F495211

General Info

Members Datasets Scaffolds Average Seq Length
1652 307 1651 163

Family's Representative Sequence

Representative Sequence 3300002155|JGI24033J26618_1011448|JGI24033J26618_10114482
Length 167
Sequence MAERIGVYPGTFDPITLGHIDIIRRGAHLVDRLVIGVTTNPSKEPMFTLPERLRMVRREVADLADGKTQVVEFNSLLMDFAESQGASMIIRGLRAVADFEYEFQMAGMNQQLNHDIETVFLMADVSLQPIASRLVKEIARYGGSIDKFVTPSVAADVKKQLKGEAGA

Samples

Sample ID Description Type Environment
1 2751185897 Sphingomonas panacis DCY99 Isolate Unclassified
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
4 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
5 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
6 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
7 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
8 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
9 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
10 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
11 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
12 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
13 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
14 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
15 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
16 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
17 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
18 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
19 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
20 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
21 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
22 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
23 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
24 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
25 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
26 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
27 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
28 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
29 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
30 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
31 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
32 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
33 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
34 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
35 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
36 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
37 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
38 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
39 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
40 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
41 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
42 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
43 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
44 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
45 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
46 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
47 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
48 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
49 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
50 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
51 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
52 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
53 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
54 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
55 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
56 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
57 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
58 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
59 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
60 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
61 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
62 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
63 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
64 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
65 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
66 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
67 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
68 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
69 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
70 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
71 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
72 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
73 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
74 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
