181 3300035118 Bacteria 3337
731 Ga0373954_0041811 3300035118 Bacteria 2137
732 Ga0373954_0068764 3300035118 Bacteria 1680
733 Ga0373954_0098006 3300035118 Bacteria 1413
734 Ga0373954_0191158 3300035118 Bacteria 1005
735 Ga0373956_0002258 3300035119 Bacteria 7935
736 Ga0373956_0013536 3300035119 Bacteria 3394
737 Ga0373956_0016025 3300035119 Bacteria 3143
738 Ga0373956_0017265 3300035119 Bacteria 3040
739 Ga0373957_0007942 3300035120 Bacteria 3416
740 Ga0373957_0032026 3300035120 Bacteria 1935
741 Ga0373957_0107550 3300035120 Bacteria 1121
742 Ga0373960_0007051 3300035121 Bacteria 2651
743 Ga0373943_0011060 3300035170 Bacteria 4053
744 Ga0373943_0015659 3300035170 Bacteria 3449
745 Ga0373943_0018525 3300035170 Bacteria 3199
746 Ga0373943_0042273 3300035170 Bacteria 2208
747 Ga0373943_0054411 3300035170 Bacteria 1979
748 Ga0373943_0216694 3300035170 Bacteria 1065
749 Ga0373946_0011166 3300035171 Bacteria 3344
750 Ga0373946_0019287 3300035171 Bacteria 2627
751 Ga0373946_0021242 3300035171 Bacteria 2516
752 Ga0373955_0009471 3300035172 Bacteria 4562
753 Ga0373955_0019876 3300035172 Bacteria 3366
754 Ga0373955_0020515 3300035172 Bacteria 3324
755 Ga0373955_0111421 3300035172 Bacteria 1582
756 Ga0373955_0112191 3300035172 Bacteria 1577
757 Ga0373942_0019540 3300035207 Bacteria 1692
758 Ga0373961_0009482 3300035241 Bacteria 2383
759 Ga0373961_0027018 3300035241 Bacteria 1573
760 Ga0373962_0004928 3300035242 Bacteria 3227
761 Ga0373924_0002411 3300035410 Bacteria 6290
762 Ga0373924_0004262 3300035410 Bacteria 4983
763 Ga0373924_0005085 3300035410 Bacteria 4635
764 Ga0373924_0014812 3300035410 Bacteria 2952
765 Ga0373931_0010444 3300035691 Bacteria 4462
766 Ga0373931_0013871 3300035691 Bacteria 3931
767 Ga0373931_0327076 3300035691 Bacteria 954
768 Ga0373935_0001695 3300035692 Bacteria 12321
769 Ga0373935_0009581 3300035692 Bacteria 5798
770 Ga0373935_0033556 3300035692 Bacteria 3195
771 Ga0373935_0070969 3300035692 Bacteria 2246
772 Ga0373935_0099904 3300035692 Bacteria 1911
773 Ga0373935_0112161 3300035692 Bacteria 1811
774 Ga0373935_0122140 3300035692 Bacteria 1741
775 Ga0373935_0160688 3300035692 Bacteria 1531
776 Ga0373935_0180726 3300035692 Bacteria 1448
777 Ga0373927_0000792 3300035695 Bacteria 24123
778 Ga0373927_0003123 3300035695 Bacteria 11979
779 Ga0373927_0018799 3300035695 Bacteria 4534
780 Ga0373927_0052319 3300035695 Bacteria 2641
781 Ga0373927_0054605 3300035695 Bacteria 2584
782 Ga0373927_0115416 3300035695 Bacteria 1750
783 Ga0373927_0276890 3300035695 Bacteria 1103
784 Ga0373933_0000777 3300035724 Bacteria 19461
785 Ga0373933_0002673 3300035724 Bacteria 9985
786 Ga0373933_0002696 3300035724 Bacteria 9942
787 Ga0373933_0005116 3300035724 Bacteria 7154
788 Ga0373933_0025925 3300035724 Bacteria 3363
789 Ga0373933_0088829 3300035724 Bacteria 1904
790 Ga0373933_0109582 3300035724 Bacteria 1721
791 Ga0373947_0009094 3300035725 Bacteria 5709
792 Ga0373947_0017854 3300035725 Bacteria 4082
793 Ga0373947_0026316 3300035725 Bacteria 3399
794 Ga0373947_0121187 3300035725 Bacteria 1661
795 Ga0373947_0173802 3300035725 Bacteria 1399
796 Ga0373947_0319309 3300035725 Bacteria 1038
797 Ga0373937_0002830 3300036401 Bacteria 14504
798 Ga0373937_0014011 3300036401 Bacteria 7070
799 Ga0373937_0024326 3300036401 Bacteria 5461
800 Ga0373937_0040006 3300036401 Bacteria 4274
801 Ga0373937_0081857 3300036401 Bacteria 2986
802 Ga0373937_0097930 3300036401 Bacteria 2720
803 Ga0373937_0129513 3300036401 Bacteria 2356
804 Ga0373937_0254823 3300036401 Bacteria 1654
805 Ga0373937_0270329 3300036401 Bacteria 1604
806 Ga0373937_0362069 3300036401 Bacteria 1374
807 Ga0373937_0400798 3300036401 Bacteria 1302
808 Ga0373937_0538301 3300036401 Bacteria 1109
809 Ga0373937_0607452 3300036401 Bacteria 1038
810 Ga0372808_001117 3300036459 Bacteria 2634
811 Ga0373925_0000335 3300037068 Bacteria 48779
812 Ga0373925_0020762 3300037068 Bacteria 4785
813 Ga0373925_0029718 3300037068 Bacteria 4009
814 Ga0373925_0038159 3300037068 Bacteria 3550
815 Ga0373925_0101917 3300037068 Bacteria 2208
816 Ga0373925_0134242 3300037068 Bacteria 1932
817 Ga0373925_0171628 3300037068 Bacteria 1712
818 Ga0373925_0240495 3300037068 Bacteria 1450
819 Ga0373925_0295397 3300037068 Bacteria 1307
820 Ga0395898_0004066 3300037466 Bacteria 16063
821 Ga0395905_0149312 3300037471 Bacteria 2199
822 Ga0436364_0728274 3300037853 Bacteria 1604
823 Ga0436365_0044969 3300039437 Bacteria 10634
824 Ga0436365_0688470 3300039437 Bacteria 1875
825 Ga0436365_0701563 3300039437 Bacteria 2490
826 Ga0436365_1909734 3300039437 Bacteria 1541
827 Ga0436360_0894372 3300039438 Bacteria 1408
828 Ga0436360_1063913 3300039438 Bacteria 2992
829 Ga0436360_1231835 3300039438 Bacteria 3260
830 Ga0436361_0180224 3300039447 Bacteria 3207
831 Ga0436361_0536993 3300039447 Bacteria 2012
832 Ga0436361_0700040 3300039447 Bacteria 1316
833 Ga0436361_0880434 3300039447 Bacteria 1295
834 Ga0436363_0055080 3300039450 Bacteria 2050
835 Ga0436363_0852619 3300039450 Bacteria 1765
836 Ga0436363_0925997 3300039450 Bacteria 1888
837 Ga0436363_0985963 3300039450 Bacteria 2889
838 Ga0436363_0986232 3300039450 Bacteria 4338
839 Ga0436362_0373621 3300039453 Bacteria 1846
840 Ga0436362_0568672 3300039453 Bacteria 1716
841 Ga0439453_0016430 3300041408 Bacteria 1291
842 Ga0439465_0057119 3300041413 Bacteria 1287
843 Ga0439435_0034972 3300042436 Bacteria 1383
844 Ga0439435_0069504 3300042436 Bacteria 1040
845 Ga0439460_0033544 3300042461 Bacteria 1475
846 Ga0466963_0168499 3300044694 Bacteria 1526
847 Ga0466959_0010466 3300045049 Bacteria 6636
848 Ga0451576_0052400 3300045051 Bacteria 4276
849 Ga0466958_0080961 3300045836 Bacteria 1998
850 Ga0466967_0110667 3300045976 Bacteria 2523
851 Ga0466967_0599398 3300045976 Bacteria 1087
852 Ga0466967_0822993 3300045976 Bacteria 922
853 Ga0495617_054885 3300046452 Bacteria 1322
854 Ga0495592_0006635 3300046454 Bacteria 8628
855 Ga0495592_0011579 3300046454 Bacteria 6679
856 Ga0495592_0036259 3300046454 Bacteria 3714
857 Ga0495592_0044670 3300046454 Bacteria 3309
858 Ga0495592_0058738 3300046454 Bacteria 2835
859 Ga0495592_0070492 3300046454 Bacteria 2546
860 Ga0495592_0145045 3300046454 Bacteria 1647
861 Ga0495592_0147547 3300046454 Bacteria 1629
862 Ga0495592_0209081 3300046454 Bacteria 1311
863 Ga0495592_0228383 3300046454 Bacteria 1240
864 Ga0495603_0001070 3300046455 Bacteria 15886
865 Ga0495603_0019622 3300046455 Bacteria 4092
866 Ga0495603_0028481 3300046455 Bacteria 3369
867 Ga0495603_0029447 3300046455 Bacteria 3310
868 Ga0495603_0046661 3300046455 Bacteria 2581
869 Ga0495603_0100496 3300046455 Bacteria 1688
870 Ga0495603_0127222 3300046455 Bacteria 1484
871 Ga0495603_0133193 3300046455 Bacteria 1447
872 Ga0495603_0135318 3300046455 Bacteria 1434
873 Ga0495629_0000368 3300046459 Bacteria 38181
874 Ga0495629_0001441 3300046459 Bacteria 18767
875 Ga0495629_0009862 3300046459 Bacteria 6970
876 Ga0495629_0017469 3300046459 Bacteria 5140
877 Ga0495629_0050734 3300046459 Bacteria 2905
878 Ga0495629_0257979 3300046459 Bacteria 1198
879 Ga0495629_0308384 3300046459 Bacteria 1083
880 Ga0495629_0341869 3300046459 Bacteria 1021
881 Ga0495638_0002894 3300046460 Bacteria 13723
882 Ga0495638_0012222 3300046460 Bacteria 5894
883 Ga0495638_0023757 3300046460 Bacteria 4004
884 Ga0495638_0029083 3300046460 Bacteria 3564
885 Ga0495638_0252386 3300046460 Bacteria 972
886 Ga0495641_0004779 3300046461 Bacteria 9427
887 Ga0495641_0013678 3300046461 Bacteria 4440
888 Ga0495641_0023743 3300046461 Bacteria 3039
889 Ga0495641_0092540 3300046461 Bacteria 1351
890 Ga0495641_0207854 3300046461 Bacteria 877
891 Ga0495651_0002392 3300046462 Bacteria 14478
892 Ga0495651_0004178 3300046462 Bacteria 11058
893 Ga0495651_0017223 3300046462 Bacteria 5600
894 Ga0495651_0062646 3300046462 Bacteria 2845
895 Ga0495651_0075576 3300046462 Bacteria 2554
896 Ga0495651_0149976 3300046462 Bacteria 1682
897 Ga0495653_0009658 3300046463 Bacteria 7890
898 Ga0495653_0011500 3300046463 Bacteria 7231
899 Ga0495653_0014724 3300046463 Bacteria 6379
900 Ga0495653_0015320 3300046463 Bacteria 6249
901 Ga0495653_0048037 3300046463 Bacteria 3297
902 Ga0495653_0117374 3300046463 Bacteria 1901
903 Ga0495653_0139162 3300046463 Bacteria 1709
904 Ga0495653_0189863 3300046463 Bacteria 1402
905 Ga0495653_0210143 3300046463 Bacteria 1315
906 Ga0495650_0040057 3300046471 Bacteria 2016
907 Ga0495580_0003347 3300046472 Bacteria 13709
908 Ga0495580_0005227 3300046472 Bacteria 10785
909 Ga0495580_0017291 3300046472 Bacteria 5397
910 Ga0495580_0049442 3300046472 Bacteria 2975
911 Ga0495580_0081204 3300046472 Bacteria 2260
912 Ga0495582_0001595 3300046473 Bacteria 12785
913 Ga0495582_0004432 3300046473 Bacteria 7895
914 Ga0495582_0076443 3300046473 Bacteria 1856
915 Ga0495605_0031005 3300046474 Bacteria 2734
916 Ga0495639_0000231 3300046475 Bacteria 27804
917 Ga0495639_0016017 3300046475 Bacteria 3252
918 Ga0495639_0020436 3300046475 Bacteria 2893
919 Ga0495639_0033456 3300046475 Bacteria 2296
920 Ga0495639_0065662 3300046475 Bacteria 1669
921 Ga0495639_0174908 3300046475 Bacteria 1043
922 Ga0495662_0005546 3300046476 Bacteria 6310
923 Ga0495662_0020593 3300046476 Bacteria 3191
924 Ga0495662_0034318 3300046476 Bacteria 2449
925 Ga0495662_0189634 3300046476 Bacteria 1014
926 Ga0495664_0011834 3300046477 Bacteria 4928
927 Ga0495664_0021493 3300046477 Bacteria 3727
928 Ga0495664_0030245 3300046477 Bacteria 3171
929 Ga0495664_0037782 3300046477 Bacteria 2850
930 Ga0495664_0039991 3300046477 Bacteria 2771
931 Ga0495664_0042158 3300046477 Bacteria 2702
932 Ga0495664_0048148 3300046477 Bacteria 2530
933 Ga0495664_0103346 3300046477 Bacteria 1717
934 Ga0495664_0254224 3300046477 Bacteria 1062
935 Ga0495584_0044448 3300046491 Bacteria 2242
936 Ga0495585_0015104 3300046492 Bacteria 4488
937 Ga0495594_0015582 3300046499 Bacteria 3995
938 Ga0495594_0180576 3300046499 Bacteria 1201
939 Ga0495594_0184599 3300046499 Bacteria 1188
940 Ga0495594_0209099 3300046499 Bacteria 1112
941 Ga0495607_0007966 3300046501 Bacteria 7282
942 Ga0495606_0136539 3300046507 Bacteria 1452
943 Ga0495608_0002243 3300046511 Bacteria 13962
944 Ga0495608_0015551 3300046511 Bacteria 5275
945 Ga0495608_0016836 3300046511 Bacteria 5060
946 Ga0495608_0017561 3300046511 Bacteria 4947
947 Ga0495608_0027213 3300046511 Bacteria 3891
948 Ga0495608_0095054 3300046511 Bacteria 1925
949 Ga0495618_0011649 3300046514 Bacteria 5335
950 Ga0495618_0023082 3300046514 Bacteria 3843
951 Ga0495618_0044979 3300046514 Bacteria 2784
952 Ga0495618_0134229 3300046514 Bacteria 1583
953 Ga0495618_0225420 3300046514 Bacteria 1181
954 Ga0495618_0271003 3300046514 Bacteria 1061
955 Ga0495628_0006423 3300046516 Bacteria 10269
956 Ga0495628_0009067 3300046516 Bacteria 8508
957 Ga0495628_0021744 3300046516 Bacteria 5271
958 Ga0495628_0090027 3300046516 Bacteria 2375
959 Ga0495628_0232795 3300046516 Bacteria 1380
960 Ga0495630_0006442 3300046517 Bacteria 8350
961 Ga0495630_0032084 3300046517 Bacteria 3911
962 Ga0495630_0056513 3300046517 Bacteria 2940
963 Ga0495630_0113720 3300046517 Bacteria 2051
964 Ga0495630_0218425 3300046517 Bacteria 1455
965 Ga0495632_0102830 3300046519 Bacteria 1346
966 Ga0495644_0002466 3300046523 Bacteria 7385
967 Ga0495648_0005065 3300046524 Bacteria 11061
968 Ga0495663_0065065 3300046525 Bacteria 1152
969 Ga0495666_0011941 3300046526 Bacteria 4336
970 Ga0495666_0025922 3300046526 Bacteria 2893
971 Ga0495666_0191930 3300046526 Bacteria 941
972 Ga0495652_0008012 3300046529 Bacteria 9688
973 Ga0495652_0043647 3300046529 Bacteria 3861
974 Ga0495652_0049003 3300046529 Bacteria 3617
975 Ga0495652_0052648 3300046529 Bacteria 3471
976 Ga0495652_0074459 3300046529 Bacteria 2823
977 Ga0495652_0168698 3300046529 Bacteria 1691
978 Ga0495652_0194087 3300046529 Bacteria 1547
979 Ga0495652_0266421 3300046529 Bacteria 1261
980 Ga0495652_0307325 3300046529 Bacteria 1150
981 Ga0495652_0365686 3300046529 Bacteria 1029
982 Ga0495665_0002780 3300046531 Bacteria 9444
983 Ga0495665_0006741 3300046531 Bacteria 6191
984 Ga0495665_0007753 3300046531 Bacteria 5807
985 Ga0495665_0032303 3300046531 Bacteria 2800
986 Ga0495640_0006384 3300046533 Bacteria 9325
987 Ga0495640_0022665 3300046533 Bacteria 4586
988 Ga0495640_0025552 3300046533 Bacteria 4281
989 Ga0495640_0037146 3300046533 Bacteria 3438
990 Ga0495640_0043398 3300046533 Bacteria 3132
991 Ga0495640_0049626 3300046533 Bacteria 2893
992 Ga0495640_0064162 3300046533 Bacteria 2484
993 Ga0495640_0067024 3300046533 Bacteria 2419
994 Ga0495640_0142460 3300046533 Bacteria 1545
995 Ga0495640_0143256 3300046533 Bacteria 1539
996 Ga0495640_0147916 3300046533 Bacteria 1510
997 Ga0495640_0290712 3300046533 Bacteria 1016
998 Ga0495586_0033183 3300046535 Bacteria 2770
999 Ga0495586_0222192 3300046535 Bacteria 1073
1000 Ga0495587_0001257 3300046536 Bacteria 16834
1001 Ga0495587_0001625 3300046536 Bacteria 14957
1002 Ga0495587_0020344 3300046536 Bacteria 4098
1003 Ga0495587_0026687 3300046536 Bacteria 3520
1004 Ga0495587_0044294 3300046536 Bacteria 2647
1005 Ga0495587_0046473 3300046536 Bacteria 2577
1006 Ga0495587_0108990 3300046536 Bacteria 1591
1007 Ga0495598_0021155 3300046537 Bacteria 1727
1008 Ga0495598_0024675 3300046537 Bacteria 1632
1009 Ga0495609_0093697 3300046538 Bacteria 1305
1010 Ga0495621_0059566 3300046539 Bacteria 1383
1011 Ga0495645_0052884 3300046543 Bacteria 2953
1012 Ga0495645_0077450 3300046543 Bacteria 2390
1013 Ga0495645_0137680 3300046543 Bacteria 1706
1014 Ga0495645_0148470 3300046543 Bacteria 1631
1015 Ga0495645_0295647 3300046543 Bacteria 1060
1016 Ga0495622_0003462 3300046557 Bacteria 7440
1017 Ga0495622_0015188 3300046557 Bacteria 3579
1018 Ga0495622_0016590 3300046557 Bacteria 3430
1019 Ga0495622_0104354 3300046557 Bacteria 1298
1020 Ga0495667_0005240 3300046559 Bacteria 8764
1021 Ga0495667_0012176 3300046559 Bacteria 5827
1022 Ga0495667_0025660 3300046559 Bacteria 3970
1023 Ga0495667_0038944 3300046559 Bacteria 3164
1024 Ga0495667_0080865 3300046559 Bacteria 2112
1025 Ga0495667_0171190 3300046559 Bacteria 1395
1026 Ga0495656_0001002 3300046615 Bacteria 9128
1027 Ga0495656_0024111 3300046615 Bacteria 2399
1028 Ga0495656_0032030 3300046615 Bacteria 2137
1029 Ga0495656_0068602 3300046615 Bacteria 1568
1030 Ga0495634_0000633 3300046642 Bacteria 34239
1031 Ga0495634_0005735 3300046642 Bacteria 9486
1032 Ga0495634_0044188 3300046642 Bacteria 3016
1033 Ga0495634_0086571 3300046642 Bacteria 2040
1034 Ga0495634_0106000 3300046642 Bacteria 1812
1035 Ga0495634_0170114 3300046642 Bacteria 1369
1036 Ga0495634_0183724 3300046642 Bacteria 1308
1037 Ga0495611_0023402 3300046648 Bacteria 2680
1038 Ga0495625_0179950 3300046660 Bacteria 1407
1039 Ga0495625_0216517 3300046660 Bacteria 1257
1040 Ga0495625_0325015 3300046660 Bacteria 979
1041 Ga0495635_0000665 3300046663 Bacteria 22077
1042 Ga0495635_0009323 3300046663 Bacteria 6858
1043 Ga0495635_0010268 3300046663 Bacteria 6547
1044 Ga0495635_0011618 3300046663 Bacteria 6171
1045 Ga0495635_0019839 3300046663 Bacteria 4683
1046 Ga0495635_0020430 3300046663 Bacteria 4612
1047 Ga0495635_0033845 3300046663 Bacteria 3544
1048 Ga0495635_0057156 3300046663 Bacteria 2685
1049 Ga0495635_0100043 3300046663 Bacteria 1981
1050 Ga0495635_0137715 3300046663 Bacteria 1663
1051 Ga0495659_0002625 3300046664 Bacteria 5797
1052 Ga0495659_0005702 3300046664 Bacteria 3924
1053 Ga0495659_0050807 3300046664 Bacteria 1509
1054 Ga0495659_0072246 3300046664 Bacteria 1294
1055 Ga0495588_0015701 3300046674 Bacteria 3650
1056 Ga0495588_0033230 3300046674 Bacteria 2604
1057 Ga0495588_0034647 3300046674 Bacteria 2555
1058 Ga0495588_0084853 3300046674 Bacteria 1655
1059 Ga0495588_0123238 3300046674 Bacteria 1366
1060 Ga0495657_0013514 3300046675 Bacteria 6020
1061 Ga0495657_0015213 3300046675 Bacteria 5634
1062 Ga0495657_0017266 3300046675 Bacteria 5243
1063 Ga0495657_0152771 3300046675 Bacteria 1432
1064 Ga0495599_0001523 3300046678 Bacteria 13330
1065 Ga0495599_0021521 3300046678 Bacteria 4024
1066 Ga0495599_0035603 3300046678 Bacteria 3125
1067 Ga0495599_0195607 3300046678 Bacteria 1243
1068 Ga0495599_0273096 3300046678 Bacteria 1025
1069 Ga0495623_0013321 3300046679 Bacteria 5333
1070 Ga0495623_0013353 3300046679 Bacteria 5327
1071 Ga0495623_0023765 3300046679 Bacteria 3954
1072 Ga0495623_0096013 3300046679 Bacteria 1811
1073 Ga0495646_0000302 3300046680 Bacteria 25255
1074 Ga0495646_0008160 3300046680 Bacteria 6656
1075 Ga0495646_0023005 3300046680 Bacteria 3924
1076 Ga0495646_0024074 3300046680 Bacteria 3834
1077 Ga0495646_0024268 3300046680 Bacteria 3819
1078 Ga0495646_0050415 3300046680 Bacteria 2523
1079 Ga0495646_0052779 3300046680 Bacteria 2454
1080 Ga0495646_0111899 3300046680 Bacteria 1554
1081 Ga0495647_0001366 3300046681 Bacteria 7521
1082 Ga0495647_0012136 3300046681 Bacteria 2962
1083 Ga0495647_0025638 3300046681 Bacteria 2155
1084 Ga0495647_0048351 3300046681 Bacteria 1644
1085 Ga0495658_0000165 3300046683 Bacteria 37152
1086 Ga0495658_0000725 3300046683 Bacteria 17802
1087 Ga0495658_0012633 3300046683 Bacteria 4283
1088 Ga0495658_0021818 3300046683 Bacteria 3380
1089 Ga0495658_0078584 3300046683 Bacteria 1932
1090 Ga0495658_0158397 3300046683 Bacteria 1395
1091 Ga0495669_0059735 3300046684 Bacteria 1722
1092 Ga0495669_0173745 3300046684 Bacteria 1025
1093 Ga0495613_0006987 3300046689 Bacteria 8413
1094 Ga0495613_0017127 3300046689 Bacteria 5395
1095 Ga0495613_0030519 3300046689 Bacteria 4004
1096 Ga0495613_0037634 3300046689 Bacteria 3586
1097 Ga0495613_0072408 3300046689 Bacteria 2512
1098 Ga0495613_0196323 3300046689 Bacteria 1424
1099 Ga0495613_0224097 3300046689 Bacteria 1319
1100 Ga0495613_0346342 3300046689 Bacteria 1021
1101 Ga0495624_0004278 3300046690 Bacteria 10487
1102 Ga0495624_0009174 3300046690 Bacteria 6859
1103 Ga0495624_0018557 3300046690 Bacteria 4653
1104 Ga0495670_0000903 3300046691 Bacteria 14309
1105 Ga0495589_0026690 3300046794 Bacteria 2925
1106 Ga0495600_0000818 3300046809 Bacteria 16525
1107 Ga0495600_0003186 3300046809 Bacteria 9601
1108 Ga0495600_0017508 3300046809 Bacteria 4559
1109 Ga0495600_0034198 3300046809 Bacteria 3299
1110 Ga0495600_0055746 3300046809 Bacteria 2581
1111 Ga0495600_0138029 3300046809 Bacteria 1583
1112 Ga0495600_0209332 3300046809 Bacteria 1250
1113 Ga0495581_0000174 3300047315 Bacteria 29174
1114 Ga0495581_0010349 3300047315 Bacteria 5397
1115 Ga0495581_0089148 3300047315 Bacteria 1789
1116 Ga0495581_0092962 3300047315 Bacteria 1750
1117 Ga0495604_0000586 3300047317 Bacteria 31728
1118 Ga0495604_0011378 3300047317 Bacteria 7061
1119 Ga0495604_0032135 3300047317 Bacteria 4161
1120 Ga0495604_0041186 3300047317 Bacteria 3623
1121 Ga0495604_0122996 3300047317 Bacteria 1875
1122 Ga0495604_0203585 3300047317 Bacteria 1371
1123 Ga0495674_0002611 3300047319 Bacteria 17539
1124 Ga0495674_0006599 3300047319 Bacteria 11129
1125 Ga0495674_0008776 3300047319 Bacteria 9618
1126 Ga0495674_0044731 3300047319 Bacteria 3934
1127 Ga0495674_0044919 3300047319 Bacteria 3925
1128 Ga0495674_0047348 3300047319 Bacteria 3813
1129 Ga0495674_0055762 3300047319 Bacteria 3464
1130 Ga0495674_0061023 3300047319 Bacteria 3287
1131 Ga0495674_0212676 3300047319 Bacteria 1601
1132 Ga0495672_0051959 3300047320 Bacteria 2410
1133 Ga0495676_0008428 3300047321 Bacteria 9451
1134 Ga0495676_0109834 3300047321 Bacteria 2025
1135 Ga0495676_0132235 3300047321 Bacteria 1799
1136 Ga0495676_0215882 3300047321 Bacteria 1324
1137 Ga0495676_0225990 3300047321 Bacteria 1288
1138 Ga0495676_0249783 3300047321 Bacteria 1210
1139 Ga0495676_0307879 3300047321 Bacteria 1067
1140 Ga0495680_0001983 3300047322 Bacteria 21507
1141 Ga0495680_0002786 3300047322 Bacteria 17617
1142 Ga0495680_0018445 3300047322 Bacteria 5925
1143 Ga0495680_0046270 3300047322 Bacteria 3431
1144 Ga0495680_0086826 3300047322 Bacteria 2353
1145 Ga0495680_0128982 3300047322 Bacteria 1860
1146 Ga0495683_0107500 3300047323 Bacteria 1335
1147 Ga0495675_0002188 3300047444 Bacteria 11653
1148 Ga0495675_0002226 3300047444 Bacteria 11575
1149 Ga0495675_0006353 3300047444 Bacteria 7231
1150 Ga0495675_0025477 3300047444 Bacteria 3771
1151 Ga0495675_0033827 3300047444 Bacteria 3262
1152 Ga0495675_0178527 3300047444 Bacteria 1301
1153 Ga0495677_0067677 3300047445 Bacteria 1329
1154 Ga0495679_006235 3300047446 Bacteria 5168
1155 Ga0495673_0013916 3300047469 Bacteria 4204