75 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
76 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
77 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
78 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
79 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
80 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
81 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
82 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
83 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
84 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
85 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
86 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
87 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
88 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
89 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
90 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
91 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
92 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
93 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
94 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
95 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
96 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
97 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
98 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
99 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
100 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
101 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
102 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
103 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
104 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
105 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
106 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
107 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
108 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
109 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
110 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
111 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
112 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
113 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
114 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
115 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
116 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
117 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
118 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
119 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
120 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
121 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
122 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
182 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
186 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
187 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
188 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
189 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
190 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
191 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
192 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
193 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
194 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
195 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
196 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
197 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
198 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
199 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
200 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
201 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
202 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
203 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
204 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
205 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
206 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
207 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
208 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
209 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
210 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
211 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
212 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
213 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
214 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
215 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
216 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
217 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
218 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
219 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
220 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
221 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
222 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
223 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
224 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
225 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
226 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
227 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
228 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
229 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
230 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
231 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
232 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
233 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
234 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
235 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
236 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
237 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
238 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
239 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
240 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
241 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
242 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
243 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
244 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
245 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
246 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
247 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
248 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
249 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
250 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
251 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
252 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
253 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
254 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
255 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
256 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
257 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
258 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
259 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
260 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
261 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
262 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
263 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
264 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
265 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
266 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
267 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
268 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
269 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
270 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
271 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
272 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
273 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
274 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
275 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
276 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
277 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
278 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
279 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
280 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
281 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
282 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
283 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
284 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
285 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
286 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
287 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
288 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
289 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
290 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
291 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
292 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
293 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
294 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
295 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
296 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
297 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
298 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
299 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
300 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
301 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
302 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
303 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
304 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
305 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
306 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
307 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.94
Metatranscriptomes 0
Isolates 0.06

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.3
Nodule 0
Rhizoplane 4.24
Rhizosphere 94.73
Stem 0
Stem Tuber 0
Unclassified 0.73

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1010212 3300001904 Bacteria 1535
2 JGI24741J21665_1013179 3300001915 Bacteria 1407
3 JGI24752J21851_1022930 3300001976 Bacteria 816
4 JGI24747J21853_1003964 3300001978 Bacteria 1304
5 JGI24740J21852_10001610 3300001979 Bacteria 10376
6 JGI24740J21852_10009585 3300001979 Bacteria 3781
7 JGI24740J21852_10037431 3300001979 Bacteria 1498
8 JGI24739J22299_10027151 3300001989 Bacteria 2004
9 JGI24739J22299_10081330 3300001989 Bacteria 995
10 JGI24737J22298_10010753 3300001990 Bacteria 3009
11 JGI24737J22298_10011933 3300001990 Bacteria 2838
12 JGI24737J22298_10017178 3300001990 Bacteria 2333
13 JGI24737J22298_10023111 3300001990 Bacteria 1973
14 JGI24737J22298_10091450 3300001990 Bacteria 903
15 JGI24737J22298_10133509 3300001990 Bacteria 733
16 JGI24743J22301_10003208 3300001991 Bacteria 2566
17 JGI24735J21928_10001242 3300002067 Bacteria 9053
18 JGI24735J21928_10022584 3300002067 Bacteria 1914
19 JGI24735J21928_10034548 3300002067 Bacteria 1490
20 JGI24735J21928_10036572 3300002067 Bacteria 1440
21 JGI24735J21928_10060810 3300002067 Bacteria 1085
22 JGI24745J21846_1005838 3300002073 Bacteria 1350
23 JGI24738J21930_10010970 3300002075 Bacteria 2003
24 JGI24738J21930_10065341 3300002075 Bacteria 749
25 JGI24033J26618_1011448 3300002155 Bacteria 1057
26 JGI24034J26672_10006369 3300002239 Bacteria 1702
27 Ga0065712_10427053 3300005290 Bacteria 706
28 Ga0065715_10022198 3300005293 Bacteria 1687
29 Ga0065715_10048310 3300005293 Bacteria 1255
30 Ga0065715_10212777 3300005293 Bacteria 1306
31 Ga0065715_10232064 3300005293 Bacteria 1230
32 Ga0065715_10547467 3300005293 Bacteria 743
33 Ga0065715_10662080 3300005293 Bacteria 672
34 Ga0065707_10587971 3300005295 Bacteria 697
35 Ga0070658_10000154 3300005327 Bacteria 60560
36 Ga0070658_10006912 3300005327 Bacteria 9162
37 Ga0070658_10007616 3300005327 Bacteria 8731
38 Ga0070658_10014349 3300005327 Bacteria 6356
39 Ga0070658_10018026 3300005327 Bacteria 5646
40 Ga0070658_10031224 3300005327 Bacteria 4277
41 Ga0070658_10065514 3300005327 Bacteria 2965
42 Ga0070658_10104324 3300005327 Bacteria 2345
43 Ga0070658_10116223 3300005327 Bacteria 2220
44 Ga0070658_10300052 3300005327 Bacteria 1370
45 Ga0070658_10332441 3300005327 Bacteria 1299
46 Ga0070658_10372454 3300005327 Bacteria 1224
47 Ga0070658_10401122 3300005327 Bacteria 1178
48 Ga0070658_10486022 3300005327 Bacteria 1066
49 Ga0070658_10565327 3300005327 Bacteria 984
50 Ga0070658_11413826 3300005327 Bacteria 604
51 Ga0070676_10013713 3300005328 Bacteria 4443
52 Ga0070676_10137099 3300005328 Bacteria 1554
53 Ga0070676_10253127 3300005328 Bacteria 1176
54 Ga0070676_10437416 3300005328 Bacteria 917
55 Ga0070676_11038355 3300005328 Bacteria 617
56 Ga0070683_100015278 3300005329 Bacteria 6741
57 Ga0070683_100070643 3300005329 Bacteria 3257
58 Ga0070683_100074304 3300005329 Bacteria 3175
59 Ga0070683_100279139 3300005329 Bacteria 1589
60 Ga0070690_100072043 3300005330 Bacteria 2246
61 Ga0070690_100347373 3300005330 Bacteria 1076
62 Ga0070670_100015694 3300005331 Bacteria 6501
63 Ga0070670_100025000 3300005331 Bacteria 5138
64 Ga0070670_100063614 3300005331 Bacteria 3167
65 Ga0070670_100132061 3300005331 Bacteria 2157
66 Ga0070670_100163672 3300005331 Bacteria 1928
67 Ga0070670_100212640 3300005331 Bacteria 1681
68 Ga0070670_100312968 3300005331 Bacteria 1375
69 Ga0070670_100357568 3300005331 Bacteria 1283
70 Ga0070677_10027263 3300005333 Bacteria 2149
71 Ga0070677_10035868 3300005333 Bacteria 1925
72 Ga0070677_10044301 3300005333 Bacteria 1770
73 Ga0068869_100185828 3300005334 Bacteria 1631
74 Ga0070666_10004574 3300005335 Bacteria 8436
75 Ga0070666_10010482 3300005335 Bacteria 5799
76 Ga0070666_10068344 3300005335 Bacteria 2414
77 Ga0070666_10104057 3300005335 Bacteria 1959
78 Ga0070666_10135122 3300005335 Bacteria 1716