1156 Ga0495673_0059113 3300047469 Bacteria 1649
1157 Ga0495673_0059625 3300047469 Bacteria 1640
1158 Ga0495684_0011529 3300047471 Bacteria 6829
1159 Ga0495684_0014074 3300047471 Bacteria 6152
1160 Ga0495684_0015612 3300047471 Bacteria 5845
1161 Ga0495684_0017881 3300047471 Bacteria 5461
1162 Ga0495684_0033194 3300047471 Bacteria 3961
1163 Ga0495684_0092302 3300047471 Bacteria 2293
1164 Ga0495684_0107771 3300047471 Bacteria 2104
1165 Ga0495684_0147683 3300047471 Bacteria 1759
1166 Ga0495593_0017972 3300047673 Bacteria 3978
1167 Ga0495593_0024670 3300047673 Bacteria 3330
1168 Ga0495593_0031691 3300047673 Bacteria 2886
1169 Ga0495593_0035570 3300047673 Bacteria 2704
1170 Ga0495593_0119720 3300047673 Bacteria 1340
1171 Ga0495593_0123556 3300047673 Bacteria 1316
1172 Ga0495602_0009747 3300048088 Bacteria 9979
1173 Ga0495602_0020909 3300048088 Bacteria 6455
1174 Ga0495602_0029841 3300048088 Bacteria 5183
1175 Ga0495602_0428087 3300048088 Bacteria 938
1176 Ga0495614_0003910 3300048089 Bacteria 6692
1177 Ga0495614_0020009 3300048089 Bacteria 2895
1178 Ga0495614_0051894 3300048089 Bacteria 1758
1179 Ga0495615_0005570 3300048090 Bacteria 2273
1180 Ga0495615_0040482 3300048090 Bacteria 1160
1181 Ga0495615_0041700 3300048090 Bacteria 1148
1182 Ga0496100_0010438 3300048903 Bacteria 5257
1183 Ga0496100_0027949 3300048903 Bacteria 3474
1184 Ga0496100_0110557 3300048903 Bacteria 1908
1185 Ga0496100_0147673 3300048903 Bacteria 1673
1186 Ga0496100_0178562 3300048903 Bacteria 1534
1187 Ga0496100_0247177 3300048903 Bacteria 1318
1188 Ga0496100_0404753 3300048903 Bacteria 1040
1189 Ga0496101_0018532 3300048904 Bacteria 4735
1190 Ga0496101_0021632 3300048904 Bacteria 4420
1191 Ga0496101_0079631 3300048904 Bacteria 2419
1192 Ga0496101_0089116 3300048904 Bacteria 2292
1193 Ga0496101_0147543 3300048904 Bacteria 1797
1194 Ga0496101_0164455 3300048904 Bacteria 1703
1195 Ga0496101_0313385 3300048904 Bacteria 1230
1196 Ga0496101_0353154 3300048904 Bacteria 1155
1197 Ga0496101_0376129 3300048904 Bacteria 1117
1198 Ga0496102_0007073 3300048905 Bacteria 9578
1199 Ga0496102_0011614 3300048905 Bacteria 7601
1200 Ga0496102_0032808 3300048905 Bacteria 4666
1201 Ga0496102_0042391 3300048905 Bacteria 4124
1202 Ga0496102_0063696 3300048905 Bacteria 3377
1203 Ga0496102_0087141 3300048905 Bacteria 2884
1204 Ga0496102_0099473 3300048905 Bacteria 2699
1205 Ga0496102_0112221 3300048905 Bacteria 2542
1206 Ga0496102_0344148 3300048905 Bacteria 1404
1207 Ga0496103_0006069 3300048906 Bacteria 7220
1208 Ga0496103_0017752 3300048906 Bacteria 4262
1209 Ga0496103_0042226 3300048906 Bacteria 2805
1210 Ga0496103_0087689 3300048906 Bacteria 1962
1211 Ga0496104_0000880 3300048907 Bacteria 25856
1212 Ga0496104_0037922 3300048907 Bacteria 4507
1213 Ga0496104_0041944 3300048907 Bacteria 4291
1214 Ga0496104_0068209 3300048907 Bacteria 3379
1215 Ga0496104_0071639 3300048907 Bacteria 3295
1216 Ga0496104_0093199 3300048907 Bacteria 2881
1217 Ga0496104_0148873 3300048907 Bacteria 2247
1218 Ga0496104_0222647 3300048907 Bacteria 1799
1219 Ga0496104_0278171 3300048907 Bacteria 1587
1220 Ga0496104_0451386 3300048907 Bacteria 1197
1221 Ga0496105_0001068 3300048908 Bacteria 18956
1222 Ga0496105_0001416 3300048908 Bacteria 16859
1223 Ga0496105_0014047 3300048908 Bacteria 6371
1224 Ga0496105_0022341 3300048908 Bacteria 5123
1225 Ga0496105_0030649 3300048908 Bacteria 4407
1226 Ga0496105_0048910 3300048908 Bacteria 3490
1227 Ga0496105_0057658 3300048908 Bacteria 3206
1228 Ga0496105_0240970 3300048908 Bacteria 1467
1229 Ga0496105_0290265 3300048908 Bacteria 1317
1230 Ga0496106_0000132 3300048909 Bacteria 56128
1231 Ga0496106_0011968 3300048909 Bacteria 6405
1232 Ga0496106_0013521 3300048909 Bacteria 6027
1233 Ga0496106_0045055 3300048909 Bacteria 3312
1234 Ga0496106_0052596 3300048909 Bacteria 3073
1235 Ga0496106_0060632 3300048909 Bacteria 2868
1236 Ga0496106_0103852 3300048909 Bacteria 2206
1237 Ga0496106_0137590 3300048909 Bacteria 1919
1238 Ga0496106_0217211 3300048909 Bacteria 1524
1239 Ga0496107_0006567 3300048910 Bacteria 8002
1240 Ga0496107_0009364 3300048910 Bacteria 6789
1241 Ga0496107_0009646 3300048910 Bacteria 6694
1242 Ga0496107_0044384 3300048910 Bacteria 3195
1243 Ga0496107_0094933 3300048910 Bacteria 2182
1244 Ga0496107_0111538 3300048910 Bacteria 2010
1245 Ga0496107_0115883 3300048910 Bacteria 1972
1246 Ga0496107_0125822 3300048910 Bacteria 1890
1247 Ga0496107_0126114 3300048910 Bacteria 1888
1248 Ga0496107_0173318 3300048910 Bacteria 1601
1249 Ga0496107_0241782 3300048910 Bacteria 1343
1250 Ga0496108_0000522 3300048911 Bacteria 30076
1251 Ga0496108_0003135 3300048911 Bacteria 13289
1252 Ga0496108_0006976 3300048911 Bacteria 9144
1253 Ga0496108_0034587 3300048911 Bacteria 4199
1254 Ga0496108_0057391 3300048911 Bacteria 3271
1255 Ga0496108_0096164 3300048911 Bacteria 2522
1256 Ga0496108_0288660 3300048911 Bacteria 1428
1257 Ga0496109_0022446 3300048912 Bacteria 5589
1258 Ga0496109_0028555 3300048912 Bacteria 4989
1259 Ga0496109_0093748 3300048912 Bacteria 2779
1260 Ga0496109_0369222 3300048912 Bacteria 1355
1261 Ga0496109_0444272 3300048912 Bacteria 1225
1262 Ga0496110_0062125 3300048913 Bacteria 3298
1263 Ga0496110_0103431 3300048913 Bacteria 2554
1264 Ga0496110_0138692 3300048913 Bacteria 2198
1265 Ga0496110_0143631 3300048913 Bacteria 2158
1266 Ga0496111_0035681 3300048914 Bacteria 3555
1267 Ga0496111_0076598 3300048914 Bacteria 2438
1268 Ga0496111_0094917 3300048914 Bacteria 2188
1269 Ga0496111_0122079 3300048914 Bacteria 1924
1270 Ga0496111_0132495 3300048914 Bacteria 1845
1271 Ga0496111_0243757 3300048914 Bacteria 1334
1272 Ga0496112_0001086 3300048915 Bacteria 20123
1273 Ga0496112_0003420 3300048915 Bacteria 13108
1274 Ga0496112_0007256 3300048915 Bacteria 9825
1275 Ga0496112_0032432 3300048915 Bacteria 5072
1276 Ga0496112_0065761 3300048915 Bacteria 3578
1277 Ga0496112_0086972 3300048915 Bacteria 3092
1278 Ga0496112_0095156 3300048915 Bacteria 2949
1279 Ga0496112_0095580 3300048915 Bacteria 2942
1280 Ga0496112_0217806 3300048915 Bacteria 1865
1281 Ga0496113_0004411 3300048916 Bacteria 8639
1282 Ga0496113_0016021 3300048916 Bacteria 5171
1283 Ga0496113_0024656 3300048916 Bacteria 4278
1284 Ga0496113_0036274 3300048916 Bacteria 3611
1285 Ga0496113_0117827 3300048916 Bacteria 2074
1286 Ga0496113_0286589 3300048916 Bacteria 1317
1287 Ga0496113_0385994 3300048916 Bacteria 1124
1288 Ga0496114_0032608 3300048917 Bacteria 4288
1289 Ga0496114_0047965 3300048917 Bacteria 3552
1290 Ga0496114_0053960 3300048917 Bacteria 3350
1291 Ga0496114_0064347 3300048917 Bacteria 3071
1292 Ga0496114_0116334 3300048917 Bacteria 2295
1293 Ga0496114_0146468 3300048917 Bacteria 2047
1294 Ga0496114_0182209 3300048917 Bacteria 1835
1295 Ga0496114_0342875 3300048917 Bacteria 1321
1296 Ga0496114_0533969 3300048917 Bacteria 1037
1297 Ga0496115_0003538 3300048918 Bacteria 11238
1298 Ga0496115_0010568 3300048918 Bacteria 6902
1299 Ga0496115_0012652 3300048918 Bacteria 6359
1300 Ga0496115_0022964 3300048918 Bacteria 4837
1301 Ga0496115_0026346 3300048918 Bacteria 4537
1302 Ga0496115_0031711 3300048918 Bacteria 4165
1303 Ga0496115_0046127 3300048918 Bacteria 3482
1304 Ga0496115_0048408 3300048918 Bacteria 3400
1305 Ga0496115_0147688 3300048918 Bacteria 1941
1306 Ga0496115_0182069 3300048918 Bacteria 1737
1307 Ga0496115_0368417 3300048918 Bacteria 1170
1308 Ga0496115_0490899 3300048918 Bacteria 988
1309 Ga0496116_0010885 3300048919 Bacteria 7585
1310 Ga0496117_0084892 3300048920 Bacteria 2064
1311 Ga0496117_0154729 3300048920 Bacteria 1352
1312 Ga0496118_0007271 3300048921 Bacteria 11791
1313 Ga0496118_0108378 3300048921 Bacteria 1852
1314 Ga0496118_0203466 3300048921 Bacteria 1170
1315 Ga0496118_0208771 3300048921 Bacteria 1148
1316 Ga0496119_0000934 3300048922 Bacteria 37665
1317 Ga0496119_0081584 3300048922 Bacteria 1862
1318 Ga0496120_0019707 3300048923 Bacteria 4307
1319 Ga0496120_0035259 3300048923 Bacteria 2990
1320 Ga0496121_0000418 3300048924 Bacteria 84182
1321 Ga0496121_0013014 3300048924 Bacteria 8989
1322 Ga0496121_0013148 3300048924 Bacteria 8928
1323 Ga0496121_0015424 3300048924 Bacteria 8009
1324 Ga0496121_0040382 3300048924 Bacteria 4095
1325 Ga0496121_0075851 3300048924 Bacteria 2684
1326 Ga0496121_0102349 3300048924 Bacteria 2207
1327 Ga0496121_0184811 3300048924 Bacteria 1500
1328 Ga0496121_0198015 3300048924 Bacteria 1434
1329 Ga0496121_0200162 3300048924 Bacteria 1424
1330 Ga0496121_0201760 3300048924 Bacteria 1417
1331 Ga0496121_0226368 3300048924 Bacteria 1313
1332 Ga0496121_0260851 3300048924 Bacteria 1196
1333 Ga0496121_0325022 3300048924 Bacteria 1034
1334 Ga0496121_0354958 3300048924 Bacteria 975
1335 Ga0496122_0031712 3300048925 Bacteria 4389
1336 Ga0496124_0001129 3300048927 Bacteria 42006
1337 Ga0496124_0192246 3300048927 Bacteria 1560
1338 Ga0496125_0000731 3300048928 Bacteria 54449
1339 Ga0496125_0051362 3300048928 Bacteria 3401
1340 Ga0496125_0074448 3300048928 Bacteria 2633
1341 Ga0496125_0167200 3300048928 Bacteria 1484
1342 Ga0496126_0004045 3300048929 Bacteria 17839
1343 Ga0496126_0004527 3300048929 Bacteria 16537
1344 Ga0496126_0010386 3300048929 Bacteria 9768
1345 Ga0496126_0023549 3300048929 Bacteria 5967
1346 Ga0496126_0032326 3300048929 Bacteria 4930
1347 Ga0496126_0061797 3300048929 Bacteria 3363
1348 Ga0496126_0064956 3300048929 Bacteria 3267
1349 Ga0496126_0108261 3300048929 Bacteria 2423
1350 Ga0496126_0109155 3300048929 Bacteria 2412
1351 Ga0496126_0117746 3300048929 Bacteria 2307
1352 Ga0496126_0146812 3300048929 Bacteria 2025
1353 Ga0496126_0155481 3300048929 Bacteria 1957
1354 Ga0496126_0170248 3300048929 Bacteria 1856
1355 Ga0496126_0199193 3300048929 Bacteria 1692
1356 Ga0496126_0248214 3300048929 Bacteria 1484
1357 Ga0496126_0261443 3300048929 Bacteria 1439
1358 Ga0501031_0058914 3300049568 Bacteria 2503
1359 Ga0501032_0045770 3300049569 Bacteria 2958
1360 Ga0501034_0045770 3300049571 Bacteria 4420
1361 Ga0501034_0073885 3300049571 Bacteria 3418
1362 Ga0501034_0160997 3300049571 Bacteria 2215
1363 Ga0501037_0030714 3300049573 Bacteria 3969
1364 Ga0501038_0042666 3300049574 Bacteria 3950
1365 Ga0501038_0178312 3300049574 Bacteria 1716
1366 Ga0501039_0062348 3300049575 Bacteria 2888
1367 Ga0501039_0093612 3300049575 Bacteria 2342
1368 Ga0501039_0197587 3300049575 Bacteria 1581
1369 Ga0501040_0048931 3300049576 Bacteria 2890
1370 Ga0501041_0094886 3300049577 Bacteria 1843
1371 Ga0501041_0127755 3300049577 Bacteria 1583
1372 Ga0501041_0177680 3300049577 Bacteria 1333
1373 Ga0501043_0303925 3300049579 Bacteria 1218
1374 Ga0501046_0029535 3300049580 Bacteria 4456
1375 Ga0501046_0151704 3300049580 Bacteria 1748
1376 Ga0501046_0243478 3300049580 Bacteria 1326
1377 Ga0501047_0004564 3300049581 Bacteria 13023
1378 Ga0501047_0049560 3300049581 Bacteria 4055
1379 Ga0501047_0094159 3300049581 Bacteria 2874
1380 Ga0501048_0170030 3300049582 Bacteria 1544
1381 Ga0501048_0382698 3300049582 Bacteria 1005
1382 Ga0501068_0289311 3300049584 Bacteria 1048
1383 Ga0501070_0209068 3300049586 Bacteria 1602
1384 Ga0501070_0347566 3300049586 Bacteria 1204
1385 Ga0501071_0115007 3300049587 Bacteria 1991
1386 Ga0501071_0541411 3300049587 Bacteria 894
1387 Ga0501072_0034483 3300049588 Bacteria 3967
1388 Ga0501073_0002140 3300049589 Bacteria 14776
1389 Ga0501073_0044295 3300049589 Bacteria 3136
1390 Ga0501073_0050512 3300049589 Bacteria 2914
1391 Ga0501074_0106074 3300049590 Bacteria 2011
1392 Ga0501075_0317016 3300049591 Bacteria 1188
1393 Ga0501076_0117795 3300049592 Bacteria 2150
1394 Ga0501077_0018891 3300049593 Bacteria 4362
1395 Ga0501077_0250104 3300049593 Bacteria 1127
1396 Ga0501079_0063022 3300049741 Bacteria 2860
1397 Ga0501079_0260645 3300049741 Bacteria 1355
1398 Ga0501079_0287845 3300049741 Bacteria 1285
1399 Ga0501080_0016431 3300049742 Bacteria 6834
1400 Ga0501080_0019709 3300049742 Bacteria 6247
1401 Ga0501080_0089568 3300049742 Bacteria 2858
1402 Ga0501081_0059785 3300049743 Bacteria 2639
1403 Ga0501081_0115830 3300049743 Bacteria 1905
1404 Ga0501081_0243305 3300049743 Bacteria 1312
1405 Ga0501035_0064798 3300049822 Bacteria 3246
1406 Ga0501044_0017240 3300049823 Bacteria 7747
1407 Ga0501044_0032621 3300049823 Bacteria 5474
1408 Ga0501044_0120153 3300049823 Bacteria 2629
1409 Ga0501044_0137129 3300049823 Bacteria 2437
1410 Ga0501045_0194191 3300049824 Bacteria 1513
1411 Ga0501045_0371276 3300049824 Bacteria 1065
1412 nmdc:mga03n38_2850_c1 3300050490 Bacteria 5441
1413 nmdc:mga00v17_180052_c1 3300050491 Bacteria 1364
1414 nmdc:mga00v17_57759_c1 3300050491 Bacteria 2374
1415 nmdc:mga0yw44_12876_c1 3300050492 Bacteria 4379
1416 nmdc:mga0yw44_331031_c1 3300050492 Bacteria 1023
1417 nmdc:mga0yw44_36164_c1 3300050492 Bacteria 2908
1418 nmdc:mga06z11_126042_c1 3300050494 Bacteria 1433
1419 nmdc:mga06z11_142671_c1 3300050494 Bacteria 1355
1420 nmdc:mga05p37_10904_c1 3300050507 Bacteria 10791
1421 nmdc:mga05p37_120825_c1 3300050507 Bacteria 3218
1422 nmdc:mga05p37_1466_c1 3300050507 Bacteria 27394
1423 nmdc:mga05p37_149125_c1 3300050507 Bacteria 2862
1424 nmdc:mga05p37_27432_c1 3300050507 Bacteria 6637
1425 nmdc:mga05p37_315_c1 3300050507 Bacteria 51176
1426 nmdc:mga05p37_358328_c1 3300050507 Bacteria 1715
1427 nmdc:mga05p37_50222_c1 3300050507 Bacteria 5129
1428 nmdc:mga05p37_528072_c1 3300050507 Bacteria 1348
1429 nmdc:mga05p37_53933_c1 3300050507 Bacteria 4946
1430 nmdc:mga05p37_597332_c1 3300050507 Bacteria 1247
1431 nmdc:mga05p37_653183_c1 3300050507 Bacteria 1177
1432 nmdc:mga09592_104620_c1 3300050508 Bacteria 2426
1433 nmdc:mga09592_2164_c1 3300050508 Bacteria 15858
1434 nmdc:mga09592_52175_c1 3300050508 Bacteria 3451
1435 nmdc:mga09592_6140_c1 3300050508 Bacteria 9783
1436 nmdc:mga09592_64155_c1 3300050508 Bacteria 3109
1437 nmdc:mga0qj67_22278_c1 3300050509 Bacteria 4866
1438 nmdc:mga0qj67_249536_c1 3300050509 Bacteria 1440
1439 nmdc:mga0qj67_304301_c1 3300050509 Bacteria 1291
1440 nmdc:mga0qj67_375256_c1 3300050509 Bacteria 1149
1441 nmdc:mga0qj67_4124_c1 3300050509 Bacteria 10530
1442 nmdc:mga0qj67_6972_c1 3300050509 Bacteria 8320
1443 nmdc:mga06r32_1041_c1 3300050510 Bacteria 25044
1444 nmdc:mga06r32_18750_c1 3300050510 Bacteria 6340
1445 nmdc:mga06r32_25105_c1 3300050510 Bacteria 5539
1446 nmdc:mga06r32_4341_c1 3300050510 Bacteria 12692
1447 nmdc:mga06r32_540_c1 3300050510 Bacteria 32863
1448 nmdc:mga06r32_604155_c1 3300050510 Bacteria 1068
1449 nmdc:mga06r32_73686_c1 3300050510 Bacteria 3308
1450 nmdc:mga06r32_9539_c1 3300050510 Bacteria 8765
1451 nmdc:mga08y16_116992_c1 3300050511 Bacteria 2775
1452 nmdc:mga08y16_17281_c1 3300050511 Bacteria 7594
1453 nmdc:mga08y16_190428_c1 3300050511 Bacteria 2128
1454 nmdc:mga08y16_203935_c1 3300050511 Bacteria 2049
1455 nmdc:mga08y16_453715_c1 3300050511 Bacteria 1307
1456 nmdc:mga08y16_586_c1 3300050511 Bacteria 33877
1457 nmdc:mga08y16_616404_c1 3300050511 Bacteria 1092
1458 nmdc:mga08y16_831_c1 3300050511 Bacteria 29648
1459 nmdc:mga08y16_96846_c1 3300050511 Bacteria 3072
1460 nmdc:mga0n895_195358_c1 3300050512 Bacteria 2054
1461 nmdc:mga0n895_216508_c1 3300050512 Bacteria 1945
1462 nmdc:mga0n895_3117_c1 3300050512 Bacteria 13214
1463 nmdc:mga0n895_360659_c1 3300050512 Bacteria 1472
1464 nmdc:mga0n895_393685_c1 3300050512 Bacteria 1401
1465 nmdc:mga0n895_490414_c1 3300050512 Bacteria 1238
1466 nmdc:mga0n895_624172_c1 3300050512 Bacteria 1078
1467 nmdc:mga0n895_739012_c1 3300050512 Bacteria 978
1468 nmdc:mga0n895_74753_c1 3300050512 Bacteria 3367
1469 nmdc:mga0rr50_10295_c1 3300050513 Bacteria 5926
1470 nmdc:mga0rr50_120962_c1 3300050513 Bacteria 2084
1471 nmdc:mga0rr50_5517_c1 3300050513 Bacteria 7559
1472 nmdc:mga0rr50_6196_c1 3300050513 Bacteria 7247
1473 nmdc:mga08x19_212668_c1 3300050514 Bacteria 1327
1474 nmdc:mga08x19_27850_c1 3300050514 Bacteria 3050
1475 nmdc:mga08x19_8561_c1 3300050514 Bacteria 6097
1476 nmdc:mga0a205_1775_c1 3300050515 Bacteria 18650
1477 nmdc:mga0a205_264967_c1 3300050515 Bacteria 1596
1478 Ga0495601_0001373 3300053077 Bacteria 13393
1479 Ga0495601_0057005 3300053077 Bacteria 2475
1480 Ga0495601_0233380 3300053077 Bacteria 1201
1481 Ga0495612_0001291 3300053078 Bacteria 10336
1482 Ga0495612_0013278 3300053078 Bacteria 3317
1483 Ga0495612_0015371 3300053078 Bacteria 3067
1484 Ga0495612_0020778 3300053078 Bacteria 2632
1485 Ga0495612_0025441 3300053078 Bacteria 2376
1486 Ga0495612_0077839 3300053078 Bacteria 1390
1487 Ga0500635_0013237 3300053080 Bacteria 2391
1488 Ga0495655_0016284 3300053083 Bacteria 1598
1489 Ga0495595_0001034 3300053084 Bacteria 10719
1490 Ga0495595_0001403 3300053084 Bacteria 9362
1491 Ga0495595_0002352 3300053084 Bacteria 7370
1492 Ga0495595_0026025 3300053084 Bacteria 2596
1493 Ga0495595_0033082 3300053084 Bacteria 2331
1494 Ga0495595_0234914 3300053084 Bacteria 916
1495 Ga0495619_0000840 3300053085 Bacteria 20168
1496 Ga0495619_0007058 3300053085 Bacteria 7109
1497 Ga0495619_0008366 3300053085 Bacteria 6540
1498 Ga0495619_0015820 3300053085 Bacteria 4775
1499 Ga0495619_0040820 3300053085 Bacteria 3033
1500 Ga0495619_0058705 3300053085 Bacteria 2554
1501 Ga0495619_0062434 3300053085 Bacteria 2480
1502 Ga0495619_0081446 3300053085 Bacteria 2179
1503 Ga0495619_0279066 3300053085 Bacteria 1158
1504 Ga0500643_000013 3300053087 Bacteria 324296
1505 Ga0500643_004959 3300053087 Bacteria 5853
1506 Ga0500643_022810 3300053087 Bacteria 2009
1507 Ga0500646_0047499 3300053090 Bacteria 1228
1508 Ga0500647_0028989 3300053091 Bacteria 2623
1509 Ga0500583_0046098 3300053092 Bacteria 2005
1510 Ga0500583_0128417 3300053092 Bacteria 1256
1511 Ga0500651_0000616 3300053093 Bacteria 17766
1512 Ga0500566_0000175 3300053094 Bacteria 32618
1513 Ga0500566_0003046 3300053094 Bacteria 10026
1514 Ga0500566_0006647 3300053094 Bacteria 6847
1515 Ga0500566_0057559 3300053094 Bacteria 2208
1516 Ga0500566_0161973 3300053094 Bacteria 1165
1517 Ga0500640_086105 3300053095 Bacteria 1324
1518 Ga0500641_0036402 3300053096 Bacteria 1969
1519 Ga0500641_0120655 3300053096 Bacteria 1130
1520 Ga0500555_002934 3300053103 Bacteria 4886
1521 Ga0500556_0109675 3300053104 Bacteria 1069
1522 Ga0500572_000114 3300053111 Bacteria 26963
1523 Ga0500572_009862 3300053111 Bacteria 2269
1524 Ga0500595_000068 3300053119 Bacteria 73931
1525 Ga0500595_008406 3300053119 Bacteria 4216
1526 Ga0500595_009450 3300053119 Bacteria 3936
1527 Ga0500595_021582 3300053119 Bacteria 2296
1528 Ga0500595_032262 3300053119 Bacteria 1750
1529 Ga0500595_041065 3300053119 Bacteria 1488
1530 Ga0500595_044503 3300053119 Bacteria 1406
1531 Ga0500607_068838 3300053121 Bacteria 1831
1532 Ga0500642_0021517 3300053130 Bacteria 2556
1533 Ga0500559_0001756 3300053136 Bacteria 11890
1534 Ga0500559_0012809 3300053136 Bacteria 3559
1535 Ga0500559_0032940 3300053136 Bacteria 2229
1536 Ga0500568_0017675 3300053139 Bacteria 3143
1537 Ga0500568_0053071 3300053139 Bacteria 1590
1538 Ga0500590_065153 3300053148 Bacteria 1823
1539 Ga0500603_000248 3300053150 Bacteria 14177
1540 Ga0500603_001082 3300053150 Bacteria 6406
1541 Ga0500604_0029703 3300053151 Bacteria 1595
1542 Ga0500616_0068821 3300053153 Bacteria 1812
1543 Ga0500638_036593 3300053162 Bacteria 2380
1544 Ga0500638_103030 3300053162 Bacteria 1328
1545 Ga0500639_000006 3300053163 Bacteria 165068
1546 Ga0500636_0001375 3300053177 Bacteria 13212
1547 Ga0500636_0073559 3300053177 Bacteria 1979
1548 Ga0500637_0000482 3300053178 Bacteria 15406
1549 Ga0500637_0018743 3300053178 Bacteria 3722
1550 Ga0500637_0111201 3300053178 Bacteria 1588
1551 Ga0500637_0174753 3300053178 Bacteria 1233
1552 Ga0500645_007476 3300053730 Bacteria 3802
1553 Ga0500645_033811 3300053730 Bacteria 1528
1554 Ga0500596_004758 3300053735 Bacteria 2459
1555 Ga0500596_022204 3300053735 Bacteria 958
1556 Ga0500601_000287 3300053737 Bacteria 9581
1557 Ga0501084_0136951 3300054114 Bacteria 2061
1558 Ga0501084_0142391 3300054114 Bacteria 2019
1559 Ga0501084_0175242 3300054114 Bacteria 1810
1560 Ga0500661_002150 3300055283 Bacteria 3719
1561 Ga0500661_007310 3300055283 Bacteria 2046
1562 Ga0501082_0065338 3300060353 Bacteria 3133
1563 Ga0501082_0127746 3300060353 Bacteria 2205
1564 Ga0501082_0371628 3300060353 Bacteria 1247
1565 Ga0530510_0036129 3300061734 Bacteria 3561
1566 Ga0530510_0061492 3300061734 Bacteria 2719
1567 Ga0530510_0063940 3300061734 Bacteria 2665
1568 Ga0530510_0188941 3300061734 Bacteria 1529

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025929 Ga0207664_10046942 Ga0207664_100469423 246
2 3300045976 Ga0466967_0822993 Ga0466967_0822993_65_844 255
3 3300050511 nmdc:mga08y16_453715_c1 nmdc:mga08y16_453715_c1_18_803 259
4 3300046642 Ga0495634_0183724 Ga0495634_0183724_26_808 260
5 3300046526 Ga0495666_0191930 Ga0495666_0191930_42_827 261
6 3300048929 Ga0496126_0248214 Ga0496126_0248214_11_796 261
7 3300035117 Ga0373953_0002671 Ga0373953_0002671_4594_5382 262
8 3300035171 Ga0373946_0021242 Ga0373946_0021242_1702_2490 262
9 3300035692 Ga0373935_0099904 Ga0373935_0099904_1097_1891 262
10 3300042436 Ga0439435_0034972 Ga0439435_0034972_18_806 262
11 3300046460 Ga0495638_0023757 Ga0495638_0023757_1914_2795 262
12 3300046461 Ga0495641_0207854 Ga0495641_0207854_18_812 262
13 3300046463 Ga0495653_0015320 Ga0495653_0015320_16_810 262
14 3300046525 Ga0495663_0065065 Ga0495663_0065065_23_817 262
15 3300047444 Ga0495675_0178527 Ga0495675_0178527_484_1278 262
16 3300048090 Ga0495615_0005570 Ga0495615_0005570_1470_2258 262
17 3300048903 Ga0496100_0247177 Ga0496100_0247177_28_822 262
18 3300048921 Ga0496118_0203466 Ga0496118_0203466_368_1156 262
19 3300049587 Ga0501071_0541411 Ga0501071_0541411_85_879 262
20 3300049824 Ga0501045_0371276 Ga0501045_0371276_253_1041 262
21 3300053084 Ga0495595_0234914 Ga0495595_0234914_101_895 262
22 3300053094 Ga0500566_0161973 Ga0500566_0161973_356_1150 262
23 3300028794 Ga0307515_10000950 Ga0307515_1000095042 263
24 3300031456 Ga0307513_10381425 Ga0307513_103814251 263
25 3300049743 Ga0501081_0115830 Ga0501081_0115830_1085_1894 264
26 3300039450 Ga0436363_0852619 Ga0436363_0852619_607_1494 272
27 3300048929 Ga0496126_0155481 Ga0496126_0155481_17_937 274
28 3300005436 Ga0070713_100036360 Ga0070713_1000363602 275
29 3300005437 Ga0070710_10008606 Ga0070710_100086062 275
30 3300005440 Ga0070705_100213462 Ga0070705_1002134621 275
31 3300005545 Ga0070695_100453832 Ga0070695_1004538321 275
32 3300005548 Ga0070665_100063637 Ga0070665_1000636372 275
33 3300006237 Ga0097621_100097759 Ga0097621_1000977592 275
34 3300006358 Ga0068871_100074844 Ga0068871_1000748443 275
35 3300009098 Ga0105245_10100413 Ga0105245_101004132 275
36 3300009101 Ga0105247_10058347 Ga0105247_100583472 275
37 3300009148 Ga0105243_10151050 Ga0105243_101510502 275
38 3300009176 Ga0105242_10009244 Ga0105242_100092446 275
39 3300009545 Ga0105237_10029474 Ga0105237_100294742 275
40 3300010375 Ga0105239_10067319 Ga0105239_100673192 275
41 3300013296 Ga0157374_10550822 Ga0157374_105508221 275
42 3300013306 Ga0163162_10169824 Ga0163162_101698242 275
43 3300021441 Ga0213871_10001534 Ga0213871_100015343 275
44 3300025898 Ga0207692_10034977 Ga0207692_100349773 275
45 3300025914 Ga0207671_10228502 Ga0207671_102285021 275
46 3300025916 Ga0207663_10195863 Ga0207663_101958632 275
47 3300025928 Ga0207700_10084608 Ga0207700_100846082 275
48 3300025929 Ga0207664_10053269 Ga0207664_100532691 275
49 3300025934 Ga0207686_10007615 Ga0207686_100076153 275
50 3300025935 Ga0207709_10017654 Ga0207709_100176544 275
51 3300025941 Ga0207711_10039259 Ga0207711_100392592 275
52 3300035088 Ga0373940_0045662 Ga0373940_0045662_129_1010 275
53 3300039438 Ga0436360_1231835 Ga0436360_1231835_1874_2746 275
54 3300039453 Ga0436362_0373621 Ga0436362_0373621_859_1740 275
55 3300048903 Ga0496100_0027949 Ga0496100_0027949_1327_2208 275
56 3300048904 Ga0496101_0018532 Ga0496101_0018532_60_941 275
57 3300048907 Ga0496104_0148873 Ga0496104_0148873_182_1063 275
58 3300048908 Ga0496105_0014047 Ga0496105_0014047_3739_4620 275
59 3300048909 Ga0496106_0052596 Ga0496106_0052596_1782_2663 275
60 3300048910 Ga0496107_0006567 Ga0496107_0006567_5024_5905 275
61 3300048911 Ga0496108_0034587 Ga0496108_0034587_185_1066 275
62 3300048912 Ga0496109_0369222 Ga0496109_0369222_47_928 275
63 3300048914 Ga0496111_0076598 Ga0496111_0076598_670_1551 275
64 3300048917 Ga0496114_0116334 Ga0496114_0116334_255_1136 275
65 3300009147 Ga0114129_10087092 Ga0114129_100870925 276
66 3300045836 Ga0466958_0080961 Ga0466958_0080961_1078_1965 276
67 3300005458 Ga0070681_10069392 Ga0070681_100693922 277
68 3300039447 Ga0436361_0536993 Ga0436361_0536993_681_1562 277
69 3300045049 Ga0466959_0010466 Ga0466959_0010466_5523_6404 277
70 3300003659 JGI25404J52841_10010659 JGI25404J52841_100106592 278
71 3300005983 Ga0081540_1000099 Ga0081540_100009912 278
72 3300053104 Ga0500556_0109675 Ga0500556_0109675_216_1052 278
73 3300006847 Ga0075431_100006331 Ga0075431_1000063312 279
74 3300035725 Ga0373947_0319309 Ga0373947_0319309_74_946 279
75 3300036401 Ga0373937_0270329 Ga0373937_0270329_647_1519 279
76 3300050510 nmdc:mga06r32_4341_c1 nmdc:mga06r32_4341_c1_9310_10191 279
77 3300053077 Ga0495601_0057005 Ga0495601_0057005_123_995 279
78 3300005355 Ga0070671_100026397 Ga0070671_1000263973 280
79 3300005456 Ga0070678_100006358 Ga0070678_1000063585 280
80 3300005457 Ga0070662_100014882 Ga0070662_1000148825 280
81 3300009093 Ga0105240_10226329 Ga0105240_102263292 280
82 3300009177 Ga0105248_10099014 Ga0105248_100990142 280
83 3300013100 Ga0157373_10246102 Ga0157373_102461022 280
84 3300013297 Ga0157378_10035910 Ga0157378_100359102 280
85 3300013308 Ga0157375_10062186 Ga0157375_100621862 280
86 3300014969 Ga0157376_10064418 Ga0157376_100644182 280
87 3300021361 Ga0213872_10031730 Ga0213872_100317301 280
88 3300025933 Ga0207706_10071560 Ga0207706_100715603 280
89 3300026121 Ga0207683_10015216 Ga0207683_100152163 280
90 3300035086 Ga0373934_0005104 Ga0373934_0005104_549_1430 280
91 3300035118 Ga0373954_0007974 Ga0373954_0007974_2065_2946 280
92 3300035119 Ga0373956_0017265 Ga0373956_0017265_644_1525 280
93 3300035120 Ga0373957_0007942 Ga0373957_0007942_1878_2759 280
94 3300035172 Ga0373955_0019876 Ga0373955_0019876_2441_3322 280
95 3300035410 Ga0373924_0002411 Ga0373924_0002411_2628_3509 280
96 3300035724 Ga0373933_0005116 Ga0373933_0005116_4152_5033 280
97 3300039438 Ga0436360_0894372 Ga0436360_0894372_290_1162 280
98 3300039447 Ga0436361_0180224 Ga0436361_0180224_741_1613 280
99 3300046454 Ga0495592_0147547 Ga0495592_0147547_196_1077 280
100 3300046462 Ga0495651_0004178 Ga0495651_0004178_5188_6069 280
101 3300046463 Ga0495653_0009658 Ga0495653_0009658_2640_3521 280
102 3300046477 Ga0495664_0103346 Ga0495664_0103346_771_1652 280
103 3300046511 Ga0495608_0027213 Ga0495608_0027213_1268_2149 280
104 3300046514 Ga0495618_0044979 Ga0495618_0044979_421_1302 280
105 3300046516 Ga0495628_0009067 Ga0495628_0009067_6274_7155 280
106 3300046533 Ga0495640_0025552 Ga0495640_0025552_1782_2663 280
107 3300046535 Ga0495586_0222192 Ga0495586_0222192_89_970 280
108 3300046536 Ga0495587_0001257 Ga0495587_0001257_8864_9745 280
109 3300046543 Ga0495645_0077450 Ga0495645_0077450_1484_2365 280
110 3300046559 Ga0495667_0005240 Ga0495667_0005240_6401_7282 280
111 3300046642 Ga0495634_0044188 Ga0495634_0044188_1027_1908 280
112 3300046663 Ga0495635_0019839 Ga0495635_0019839_1555_2436 280
113 3300046675 Ga0495657_0013514 Ga0495657_0013514_2082_2963 280
114 3300046678 Ga0495599_0035603 Ga0495599_0035603_195_1076 280
115 3300046679 Ga0495623_0023765 Ga0495623_0023765_2653_3534 280
116 3300046680 Ga0495646_0000302 Ga0495646_0000302_5461_6342 280
117 3300046689 Ga0495613_0346342 Ga0495613_0346342_29_910 280
118 3300047317 Ga0495604_0203585 Ga0495604_0203585_70_951 280
119 3300047319 Ga0495674_0055762 Ga0495674_0055762_1316_2197 280
120 3300047322 Ga0495680_0002786 Ga0495680_0002786_899_1780 280
121 3300047444 Ga0495675_0002188 Ga0495675_0002188_421_1302 280
122 3300048088 Ga0495602_0009747 Ga0495602_0009747_421_1302 280
123 3300048905 Ga0496102_0087141 Ga0496102_0087141_11_892 280
124 3300048915 Ga0496112_0095580 Ga0496112_0095580_1186_2067 280
125 3300053080 Ga0500635_0013237 Ga0500635_0013237_1535_2377 280
126 3300053084 Ga0495595_0033082 Ga0495595_0033082_207_1088 280
127 3300053085 Ga0495619_0015820 Ga0495619_0015820_1845_2726 280
128 3300005435 Ga0070714_100007037 Ga0070714_1000070378 281
129 3300005518 Ga0070699_100002421 Ga0070699_1000024216 281
130 3300009553 Ga0105249_10268799 Ga0105249_102687992 281
131 3300039438 Ga0436360_1063913 Ga0436360_1063913_270_1148 281
132 3300039450 Ga0436363_0985963 Ga0436363_0985963_731_1687 281
133 3300039450 Ga0436363_0986232 Ga0436363_0986232_1806_2699 281
134 3300048090 Ga0495615_0041700 Ga0495615_0041700_90_971 281
135 3300053083 Ga0495655_0016284 Ga0495655_0016284_60_941 281
136 iso_pu_bacteria 2513237104 2513717736 284
137 iso_pu_bacteria 2517093001 2517104399 284
138 iso_pu_bacteria 2524023205 2524438366 284
139 iso_pu_bacteria 2528768022 2528854628 284
140 iso_pu_bacteria 2744054633 2745078483 284
141 iso_pu_bacteria 2824600985 2824607194 284
142 iso_pu_bacteria 2824609381 2824615106 284
143 iso_pu_bacteria 2824653114 2824660174 284
144 iso_pu_bacteria 2824661429 2824668457 284
145 iso_pu_bacteria 2824704595 2824712883 284
146 iso_pu_bacteria 2824753945 2824761438 284
147 iso_pu_bacteria 2824763712 2824771214 284
148 iso_pu_bacteria 2844315083 2844321147 284
149 iso_pu_bacteria 2876761206 2876767468 284
150 iso_pu_bacteria 2879099564 2879100159 284
151 iso_pu_bacteria 2885409591 2885414215 284
152 iso_pu_bacteria 2888388044 2888391762 284
153 iso_pu_bacteria 2888419890 2888426657 284
154 iso_pu_bacteria 2903727486 2903728571 284
155 iso_pu_bacteria 2904711408 2904713722 284
156 iso_pu_bacteria 2906602504 2906607762 284
157 iso_pu_bacteria 2922368715 2922370504 284
158 iso_pu_bacteria 2929615660 2929620084 284
159 iso_pu_bacteria 2929624759 2929629397 284
160 iso_pu_bacteria 2932784394 2932791440 284
161 iso_pu_bacteria 2932809354 2932816694 284
162 iso_pu_bacteria 2932818245 2932824124 284
163 iso_pu_bacteria 2932828146 2932835342 284
164 iso_pu_bacteria 2933577622 2933582001 284
165 iso_pu_bacteria 2935616580 2935621085 284
166 iso_pu_bacteria 2935638405 2935643608 284
167 iso_pu_bacteria 2935665750 2935671082 284
168 iso_pu_bacteria 2935675223 2935681312 284
169 iso_pu_bacteria 2935684952 2935689342 284
170 iso_pu_bacteria 2935694250 2935699920 284
171 iso_pu_bacteria 2935703347 2935712149 284
172 iso_pu_bacteria 2935713505 2935720288 284
173 iso_pu_bacteria 2935722832 2935728095 284
174 iso_pu_bacteria 2935732158 2935737308 284
175 iso_pu_bacteria 2935741537 2935746631 284
176 iso_pu_bacteria 2935750917 2935757598 284
177 iso_pu_bacteria 2935760218 2935763974 284
178 iso_pu_bacteria 2935801545 2935807949 284
179 iso_pu_bacteria 2935810662 2935818715 284
180 iso_pu_bacteria 2935827899 2935833125 284
181 iso_pu_bacteria 2935837841 2935844219 284
182 iso_pu_bacteria 2935855204 2935859722 284
183 iso_pu_bacteria 2935864058 2935872120 284
184 iso_pu_bacteria 2935873716 2935878956 284
185 iso_pu_bacteria 2935959822 2935965669 284
186 iso_pu_bacteria 2935992306 2936000303 284
187 iso_pu_bacteria 2936002035 2936008461 284
188 iso_pu_bacteria 2936037263 2936045525 284
189 iso_pu_bacteria 2940556831 2940563580 284
190 iso_pu_bacteria 2941531003 2941537323 284
191 iso_pu_bacteria 2941538514 2941542551 284
192 iso_pu_bacteria 3005710791 3005717207 284
193 iso_pu_bacteria 3005718088 3005724178 284
194 iso_pu_bacteria 8006926726 8006929302 284
195 iso_pu_bacteria 8016511872 8016519437 284
196 iso_pu_bacteria 8017057580 8017066084 284
197 iso_pu_bacteria 8019576017 8019578550 284
198 iso_pu_bacteria 8019586578 8019596598 284
199 iso_pu_bacteria 8019597564 8019605105 284
200 iso_pu_bacteria 8055742211 8055750163 284
201 iso_pu_bacteria 8056967851 8056975944 284
202 3300006844 Ga0075428_100214644 Ga0075428_1002146442 285
203 3300009094 Ga0111539_10093964 Ga0111539_100939644 285
204 3300009147 Ga0114129_10048312 Ga0114129_100483122 285
205 3300053085 Ga0495619_0062434 Ga0495619_0062434_629_1510 285
206 iso_pu_bacteria 3003930520 3003934232 285
207 iso_pu_bacteria 2508501128 2509146573 286
208 iso_pu_bacteria 2513237098 2513671560 286
209 iso_pu_bacteria 2513237141 2513887791 286
210 iso_pu_bacteria 2524023210 2524464867 286
211 iso_pu_bacteria 2524023228 2524538240 286
212 iso_pu_bacteria 2791355199 2793080356 286
213 iso_pu_bacteria 2904699407 2904706724 286
214 iso_pu_bacteria 2917554339 2917556379 286
215 iso_pu_bacteria 3005474847 3005476366 286
216 iso_pu_bacteria 8006933436 8006937705 286
217 iso_pu_bacteria 8006973647 8006977736 286
218 iso_pu_bacteria 8006984368 8006989787 286
219 3300049577 Ga0501041_0127755 Ga0501041_0127755_137_1018 287
220 3300049588 Ga0501072_0034483 Ga0501072_0034483_1695_2576 287
221 3300054114 Ga0501084_0142391 Ga0501084_0142391_142_1023 287
222 3300060353 Ga0501082_0127746 Ga0501082_0127746_620_1501 287
223 3300061734 Ga0530510_0188941 Ga0530510_0188941_546_1427 287
224 iso_pu_bacteria 2738543024 2739306717 287
225 iso_pu_bacteria 2876377896 2876382758 287
226 iso_pu_bacteria 2883291878 2883294548 287
227 iso_pu_bacteria 2885305155 2885311784 287
228 iso_pu_bacteria 2885326080 2885333723 287
229 iso_pu_bacteria 2885334103 2885337129 287
230 iso_pu_bacteria 2938014810 2938015039 287
231 iso_pu_bacteria 2968117919 2968120314 287
232 3300005262 Ga0065165_1002212 Ga0065165_100221212 288
233 3300005347 Ga0070668_100114349 Ga0070668_1001143492 288
234 3300005455 Ga0070663_100029050 Ga0070663_1000290505 288
235 3300005548 Ga0070665_100092135 Ga0070665_1000921353 288
236 3300005578 Ga0068854_100451225 Ga0068854_1004512252 288
237 3300005616 Ga0068852_100084171 Ga0068852_1000841712 288
238 3300005617 Ga0068859_100562279 Ga0068859_1005622792 288
239 3300005983 Ga0081540_1055168 Ga0081540_10551682 288
240 3300006186 Ga0075369_10026101 Ga0075369_100261012 288
241 3300006931 Ga0097620_100562333 Ga0097620_1005623332 288
242 3300009093 Ga0105240_10120765 Ga0105240_101207653 288
243 3300009098 Ga0105245_10578883 Ga0105245_105788831 288
244 3300009174 Ga0105241_10045672 Ga0105241_100456723 288
245 3300009174 Ga0105241_10160193 Ga0105241_101601932 288
246 3300009545 Ga0105237_10001334 Ga0105237_1000133428 288
247 3300010375 Ga0105239_10128998 Ga0105239_101289983 288
248 3300010375 Ga0105239_10334965 Ga0105239_103349652 288
249 3300014325 Ga0163163_10189779 Ga0163163_101897792 288
250 3300025230 Ga0209563_102374 Ga0209563_1023745 288
251 3300025254 Ga0209148_1000232 Ga0209148_100023267 288
252 3300025261 Ga0209233_1005430 Ga0209233_10054301 288
253 3300025261 Ga0209233_1014462 Ga0209233_10144622 288
254 3300025272 Ga0209455_1004104 Ga0209455_10041043 288
255 3300025284 Ga0209130_1027165 Ga0209130_10271652 288
256 3300025297 Ga0209758_1016277 Ga0209758_10162772 288
257 3300025299 Ga0209256_1015886 Ga0209256_10158861 288
258 3300025302 Ga0207426_1002604 Ga0207426_10026048 288
259 3300025911 Ga0207654_10057274 Ga0207654_100572742 288
260 3300025913 Ga0207695_10000123 Ga0207695_1000012367 288
261 3300025914 Ga0207671_10003762 Ga0207671_1000376216 288
262 3300025945 Ga0207679_10557763 Ga0207679_105577631 288
263 3300025972 Ga0207668_10080478 Ga0207668_100804782 288
264 3300026078 Ga0207702_10581584 Ga0207702_105815841 288
265 3300026142 Ga0207698_10106079 Ga0207698_101060792 288
266 3300033180 Ga0307510_10012742 Ga0307510_100127429 288
267 3300033180 Ga0307510_10153347 Ga0307510_101533472 288
268 3300033180 Ga0307510_10251707 Ga0307510_102517072 288
269 3300046454 Ga0495592_0070492 Ga0495592_0070492_1493_2359 288
270 3300046459 Ga0495629_0341869 Ga0495629_0341869_58_924 288
271 3300046460 Ga0495638_0012222 Ga0495638_0012222_2878_3744 288
272 3300046462 Ga0495651_0062646 Ga0495651_0062646_779_1645 288
273 3300046462 Ga0495651_0149976 Ga0495651_0149976_98_964 288
274 3300046463 Ga0495653_0189863 Ga0495653_0189863_170_1036 288
275 3300046507 Ga0495606_0136539 Ga0495606_0136539_400_1266 288
276 3300046511 Ga0495608_0015551 Ga0495608_0015551_2882_3748 288
277 3300046516 Ga0495628_0090027 Ga0495628_0090027_1100_1966 288
278 3300046524 Ga0495648_0005065 Ga0495648_0005065_2201_3067 288
279 3300046529 Ga0495652_0074459 Ga0495652_0074459_1173_2039 288
280 3300046529 Ga0495652_0194087 Ga0495652_0194087_387_1253 288
281 3300046533 Ga0495640_0037146 Ga0495640_0037146_236_1102 288
282 3300046533 Ga0495640_0043398 Ga0495640_0043398_1725_2591 288
283 3300046536 Ga0495587_0046473 Ga0495587_0046473_1496_2362 288
284 3300046543 Ga0495645_0137680 Ga0495645_0137680_621_1487 288
285 3300046559 Ga0495667_0038944 Ga0495667_0038944_711_1577 288
286 3300046660 Ga0495625_0179950 Ga0495625_0179950_530_1396 288
287 3300046663 Ga0495635_0033845 Ga0495635_0033845_1570_2436 288
288 3300046663 Ga0495635_0057156 Ga0495635_0057156_231_1097 288
289 3300046675 Ga0495657_0017266 Ga0495657_0017266_3177_4043 288
290 3300046679 Ga0495623_0096013 Ga0495623_0096013_694_1560 288
291 3300046680 Ga0495646_0024268 Ga0495646_0024268_2513_3379 288
292 3300046809 Ga0495600_0034198 Ga0495600_0034198_1469_2335 288
293 3300047317 Ga0495604_0011378 Ga0495604_0011378_1651_2517 288
294 3300047319 Ga0495674_0006599 Ga0495674_0006599_6442_7308 288
295 3300047323 Ga0495683_0107500 Ga0495683_0107500_10_876 288
296 3300047444 Ga0495675_0025477 Ga0495675_0025477_1979_2845 288
297 3300047469 Ga0495673_0059113 Ga0495673_0059113_693_1559 288
298 3300048088 Ga0495602_0020909 Ga0495602_0020909_2073_2939 288
299 3300048088 Ga0495602_0428087 Ga0495602_0428087_59_925 288
300 3300048903 Ga0496100_0404753 Ga0496100_0404753_70_936 288
301 3300048904 Ga0496101_0147543 Ga0496101_0147543_918_1784 288
302 3300048907 Ga0496104_0222647 Ga0496104_0222647_677_1543 288
303 3300048907 Ga0496104_0451386 Ga0496104_0451386_32_898 288
304 3300048908 Ga0496105_0022341 Ga0496105_0022341_3357_4223 288
305 3300048908 Ga0496105_0030649 Ga0496105_0030649_807_1673 288
306 3300048910 Ga0496107_0044384 Ga0496107_0044384_1739_2605 288
307 3300048912 Ga0496109_0444272 Ga0496109_0444272_171_1037 288
308 3300048913 Ga0496110_0143631 Ga0496110_0143631_59_925 288
309 3300048914 Ga0496111_0094917 Ga0496111_0094917_243_1109 288
310 3300048917 Ga0496114_0342875 Ga0496114_0342875_417_1283 288
311 3300048919 Ga0496116_0010885 Ga0496116_0010885_3855_4721 288
312 3300048920 Ga0496117_0084892 Ga0496117_0084892_1012_1878 288
313 3300048922 Ga0496119_0000934 Ga0496119_0000934_23613_24479 288
314 3300048923 Ga0496120_0019707 Ga0496120_0019707_727_1593 288
315 3300048923 Ga0496120_0035259 Ga0496120_0035259_815_1681 288
316 3300048924 Ga0496121_0015424 Ga0496121_0015424_5941_6807 288
317 3300048924 Ga0496121_0260851 Ga0496121_0260851_258_1124 288
318 3300048929 Ga0496126_0146812 Ga0496126_0146812_574_1440 288
319 3300050492 nmdc:mga0yw44_12876_c1 nmdc:mga0yw44_12876_c1_1459_2325 288
320 3300053087 Ga0500643_000013 Ga0500643_000013_245324_246190 288
321 3300053092 Ga0500583_0046098 Ga0500583_0046098_634_1500 288
322 3300053094 Ga0500566_0006647 Ga0500566_0006647_3325_4191 288
323 3300053094 Ga0500566_0057559 Ga0500566_0057559_302_1168 288
324 3300053096 Ga0500641_0120655 Ga0500641_0120655_83_949 288
325 3300053103 Ga0500555_002934 Ga0500555_002934_624_1490 288
326 3300053119 Ga0500595_021582 Ga0500595_021582_793_1659 288
327 3300053121 Ga0500607_068838 Ga0500607_068838_224_1090 288
328 3300053130 Ga0500642_0021517 Ga0500642_0021517_427_1293 288
329 3300053139 Ga0500568_0017675 Ga0500568_0017675_1560_2426 288
330 3300053177 Ga0500636_0001375 Ga0500636_0001375_8835_9701 288
331 3300053730 Ga0500645_007476 Ga0500645_007476_973_1839 288
332 3300053737 Ga0500601_000287 Ga0500601_000287_3993_4859 288
333 3300055283 Ga0500661_007310 Ga0500661_007310_1001_1867 288
334 iso_pu_bacteria 2899803654 2899805900 288
335 3300003203 JGI25406J46586_10006913 JGI25406J46586_100069133 289
336 3300005329 Ga0070683_100079617 Ga0070683_1000796172 289
337 3300005336 Ga0070680_100008875 Ga0070680_1000088753 289
338 3300005336 Ga0070680_100313883 Ga0070680_1003138831 289
339 3300005337 Ga0070682_100386906 Ga0070682_1003869061 289
340 3300005353 Ga0070669_100153719 Ga0070669_1001537192 289
341 3300005353 Ga0070669_100395455 Ga0070669_1003954551 289
342 3300005434 Ga0070709_10001107 Ga0070709_100011074 289
343 3300005436 Ga0070713_100006481 Ga0070713_1000064815 289
344 3300005436 Ga0070713_100020309 Ga0070713_1000203095 289
345 3300005439 Ga0070711_100133385 Ga0070711_1001333852 289
346 3300005439 Ga0070711_100193063 Ga0070711_1001930631 289
347 3300005458 Ga0070681_10078659 Ga0070681_100786592 289
348 3300005458 Ga0070681_10358733 Ga0070681_103587332 289
349 3300005458 Ga0070681_10521681 Ga0070681_105216811 289
350 3300005530 Ga0070679_100374278 Ga0070679_1003742782 289
351 3300005530 Ga0070679_100385856 Ga0070679_1003858562 289
352 3300005535 Ga0070684_100019618 Ga0070684_1000196185 289
353 3300005535 Ga0070684_100086984 Ga0070684_1000869842 289