79 Ga0070666_10343047 3300005335 Bacteria 1068
80 Ga0070666_10470227 3300005335 Bacteria 909
81 Ga0070666_10752873 3300005335 Bacteria 716
82 Ga0070680_100000628 3300005336 Bacteria 24555
83 Ga0070680_100000647 3300005336 Bacteria 24195
84 Ga0070680_100009749 3300005336 Bacteria 7392
85 Ga0070680_100036669 3300005336 Bacteria 3962
86 Ga0070680_100042036 3300005336 Bacteria 3707
87 Ga0070680_100199350 3300005336 Bacteria 1688
88 Ga0070680_100532012 3300005336 Bacteria 1007
89 Ga0070682_100037224 3300005337 Bacteria 2977
90 Ga0068868_100004431 3300005338 Bacteria 9849
91 Ga0068868_100032833 3300005338 Bacteria 3995
92 Ga0068868_101141153 3300005338 Bacteria 718
93 Ga0068868_101272016 3300005338 Bacteria 682
94 Ga0068868_101272017 3300005338 Bacteria 682
95 Ga0070660_100000284 3300005339 Bacteria 33712
96 Ga0070660_100003772 3300005339 Bacteria 10473
97 Ga0070660_100010071 3300005339 Bacteria 6668
98 Ga0070660_100013141 3300005339 Bacteria 5932
99 Ga0070660_100015745 3300005339 Bacteria 5469
100 Ga0070660_100035397 3300005339 Bacteria 3779
101 Ga0070660_100035753 3300005339 Bacteria 3760
102 Ga0070660_100040747 3300005339 Bacteria 3536
103 Ga0070660_100041543 3300005339 Bacteria 3506
104 Ga0070660_100179233 3300005339 Bacteria 1714
105 Ga0070660_100220678 3300005339 Bacteria 1541
106 Ga0070660_100260684 3300005339 Bacteria 1415
107 Ga0070660_100395978 3300005339 Bacteria 1141
108 Ga0070660_100399442 3300005339 Bacteria 1136
109 Ga0070660_100537131 3300005339 Bacteria 975
110 Ga0070660_100660189 3300005339 Bacteria 876
111 Ga0070660_100709214 3300005339 Bacteria 844
112 Ga0070687_100270074 3300005343 Bacteria 1065
113 Ga0070687_100684188 3300005343 Bacteria 715
114 Ga0070661_100000195 3300005344 Bacteria 50203
115 Ga0070661_100010511 3300005344 Bacteria 6436
116 Ga0070661_100020477 3300005344 Bacteria 4718
117 Ga0070661_100020750 3300005344 Bacteria 4686
118 Ga0070661_100024157 3300005344 Bacteria 4359
119 Ga0070661_100033985 3300005344 Bacteria 3697
120 Ga0070661_100095126 3300005344 Bacteria 2209
121 Ga0070661_100101419 3300005344 Bacteria 2141
122 Ga0070661_100338097 3300005344 Bacteria 1179
123 Ga0070661_100437589 3300005344 Bacteria 1039
124 Ga0070661_100904404 3300005344 Bacteria 729
125 Ga0070692_10028975 3300005345 Bacteria 2757
126 Ga0070692_10073944 3300005345 Bacteria 1822
127 Ga0070692_10212899 3300005345 Bacteria 1138
128 Ga0070668_100021509 3300005347 Bacteria 4873
129 Ga0070668_100150543 3300005347 Bacteria 1881
130 Ga0070668_100362847 3300005347 Bacteria 1229
131 Ga0070668_100659438 3300005347 Bacteria 920
132 Ga0070668_101033471 3300005347 Bacteria 739
133 Ga0070668_101573519 3300005347 Bacteria 602
134 Ga0070669_100046758 3300005353 Bacteria 3156
135 Ga0070669_100122427 3300005353 Bacteria 1986
136 Ga0070669_100443433 3300005353 Bacteria 1069
137 Ga0070669_100572518 3300005353 Bacteria 944
138 Ga0070669_100591849 3300005353 Bacteria 929
139 Ga0070669_100904251 3300005353 Bacteria 754
140 Ga0070669_101088612 3300005353 Bacteria 688
141 Ga0070675_100015199 3300005354 Bacteria 6079
142 Ga0070675_100045875 3300005354 Bacteria 3577
143 Ga0070675_100156310 3300005354 Bacteria 1958
144 Ga0070675_100183220 3300005354 Bacteria 1811
145 Ga0070675_100247955 3300005354 Bacteria 1558
146 Ga0070675_100551124 3300005354 Bacteria 1043
147 Ga0070675_100957301 3300005354 Bacteria 785
148 Ga0070671_100003815 3300005355 Bacteria 11831
149 Ga0070671_100004097 3300005355 Bacteria 11508
150 Ga0070671_100004402 3300005355 Bacteria 11135
151 Ga0070671_100028487 3300005355 Bacteria 4599
152 Ga0070671_100029406 3300005355 Bacteria 4530
153 Ga0070671_100033513 3300005355 Bacteria 4248
154 Ga0070671_100043806 3300005355 Bacteria 3719
155 Ga0070671_100077647 3300005355 Bacteria 2775
156 Ga0070671_100111200 3300005355 Bacteria 2301
157 Ga0070671_100181039 3300005355 Bacteria 1784
158 Ga0070671_100238165 3300005355 Bacteria 1545
159 Ga0070671_100340850 3300005355 Bacteria 1279
160 Ga0070671_100363668 3300005355 Bacteria 1235
161 Ga0070671_100440675 3300005355 Bacteria 1117
162 Ga0070671_100475417 3300005355 Bacteria 1073
163 Ga0070671_100641918 3300005355 Bacteria 919
164 Ga0070674_100008681 3300005356 Bacteria 6058
165 Ga0070674_100039115 3300005356 Bacteria 3202
166 Ga0070674_100049403 3300005356 Bacteria 2891
167 Ga0070674_100381421 3300005356 Bacteria 1147
168 Ga0070674_100536021 3300005356 Bacteria 980
169 Ga0070673_100018613 3300005364 Bacteria 4967
170 Ga0070673_100019179 3300005364 Bacteria 4907
171 Ga0070673_100024623 3300005364 Bacteria 4417
172 Ga0070673_100025930 3300005364 Bacteria 4322
173 Ga0070673_100070621 3300005364 Bacteria 2803