354 3300005539 Ga0068853_100030114 Ga0068853_1000301142 289
355 3300005563 Ga0068855_100078606 Ga0068855_1000786062 289
356 3300005563 Ga0068855_100147620 Ga0068855_1001476203 289
357 3300005563 Ga0068855_100444395 Ga0068855_1004443952 289
358 3300005564 Ga0070664_100281910 Ga0070664_1002819102 289
359 3300005843 Ga0068860_100001648 Ga0068860_1000016486 289
360 3300005983 Ga0081540_1041618 Ga0081540_10416182 289
361 3300005985 Ga0081539_10004774 Ga0081539_1000477411 289
362 3300006028 Ga0070717_10104266 Ga0070717_101042663 289
363 3300006173 Ga0070716_100016254 Ga0070716_1000162542 289
364 3300006175 Ga0070712_100028909 Ga0070712_1000289093 289
365 3300006175 Ga0070712_100048244 Ga0070712_1000482442 289
366 3300006844 Ga0075428_100302649 Ga0075428_1003026492 289
367 3300009093 Ga0105240_10084004 Ga0105240_100840042 289
368 3300009093 Ga0105240_10198305 Ga0105240_101983052 289
369 3300009093 Ga0105240_10451598 Ga0105240_104515982 289
370 3300009094 Ga0111539_10201726 Ga0111539_102017261 289
371 3300009147 Ga0114129_10038551 Ga0114129_100385513 289
372 3300009545 Ga0105237_10039007 Ga0105237_100390074 289
373 3300009545 Ga0105237_10364318 Ga0105237_103643182 289
374 3300009551 Ga0105238_10018857 Ga0105238_100188572 289
375 3300009551 Ga0105238_10029584 Ga0105238_100295842 289
376 3300010375 Ga0105239_10227048 Ga0105239_102270482 289
377 3300013104 Ga0157370_10090104 Ga0157370_100901042 289
378 3300013105 Ga0157369_10015777 Ga0157369_100157775 289
379 3300013105 Ga0157369_10493497 Ga0157369_104934971 289
380 3300020082 Ga0206353_11937846 Ga0206353_119378462 289
381 3300021377 Ga0213874_10047224 Ga0213874_100472241 289
382 3300021377 Ga0213874_10055302 Ga0213874_100553022 289
383 3300021384 Ga0213876_10004341 Ga0213876_100043412 289
384 3300021384 Ga0213876_10055424 Ga0213876_100554242 289
385 3300021388 Ga0213875_10104231 Ga0213875_101042312 289
386 3300025253 Ga0209677_105468 Ga0209677_1054682 289
387 3300025261 Ga0209233_1004124 Ga0209233_10041245 289
388 3300025272 Ga0209455_1001619 Ga0209455_10016196 289
389 3300025272 Ga0209455_1003297 Ga0209455_10032972 289
390 3300025898 Ga0207692_10000223 Ga0207692_100002234 289
391 3300025898 Ga0207692_10140586 Ga0207692_101405862 289
392 3300025900 Ga0207710_10089064 Ga0207710_100890642 289
393 3300025904 Ga0207647_10100979 Ga0207647_101009792 289
394 3300025906 Ga0207699_10002413 Ga0207699_100024136 289
395 3300025906 Ga0207699_10062568 Ga0207699_100625682 289
396 3300025912 Ga0207707_10003051 Ga0207707_1000305113 289
397 3300025912 Ga0207707_10230297 Ga0207707_102302971 289
398 3300025913 Ga0207695_10360175 Ga0207695_103601752 289
399 3300025913 Ga0207695_10373416 Ga0207695_103734162 289
400 3300025914 Ga0207671_10024043 Ga0207671_100240434 289
401 3300025914 Ga0207671_10124669 Ga0207671_101246692 289
402 3300025915 Ga0207693_10033811 Ga0207693_100338114 289
403 3300025915 Ga0207693_10039685 Ga0207693_100396853 289
404 3300025916 Ga0207663_10106986 Ga0207663_101069862 289
405 3300025916 Ga0207663_10247096 Ga0207663_102470962 289
406 3300025916 Ga0207663_10443032 Ga0207663_104430321 289
407 3300025917 Ga0207660_10042759 Ga0207660_100427594 289
408 3300025917 Ga0207660_10044180 Ga0207660_100441802 289
409 3300025921 Ga0207652_10014356 Ga0207652_100143565 289
410 3300025921 Ga0207652_10177188 Ga0207652_101771882 289
411 3300025923 Ga0207681_10230809 Ga0207681_102308092 289
412 3300025928 Ga0207700_10032525 Ga0207700_100325252 289
413 3300025928 Ga0207700_10227954 Ga0207700_102279542 289
414 3300025928 Ga0207700_10622186 Ga0207700_106221861 289
415 3300025939 Ga0207665_10057055 Ga0207665_100570552 289
416 3300025939 Ga0207665_10341723 Ga0207665_103417232 289
417 3300025949 Ga0207667_10120809 Ga0207667_101208093 289
418 3300025986 Ga0207658_10235743 Ga0207658_102357432 289
419 3300026041 Ga0207639_10020584 Ga0207639_100205843 289
420 3300026041 Ga0207639_10197927 Ga0207639_101979272 289
421 3300026078 Ga0207702_10280212 Ga0207702_102802122 289
422 3300026088 Ga0207641_10386860 Ga0207641_103868602 289
423 3300028381 Ga0268264_10000042 Ga0268264_10000042342 289
424 3300028556 Ga0265337_1052684 Ga0265337_10526841 289
425 3300028563 Ga0265319_1021564 Ga0265319_10215643 289
426 3300028573 Ga0265334_10001691 Ga0265334_100016917 289
427 3300028653 Ga0265323_10000604 Ga0265323_1000060418 289
428 3300028654 Ga0265322_10016967 Ga0265322_100169672 289
429 3300028666 Ga0265336_10000679 Ga0265336_100006793 289
430 3300028800 Ga0265338_10000271 Ga0265338_1000027151 289
431 3300029957 Ga0265324_10010126 Ga0265324_100101262 289
432 3300030521 Ga0307511_10097238 Ga0307511_100972382 289
433 3300031456 Ga0307513_10158629 Ga0307513_101586292 289
434 3300031507 Ga0307509_10170607 Ga0307509_101706072 289
435 3300031616 Ga0307508_10000063 Ga0307508_10000063131 289
436 3300031616 Ga0307508_10287808 Ga0307508_102878081 289
437 3300031730 Ga0307516_10016366 Ga0307516_100163666 289
438 3300033179 Ga0307507_10039462 Ga0307507_100394624 289
439 3300035083 Ga0373926_0008015 Ga0373926_0008015_95_964 289
440 3300035086 Ga0373934_0082672 Ga0373934_0082672_284_1153 289
441 3300035118 Ga0373954_0068764 Ga0373954_0068764_427_1296 289
442 3300035170 Ga0373943_0054411 Ga0373943_0054411_132_1001 289
443 3300035172 Ga0373955_0112191 Ga0373955_0112191_145_1014 289
444 3300035410 Ga0373924_0005085 Ga0373924_0005085_313_1182 289
445 3300035692 Ga0373935_0033556 Ga0373935_0033556_286_1155 289
446 3300035692 Ga0373935_0070969 Ga0373935_0070969_1109_1978 289
447 3300035695 Ga0373927_0003123 Ga0373927_0003123_7363_8232 289
448 3300035695 Ga0373927_0052319 Ga0373927_0052319_1530_2399 289
449 3300035695 Ga0373927_0054605 Ga0373927_0054605_1128_1997 289
450 3300036401 Ga0373937_0538301 Ga0373937_0538301_79_948 289
451 3300037068 Ga0373925_0000335 Ga0373925_0000335_3966_4835 289
452 3300037068 Ga0373925_0020762 Ga0373925_0020762_1340_2209 289
453 3300037466 Ga0395898_0004066 Ga0395898_0004066_2903_3772 289
454 3300037853 Ga0436364_0728274 Ga0436364_0728274_217_1086 289
455 3300039437 Ga0436365_0044969 Ga0436365_0044969_1197_2066 289
456 3300039437 Ga0436365_0688470 Ga0436365_0688470_940_1809 289
457 3300039437 Ga0436365_0701563 Ga0436365_0701563_491_1360 289
458 3300039450 Ga0436363_0055080 Ga0436363_0055080_659_1528 289
459 3300039453 Ga0436362_0568672 Ga0436362_0568672_221_1090 289
460 3300045976 Ga0466967_0599398 Ga0466967_0599398_102_971 289
461 3300046454 Ga0495592_0145045 Ga0495592_0145045_405_1274 289
462 3300046455 Ga0495603_0133193 Ga0495603_0133193_62_931 289
463 3300046460 Ga0495638_0002894 Ga0495638_0002894_2872_3747 289
464 3300046460 Ga0495638_0029083 Ga0495638_0029083_2471_3355 289
465 3300046463 Ga0495653_0210143 Ga0495653_0210143_397_1266 289
466 3300046472 Ga0495580_0005227 Ga0495580_0005227_6082_6951 289
467 3300046477 Ga0495664_0030245 Ga0495664_0030245_2045_2914 289
468 3300046499 Ga0495594_0184599 Ga0495594_0184599_294_1169 289
469 3300046517 Ga0495630_0056513 Ga0495630_0056513_61_930 289
470 3300046529 Ga0495652_0052648 Ga0495652_0052648_2244_3113 289
471 3300046533 Ga0495640_0022665 Ga0495640_0022665_1243_2112 289
472 3300046533 Ga0495640_0142460 Ga0495640_0142460_631_1500 289
473 3300046543 Ga0495645_0295647 Ga0495645_0295647_69_938 289
474 3300046642 Ga0495634_0086571 Ga0495634_0086571_901_1770 289
475 3300046690 Ga0495624_0018557 Ga0495624_0018557_3380_4249 289
476 3300046809 Ga0495600_0209332 Ga0495600_0209332_174_1043 289
477 3300047319 Ga0495674_0047348 Ga0495674_0047348_517_1386 289
478 3300047321 Ga0495676_0307879 Ga0495676_0307879_84_953 289
479 3300047471 Ga0495684_0011529 Ga0495684_0011529_4087_4956 289
480 3300047673 Ga0495593_0119720 Ga0495593_0119720_194_1063 289
481 3300048909 Ga0496106_0011968 Ga0496106_0011968_1463_2332 289
482 3300048910 Ga0496107_0241782 Ga0496107_0241782_265_1155 289
483 3300048921 Ga0496118_0007271 Ga0496118_0007271_9511_10380 289
484 3300048921 Ga0496118_0208771 Ga0496118_0208771_155_1024 289
485 3300048922 Ga0496119_0081584 Ga0496119_0081584_579_1448 289
486 3300048924 Ga0496121_0000418 Ga0496121_0000418_23113_23982 289
487 3300048924 Ga0496121_0040382 Ga0496121_0040382_1287_2156 289
488 3300048924 Ga0496121_0184811 Ga0496121_0184811_71_940 289
489 3300048924 Ga0496121_0198015 Ga0496121_0198015_530_1399 289
490 3300048927 Ga0496124_0001129 Ga0496124_0001129_1845_2714 289
491 3300048928 Ga0496125_0051362 Ga0496125_0051362_1325_2194 289
492 3300048928 Ga0496125_0074448 Ga0496125_0074448_1527_2429 289
493 3300048929 Ga0496126_0023549 Ga0496126_0023549_775_1644 289
494 3300048929 Ga0496126_0032326 Ga0496126_0032326_2356_3258 289
495 3300049571 Ga0501034_0045770 Ga0501034_0045770_215_1093 289
496 3300049574 Ga0501038_0178312 Ga0501038_0178312_767_1645 289
497 3300049580 Ga0501046_0029535 Ga0501046_0029535_2545_3414 289
498 3300049581 Ga0501047_0004564 Ga0501047_0004564_2626_3495 289
499 3300049589 Ga0501073_0050512 Ga0501073_0050512_1763_2632 289
500 3300049590 Ga0501074_0106074 Ga0501074_0106074_1099_1968 289
501 3300049742 Ga0501080_0016431 Ga0501080_0016431_4159_5028 289
502 3300049823 Ga0501044_0032621 Ga0501044_0032621_3131_4000 289
503 3300050507 nmdc:mga05p37_27432_c1 nmdc:mga05p37_27432_c1_2080_2964 289
504 3300050511 nmdc:mga08y16_116992_c1 nmdc:mga08y16_116992_c1_1597_2472 289
505 3300050511 nmdc:mga08y16_616404_c1 nmdc:mga08y16_616404_c1_18_902 289
506 3300050511 nmdc:mga08y16_96846_c1 nmdc:mga08y16_96846_c1_2030_2899 289
507 3300050512 nmdc:mga0n895_490414_c1 nmdc:mga0n895_490414_c1_30_899 289
508 3300053078 Ga0495612_0077839 Ga0495612_0077839_427_1296 289
509 3300053087 Ga0500643_004959 Ga0500643_004959_1933_2811 289
510 3300053090 Ga0500646_0047499 Ga0500646_0047499_72_947 289
511 3300053096 Ga0500641_0036402 Ga0500641_0036402_351_1226 289
512 3300053111 Ga0500572_009862 Ga0500572_009862_66_935 289
513 3300053119 Ga0500595_044503 Ga0500595_044503_171_1040 289
514 3300053136 Ga0500559_0012809 Ga0500559_0012809_677_1546 289
515 3300053136 Ga0500559_0032940 Ga0500559_0032940_67_936 289
516 3300053151 Ga0500604_0029703 Ga0500604_0029703_135_1010 289
517 3300053735 Ga0500596_004758 Ga0500596_004758_1352_2221 289
518 3300002077 JGI24744J21845_10028950 JGI24744J21845_100289501 290
519 3300002244 JGI24742J22300_10026243 JGI24742J22300_100262432 290
520 3300003659 JGI25404J52841_10006038 JGI25404J52841_100060382 290
521 3300003659 JGI25404J52841_10009246 JGI25404J52841_100092462 290
522 3300003659 JGI25404J52841_10013873 JGI25404J52841_100138731 290
523 3300003659 JGI25404J52841_10023519 JGI25404J52841_100235192 290
524 3300003659 JGI25404J52841_10040163 JGI25404J52841_100401631 290
525 3300003911 JGI25405J52794_10008242 JGI25405J52794_100082422 290
526 3300005293 Ga0065715_10067341 Ga0065715_100673411 290
527 3300005329 Ga0070683_100077937 Ga0070683_1000779372 290
528 3300005330 Ga0070690_100134299 Ga0070690_1001342992 290
529 3300005331 Ga0070670_100101876 Ga0070670_1001018762 290
530 3300005331 Ga0070670_100321506 Ga0070670_1003215062 290
531 3300005331 Ga0070670_100498547 Ga0070670_1004985471 290
532 3300005334 Ga0068869_100189293 Ga0068869_1001892932 290
533 3300005334 Ga0068869_100422914 Ga0068869_1004229141 290
534 3300005335 Ga0070666_10014526 Ga0070666_100145262 290
535 3300005336 Ga0070680_100002387 Ga0070680_1000023872 290
536 3300005337 Ga0070682_100186328 Ga0070682_1001863282 290
537 3300005338 Ga0068868_100046913 Ga0068868_1000469133 290
538 3300005338 Ga0068868_100054926 Ga0068868_1000549262 290
539 3300005338 Ga0068868_100240067 Ga0068868_1002400672 290
540 3300005339 Ga0070660_100146491 Ga0070660_1001464912 290
541 3300005339 Ga0070660_100395861 Ga0070660_1003958612 290
542 3300005340 Ga0070689_100040447 Ga0070689_1000404472 290
543 3300005340 Ga0070689_100092897 Ga0070689_1000928972 290
544 3300005340 Ga0070689_100122141 Ga0070689_1001221412 290
545 3300005340 Ga0070689_100380273 Ga0070689_1003802732 290
546 3300005340 Ga0070689_100399150 Ga0070689_1003991501 290
547 3300005341 Ga0070691_10004562 Ga0070691_100045625 290
548 3300005341 Ga0070691_10021948 Ga0070691_100219482 290
549 3300005344 Ga0070661_100042539 Ga0070661_1000425392 290
550 3300005345 Ga0070692_10056400 Ga0070692_100564002 290
551 3300005347 Ga0070668_100043086 Ga0070668_1000430864 290
552 3300005347 Ga0070668_100099844 Ga0070668_1000998442 290
553 3300005347 Ga0070668_100275915 Ga0070668_1002759151 290
554 3300005353 Ga0070669_100077618 Ga0070669_1000776182 290
555 3300005353 Ga0070669_100144241 Ga0070669_1001442412 290
556 3300005354 Ga0070675_100068056 Ga0070675_1000680562 290
557 3300005354 Ga0070675_100099709 Ga0070675_1000997091 290
558 3300005354 Ga0070675_100172344 Ga0070675_1001723442 290
559 3300005355 Ga0070671_100018411 Ga0070671_1000184112 290
560 3300005355 Ga0070671_100046054 Ga0070671_1000460543 290
561 3300005355 Ga0070671_100047574 Ga0070671_1000475742 290
562 3300005356 Ga0070674_100044758 Ga0070674_1000447582 290
563 3300005364 Ga0070673_100040843 Ga0070673_1000408432 290
564 3300005364 Ga0070673_100325562 Ga0070673_1003255621 290
565 3300005365 Ga0070688_100017531 Ga0070688_1000175313 290
566 3300005365 Ga0070688_100343462 Ga0070688_1003434621 290
567 3300005367 Ga0070667_100365844 Ga0070667_1003658442 290
568 3300005406 Ga0070703_10013169 Ga0070703_100131693 290
569 3300005434 Ga0070709_10001190 Ga0070709_100011904 290
570 3300005434 Ga0070709_10011552 Ga0070709_100115523 290
571 3300005434 Ga0070709_10220365 Ga0070709_102203652 290
572 3300005435 Ga0070714_100018431 Ga0070714_1000184314 290
573 3300005435 Ga0070714_100031504 Ga0070714_1000315044 290
574 3300005435 Ga0070714_100038045 Ga0070714_1000380453 290
575 3300005435 Ga0070714_100423236 Ga0070714_1004232361 290
576 3300005436 Ga0070713_100006665 Ga0070713_1000066652 290
577 3300005436 Ga0070713_100030054 Ga0070713_1000300543 290
578 3300005436 Ga0070713_100040690 Ga0070713_1000406902 290
579 3300005436 Ga0070713_100045828 Ga0070713_1000458282 290
580 3300005436 Ga0070713_100315435 Ga0070713_1003154352 290
581 3300005436 Ga0070713_100426136 Ga0070713_1004261361 290
582 3300005437 Ga0070710_10001782 Ga0070710_100017829 290
583 3300005437 Ga0070710_10182842 Ga0070710_101828421 290
584 3300005439 Ga0070711_100028466 Ga0070711_1000284662 290
585 3300005439 Ga0070711_100067363 Ga0070711_1000673633 290
586 3300005439 Ga0070711_100111956 Ga0070711_1001119562 290
587 3300005439 Ga0070711_100165926 Ga0070711_1001659262 290
588 3300005439 Ga0070711_100226822 Ga0070711_1002268221 290
589 3300005439 Ga0070711_100427723 Ga0070711_1004277231 290
590 3300005440 Ga0070705_100001178 Ga0070705_1000011788 290
591 3300005441 Ga0070700_100036945 Ga0070700_1000369452 290
592 3300005441 Ga0070700_100133208 Ga0070700_1001332082 290
593 3300005444 Ga0070694_100002039 Ga0070694_1000020397 290
594 3300005445 Ga0070708_100345006 Ga0070708_1003450061 290
595 3300005455 Ga0070663_100049849 Ga0070663_1000498492 290
596 3300005455 Ga0070663_100091518 Ga0070663_1000915182 290
597 3300005455 Ga0070663_100096946 Ga0070663_1000969462 290
598 3300005455 Ga0070663_100208689 Ga0070663_1002086892 290
599 3300005456 Ga0070678_100025181 Ga0070678_1000251813 290
600 3300005457 Ga0070662_100279391 Ga0070662_1002793911 290
601 3300005458 Ga0070681_10028980 Ga0070681_100289803 290
602 3300005458 Ga0070681_10077104 Ga0070681_100771042 290
603 3300005459 Ga0068867_100016601 Ga0068867_1000166014 290
604 3300005459 Ga0068867_100081408 Ga0068867_1000814082 290
605 3300005459 Ga0068867_100121570 Ga0068867_1001215702 290
606 3300005466 Ga0070685_10024915 Ga0070685_100249153 290
607 3300005467 Ga0070706_100119281 Ga0070706_1001192812 290
608 3300005467 Ga0070706_100162988 Ga0070706_1001629882 290
609 3300005467 Ga0070706_100217469 Ga0070706_1002174692 290
610 3300005471 Ga0070698_100035867 Ga0070698_1000358673 290
611 3300005518 Ga0070699_100002351 Ga0070699_1000023518 290
612 3300005535 Ga0070684_100026386 Ga0070684_1000263862 290
613 3300005536 Ga0070697_100028213 Ga0070697_1000282133 290
614 3300005536 Ga0070697_100089478 Ga0070697_1000894782 290
615 3300005536 Ga0070697_100211930 Ga0070697_1002119302 290
616 3300005544 Ga0070686_100235422 Ga0070686_1002354222 290
617 3300005545 Ga0070695_100001069 Ga0070695_1000010695 290
618 3300005545 Ga0070695_100002352 Ga0070695_1000023522 290
619 3300005546 Ga0070696_100000904 Ga0070696_10000090410 290
620 3300005546 Ga0070696_100101258 Ga0070696_1001012581 290
621 3300005547 Ga0070693_100180406 Ga0070693_1001804062 290
622 3300005548 Ga0070665_100025774 Ga0070665_1000257741 290
623 3300005548 Ga0070665_100028015 Ga0070665_1000280155 290
624 3300005548 Ga0070665_100084650 Ga0070665_1000846503 290
625 3300005548 Ga0070665_100091697 Ga0070665_1000916971 290
626 3300005548 Ga0070665_100120566 Ga0070665_1001205661 290
627 3300005548 Ga0070665_100181512 Ga0070665_1001815122 290
628 3300005548 Ga0070665_100189682 Ga0070665_1001896822 290
629 3300005549 Ga0070704_100013643 Ga0070704_1000136434 290
630 3300005564 Ga0070664_100098086 Ga0070664_1000980862 290
631 3300005564 Ga0070664_100216192 Ga0070664_1002161922 290
632 3300005577 Ga0068857_100020859 Ga0068857_1000208592 290
633 3300005577 Ga0068857_100026434 Ga0068857_1000264345 290
634 3300005577 Ga0068857_100359814 Ga0068857_1003598141 290
635 3300005615 Ga0070702_100016060 Ga0070702_1000160602 290
636 3300005615 Ga0070702_100042973 Ga0070702_1000429732 290
637 3300005616 Ga0068852_100109302 Ga0068852_1001093022 290
638 3300005617 Ga0068859_100010100 Ga0068859_1000101004 290
639 3300005617 Ga0068859_100329691 Ga0068859_1003296912 290
640 3300005618 Ga0068864_100098231 Ga0068864_1000982312 290
641 3300005618 Ga0068864_100175018 Ga0068864_1001750182 290
642 3300005618 Ga0068864_100192783 Ga0068864_1001927832 290
643 3300005718 Ga0068866_10107406 Ga0068866_101074062 290
644 3300005719 Ga0068861_100078426 Ga0068861_1000784262 290
645 3300005719 Ga0068861_100185090 Ga0068861_1001850902 290
646 3300005834 Ga0068851_10142837 Ga0068851_101428371 290
647 3300005841 Ga0068863_100097041 Ga0068863_1000970412 290
648 3300005841 Ga0068863_100139683 Ga0068863_1001396832 290
649 3300005841 Ga0068863_100152554 Ga0068863_1001525542 290
650 3300005841 Ga0068863_100275226 Ga0068863_1002752261 290
651 3300005841 Ga0068863_100761100 Ga0068863_1007611001 290
652 3300005842 Ga0068858_100047793 Ga0068858_1000477932 290
653 3300005842 Ga0068858_100083398 Ga0068858_1000833983 290
654 3300005842 Ga0068858_100656091 Ga0068858_1006560911 290
655 3300005843 Ga0068860_100005313 Ga0068860_1000053139 290
656 3300005843 Ga0068860_100047304 Ga0068860_1000473042 290
657 3300005843 Ga0068860_100184631 Ga0068860_1001846311 290
658 3300005843 Ga0068860_100221060 Ga0068860_1002210602 290
659 3300005844 Ga0068862_100003877 Ga0068862_1000038779 290
660 3300005844 Ga0068862_100224320 Ga0068862_1002243202 290
661 3300005937 Ga0081455_10010152 Ga0081455_100101523 290
662 3300005937 Ga0081455_10014384 Ga0081455_100143847 290
663 3300005937 Ga0081455_10015293 Ga0081455_100152932 290
664 3300005937 Ga0081455_10018759 Ga0081455_100187593 290
665 3300005937 Ga0081455_10033485 Ga0081455_100334851 290
666 3300005937 Ga0081455_10045589 Ga0081455_100455893 290
667 3300005937 Ga0081455_10168088 Ga0081455_101680882 290
668 3300005937 Ga0081455_10201116 Ga0081455_102011162 290
669 3300005937 Ga0081455_10395835 Ga0081455_103958351 290
670 3300005981 Ga0081538_10039013 Ga0081538_100390132 290
671 3300005981 Ga0081538_10050047 Ga0081538_100500471 290
672 3300005983 Ga0081540_1000439 Ga0081540_100043936 290
673 3300005983 Ga0081540_1002134 Ga0081540_10021342 290
674 3300005983 Ga0081540_1006679 Ga0081540_10066797 290
675 3300005983 Ga0081540_1006760 Ga0081540_10067602 290
676 3300005983 Ga0081540_1007315 Ga0081540_10073156 290
677 3300005983 Ga0081540_1014061 Ga0081540_10140615 290
678 3300005983 Ga0081540_1019482 Ga0081540_10194822 290
679 3300005983 Ga0081540_1021005 Ga0081540_10210051 290
680 3300005983 Ga0081540_1048258 Ga0081540_10482582 290
681 3300005983 Ga0081540_1056140 Ga0081540_10561402 290
682 3300005983 Ga0081540_1056927 Ga0081540_10569272 290
683 3300005983 Ga0081540_1059056 Ga0081540_10590562 290
684 3300005983 Ga0081540_1076376 Ga0081540_10763761 290
685 3300005983 Ga0081540_1101944 Ga0081540_11019442 290
686 3300005985 Ga0081539_10120320 Ga0081539_101203201 290
687 3300006028 Ga0070717_10000716 Ga0070717_1000071624 290
688 3300006028 Ga0070717_10001486 Ga0070717_1000148610 290
689 3300006028 Ga0070717_10010234 Ga0070717_100102346 290
690 3300006028 Ga0070717_10016760 Ga0070717_100167602 290
691 3300006028 Ga0070717_10596851 Ga0070717_105968511 290
692 3300006038 Ga0075365_10053793 Ga0075365_100537932 290
693 3300006038 Ga0075365_10071632 Ga0075365_100716322 290
694 3300006038 Ga0075365_10074908 Ga0075365_100749083 290
695 3300006048 Ga0075363_100007902 Ga0075363_1000079022 290
696 3300006048 Ga0075363_100139405 Ga0075363_1001394052 290
697 3300006051 Ga0075364_10152646 Ga0075364_101526462 290
698 3300006058 Ga0075432_10006290 Ga0075432_100062902 290
699 3300006163 Ga0070715_10001917 Ga0070715_100019177 290
700 3300006163 Ga0070715_10021949 Ga0070715_100219492 290
701 3300006163 Ga0070715_10063554 Ga0070715_100635541 290
702 3300006173 Ga0070716_100001746 Ga0070716_1000017467 290
703 3300006173 Ga0070716_100013222 Ga0070716_1000132224 290
704 3300006173 Ga0070716_100180112 Ga0070716_1001801122 290
705 3300006173 Ga0070716_100182933 Ga0070716_1001829331 290
706 3300006175 Ga0070712_100006624 Ga0070712_1000066243 290
707 3300006175 Ga0070712_100018711 Ga0070712_1000187113 290
708 3300006175 Ga0070712_100060755 Ga0070712_1000607552 290
709 3300006175 Ga0070712_100109396 Ga0070712_1001093962 290
710 3300006175 Ga0070712_100214012 Ga0070712_1002140121 290
711 3300006177 Ga0075362_10025069 Ga0075362_100250692 290
712 3300006177 Ga0075362_10079503 Ga0075362_100795032 290
713 3300006178 Ga0075367_10008644 Ga0075367_100086444 290
714 3300006178 Ga0075367_10158107 Ga0075367_101581071 290
715 3300006237 Ga0097621_100031404 Ga0097621_1000314042 290
716 3300006237 Ga0097621_100101102 Ga0097621_1001011023 290
717 3300006358 Ga0068871_100070746 Ga0068871_1000707461 290
718 3300006358 Ga0068871_100507413 Ga0068871_1005074131 290
719 3300006844 Ga0075428_100024342 Ga0075428_1000243423 290
720 3300006844 Ga0075428_100026550 Ga0075428_1000265503 290
721 3300006844 Ga0075428_100029409 Ga0075428_1000294096 290
722 3300006844 Ga0075428_100071671 Ga0075428_1000716712 290
723 3300006844 Ga0075428_100099359 Ga0075428_1000993593 290
724 3300006846 Ga0075430_100000545 Ga0075430_10000054522 290
725 3300006846 Ga0075430_100009092 Ga0075430_10000909210 290
726 3300006846 Ga0075430_100045141 Ga0075430_1000451412 290
727 3300006846 Ga0075430_100063402 Ga0075430_1000634024 290
728 3300006847 Ga0075431_100001204 Ga0075431_10000120410 290
729 3300006847 Ga0075431_100030443 Ga0075431_1000304434 290
730 3300006847 Ga0075431_100120799 Ga0075431_1001207992 290
731 3300006852 Ga0075433_10001094 Ga0075433_100010949 290
732 3300006852 Ga0075433_10346986 Ga0075433_103469862 290
733 3300006871 Ga0075434_100007552 Ga0075434_1000075527 290
734 3300006871 Ga0075434_100036695 Ga0075434_1000366953 290
735 3300006871 Ga0075434_100307196 Ga0075434_1003071962 290
736 3300006871 Ga0075434_100332235 Ga0075434_1003322352 290
737 3300006880 Ga0075429_100000060 Ga0075429_10000006048 290
738 3300006880 Ga0075429_100007094 Ga0075429_1000070948 290
739 3300006880 Ga0075429_100249672 Ga0075429_1002496722 290
740 3300006880 Ga0075429_100453415 Ga0075429_1004534152 290
741 3300006881 Ga0068865_100029469 Ga0068865_1000294692 290
742 3300006881 Ga0068865_100194860 Ga0068865_1001948602 290
743 3300006914 Ga0075436_100011021 Ga0075436_1000110213 290
744 3300006914 Ga0075436_100125725 Ga0075436_1001257252 290
745 3300006914 Ga0075436_100250904 Ga0075436_1002509041 290
746 3300006931 Ga0097620_100010100 Ga0097620_1000101007 290
747 3300006931 Ga0097620_100329683 Ga0097620_1003296832 290
748 3300007076 Ga0075435_100013192 Ga0075435_1000131924 290
749 3300007076 Ga0075435_100037354 Ga0075435_1000373545 290
750 3300007076 Ga0075435_100039490 Ga0075435_1000394903 290
751 3300007076 Ga0075435_100046304 Ga0075435_1000463043 290
752 3300007076 Ga0075435_100149568 Ga0075435_1001495682 290
753 3300007076 Ga0075435_100362339 Ga0075435_1003623392 290
754 3300007265 Ga0099794_10017538 Ga0099794_100175383 290
755 3300007265 Ga0099794_10165188 Ga0099794_101651881 290
756 3300009092 Ga0105250_10042938 Ga0105250_100429381 290
757 3300009094 Ga0111539_10001967 Ga0111539_1000196713 290
758 3300009094 Ga0111539_10002950 Ga0111539_100029503 290
759 3300009094 Ga0111539_10037843 Ga0111539_100378432 290
760 3300009094 Ga0111539_10061372 Ga0111539_100613721 290
761 3300009094 Ga0111539_10353449 Ga0111539_103534492 290
762 3300009098 Ga0105245_10034851 Ga0105245_100348513 290
763 3300009098 Ga0105245_10039646 Ga0105245_100396462 290
764 3300009098 Ga0105245_10083141 Ga0105245_100831413 290
765 3300009098 Ga0105245_10087805 Ga0105245_100878053 290
766 3300009098 Ga0105245_10245477 Ga0105245_102454772 290
767 3300009101 Ga0105247_10008161 Ga0105247_100081612 290
768 3300009101 Ga0105247_10103109 Ga0105247_101031092 290
769 3300009101 Ga0105247_10181066 Ga0105247_101810662 290
770 3300009101 Ga0105247_10197791 Ga0105247_101977912 290
771 3300009101 Ga0105247_10391573 Ga0105247_103915731 290
772 3300009147 Ga0114129_10002096 Ga0114129_1000209613 290
773 3300009147 Ga0114129_10010577 Ga0114129_100105773 290
774 3300009147 Ga0114129_10092140 Ga0114129_100921402 290
775 3300009147 Ga0114129_10119530 Ga0114129_101195302 290
776 3300009147 Ga0114129_10148949 Ga0114129_101489492 290
777 3300009147 Ga0114129_10287324 Ga0114129_102873242 290
778 3300009147 Ga0114129_10439943 Ga0114129_104399432 290
779 3300009147 Ga0114129_11199642 Ga0114129_111996421 290
780 3300009148 Ga0105243_10065654 Ga0105243_100656542 290
781 3300009148 Ga0105243_10693252 Ga0105243_106932521 290
782 3300009174 Ga0105241_10077945 Ga0105241_100779452 290
783 3300009174 Ga0105241_10091369 Ga0105241_100913692 290
784 3300009174 Ga0105241_10220417 Ga0105241_102204172 290
785 3300009176 Ga0105242_10012738 Ga0105242_100127386 290
786 3300009176 Ga0105242_10130030 Ga0105242_101300303 290
787 3300009177 Ga0105248_10076298 Ga0105248_100762982 290
788 3300009177 Ga0105248_10120209 Ga0105248_101202092 290
789 3300009177 Ga0105248_10512442 Ga0105248_105124422 290
790 3300009545 Ga0105237_10167796 Ga0105237_101677962 290
791 3300009545 Ga0105237_10291704 Ga0105237_102917041 290
792 3300009551 Ga0105238_10074721 Ga0105238_100747212 290
793 3300009551 Ga0105238_10429705 Ga0105238_104297052 290
794 3300009551 Ga0105238_10436033 Ga0105238_104360332 290
795 3300009553 Ga0105249_10002492 Ga0105249_100024929 290
796 3300009553 Ga0105249_10249831 Ga0105249_102498311 290
797 3300009553 Ga0105249_10272211 Ga0105249_102722112 290
798 3300010159 Ga0099796_10056148 Ga0099796_100561482 290
799 3300010159 Ga0099796_10071151 Ga0099796_100711511 290
800 3300010375 Ga0105239_10050181 Ga0105239_100501812 290
801 3300010375 Ga0105239_10074953 Ga0105239_100749532 290
802 3300010375 Ga0105239_10534696 Ga0105239_105346962 290
803 3300010375 Ga0105239_10833802 Ga0105239_108338022 290
804 3300011119 Ga0105246_10010656 Ga0105246_100106565 290
805 3300011119 Ga0105246_10069972 Ga0105246_100699722 290
806 3300011119 Ga0105246_10072514 Ga0105246_100725143 290
807 3300011119 Ga0105246_10203154 Ga0105246_102031542 290
808 3300013296 Ga0157374_10297987 Ga0157374_102979872 290
809 3300013296 Ga0157374_10379432 Ga0157374_103794322 290
810 3300013297 Ga0157378_10081083 Ga0157378_100810833 290
811 3300013297 Ga0157378_10408274 Ga0157378_104082742 290
812 3300013306 Ga0163162_10052221 Ga0163162_100522213 290
813 3300013306 Ga0163162_10161498 Ga0163162_101614982 290
814 3300013306 Ga0163162_10623683 Ga0163162_106236831 290
815 3300013308 Ga0157375_10018359 Ga0157375_100183596 290
816 3300013308 Ga0157375_10031765 Ga0157375_100317653 290
817 3300013308 Ga0157375_10147670 Ga0157375_101476702 290
818 3300013308 Ga0157375_10294960 Ga0157375_102949602 290
819 3300014325 Ga0163163_10030168 Ga0163163_100301685 290
820 3300014325 Ga0163163_10033361 Ga0163163_100333614 290
821 3300014325 Ga0163163_10044632 Ga0163163_100446324 290
822 3300014325 Ga0163163_10068097 Ga0163163_100680973 290
823 3300014325 Ga0163163_10099668 Ga0163163_100996682 290
824 3300014325 Ga0163163_10174962 Ga0163163_101749622 290
825 3300014326 Ga0157380_10101789 Ga0157380_101017892 290
826 3300014326 Ga0157380_10456982 Ga0157380_104569822 290
827 3300014745 Ga0157377_10155719 Ga0157377_101557192 290
828 3300014968 Ga0157379_10013466 Ga0157379_100134662 290
829 3300014968 Ga0157379_10019591 Ga0157379_100195915 290
830 3300014968 Ga0157379_10038470 Ga0157379_100384702 290
831 3300014968 Ga0157379_10117733 Ga0157379_101177332 290
832 3300014968 Ga0157379_10169935 Ga0157379_101699352 290
833 3300014969 Ga0157376_10160051 Ga0157376_101600512 290
834 3300014969 Ga0157376_10180347 Ga0157376_101803472 290
835 3300017792 Ga0163161_10021302 Ga0163161_100213022 290
836 3300017792 Ga0163161_10247286 Ga0163161_102472862 290
837 3300020082 Ga0206353_10185676 Ga0206353_101856762 290
838 3300021377 Ga0213874_10009302 Ga0213874_100093022 290
839 3300021384 Ga0213876_10146842 Ga0213876_101468421 290
840 3300024227 Ga0228598_1005985 Ga0228598_10059853 290
841 3300025297 Ga0209758_1024538 Ga0209758_10245381 290
842 3300025315 Ga0207697_10057106 Ga0207697_100571062 290
843 3300025885 Ga0207653_10002710 Ga0207653_100027104 290
844 3300025893 Ga0207682_10000909 Ga0207682_100009099 290
845 3300025898 Ga0207692_10007542 Ga0207692_100075424 290
846 3300025898 Ga0207692_10016246 Ga0207692_100162462 290
847 3300025899 Ga0207642_10094144 Ga0207642_100941442 290
848 3300025900 Ga0207710_10015027 Ga0207710_100150272 290
849 3300025900 Ga0207710_10016158 Ga0207710_100161583 290
850 3300025901 Ga0207688_10107588 Ga0207688_101075882 290
851 3300025901 Ga0207688_10108152 Ga0207688_101081522 290
852 3300025903 Ga0207680_10004200 Ga0207680_100042005 290
853 3300025904 Ga0207647_10130307 Ga0207647_101303071 290
854 3300025905 Ga0207685_10005632 Ga0207685_100056322 290
855 3300025905 Ga0207685_10085326 Ga0207685_100853262 290
856 3300025906 Ga0207699_10025942 Ga0207699_100259422 290
857 3300025907 Ga0207645_10072744 Ga0207645_100727442 290
858 3300025907 Ga0207645_10075743 Ga0207645_100757432 290
859 3300025910 Ga0207684_10079331 Ga0207684_100793312 290
860 3300025910 Ga0207684_10277433 Ga0207684_102774332 290
861 3300025911 Ga0207654_10031132 Ga0207654_100311322 290
862 3300025911 Ga0207654_10128775 Ga0207654_101287752 290
863 3300025912 Ga0207707_10045116 Ga0207707_100451163 290
864 3300025914 Ga0207671_10068901 Ga0207671_100689012 290
865 3300025915 Ga0207693_10001798 Ga0207693_100017984 290
866 3300025915 Ga0207693_10016409 Ga0207693_100164093 290
867 3300025915 Ga0207693_10030529 Ga0207693_100305292 290
868 3300025915 Ga0207693_10041551 Ga0207693_100415512 290
869 3300025915 Ga0207693_10077542 Ga0207693_100775422 290
870 3300025915 Ga0207693_10173812 Ga0207693_101738122 290
871 3300025915 Ga0207693_10209791 Ga0207693_102097911 290
872 3300025915 Ga0207693_10254724 Ga0207693_102547242 290
873 3300025915 Ga0207693_10305049 Ga0207693_103050492 290
874 3300025915 Ga0207693_10377643 Ga0207693_103776431 290
875 3300025915 Ga0207693_10394101 Ga0207693_103941012 290
876 3300025916 Ga0207663_10000363 Ga0207663_100003636 290
877 3300025916 Ga0207663_10035261 Ga0207663_100352613 290
878 3300025916 Ga0207663_10049105 Ga0207663_100491052 290
879 3300025916 Ga0207663_10106146 Ga0207663_101061462 290
880 3300025916 Ga0207663_10203638 Ga0207663_102036382 290
881 3300025916 Ga0207663_10430922 Ga0207663_104309221 290
882 3300025917 Ga0207660_10012977 Ga0207660_100129774 290
883 3300025918 Ga0207662_10018518 Ga0207662_100185183 290
884 3300025918 Ga0207662_10170773 Ga0207662_101707731 290
885 3300025919 Ga0207657_10136092 Ga0207657_101360922 290
886 3300025919 Ga0207657_10350131 Ga0207657_103501311 290
887 3300025920 Ga0207649_10011963 Ga0207649_100119633 290
888 3300025920 Ga0207649_10081444 Ga0207649_100814442 290
889 3300025920 Ga0207649_10103684 Ga0207649_101036842 290
890 3300025920 Ga0207649_10132264 Ga0207649_101322642 290
891 3300025922 Ga0207646_10087213 Ga0207646_100872132 290
892 3300025924 Ga0207694_10160110 Ga0207694_101601102 290
893 3300025924 Ga0207694_10208078 Ga0207694_102080782 290
894 3300025925 Ga0207650_10036345 Ga0207650_100363452 290
895 3300025925 Ga0207650_10047592 Ga0207650_100475922 290
896 3300025925 Ga0207650_10245304 Ga0207650_102453042 290
897 3300025925 Ga0207650_10276004 Ga0207650_102760042 290
898 3300025925 Ga0207650_10327989 Ga0207650_103279891 290
899 3300025927 Ga0207687_10010758 Ga0207687_100107582 290
900 3300025927 Ga0207687_10077579 Ga0207687_100775792 290
901 3300025927 Ga0207687_10127810 Ga0207687_101278102 290
902 3300025927 Ga0207687_10170033 Ga0207687_101700331 290
903 3300025927 Ga0207687_10309640 Ga0207687_103096401 290
904 3300025928 Ga0207700_10014450 Ga0207700_100144504 290
905 3300025928 Ga0207700_10100022 Ga0207700_101000222 290
906 3300025928 Ga0207700_10255207 Ga0207700_102552071 290
907 3300025928 Ga0207700_10281663 Ga0207700_102816632 290
908 3300025928 Ga0207700_10437971 Ga0207700_104379712 290
909 3300025929 Ga0207664_10006243 Ga0207664_100062435 290
910 3300025931 Ga0207644_10005617 Ga0207644_100056172 290
911 3300025931 Ga0207644_10312479 Ga0207644_103124791 290
912 3300025931 Ga0207644_10323757 Ga0207644_103237571 290
913 3300025933 Ga0207706_10042321 Ga0207706_100423212 290
914 3300025933 Ga0207706_10294951 Ga0207706_102949512 290
915 3300025933 Ga0207706_10328764 Ga0207706_103287642 290
916 3300025934 Ga0207686_10091080 Ga0207686_100910802 290
917 3300025934 Ga0207686_10094088 Ga0207686_100940882 290
918 3300025936 Ga0207670_10052761 Ga0207670_100527612 290
919 3300025936 Ga0207670_10141732 Ga0207670_101417322 290
920 3300025936 Ga0207670_10198233 Ga0207670_101982331 290
921 3300025936 Ga0207670_10392385 Ga0207670_103923851 290
922 3300025939 Ga0207665_10000530 Ga0207665_1000053013 290
923 3300025939 Ga0207665_10003497 Ga0207665_100034975 290
924 3300025939 Ga0207665_10091882 Ga0207665_100918822 290
925 3300025939 Ga0207665_10119678 Ga0207665_101196781 290
926 3300025939 Ga0207665_10145156 Ga0207665_101451562 290
927 3300025939 Ga0207665_10209970 Ga0207665_102099702 290
928 3300025940 Ga0207691_10006531 Ga0207691_100065312 290
929 3300025941 Ga0207711_10010809 Ga0207711_100108096 290
930 3300025941 Ga0207711_10157825 Ga0207711_101578252 290
931 3300025941 Ga0207711_10541709 Ga0207711_105417092 290
932 3300025942 Ga0207689_10027444 Ga0207689_100274444 290
933 3300025942 Ga0207689_10226442 Ga0207689_102264422 290
934 3300025944 Ga0207661_10071272 Ga0207661_100712723 290
935 3300025945 Ga0207679_10080904 Ga0207679_100809042 290
936 3300025960 Ga0207651_10006504 Ga0207651_100065046 290
937 3300025960 Ga0207651_10046021 Ga0207651_100460212 290
938 3300025961 Ga0207712_10066378 Ga0207712_100663782 290
939 3300025961 Ga0207712_10134412 Ga0207712_101344121 290
940 3300025961 Ga0207712_10157808 Ga0207712_101578082 290
941 3300025972 Ga0207668_10019178 Ga0207668_100191782 290
942 3300025972 Ga0207668_10064448 Ga0207668_100644482 290
943 3300025972 Ga0207668_10093584 Ga0207668_100935842 290
944 3300025972 Ga0207668_10104998 Ga0207668_101049982 290
945 3300025972 Ga0207668_10364311 Ga0207668_103643112 290
946 3300025972 Ga0207668_10453373 Ga0207668_104533731 290
947 3300025986 Ga0207658_10040399 Ga0207658_100403993 290
948 3300026023 Ga0207677_10153739 Ga0207677_101537391 290
949 3300026023 Ga0207677_10154747 Ga0207677_101547472 290
950 3300026035 Ga0207703_10073127 Ga0207703_100731273 290
951 3300026035 Ga0207703_10074966 Ga0207703_100749662 290
952 3300026035 Ga0207703_10092906 Ga0207703_100929062 290
953 3300026035 Ga0207703_10141221 Ga0207703_101412212 290
954 3300026041 Ga0207639_10318719 Ga0207639_103187191 290
955 3300026067 Ga0207678_10003243 Ga0207678_1000324310 290
956 3300026067 Ga0207678_10065786 Ga0207678_100657862 290
957 3300026067 Ga0207678_10070260 Ga0207678_100702602 290
958 3300026067 Ga0207678_10200532 Ga0207678_102005322 290
959 3300026067 Ga0207678_10231862 Ga0207678_102318622 290
960 3300026067 Ga0207678_10337209 Ga0207678_103372091 290
961 3300026067 Ga0207678_10343993 Ga0207678_103439931 290
962 3300026067 Ga0207678_10476070 Ga0207678_104760701 290
963 3300026075 Ga0207708_10001021 Ga0207708_1000102115 290
964 3300026075 Ga0207708_10043912 Ga0207708_100439122 290
965 3300026075 Ga0207708_10149014 Ga0207708_101490142 290
966 3300026078 Ga0207702_10160193 Ga0207702_101601932 290
967 3300026088 Ga0207641_10009341 Ga0207641_100093412 290
968 3300026088 Ga0207641_10122942 Ga0207641_101229422 290
969 3300026088 Ga0207641_10241829 Ga0207641_102418292 290
970 3300026088 Ga0207641_10247231 Ga0207641_102472312 290
971 3300026089 Ga0207648_10021386 Ga0207648_100213863 290
972 3300026089 Ga0207648_10033864 Ga0207648_100338644 290
973 3300026089 Ga0207648_10149759 Ga0207648_101497592 290
974 3300026095 Ga0207676_10084872 Ga0207676_100848722 290
975 3300026095 Ga0207676_10154058 Ga0207676_101540582 290
976 3300026116 Ga0207674_10015333 Ga0207674_100153332 290
977 3300026116 Ga0207674_10054872 Ga0207674_100548723 290
978 3300026116 Ga0207674_10077574 Ga0207674_100775742 290
979 3300026118 Ga0207675_100277353 Ga0207675_1002773532 290
980 3300026121 Ga0207683_10002435 Ga0207683_1000243515 290
981 3300026121 Ga0207683_10006018 Ga0207683_100060186 290
982 3300026121 Ga0207683_10013955 Ga0207683_100139556 290
983 3300026121 Ga0207683_10338969 Ga0207683_103389692 290
984 3300027512 Ga0209179_1001947 Ga0209179_10019472 290
985 3300027512 Ga0209179_1015941 Ga0209179_10159411 290
986 3300027671 Ga0209588_1014672 Ga0209588_10146722 290
987 3300027907 Ga0207428_10000219 Ga0207428_1000021955 290
988 3300027907 Ga0207428_10019378 Ga0207428_100193785 290
989 3300027907 Ga0207428_10200086 Ga0207428_102000862 290
990 3300028023 Ga0265357_1000114 Ga0265357_10001142 290
991 3300028379 Ga0268266_10003841 Ga0268266_100038413 290
992 3300028379 Ga0268266_10006378 Ga0268266_100063784 290
993 3300028379 Ga0268266_10016905 Ga0268266_100169056 290
994 3300028379 Ga0268266_10021214 Ga0268266_100212142 290
995 3300028379 Ga0268266_10056608 Ga0268266_100566082 290
996 3300028379 Ga0268266_10071381 Ga0268266_100713812 290
997 3300028379 Ga0268266_10139538 Ga0268266_101395382 290
998 3300028379 Ga0268266_10147700 Ga0268266_101477002 290
999 3300028379 Ga0268266_10203243 Ga0268266_102032432 290
1000 3300028380 Ga0268265_10000692 Ga0268265_1000069221 290
1001 3300028380 Ga0268265_10591370 Ga0268265_105913701 290
1002 3300028381 Ga0268264_10001498 Ga0268264_1000149815 290
1003 3300028381 Ga0268264_10150232 Ga0268264_101502321 290
1004 3300028381 Ga0268264_10182918 Ga0268264_101829182 290
1005 3300028381 Ga0268264_10217979 Ga0268264_102179792 290
1006 3300028577 Ga0265318_10076142 Ga0265318_100761422 290
1007 3300031090 Ga0265760_10041513 Ga0265760_100415131 290
1008 3300031235 Ga0265330_10007601 Ga0265330_100076014 290
1009 3300031235 Ga0265330_10037789 Ga0265330_100377892 290
1010 3300031235 Ga0265330_10050657 Ga0265330_100506572 290
1011 3300031238 Ga0265332_10075635 Ga0265332_100756352 290
1012 3300031247 Ga0265340_10007354 Ga0265340_100073545 290
1013 3300031247 Ga0265340_10011210 Ga0265340_100112102 290
1014 3300031247 Ga0265340_10046320 Ga0265340_100463202 290
1015 3300031247 Ga0265340_10103391 Ga0265340_101033911 290
1016 3300031249 Ga0265339_10020140 Ga0265339_100201402 290
1017 3300031250 Ga0265331_10002519 Ga0265331_100025193 290
1018 3300031344 Ga0265316_10065277 Ga0265316_100652773 290
1019 3300031344 Ga0265316_10271717 Ga0265316_102717172 290
1020 3300031507 Ga0307509_10104342 Ga0307509_101043422 290
1021 3300031507 Ga0307509_10363692 Ga0307509_103636921 290
1022 3300031595 Ga0265313_10000832 Ga0265313_1000083223 290
1023 3300031616 Ga0307508_10102794 Ga0307508_101027942 290
1024 3300031691 Ga0316579_10159814 Ga0316579_101598141 290
1025 3300031711 Ga0265314_10006217 Ga0265314_100062175 290
1026 3300031712 Ga0265342_10003354 Ga0265342_1000335410 290
1027 3300031712 Ga0265342_10021002 Ga0265342_100210022 290
1028 3300031712 Ga0265342_10099237 Ga0265342_100992372 290
1029 3300031824 Ga0307413_10165516 Ga0307413_101655162 290
1030 3300032126 Ga0307415_100437034 Ga0307415_1004370341 290
1031 3300033180 Ga0307510_10065915 Ga0307510_100659152 290
1032 3300035083 Ga0373926_0091784 Ga0373926_0091784_74_955 290
1033 3300035086 Ga0373934_0012245 Ga0373934_0012245_2339_3211 290
1034 3300035089 Ga0373944_0009913 Ga0373944_0009913_1669_2550 290
1035 3300035089 Ga0373944_0017924 Ga0373944_0017924_580_1461 290
1036 3300035111 Ga0373923_0000876 Ga0373923_0000876_3067_3948 290
1037 3300035111 Ga0373923_0011115 Ga0373923_0011115_91_972 290
1038 3300035111 Ga0373923_0021126 Ga0373923_0021126_1587_2486 290
1039 3300035113 Ga0373936_0011157 Ga0373936_0011157_117_998 290
1040 3300035113 Ga0373936_0042165 Ga0373936_0042165_698_1579 290