174 Ga0070673_100147342 3300005364 Bacteria 1991
175 Ga0070673_100321249 3300005364 Bacteria 1367
176 Ga0070673_101010394 3300005364 Bacteria 775
177 Ga0070659_100002125 3300005366 Bacteria 14119
178 Ga0070659_100003347 3300005366 Bacteria 11401
179 Ga0070659_100005974 3300005366 Bacteria 8778
180 Ga0070659_100008476 3300005366 Bacteria 7512
181 Ga0070659_100030702 3300005366 Bacteria 4159
182 Ga0070659_100035537 3300005366 Bacteria 3880
183 Ga0070659_100043883 3300005366 Bacteria 3498
184 Ga0070659_100052732 3300005366 Bacteria 3199
185 Ga0070659_100079588 3300005366 Bacteria 2616
186 Ga0070659_100108950 3300005366 Bacteria 2235
187 Ga0070659_100125137 3300005366 Bacteria 2085
188 Ga0070659_100148952 3300005366 Bacteria 1908
189 Ga0070659_100254489 3300005366 Bacteria 1456
190 Ga0070659_100340224 3300005366 Bacteria 1257
191 Ga0070659_100341901 3300005366 Bacteria 1254
192 Ga0070659_100411701 3300005366 Bacteria 1142
193 Ga0070659_100446074 3300005366 Bacteria 1097
194 Ga0070667_100003547 3300005367 Bacteria 13297
195 Ga0070667_100007016 3300005367 Bacteria 9364
196 Ga0070667_100011149 3300005367 Bacteria 7434
197 Ga0070667_100016604 3300005367 Bacteria 6092
198 Ga0070667_100022481 3300005367 Bacteria 5230
199 Ga0070667_100043386 3300005367 Bacteria 3774
200 Ga0070667_100149042 3300005367 Bacteria 2054
201 Ga0070667_100198696 3300005367 Bacteria 1779
202 Ga0070667_100237995 3300005367 Bacteria 1625
203 Ga0070667_100263655 3300005367 Bacteria 1543
204 Ga0070667_100824342 3300005367 Bacteria 862
205 Ga0070667_101234963 3300005367 Bacteria 700
206 Ga0070709_10037136 3300005434 Bacteria 2973
207 Ga0070714_100031841 3300005435 Bacteria 4402
208 Ga0070714_100046761 3300005435 Bacteria 3673
209 Ga0070714_100054824 3300005435 Bacteria 3407
210 Ga0070714_100106101 3300005435 Bacteria 2482
211 Ga0070714_100135274 3300005435 Bacteria 2207
212 Ga0070714_100335657 3300005435 Bacteria 1416
213 Ga0070714_100814473 3300005435 Bacteria 905
214 Ga0070714_101385422 3300005435 Bacteria 687
215 Ga0070713_100014363 3300005436 Bacteria 5878
216 Ga0070713_100355619 3300005436 Bacteria 1360
217 Ga0070713_100726083 3300005436 Bacteria 949
218 Ga0070701_10245048 3300005438 Bacteria 1080
219 Ga0070705_100196603 3300005440 Bacteria 1379
220 Ga0070705_101188271 3300005440 Bacteria 628
221 Ga0070700_101264982 3300005441 Bacteria 619
222 Ga0070694_101041799 3300005444 Bacteria 680
223 Ga0070694_101231807 3300005444 Bacteria 628
224 Ga0070708_101014853 3300005445 Bacteria 778
225 Ga0070663_100000199 3300005455 Bacteria 29919
226 Ga0070663_100018151 3300005455 Bacteria 4606
227 Ga0070663_100047107 3300005455 Bacteria 3053
228 Ga0070663_100051792 3300005455 Bacteria 2926
229 Ga0070663_100071562 3300005455 Bacteria 2524
230 Ga0070663_100082163 3300005455 Bacteria 2370
231 Ga0070663_100085711 3300005455 Bacteria 2325
232 Ga0070663_100099714 3300005455 Bacteria 2166
233 Ga0070663_100107220 3300005455 Bacteria 2094
234 Ga0070663_100171858 3300005455 Bacteria 1676
235 Ga0070663_100286005 3300005455 Bacteria 1315
236 Ga0070663_100354069 3300005455 Bacteria 1189
237 Ga0070678_100001565 3300005456 Bacteria 12250
238 Ga0070678_100008600 3300005456 Bacteria 6119
239 Ga0070678_100019238 3300005456 Bacteria 4447
240 Ga0070678_100027353 3300005456 Bacteria 3871
241 Ga0070678_100044842 3300005456 Bacteria 3160
242 Ga0070678_100053056 3300005456 Bacteria 2947
243 Ga0070678_100083643 3300005456 Bacteria 2426
244 Ga0070678_100608282 3300005456 Bacteria 976
245 Ga0070662_100000049 3300005457 Bacteria 64630
246 Ga0070662_100005871 3300005457 Bacteria 7879
247 Ga0070662_100027358 3300005457 Bacteria 3957
248 Ga0070662_100044799 3300005457 Bacteria 3171
249 Ga0070662_100046556 3300005457 Bacteria 3116
250 Ga0070662_100047746 3300005457 Bacteria 3081
251 Ga0070662_100048090 3300005457 Bacteria 3072
252 Ga0070662_100090223 3300005457 Bacteria 2300
253 Ga0070662_100090904 3300005457 Bacteria 2292
254 Ga0070662_100103914 3300005457 Bacteria 2155
255 Ga0070662_100132815 3300005457 Bacteria 1921
256 Ga0070662_100370091 3300005457 Bacteria 1177
257 Ga0070662_100658143 3300005457 Bacteria 884
258 Ga0070662_100875406 3300005457 Bacteria 766
259 Ga0070681_10025826 3300005458 Bacteria 5906
260 Ga0070681_10426345 3300005458 Bacteria 1238
261 Ga0070681_10800030 3300005458 Bacteria 860
262 Ga0070681_11349937 3300005458 Bacteria 636
263 Ga0068867_100029493 3300005459 Bacteria 3953
264 Ga0068867_100058181 3300005459 Bacteria 2864
265 Ga0068867_100068890 3300005459 Bacteria 2641
266 Ga0068867_100403000 3300005459 Bacteria 1154
267 Ga0068867_101208085 3300005459 Bacteria 695
268 Ga0070679_100005648 3300005530 Bacteria 11594