1041 3300035113 Ga0373936_0091709 Ga0373936_0091709_103_975 290
1042 3300035114 Ga0373939_0013155 Ga0373939_0013155_755_1672 290
1043 3300035114 Ga0373939_0042092 Ga0373939_0042092_331_1212 290
1044 3300035116 Ga0373945_0002606 Ga0373945_0002606_2604_3485 290
1045 3300035116 Ga0373945_0010586 Ga0373945_0010586_122_1003 290
1046 3300035116 Ga0373945_0030076 Ga0373945_0030076_768_1640 290
1047 3300035116 Ga0373945_0059362 Ga0373945_0059362_114_995 290
1048 3300035117 Ga0373953_0034308 Ga0373953_0034308_978_1850 290
1049 3300035118 Ga0373954_0006599 Ga0373954_0006599_4049_4945 290
1050 3300035118 Ga0373954_0016181 Ga0373954_0016181_900_1781 290
1051 3300035118 Ga0373954_0041811 Ga0373954_0041811_1241_2122 290
1052 3300035118 Ga0373954_0098006 Ga0373954_0098006_83_964 290
1053 3300035118 Ga0373954_0191158 Ga0373954_0191158_83_982 290
1054 3300035119 Ga0373956_0002258 Ga0373956_0002258_3115_3996 290
1055 3300035119 Ga0373956_0013536 Ga0373956_0013536_2464_3336 290
1056 3300035119 Ga0373956_0016025 Ga0373956_0016025_2140_3036 290
1057 3300035120 Ga0373957_0032026 Ga0373957_0032026_461_1342 290
1058 3300035120 Ga0373957_0107550 Ga0373957_0107550_78_959 290
1059 3300035121 Ga0373960_0007051 Ga0373960_0007051_262_1179 290
1060 3300035170 Ga0373943_0011060 Ga0373943_0011060_535_1416 290
1061 3300035170 Ga0373943_0015659 Ga0373943_0015659_1212_2084 290
1062 3300035170 Ga0373943_0018525 Ga0373943_0018525_2027_2908 290
1063 3300035170 Ga0373943_0042273 Ga0373943_0042273_995_1873 290
1064 3300035170 Ga0373943_0216694 Ga0373943_0216694_56_937 290
1065 3300035171 Ga0373946_0011166 Ga0373946_0011166_454_1335 290
1066 3300035171 Ga0373946_0019287 Ga0373946_0019287_480_1361 290
1067 3300035172 Ga0373955_0009471 Ga0373955_0009471_2245_3126 290
1068 3300035172 Ga0373955_0020515 Ga0373955_0020515_707_1588 290
1069 3300035172 Ga0373955_0111421 Ga0373955_0111421_289_1185 290
1070 3300035207 Ga0373942_0019540 Ga0373942_0019540_181_1062 290
1071 3300035241 Ga0373961_0009482 Ga0373961_0009482_537_1454 290
1072 3300035241 Ga0373961_0027018 Ga0373961_0027018_121_1002 290
1073 3300035242 Ga0373962_0004928 Ga0373962_0004928_739_1620 290
1074 3300035410 Ga0373924_0004262 Ga0373924_0004262_2729_3610 290
1075 3300035410 Ga0373924_0014812 Ga0373924_0014812_1747_2628 290
1076 3300035691 Ga0373931_0010444 Ga0373931_0010444_1252_2169 290
1077 3300035691 Ga0373931_0013871 Ga0373931_0013871_2455_3327 290
1078 3300035691 Ga0373931_0327076 Ga0373931_0327076_33_923 290
1079 3300035692 Ga0373935_0001695 Ga0373935_0001695_2856_3728 290
1080 3300035692 Ga0373935_0009581 Ga0373935_0009581_3472_4353 290
1081 3300035692 Ga0373935_0112161 Ga0373935_0112161_781_1653 290
1082 3300035692 Ga0373935_0122140 Ga0373935_0122140_326_1207 290
1083 3300035692 Ga0373935_0160688 Ga0373935_0160688_587_1483 290
1084 3300035692 Ga0373935_0180726 Ga0373935_0180726_187_1068 290
1085 3300035695 Ga0373927_0000792 Ga0373927_0000792_1343_2215 290
1086 3300035695 Ga0373927_0018799 Ga0373927_0018799_1640_2521 290
1087 3300035695 Ga0373927_0115416 Ga0373927_0115416_440_1321 290
1088 3300035695 Ga0373927_0276890 Ga0373927_0276890_197_1078 290
1089 3300035724 Ga0373933_0000777 Ga0373933_0000777_1060_1932 290
1090 3300035724 Ga0373933_0002673 Ga0373933_0002673_6637_7518 290
1091 3300035724 Ga0373933_0002696 Ga0373933_0002696_2370_3242 290
1092 3300035724 Ga0373933_0025925 Ga0373933_0025925_557_1438 290
1093 3300035724 Ga0373933_0088829 Ga0373933_0088829_38_934 290
1094 3300035724 Ga0373933_0109582 Ga0373933_0109582_751_1632 290
1095 3300035725 Ga0373947_0009094 Ga0373947_0009094_868_1740 290
1096 3300035725 Ga0373947_0017854 Ga0373947_0017854_2340_3221 290
1097 3300035725 Ga0373947_0026316 Ga0373947_0026316_2406_3278 290
1098 3300035725 Ga0373947_0121187 Ga0373947_0121187_478_1359 290
1099 3300035725 Ga0373947_0173802 Ga0373947_0173802_239_1138 290
1100 3300036401 Ga0373937_0002830 Ga0373937_0002830_8242_9123 290
1101 3300036401 Ga0373937_0014011 Ga0373937_0014011_2438_3319 290
1102 3300036401 Ga0373937_0024326 Ga0373937_0024326_1742_2614 290
1103 3300036401 Ga0373937_0040006 Ga0373937_0040006_390_1307 290
1104 3300036401 Ga0373937_0081857 Ga0373937_0081857_165_1037 290
1105 3300036401 Ga0373937_0097930 Ga0373937_0097930_1194_2090 290
1106 3300036401 Ga0373937_0129513 Ga0373937_0129513_731_1630 290
1107 3300036401 Ga0373937_0254823 Ga0373937_0254823_659_1540 290
1108 3300036401 Ga0373937_0362069 Ga0373937_0362069_323_1195 290
1109 3300036401 Ga0373937_0400798 Ga0373937_0400798_120_992 290
1110 3300036401 Ga0373937_0607452 Ga0373937_0607452_105_977 290
1111 3300036459 Ga0372808_001117 Ga0372808_001117_1297_2169 290
1112 3300037068 Ga0373925_0029718 Ga0373925_0029718_1667_2539 290
1113 3300037068 Ga0373925_0038159 Ga0373925_0038159_228_1109 290
1114 3300037068 Ga0373925_0101917 Ga0373925_0101917_353_1225 290
1115 3300037068 Ga0373925_0134242 Ga0373925_0134242_480_1361 290
1116 3300037068 Ga0373925_0171628 Ga0373925_0171628_91_972 290
1117 3300037068 Ga0373925_0240495 Ga0373925_0240495_483_1364 290
1118 3300037068 Ga0373925_0295397 Ga0373925_0295397_375_1247 290
1119 3300037471 Ga0395905_0149312 Ga0395905_0149312_1073_1945 290
1120 3300039437 Ga0436365_1909734 Ga0436365_1909734_363_1244 290
1121 3300039447 Ga0436361_0700040 Ga0436361_0700040_208_1122 290
1122 3300039447 Ga0436361_0880434 Ga0436361_0880434_266_1147 290
1123 3300039450 Ga0436363_0925997 Ga0436363_0925997_738_1610 290
1124 3300041408 Ga0439453_0016430 Ga0439453_0016430_255_1136 290
1125 3300041413 Ga0439465_0057119 Ga0439465_0057119_106_978 290
1126 3300042436 Ga0439435_0069504 Ga0439435_0069504_130_1011 290
1127 3300042461 Ga0439460_0033544 Ga0439460_0033544_467_1345 290
1128 3300044694 Ga0466963_0168499 Ga0466963_0168499_24_896 290
1129 3300045051 Ga0451576_0052400 Ga0451576_0052400_1140_2021 290
1130 3300045976 Ga0466967_0110667 Ga0466967_0110667_1217_2089 290
1131 3300046452 Ga0495617_054885 Ga0495617_054885_417_1289 290
1132 3300046454 Ga0495592_0006635 Ga0495592_0006635_396_1277 290
1133 3300046454 Ga0495592_0011579 Ga0495592_0011579_4330_5202 290
1134 3300046454 Ga0495592_0036259 Ga0495592_0036259_1201_2097 290
1135 3300046454 Ga0495592_0044670 Ga0495592_0044670_688_1569 290
1136 3300046454 Ga0495592_0058738 Ga0495592_0058738_1913_2785 290
1137 3300046454 Ga0495592_0209081 Ga0495592_0209081_226_1125 290
1138 3300046454 Ga0495592_0228383 Ga0495592_0228383_26_907 290
1139 3300046455 Ga0495603_0001070 Ga0495603_0001070_8887_9759 290
1140 3300046455 Ga0495603_0019622 Ga0495603_0019622_1842_2723 290
1141 3300046455 Ga0495603_0028481 Ga0495603_0028481_2309_3181 290
1142 3300046455 Ga0495603_0029447 Ga0495603_0029447_129_1001 290
1143 3300046455 Ga0495603_0046661 Ga0495603_0046661_1640_2512 290
1144 3300046455 Ga0495603_0100496 Ga0495603_0100496_349_1230 290
1145 3300046455 Ga0495603_0127222 Ga0495603_0127222_292_1173 290
1146 3300046455 Ga0495603_0135318 Ga0495603_0135318_237_1109 290
1147 3300046459 Ga0495629_0000368 Ga0495629_0000368_9787_10668 290
1148 3300046459 Ga0495629_0001441 Ga0495629_0001441_1445_2317 290
1149 3300046459 Ga0495629_0009862 Ga0495629_0009862_2599_3480 290
1150 3300046459 Ga0495629_0017469 Ga0495629_0017469_868_1749 290
1151 3300046459 Ga0495629_0050734 Ga0495629_0050734_1971_2843 290
1152 3300046459 Ga0495629_0257979 Ga0495629_0257979_19_900 290
1153 3300046459 Ga0495629_0308384 Ga0495629_0308384_27_923 290
1154 3300046460 Ga0495638_0252386 Ga0495638_0252386_77_949 290
1155 3300046461 Ga0495641_0004779 Ga0495641_0004779_7433_8305 290
1156 3300046461 Ga0495641_0013678 Ga0495641_0013678_3003_3884 290
1157 3300046461 Ga0495641_0023743 Ga0495641_0023743_1856_2737 290
1158 3300046461 Ga0495641_0092540 Ga0495641_0092540_324_1196 290
1159 3300046462 Ga0495651_0002392 Ga0495651_0002392_7087_7968 290
1160 3300046462 Ga0495651_0017223 Ga0495651_0017223_2762_3643 290
1161 3300046462 Ga0495651_0075576 Ga0495651_0075576_951_1823 290
1162 3300046463 Ga0495653_0011500 Ga0495653_0011500_832_1713 290
1163 3300046463 Ga0495653_0014724 Ga0495653_0014724_61_933 290
1164 3300046463 Ga0495653_0048037 Ga0495653_0048037_144_1043 290
1165 3300046463 Ga0495653_0117374 Ga0495653_0117374_297_1178 290
1166 3300046463 Ga0495653_0139162 Ga0495653_0139162_517_1413 290
1167 3300046471 Ga0495650_0040057 Ga0495650_0040057_782_1654 290
1168 3300046472 Ga0495580_0003347 Ga0495580_0003347_11587_12459 290
1169 3300046472 Ga0495580_0017291 Ga0495580_0017291_1917_2798 290
1170 3300046472 Ga0495580_0049442 Ga0495580_0049442_624_1505 290
1171 3300046472 Ga0495580_0081204 Ga0495580_0081204_411_1292 290
1172 3300046473 Ga0495582_0001595 Ga0495582_0001595_7043_7924 290
1173 3300046473 Ga0495582_0004432 Ga0495582_0004432_6972_7844 290
1174 3300046473 Ga0495582_0076443 Ga0495582_0076443_612_1484 290
1175 3300046474 Ga0495605_0031005 Ga0495605_0031005_1339_2214 290
1176 3300046475 Ga0495639_0000231 Ga0495639_0000231_20368_21240 290
1177 3300046475 Ga0495639_0016017 Ga0495639_0016017_368_1249 290
1178 3300046475 Ga0495639_0020436 Ga0495639_0020436_1954_2835 290
1179 3300046475 Ga0495639_0033456 Ga0495639_0033456_134_1006 290
1180 3300046475 Ga0495639_0065662 Ga0495639_0065662_575_1447 290
1181 3300046475 Ga0495639_0174908 Ga0495639_0174908_130_1002 290
1182 3300046476 Ga0495662_0005546 Ga0495662_0005546_1282_2163 290
1183 3300046476 Ga0495662_0020593 Ga0495662_0020593_1257_2129 290
1184 3300046476 Ga0495662_0034318 Ga0495662_0034318_1228_2109 290
1185 3300046476 Ga0495662_0189634 Ga0495662_0189634_21_899 290
1186 3300046477 Ga0495664_0011834 Ga0495664_0011834_2636_3535 290
1187 3300046477 Ga0495664_0021493 Ga0495664_0021493_2012_2893 290
1188 3300046477 Ga0495664_0037782 Ga0495664_0037782_855_1736 290
1189 3300046477 Ga0495664_0039991 Ga0495664_0039991_607_1488 290
1190 3300046477 Ga0495664_0042158 Ga0495664_0042158_1150_2031 290
1191 3300046477 Ga0495664_0048148 Ga0495664_0048148_428_1300 290
1192 3300046477 Ga0495664_0254224 Ga0495664_0254224_109_1005 290
1193 3300046491 Ga0495584_0044448 Ga0495584_0044448_137_1018 290
1194 3300046492 Ga0495585_0015104 Ga0495585_0015104_1454_2335 290
1195 3300046499 Ga0495594_0015582 Ga0495594_0015582_2879_3751 290
1196 3300046499 Ga0495594_0180576 Ga0495594_0180576_206_1078 290
1197 3300046499 Ga0495594_0209099 Ga0495594_0209099_56_928 290
1198 3300046501 Ga0495607_0007966 Ga0495607_0007966_3530_4411 290
1199 3300046511 Ga0495608_0002243 Ga0495608_0002243_7052_7933 290
1200 3300046511 Ga0495608_0016836 Ga0495608_0016836_1299_2180 290
1201 3300046511 Ga0495608_0017561 Ga0495608_0017561_2104_2976 290
1202 3300046511 Ga0495608_0095054 Ga0495608_0095054_990_1886 290
1203 3300046514 Ga0495618_0011649 Ga0495618_0011649_4163_5044 290
1204 3300046514 Ga0495618_0023082 Ga0495618_0023082_2757_3638 290
1205 3300046514 Ga0495618_0134229 Ga0495618_0134229_214_1095 290
1206 3300046514 Ga0495618_0225420 Ga0495618_0225420_251_1132 290
1207 3300046514 Ga0495618_0271003 Ga0495618_0271003_64_936 290
1208 3300046516 Ga0495628_0006423 Ga0495628_0006423_5430_6311 290
1209 3300046516 Ga0495628_0021744 Ga0495628_0021744_347_1243 290
1210 3300046516 Ga0495628_0232795 Ga0495628_0232795_278_1159 290
1211 3300046517 Ga0495630_0006442 Ga0495630_0006442_6952_7824 290
1212 3300046517 Ga0495630_0032084 Ga0495630_0032084_2739_3620 290
1213 3300046517 Ga0495630_0113720 Ga0495630_0113720_139_1020 290
1214 3300046517 Ga0495630_0218425 Ga0495630_0218425_347_1243 290
1215 3300046519 Ga0495632_0102830 Ga0495632_0102830_147_1028 290
1216 3300046523 Ga0495644_0002466 Ga0495644_0002466_834_1715 290
1217 3300046526 Ga0495666_0011941 Ga0495666_0011941_2312_3184 290
1218 3300046526 Ga0495666_0025922 Ga0495666_0025922_1954_2835 290
1219 3300046529 Ga0495652_0008012 Ga0495652_0008012_1866_2747 290
1220 3300046529 Ga0495652_0043647 Ga0495652_0043647_1737_2609 290
1221 3300046529 Ga0495652_0049003 Ga0495652_0049003_1544_2425 290
1222 3300046529 Ga0495652_0168698 Ga0495652_0168698_624_1505 290
1223 3300046529 Ga0495652_0266421 Ga0495652_0266421_194_1075 290
1224 3300046529 Ga0495652_0307325 Ga0495652_0307325_201_1073 290
1225 3300046529 Ga0495652_0365686 Ga0495652_0365686_135_1016 290
1226 3300046531 Ga0495665_0002780 Ga0495665_0002780_7300_8172 290
1227 3300046531 Ga0495665_0006741 Ga0495665_0006741_902_1783 290
1228 3300046531 Ga0495665_0007753 Ga0495665_0007753_2923_3804 290
1229 3300046531 Ga0495665_0032303 Ga0495665_0032303_1282_2163 290
1230 3300046533 Ga0495640_0006384 Ga0495640_0006384_6995_7876 290
1231 3300046533 Ga0495640_0049626 Ga0495640_0049626_1944_2825 290
1232 3300046533 Ga0495640_0064162 Ga0495640_0064162_494_1366 290
1233 3300046533 Ga0495640_0067024 Ga0495640_0067024_65_937 290
1234 3300046533 Ga0495640_0143256 Ga0495640_0143256_264_1160 290
1235 3300046533 Ga0495640_0147916 Ga0495640_0147916_187_1068 290
1236 3300046533 Ga0495640_0290712 Ga0495640_0290712_49_930 290
1237 3300046535 Ga0495586_0033183 Ga0495586_0033183_1767_2648 290
1238 3300046536 Ga0495587_0001625 Ga0495587_0001625_8641_9522 290
1239 3300046536 Ga0495587_0020344 Ga0495587_0020344_443_1324 290
1240 3300046536 Ga0495587_0026687 Ga0495587_0026687_536_1435 290
1241 3300046536 Ga0495587_0044294 Ga0495587_0044294_1470_2351 290
1242 3300046536 Ga0495587_0108990 Ga0495587_0108990_651_1523 290
1243 3300046537 Ga0495598_0021155 Ga0495598_0021155_212_1084 290
1244 3300046537 Ga0495598_0024675 Ga0495598_0024675_132_1028 290
1245 3300046538 Ga0495609_0093697 Ga0495609_0093697_179_1060 290
1246 3300046539 Ga0495621_0059566 Ga0495621_0059566_123_1019 290
1247 3300046543 Ga0495645_0052884 Ga0495645_0052884_2023_2922 290
1248 3300046543 Ga0495645_0148470 Ga0495645_0148470_97_978 290
1249 3300046557 Ga0495622_0003462 Ga0495622_0003462_5343_6215 290
1250 3300046557 Ga0495622_0015188 Ga0495622_0015188_380_1252 290
1251 3300046557 Ga0495622_0016590 Ga0495622_0016590_2081_2962 290
1252 3300046557 Ga0495622_0104354 Ga0495622_0104354_222_1103 290
1253 3300046559 Ga0495667_0012176 Ga0495667_0012176_508_1389 290
1254 3300046559 Ga0495667_0025660 Ga0495667_0025660_1348_2244 290
1255 3300046559 Ga0495667_0080865 Ga0495667_0080865_269_1141 290
1256 3300046559 Ga0495667_0171190 Ga0495667_0171190_271_1170 290
1257 3300046615 Ga0495656_0001002 Ga0495656_0001002_4979_5860 290
1258 3300046615 Ga0495656_0024111 Ga0495656_0024111_677_1549 290
1259 3300046615 Ga0495656_0032030 Ga0495656_0032030_22_897 290
1260 3300046615 Ga0495656_0068602 Ga0495656_0068602_684_1556 290
1261 3300046642 Ga0495634_0000633 Ga0495634_0000633_27234_28106 290
1262 3300046642 Ga0495634_0005735 Ga0495634_0005735_3073_3954 290
1263 3300046642 Ga0495634_0106000 Ga0495634_0106000_30_911 290
1264 3300046642 Ga0495634_0170114 Ga0495634_0170114_319_1200 290
1265 3300046648 Ga0495611_0023402 Ga0495611_0023402_158_1039 290
1266 3300046660 Ga0495625_0216517 Ga0495625_0216517_369_1241 290
1267 3300046660 Ga0495625_0325015 Ga0495625_0325015_73_945 290
1268 3300046663 Ga0495635_0000665 Ga0495635_0000665_20875_21747 290
1269 3300046663 Ga0495635_0009323 Ga0495635_0009323_5858_6739 290
1270 3300046663 Ga0495635_0010268 Ga0495635_0010268_1521_2402 290
1271 3300046663 Ga0495635_0011618 Ga0495635_0011618_2870_3751 290
1272 3300046663 Ga0495635_0020430 Ga0495635_0020430_3702_4598 290
1273 3300046663 Ga0495635_0100043 Ga0495635_0100043_1022_1903 290
1274 3300046663 Ga0495635_0137715 Ga0495635_0137715_373_1272 290
1275 3300046664 Ga0495659_0002625 Ga0495659_0002625_3146_4027 290
1276 3300046664 Ga0495659_0005702 Ga0495659_0005702_107_1036 290
1277 3300046664 Ga0495659_0050807 Ga0495659_0050807_345_1217 290
1278 3300046664 Ga0495659_0072246 Ga0495659_0072246_78_950 290
1279 3300046674 Ga0495588_0015701 Ga0495588_0015701_689_1570 290
1280 3300046674 Ga0495588_0033230 Ga0495588_0033230_727_1599 290
1281 3300046674 Ga0495588_0034647 Ga0495588_0034647_233_1105 290
1282 3300046674 Ga0495588_0084853 Ga0495588_0084853_615_1496 290
1283 3300046674 Ga0495588_0123238 Ga0495588_0123238_60_932 290
1284 3300046675 Ga0495657_0015213 Ga0495657_0015213_3008_3889 290
1285 3300046675 Ga0495657_0152771 Ga0495657_0152771_499_1395 290
1286 3300046678 Ga0495599_0001523 Ga0495599_0001523_9560_10441 290
1287 3300046678 Ga0495599_0021521 Ga0495599_0021521_1299_2180 290
1288 3300046678 Ga0495599_0195607 Ga0495599_0195607_37_909 290
1289 3300046678 Ga0495599_0273096 Ga0495599_0273096_98_970 290
1290 3300046679 Ga0495623_0013321 Ga0495623_0013321_1840_2712 290
1291 3300046679 Ga0495623_0013353 Ga0495623_0013353_288_1169 290
1292 3300046680 Ga0495646_0008160 Ga0495646_0008160_3546_4427 290
1293 3300046680 Ga0495646_0023005 Ga0495646_0023005_2775_3647 290
1294 3300046680 Ga0495646_0024074 Ga0495646_0024074_600_1499 290
1295 3300046680 Ga0495646_0050415 Ga0495646_0050415_1449_2330 290
1296 3300046680 Ga0495646_0052779 Ga0495646_0052779_275_1147 290
1297 3300046680 Ga0495646_0111899 Ga0495646_0111899_426_1298 290
1298 3300046681 Ga0495647_0001366 Ga0495647_0001366_4352_5233 290
1299 3300046681 Ga0495647_0012136 Ga0495647_0012136_185_1066 290
1300 3300046681 Ga0495647_0025638 Ga0495647_0025638_292_1173 290
1301 3300046681 Ga0495647_0048351 Ga0495647_0048351_428_1300 290
1302 3300046683 Ga0495658_0000165 Ga0495658_0000165_1531_2412 290
1303 3300046683 Ga0495658_0000725 Ga0495658_0000725_16747_17619 290
1304 3300046683 Ga0495658_0012633 Ga0495658_0012633_1929_2810 290
1305 3300046683 Ga0495658_0021818 Ga0495658_0021818_2487_3368 290
1306 3300046683 Ga0495658_0078584 Ga0495658_0078584_182_1054 290
1307 3300046683 Ga0495658_0158397 Ga0495658_0158397_412_1284 290
1308 3300046684 Ga0495669_0059735 Ga0495669_0059735_167_1039 290
1309 3300046684 Ga0495669_0173745 Ga0495669_0173745_131_1003 290
1310 3300046689 Ga0495613_0006987 Ga0495613_0006987_71_952 290
1311 3300046689 Ga0495613_0017127 Ga0495613_0017127_2904_3776 290
1312 3300046689 Ga0495613_0030519 Ga0495613_0030519_1050_1931 290
1313 3300046689 Ga0495613_0037634 Ga0495613_0037634_887_1768 290
1314 3300046689 Ga0495613_0072408 Ga0495613_0072408_213_1094 290
1315 3300046689 Ga0495613_0196323 Ga0495613_0196323_212_1093 290
1316 3300046689 Ga0495613_0224097 Ga0495613_0224097_354_1235 290
1317 3300046690 Ga0495624_0004278 Ga0495624_0004278_7897_8778 290
1318 3300046690 Ga0495624_0009174 Ga0495624_0009174_4742_5614 290
1319 3300046691 Ga0495670_0000903 Ga0495670_0000903_3402_4283 290
1320 3300046794 Ga0495589_0026690 Ga0495589_0026690_1066_1947 290
1321 3300046809 Ga0495600_0000818 Ga0495600_0000818_2465_3337 290
1322 3300046809 Ga0495600_0003186 Ga0495600_0003186_5587_6468 290
1323 3300046809 Ga0495600_0017508 Ga0495600_0017508_3367_4248 290
1324 3300046809 Ga0495600_0055746 Ga0495600_0055746_1462_2361 290
1325 3300046809 Ga0495600_0138029 Ga0495600_0138029_448_1320 290
1326 3300047315 Ga0495581_0000174 Ga0495581_0000174_1436_2308 290
1327 3300047315 Ga0495581_0010349 Ga0495581_0010349_491_1372 290
1328 3300047315 Ga0495581_0089148 Ga0495581_0089148_791_1672 290
1329 3300047315 Ga0495581_0092962 Ga0495581_0092962_23_904 290
1330 3300047317 Ga0495604_0000586 Ga0495604_0000586_23448_24329 290
1331 3300047317 Ga0495604_0032135 Ga0495604_0032135_2663_3562 290
1332 3300047317 Ga0495604_0041186 Ga0495604_0041186_2665_3546 290
1333 3300047317 Ga0495604_0122996 Ga0495604_0122996_83_955 290
1334 3300047319 Ga0495674_0002611 Ga0495674_0002611_13027_13908 290
1335 3300047319 Ga0495674_0008776 Ga0495674_0008776_7456_8328 290
1336 3300047319 Ga0495674_0044731 Ga0495674_0044731_2499_3380 290
1337 3300047319 Ga0495674_0044919 Ga0495674_0044919_642_1538 290
1338 3300047319 Ga0495674_0061023 Ga0495674_0061023_1240_2121 290
1339 3300047319 Ga0495674_0212676 Ga0495674_0212676_363_1244 290
1340 3300047320 Ga0495672_0051959 Ga0495672_0051959_385_1281 290
1341 3300047321 Ga0495676_0008428 Ga0495676_0008428_1240_2112 290
1342 3300047321 Ga0495676_0109834 Ga0495676_0109834_312_1193 290
1343 3300047321 Ga0495676_0132235 Ga0495676_0132235_741_1622 290
1344 3300047321 Ga0495676_0215882 Ga0495676_0215882_311_1192 290
1345 3300047321 Ga0495676_0225990 Ga0495676_0225990_346_1218 290
1346 3300047321 Ga0495676_0249783 Ga0495676_0249783_305_1177 290
1347 3300047322 Ga0495680_0001983 Ga0495680_0001983_13305_14186 290
1348 3300047322 Ga0495680_0018445 Ga0495680_0018445_187_1068 290
1349 3300047322 Ga0495680_0046270 Ga0495680_0046270_1234_2115 290
1350 3300047322 Ga0495680_0086826 Ga0495680_0086826_37_933 290
1351 3300047322 Ga0495680_0128982 Ga0495680_0128982_648_1520 290
1352 3300047444 Ga0495675_0002226 Ga0495675_0002226_4526_5407 290
1353 3300047444 Ga0495675_0006353 Ga0495675_0006353_4011_4883 290
1354 3300047444 Ga0495675_0033827 Ga0495675_0033827_345_1241 290
1355 3300047445 Ga0495677_0067677 Ga0495677_0067677_393_1265 290
1356 3300047446 Ga0495679_006235 Ga0495679_006235_622_1503 290
1357 3300047469 Ga0495673_0013916 Ga0495673_0013916_2867_3739 290
1358 3300047469 Ga0495673_0059625 Ga0495673_0059625_268_1140 290
1359 3300047471 Ga0495684_0014074 Ga0495684_0014074_5215_6087 290
1360 3300047471 Ga0495684_0015612 Ga0495684_0015612_2870_3751 290
1361 3300047471 Ga0495684_0017881 Ga0495684_0017881_67_948 290
1362 3300047471 Ga0495684_0033194 Ga0495684_0033194_1624_2523 290
1363 3300047471 Ga0495684_0092302 Ga0495684_0092302_1314_2195 290
1364 3300047471 Ga0495684_0107771 Ga0495684_0107771_973_1854 290
1365 3300047471 Ga0495684_0147683 Ga0495684_0147683_458_1354 290
1366 3300047673 Ga0495593_0017972 Ga0495593_0017972_1940_2821 290
1367 3300047673 Ga0495593_0024670 Ga0495593_0024670_584_1465 290
1368 3300047673 Ga0495593_0031691 Ga0495593_0031691_1622_2503 290
1369 3300047673 Ga0495593_0035570 Ga0495593_0035570_866_1765 290
1370 3300047673 Ga0495593_0123556 Ga0495593_0123556_150_1031 290
1371 3300048088 Ga0495602_0029841 Ga0495602_0029841_2006_2887 290
1372 3300048089 Ga0495614_0003910 Ga0495614_0003910_4831_5712 290
1373 3300048089 Ga0495614_0020009 Ga0495614_0020009_403_1284 290
1374 3300048089 Ga0495614_0051894 Ga0495614_0051894_833_1714 290
1375 3300048090 Ga0495615_0040482 Ga0495615_0040482_252_1148 290
1376 3300048903 Ga0496100_0010438 Ga0496100_0010438_4024_4905 290
1377 3300048903 Ga0496100_0110557 Ga0496100_0110557_809_1708 290
1378 3300048903 Ga0496100_0147673 Ga0496100_0147673_395_1276 290
1379 3300048903 Ga0496100_0178562 Ga0496100_0178562_612_1484 290
1380 3300048904 Ga0496101_0021632 Ga0496101_0021632_3143_4015 290
1381 3300048904 Ga0496101_0079631 Ga0496101_0079631_862_1743 290
1382 3300048904 Ga0496101_0089116 Ga0496101_0089116_340_1221 290
1383 3300048904 Ga0496101_0164455 Ga0496101_0164455_516_1388 290
1384 3300048904 Ga0496101_0313385 Ga0496101_0313385_202_1074 290
1385 3300048904 Ga0496101_0353154 Ga0496101_0353154_201_1082 290
1386 3300048904 Ga0496101_0376129 Ga0496101_0376129_101_1000 290
1387 3300048905 Ga0496102_0007073 Ga0496102_0007073_6066_6947 290
1388 3300048905 Ga0496102_0011614 Ga0496102_0011614_2326_3207 290
1389 3300048905 Ga0496102_0032808 Ga0496102_0032808_368_1249 290
1390 3300048905 Ga0496102_0042391 Ga0496102_0042391_2097_2996 290
1391 3300048905 Ga0496102_0063696 Ga0496102_0063696_1932_2813 290
1392 3300048905 Ga0496102_0099473 Ga0496102_0099473_1674_2546 290
1393 3300048905 Ga0496102_0112221 Ga0496102_0112221_722_1600 290
1394 3300048905 Ga0496102_0344148 Ga0496102_0344148_45_926 290
1395 3300048906 Ga0496103_0006069 Ga0496103_0006069_251_1132 290
1396 3300048906 Ga0496103_0017752 Ga0496103_0017752_482_1363 290
1397 3300048906 Ga0496103_0042226 Ga0496103_0042226_836_1714 290
1398 3300048906 Ga0496103_0087689 Ga0496103_0087689_351_1223 290
1399 3300048907 Ga0496104_0000880 Ga0496104_0000880_24682_25560 290
1400 3300048907 Ga0496104_0037922 Ga0496104_0037922_1088_1960 290
1401 3300048907 Ga0496104_0041944 Ga0496104_0041944_2309_3181 290
1402 3300048907 Ga0496104_0068209 Ga0496104_0068209_92_973 290
1403 3300048907 Ga0496104_0071639 Ga0496104_0071639_1968_2849 290
1404 3300048907 Ga0496104_0093199 Ga0496104_0093199_558_1439 290
1405 3300048907 Ga0496104_0278171 Ga0496104_0278171_477_1349 290
1406 3300048908 Ga0496105_0001068 Ga0496105_0001068_17718_18599 290
1407 3300048908 Ga0496105_0001416 Ga0496105_0001416_1132_2010 290
1408 3300048908 Ga0496105_0048910 Ga0496105_0048910_73_945 290
1409 3300048908 Ga0496105_0057658 Ga0496105_0057658_1227_2099 290
1410 3300048908 Ga0496105_0240970 Ga0496105_0240970_449_1330 290
1411 3300048908 Ga0496105_0290265 Ga0496105_0290265_69_950 290
1412 3300048909 Ga0496106_0000132 Ga0496106_0000132_844_1725 290
1413 3300048909 Ga0496106_0013521 Ga0496106_0013521_3758_4630 290
1414 3300048909 Ga0496106_0045055 Ga0496106_0045055_429_1310 290
1415 3300048909 Ga0496106_0060632 Ga0496106_0060632_1256_2137 290
1416 3300048909 Ga0496106_0103852 Ga0496106_0103852_1080_1952 290
1417 3300048909 Ga0496106_0137590 Ga0496106_0137590_902_1783 290
1418 3300048909 Ga0496106_0217211 Ga0496106_0217211_330_1229 290
1419 3300048910 Ga0496107_0009364 Ga0496107_0009364_4907_5788 290
1420 3300048910 Ga0496107_0009646 Ga0496107_0009646_2403_3275 290
1421 3300048910 Ga0496107_0094933 Ga0496107_0094933_521_1420 290
1422 3300048910 Ga0496107_0111538 Ga0496107_0111538_254_1135 290
1423 3300048910 Ga0496107_0115883 Ga0496107_0115883_546_1418 290
1424 3300048910 Ga0496107_0125822 Ga0496107_0125822_226_1107 290
1425 3300048910 Ga0496107_0126114 Ga0496107_0126114_34_906 290
1426 3300048910 Ga0496107_0173318 Ga0496107_0173318_307_1200 290
1427 3300048911 Ga0496108_0000522 Ga0496108_0000522_11294_12172 290
1428 3300048911 Ga0496108_0003135 Ga0496108_0003135_11785_12666 290
1429 3300048911 Ga0496108_0006976 Ga0496108_0006976_3438_4310 290
1430 3300048911 Ga0496108_0057391 Ga0496108_0057391_316_1188 290
1431 3300048911 Ga0496108_0096164 Ga0496108_0096164_397_1269 290
1432 3300048911 Ga0496108_0288660 Ga0496108_0288660_227_1099 290
1433 3300048912 Ga0496109_0022446 Ga0496109_0022446_368_1249 290
1434 3300048912 Ga0496109_0028555 Ga0496109_0028555_507_1385 290
1435 3300048912 Ga0496109_0093748 Ga0496109_0093748_175_1056 290
1436 3300048913 Ga0496110_0062125 Ga0496110_0062125_2221_3093 290
1437 3300048913 Ga0496110_0103431 Ga0496110_0103431_1583_2455 290
1438 3300048913 Ga0496110_0138692 Ga0496110_0138692_65_937 290
1439 3300048914 Ga0496111_0035681 Ga0496111_0035681_2500_3378 290
1440 3300048914 Ga0496111_0122079 Ga0496111_0122079_837_1709 290
1441 3300048914 Ga0496111_0132495 Ga0496111_0132495_274_1146 290
1442 3300048914 Ga0496111_0243757 Ga0496111_0243757_299_1171 290
1443 3300048915 Ga0496112_0001086 Ga0496112_0001086_3337_4209 290
1444 3300048915 Ga0496112_0003420 Ga0496112_0003420_609_1487 290
1445 3300048915 Ga0496112_0007256 Ga0496112_0007256_3729_4601 290
1446 3300048915 Ga0496112_0032432 Ga0496112_0032432_2159_3031 290
1447 3300048915 Ga0496112_0065761 Ga0496112_0065761_1591_2463 290
1448 3300048915 Ga0496112_0086972 Ga0496112_0086972_2129_3001 290
1449 3300048915 Ga0496112_0095156 Ga0496112_0095156_961_1881 290
1450 3300048915 Ga0496112_0217806 Ga0496112_0217806_398_1279 290
1451 3300048916 Ga0496113_0004411 Ga0496113_0004411_7153_8031 290
1452 3300048916 Ga0496113_0016021 Ga0496113_0016021_1935_2855 290
1453 3300048916 Ga0496113_0024656 Ga0496113_0024656_3030_3911 290
1454 3300048916 Ga0496113_0036274 Ga0496113_0036274_182_1054 290
1455 3300048916 Ga0496113_0117827 Ga0496113_0117827_527_1399 290
1456 3300048916 Ga0496113_0286589 Ga0496113_0286589_11_883 290
1457 3300048916 Ga0496113_0385994 Ga0496113_0385994_12_911 290
1458 3300048917 Ga0496114_0032608 Ga0496114_0032608_1205_2077 290
1459 3300048917 Ga0496114_0047965 Ga0496114_0047965_48_929 290
1460 3300048917 Ga0496114_0053960 Ga0496114_0053960_449_1330 290
1461 3300048917 Ga0496114_0064347 Ga0496114_0064347_1105_1986 290
1462 3300048917 Ga0496114_0146468 Ga0496114_0146468_827_1708 290
1463 3300048917 Ga0496114_0182209 Ga0496114_0182209_115_1035 290
1464 3300048917 Ga0496114_0533969 Ga0496114_0533969_79_951 290
1465 3300048918 Ga0496115_0003538 Ga0496115_0003538_1208_2089 290
1466 3300048918 Ga0496115_0010568 Ga0496115_0010568_1349_2230 290
1467 3300048918 Ga0496115_0012652 Ga0496115_0012652_2277_3158 290
1468 3300048918 Ga0496115_0022964 Ga0496115_0022964_3590_4471 290
1469 3300048918 Ga0496115_0026346 Ga0496115_0026346_2424_3296 290
1470 3300048918 Ga0496115_0031711 Ga0496115_0031711_3189_4061 290
1471 3300048918 Ga0496115_0046127 Ga0496115_0046127_1244_2125 290
1472 3300048918 Ga0496115_0048408 Ga0496115_0048408_1018_1899 290
1473 3300048918 Ga0496115_0147688 Ga0496115_0147688_1017_1889 290
1474 3300048918 Ga0496115_0182069 Ga0496115_0182069_295_1194 290
1475 3300048918 Ga0496115_0368417 Ga0496115_0368417_195_1067 290
1476 3300048918 Ga0496115_0490899 Ga0496115_0490899_23_895 290
1477 3300048920 Ga0496117_0154729 Ga0496117_0154729_329_1201 290
1478 3300048921 Ga0496118_0108378 Ga0496118_0108378_307_1179 290
1479 3300048924 Ga0496121_0013014 Ga0496121_0013014_6720_7628 290
1480 3300048924 Ga0496121_0013148 Ga0496121_0013148_7576_8448 290
1481 3300048924 Ga0496121_0075851 Ga0496121_0075851_949_1875 290
1482 3300048924 Ga0496121_0102349 Ga0496121_0102349_1195_2067 290
1483 3300048924 Ga0496121_0200162 Ga0496121_0200162_527_1399 290
1484 3300048924 Ga0496121_0201760 Ga0496121_0201760_428_1300 290
1485 3300048924 Ga0496121_0226368 Ga0496121_0226368_340_1212 290
1486 3300048924 Ga0496121_0325022 Ga0496121_0325022_138_1010 290
1487 3300048924 Ga0496121_0354958 Ga0496121_0354958_37_918 290
1488 3300048925 Ga0496122_0031712 Ga0496122_0031712_3236_4108 290
1489 3300048927 Ga0496124_0192246 Ga0496124_0192246_132_1004 290
1490 3300048928 Ga0496125_0000731 Ga0496125_0000731_44417_45289 290
1491 3300048928 Ga0496125_0167200 Ga0496125_0167200_565_1437 290
1492 3300048929 Ga0496126_0004045 Ga0496126_0004045_7069_7941 290
1493 3300048929 Ga0496126_0004527 Ga0496126_0004527_6282_7154 290
1494 3300048929 Ga0496126_0010386 Ga0496126_0010386_763_1635 290
1495 3300048929 Ga0496126_0061797 Ga0496126_0061797_635_1507 290
1496 3300048929 Ga0496126_0064956 Ga0496126_0064956_841_1713 290
1497 3300048929 Ga0496126_0108261 Ga0496126_0108261_1526_2398 290
1498 3300048929 Ga0496126_0109155 Ga0496126_0109155_1262_2134 290
1499 3300048929 Ga0496126_0117746 Ga0496126_0117746_1029_1913 290
1500 3300048929 Ga0496126_0170248 Ga0496126_0170248_601_1473 290
1501 3300048929 Ga0496126_0199193 Ga0496126_0199193_430_1323 290
1502 3300048929 Ga0496126_0261443 Ga0496126_0261443_329_1201 290
1503 3300049568 Ga0501031_0058914 Ga0501031_0058914_1017_1889 290
1504 3300049569 Ga0501032_0045770 Ga0501032_0045770_618_1490 290
1505 3300049571 Ga0501034_0073885 Ga0501034_0073885_573_1445 290
1506 3300049571 Ga0501034_0160997 Ga0501034_0160997_700_1575 290
1507 3300049573 Ga0501037_0030714 Ga0501037_0030714_2549_3421 290
1508 3300049574 Ga0501038_0042666 Ga0501038_0042666_475_1362 290
1509 3300049575 Ga0501039_0062348 Ga0501039_0062348_1516_2388 290
1510 3300049575 Ga0501039_0093612 Ga0501039_0093612_459_1340 290
1511 3300049575 Ga0501039_0197587 Ga0501039_0197587_466_1347 290
1512 3300049576 Ga0501040_0048931 Ga0501040_0048931_1658_2539 290
1513 3300049577 Ga0501041_0094886 Ga0501041_0094886_834_1715 290
1514 3300049577 Ga0501041_0177680 Ga0501041_0177680_71_943 290
1515 3300049579 Ga0501043_0303925 Ga0501043_0303925_299_1171 290
1516 3300049580 Ga0501046_0151704 Ga0501046_0151704_137_1018 290
1517 3300049580 Ga0501046_0243478 Ga0501046_0243478_185_1066 290
1518 3300049581 Ga0501047_0049560 Ga0501047_0049560_1209_2081 290
1519 3300049581 Ga0501047_0094159 Ga0501047_0094159_720_1592 290
1520 3300049582 Ga0501048_0170030 Ga0501048_0170030_73_969 290
1521 3300049582 Ga0501048_0382698 Ga0501048_0382698_41_922 290
1522 3300049584 Ga0501068_0289311 Ga0501068_0289311_74_955 290
1523 3300049586 Ga0501070_0209068 Ga0501070_0209068_263_1135 290
1524 3300049586 Ga0501070_0347566 Ga0501070_0347566_16_891 290
1525 3300049587 Ga0501071_0115007 Ga0501071_0115007_462_1343 290
1526 3300049589 Ga0501073_0002140 Ga0501073_0002140_10242_11117 290
1527 3300049589 Ga0501073_0044295 Ga0501073_0044295_1723_2598 290
1528 3300049591 Ga0501075_0317016 Ga0501075_0317016_126_1019 290
1529 3300049592 Ga0501076_0117795 Ga0501076_0117795_837_1718 290
1530 3300049593 Ga0501077_0018891 Ga0501077_0018891_2465_3346 290
1531 3300049593 Ga0501077_0250104 Ga0501077_0250104_93_974 290
1532 3300049741 Ga0501079_0063022 Ga0501079_0063022_1373_2254 290
1533 3300049741 Ga0501079_0260645 Ga0501079_0260645_330_1211 290
1534 3300049741 Ga0501079_0287845 Ga0501079_0287845_336_1217 290
1535 3300049742 Ga0501080_0019709 Ga0501080_0019709_4718_5593 290
1536 3300049742 Ga0501080_0089568 Ga0501080_0089568_1606_2478 290
1537 3300049743 Ga0501081_0059785 Ga0501081_0059785_507_1388 290
1538 3300049743 Ga0501081_0243305 Ga0501081_0243305_126_1007 290
1539 3300049822 Ga0501035_0064798 Ga0501035_0064798_425_1297 290
1540 3300049823 Ga0501044_0017240 Ga0501044_0017240_613_1485 290
1541 3300049823 Ga0501044_0120153 Ga0501044_0120153_143_1015 290
1542 3300049823 Ga0501044_0137129 Ga0501044_0137129_890_1762 290
1543 3300049824 Ga0501045_0194191 Ga0501045_0194191_550_1431 290
1544 3300050490 nmdc:mga03n38_2850_c1 nmdc:mga03n38_2850_c1_4046_4918 290
1545 3300050491 nmdc:mga00v17_180052_c1 nmdc:mga00v17_180052_c1_457_1329 290
1546 3300050491 nmdc:mga00v17_57759_c1 nmdc:mga00v17_57759_c1_716_1636 290
1547 3300050492 nmdc:mga0yw44_331031_c1 nmdc:mga0yw44_331031_c1_86_958 290
1548 3300050492 nmdc:mga0yw44_36164_c1 nmdc:mga0yw44_36164_c1_1186_2058 290
1549 3300050494 nmdc:mga06z11_126042_c1 nmdc:mga06z11_126042_c1_418_1290 290
1550 3300050494 nmdc:mga06z11_142671_c1 nmdc:mga06z11_142671_c1_260_1141 290
1551 3300050507 nmdc:mga05p37_10904_c1 nmdc:mga05p37_10904_c1_1076_1954 290
1552 3300050507 nmdc:mga05p37_120825_c1 nmdc:mga05p37_120825_c1_127_1020 290
1553 3300050507 nmdc:mga05p37_1466_c1 nmdc:mga05p37_1466_c1_10736_11641 290
1554 3300050507 nmdc:mga05p37_149125_c1 nmdc:mga05p37_149125_c1_1100_2002 290
1555 3300050507 nmdc:mga05p37_315_c1 nmdc:mga05p37_315_c1_2114_2995 290
1556 3300050507 nmdc:mga05p37_358328_c1 nmdc:mga05p37_358328_c1_302_1174 290
1557 3300050507 nmdc:mga05p37_50222_c1 nmdc:mga05p37_50222_c1_4081_4962 290
1558 3300050507 nmdc:mga05p37_528072_c1 nmdc:mga05p37_528072_c1_107_1027 290
1559 3300050507 nmdc:mga05p37_53933_c1 nmdc:mga05p37_53933_c1_3854_4735 290
1560 3300050507 nmdc:mga05p37_597332_c1 nmdc:mga05p37_597332_c1_230_1111 290
1561 3300050507 nmdc:mga05p37_653183_c1 nmdc:mga05p37_653183_c1_191_1072 290
1562 3300050508 nmdc:mga09592_104620_c1 nmdc:mga09592_104620_c1_1191_2072 290
1563 3300050508 nmdc:mga09592_2164_c1 nmdc:mga09592_2164_c1_14092_14973 290
1564 3300050508 nmdc:mga09592_52175_c1 nmdc:mga09592_52175_c1_1161_2042 290
1565 3300050508 nmdc:mga09592_6140_c1 nmdc:mga09592_6140_c1_3162_4067 290
1566 3300050508 nmdc:mga09592_64155_c1 nmdc:mga09592_64155_c1_1056_1958 290
1567 3300050509 nmdc:mga0qj67_22278_c1 nmdc:mga0qj67_22278_c1_1411_2304 290
1568 3300050509 nmdc:mga0qj67_249536_c1 nmdc:mga0qj67_249536_c1_27_908 290
1569 3300050509 nmdc:mga0qj67_304301_c1 nmdc:mga0qj67_304301_c1_231_1112 290
1570 3300050509 nmdc:mga0qj67_375256_c1 nmdc:mga0qj67_375256_c1_253_1134 290
1571 3300050509 nmdc:mga0qj67_4124_c1 nmdc:mga0qj67_4124_c1_8838_9719 290
1572 3300050509 nmdc:mga0qj67_6972_c1 nmdc:mga0qj67_6972_c1_4351_5256 290
1573 3300050510 nmdc:mga06r32_1041_c1 nmdc:mga06r32_1041_c1_6070_6975 290
1574 3300050510 nmdc:mga06r32_18750_c1 nmdc:mga06r32_18750_c1_1222_2103 290
1575 3300050510 nmdc:mga06r32_25105_c1 nmdc:mga06r32_25105_c1_716_1597 290
1576 3300050510 nmdc:mga06r32_540_c1 nmdc:mga06r32_540_c1_31097_31978 290
1577 3300050510 nmdc:mga06r32_604155_c1 nmdc:mga06r32_604155_c1_35_916 290
1578 3300050510 nmdc:mga06r32_73686_c1 nmdc:mga06r32_73686_c1_1767_2645 290
1579 3300050510 nmdc:mga06r32_9539_c1 nmdc:mga06r32_9539_c1_4528_5421 290
1580 3300050511 nmdc:mga08y16_17281_c1 nmdc:mga08y16_17281_c1_4318_5193 290
1581 3300050511 nmdc:mga08y16_190428_c1 nmdc:mga08y16_190428_c1_45_926 290
1582 3300050511 nmdc:mga08y16_203935_c1 nmdc:mga08y16_203935_c1_1095_1982 290
1583 3300050511 nmdc:mga08y16_586_c1 nmdc:mga08y16_586_c1_2098_2979 290
1584 3300050511 nmdc:mga08y16_831_c1 nmdc:mga08y16_831_c1_18057_18962 290
1585 3300050512 nmdc:mga0n895_195358_c1 nmdc:mga0n895_195358_c1_731_1612 290
1586 3300050512 nmdc:mga0n895_216508_c1 nmdc:mga0n895_216508_c1_741_1622 290
1587 3300050512 nmdc:mga0n895_3117_c1 nmdc:mga0n895_3117_c1_3543_4424 290
1588 3300050512 nmdc:mga0n895_360659_c1 nmdc:mga0n895_360659_c1_363_1244 290
1589 3300050512 nmdc:mga0n895_393685_c1 nmdc:mga0n895_393685_c1_289_1161 290
1590 3300050512 nmdc:mga0n895_624172_c1 nmdc:mga0n895_624172_c1_181_1062 290
1591 3300050512 nmdc:mga0n895_739012_c1 nmdc:mga0n895_739012_c1_21_902 290
1592 3300050512 nmdc:mga0n895_74753_c1 nmdc:mga0n895_74753_c1_696_1577 290
1593 3300050513 nmdc:mga0rr50_10295_c1 nmdc:mga0rr50_10295_c1_617_1498 290
1594 3300050513 nmdc:mga0rr50_120962_c1 nmdc:mga0rr50_120962_c1_914_1786 290
1595 3300050513 nmdc:mga0rr50_5517_c1 nmdc:mga0rr50_5517_c1_6213_7094 290
1596 3300050513 nmdc:mga0rr50_6196_c1 nmdc:mga0rr50_6196_c1_3749_4630 290
1597 3300050514 nmdc:mga08x19_212668_c1 nmdc:mga08x19_212668_c1_137_1018 290
1598 3300050514 nmdc:mga08x19_27850_c1 nmdc:mga08x19_27850_c1_1344_2225 290
1599 3300050514 nmdc:mga08x19_8561_c1 nmdc:mga08x19_8561_c1_3775_4656 290
1600 3300050515 nmdc:mga0a205_1775_c1 nmdc:mga0a205_1775_c1_4074_4955 290
1601 3300050515 nmdc:mga0a205_264967_c1 nmdc:mga0a205_264967_c1_116_997 290
1602 3300053077 Ga0495601_0001373 Ga0495601_0001373_7007_7888 290
1603 3300053077 Ga0495601_0233380 Ga0495601_0233380_32_931 290
1604 3300053078 Ga0495612_0001291 Ga0495612_0001291_6044_6925 290
1605 3300053078 Ga0495612_0013278 Ga0495612_0013278_229_1128 290
1606 3300053078 Ga0495612_0015371 Ga0495612_0015371_568_1449 290
1607 3300053078 Ga0495612_0020778 Ga0495612_0020778_1565_2446 290
1608 3300053078 Ga0495612_0025441 Ga0495612_0025441_202_1098 290
1609 3300053084 Ga0495595_0001034 Ga0495595_0001034_6419_7291 290
1610 3300053084 Ga0495595_0001403 Ga0495595_0001403_7325_8206 290
1611 3300053084 Ga0495595_0002352 Ga0495595_0002352_501_1382 290
1612 3300053084 Ga0495595_0026025 Ga0495595_0026025_1661_2542 290
1613 3300053085 Ga0495619_0000840 Ga0495619_0000840_12326_13207 290
1614 3300053085 Ga0495619_0007058 Ga0495619_0007058_111_983 290
1615 3300053085 Ga0495619_0008366 Ga0495619_0008366_1598_2479 290
1616 3300053085 Ga0495619_0040820 Ga0495619_0040820_908_1780 290
1617 3300053085 Ga0495619_0058705 Ga0495619_0058705_1266_2147 290
1618 3300053085 Ga0495619_0081446 Ga0495619_0081446_1240_2121 290
1619 3300053085 Ga0495619_0279066 Ga0495619_0279066_115_987 290
1620 3300053087 Ga0500643_022810 Ga0500643_022810_478_1350 290
1621 3300053091 Ga0500647_0028989 Ga0500647_0028989_80_952 290
1622 3300053092 Ga0500583_0128417 Ga0500583_0128417_362_1234 290
1623 3300053093 Ga0500651_0000616 Ga0500651_0000616_6419_7291 290
1624 3300053094 Ga0500566_0000175 Ga0500566_0000175_64_936 290
1625 3300053094 Ga0500566_0003046 Ga0500566_0003046_6636_7508 290
1626 3300053095 Ga0500640_086105 Ga0500640_086105_39_911 290
1627 3300053111 Ga0500572_000114 Ga0500572_000114_26051_26923 290
1628 3300053119 Ga0500595_000068 Ga0500595_000068_195_1067 290
1629 3300053119 Ga0500595_008406 Ga0500595_008406_3307_4179 290
1630 3300053119 Ga0500595_009450 Ga0500595_009450_70_942 290
1631 3300053119 Ga0500595_032262 Ga0500595_032262_848_1720 290
1632 3300053119 Ga0500595_041065 Ga0500595_041065_421_1293 290
1633 3300053136 Ga0500559_0001756 Ga0500559_0001756_10944_11816 290
1634 3300053139 Ga0500568_0053071 Ga0500568_0053071_473_1345 290
1635 3300053148 Ga0500590_065153 Ga0500590_065153_357_1229 290
1636 3300053150 Ga0500603_000248 Ga0500603_000248_13145_14017 290
1637 3300053150 Ga0500603_001082 Ga0500603_001082_477_1349 290
1638 3300053153 Ga0500616_0068821 Ga0500616_0068821_55_945 290
1639 3300053162 Ga0500638_036593 Ga0500638_036593_367_1239 290
1640 3300053162 Ga0500638_103030 Ga0500638_103030_93_965 290
1641 3300053163 Ga0500639_000006 Ga0500639_000006_85462_86334 290
1642 3300053177 Ga0500636_0073559 Ga0500636_0073559_156_1028 290
1643 3300053178 Ga0500637_0000482 Ga0500637_0000482_6706_7578 290
1644 3300053178 Ga0500637_0018743 Ga0500637_0018743_618_1490 290
1645 3300053178 Ga0500637_0111201 Ga0500637_0111201_375_1247 290
1646 3300053178 Ga0500637_0174753 Ga0500637_0174753_57_950 290
1647 3300053730 Ga0500645_033811 Ga0500645_033811_219_1091 290
1648 3300053735 Ga0500596_022204 Ga0500596_022204_75_947 290
1649 3300054114 Ga0501084_0136951 Ga0501084_0136951_1025_1906 290
1650 3300054114 Ga0501084_0175242 Ga0501084_0175242_38_919 290
1651 3300055283 Ga0500661_002150 Ga0500661_002150_1552_2424 290
1652 3300060353 Ga0501082_0065338 Ga0501082_0065338_2128_3009 290
1653 3300060353 Ga0501082_0371628 Ga0501082_0371628_27_908 290
1654 3300061734 Ga0530510_0036129 Ga0530510_0036129_2168_3049 290
1655 3300061734 Ga0530510_0061492 Ga0530510_0061492_767_1648 290
1656 3300061734 Ga0530510_0063940 Ga0530510_0063940_520_1401 290
1657 iso_pu_bacteria 2852387548 2852393266 290
1658 iso_pu_bacteria 8046767195 8046772212 290
1659 iso_pu_bacteria 8057575449 8057579479 290

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07728

AAA_5

AAA domain (dynein-related subfamily)

58

208

0.91

PF00004

AAA

ATPase family associated with various cellular activities (AAA)

59

214

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
5c3c-assembly1.cif.gz_B structural characterization of a newly identified component of alpha-carboxysomes: the aaa+ domain protein cso-cbbq 0.799 16 289
5c3c-assembly1.cif.gz_B structural characterization of a newly identified component of alpha-carboxysomes: the aaa+ domain protein cso-cbbq 0.7839 16 289
5c3c-assembly1.cif.gz_A structural characterization of a newly identified component of alpha-carboxysomes: the aaa+ domain protein cso-cbbq 0.7796 16 289
5c3c-assembly1.cif.gz_A structural characterization of a newly identified component of alpha-carboxysomes: the aaa+ domain protein cso-cbbq 0.7563 16 289
6l1q-assembly1.cif.gz_C crystal structure of afcbbq2, a moxr aaa+-atpase and cbbqo-type rubisco activase from acidithiobacillus ferrooxidans 0.7437 24 285
ID Description Score Start End Superfamily
af_P71922_29_212_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8106 19 201 3.40.50.300
af_P71922_29_212_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8021 19 201 3.40.50.300
af_O53705_22_210_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.7906 22 201 3.40.50.300
af_Q2G2J8_10_182_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.7553 19 193 3.40.50.300
af_P33348_59_238_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.7525 16 190 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A848Z9W3-F1-model_v4 MoxR family ATPase 0.9793 195 289
AF-A0A3C1IFE3-F1-model_v4 ATPase 0.9723 207 289
AF-A0A848Z9W3-F1-model_v4 MoxR family ATPase 0.9693 195 289
AF-A0A4S0XHP4-F1-model_v4 deleted 0.9467 106 183
AF-A0A3C1IFE3-F1-model_v4 ATPase 0.9393 207 289

Feature Viewer

pLDDT pTM Quality
86.25 0.81 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map