269 Ga0070679_100094978 3300005530 Bacteria 2969
270 Ga0070679_100102138 3300005530 Bacteria 2853
271 Ga0070679_100380371 3300005530 Bacteria 1358
272 Ga0070684_100036973 3300005535 Bacteria 4186
273 Ga0070684_100636332 3300005535 Bacteria 993
274 Ga0070684_100668957 3300005535 Bacteria 967
275 Ga0068853_100000098 3300005539 Bacteria 59230
276 Ga0068853_100025705 3300005539 Bacteria 4942
277 Ga0068853_100048436 3300005539 Bacteria 3650
278 Ga0068853_100066503 3300005539 Bacteria 3130
279 Ga0068853_100096279 3300005539 Bacteria 2611
280 Ga0068853_100143516 3300005539 Bacteria 2144
281 Ga0068853_100183563 3300005539 Bacteria 1898
282 Ga0068853_100217176 3300005539 Bacteria 1745
283 Ga0068853_100221042 3300005539 Bacteria 1730
284 Ga0068853_100301621 3300005539 Bacteria 1481
285 Ga0068853_100304055 3300005539 Bacteria 1475
286 Ga0068853_100545494 3300005539 Bacteria 1098
287 Ga0068853_101027378 3300005539 Bacteria 794
288 Ga0070672_100006310 3300005543 Bacteria 7951
289 Ga0070672_100011514 3300005543 Bacteria 6170
290 Ga0070672_100067546 3300005543 Bacteria 2833
291 Ga0070672_100154815 3300005543 Bacteria 1898
292 Ga0070672_100167953 3300005543 Bacteria 1823
293 Ga0070672_100176369 3300005543 Bacteria 1779
294 Ga0070672_100328221 3300005543 Bacteria 1301
295 Ga0070672_100435920 3300005543 Bacteria 1127
296 Ga0070686_100504144 3300005544 Bacteria 939
297 Ga0070686_101445201 3300005544 Bacteria 578
298 Ga0070695_100011571 3300005545 Bacteria 5279
299 Ga0070695_100109345 3300005545 Bacteria 1873
300 Ga0070696_100003877 3300005546 Bacteria 9991
301 Ga0070696_100006531 3300005546 Bacteria 7787
302 Ga0070696_100251807 3300005546 Bacteria 1336
303 Ga0070693_100001644 3300005547 Bacteria 10121
304 Ga0070693_100096568 3300005547 Bacteria 1792
305 Ga0070693_100332780 3300005547 Bacteria 1034
306 Ga0070693_100335088 3300005547 Bacteria 1031
307 Ga0070693_100365932 3300005547 Bacteria 991
308 Ga0070665_100006682 3300005548 Bacteria 11728
309 Ga0070665_100009494 3300005548 Bacteria 9838
310 Ga0070665_100068148 3300005548 Bacteria 3568
311 Ga0070665_100069005 3300005548 Bacteria 3543
312 Ga0070665_100313008 3300005548 Bacteria 1574
313 Ga0070665_100690446 3300005548 Bacteria 1034
314 Ga0070665_101159651 3300005548 Bacteria 784
315 Ga0070704_100763071 3300005549 Bacteria 862
316 Ga0068855_100000546 3300005563 Bacteria 46150
317 Ga0068855_100018927 3300005563 Bacteria 8277
318 Ga0068855_100044979 3300005563 Bacteria 5223
319 Ga0068855_100126744 3300005563 Bacteria 2918
320 Ga0068855_100155487 3300005563 Bacteria 2598
321 Ga0068855_100169119 3300005563 Bacteria 2476
322 Ga0068855_100216320 3300005563 Bacteria 2151
323 Ga0068855_100228774 3300005563 Bacteria 2083
324 Ga0068855_100307820 3300005563 Bacteria 1753
325 Ga0068855_100307823 3300005563 Bacteria 1753
326 Ga0068855_100350828 3300005563 Bacteria 1625
327 Ga0068855_100660662 3300005563 Bacteria 1122
328 Ga0068855_100680617 3300005563 Bacteria 1102
329 Ga0068855_101480917 3300005563 Bacteria 697
330 Ga0070664_100000162 3300005564 Bacteria 46036
331 Ga0070664_100002252 3300005564 Bacteria 15524
332 Ga0070664_100003267 3300005564 Bacteria 13100
333 Ga0070664_100017302 3300005564 Bacteria 5919
334 Ga0070664_100025951 3300005564 Bacteria 4857
335 Ga0070664_100033729 3300005564 Bacteria 4290
336 Ga0070664_100042227 3300005564 Bacteria 3849
337 Ga0070664_100042269 3300005564 Bacteria 3848
338 Ga0070664_100062965 3300005564 Bacteria 3162
339 Ga0070664_100118431 3300005564 Bacteria 2316
340 Ga0070664_100358890 3300005564 Bacteria 1327
341 Ga0070664_100467171 3300005564 Bacteria 1160
342 Ga0070664_100518833 3300005564 Bacteria 1100
343 Ga0070664_100711728 3300005564 Bacteria 936
344 Ga0070664_100715172 3300005564 Bacteria 934
345 Ga0068857_100015202 3300005577 Bacteria 6716
346 Ga0068857_100022989 3300005577 Bacteria 5483
347 Ga0068857_100088253 3300005577 Bacteria 2774
348 Ga0068857_100972997 3300005577 Bacteria 816
349 Ga0068854_100029180 3300005578 Bacteria 3817
350 Ga0068854_100047436 3300005578 Bacteria 3061
351 Ga0068854_100048961 3300005578 Bacteria 3017
352 Ga0068854_100053370 3300005578 Bacteria 2903
353 Ga0068854_100058642 3300005578 Bacteria 2779
354 Ga0068854_100061906 3300005578 Bacteria 2711
355 Ga0068854_100169973 3300005578 Bacteria 1696
356 Ga0068854_100202155 3300005578 Bacteria 1562
357 Ga0068854_100278998 3300005578 Bacteria 1345
358 Ga0068854_100288064 3300005578 Bacteria 1324
359 Ga0068854_100492527 3300005578 Bacteria 1031
360 Ga0068854_101446863 3300005578 Bacteria 622
361 Ga0068856_100000788 3300005614 Bacteria 34349
362 Ga0068856_100019423 3300005614 Bacteria 6595
363 Ga0068856_100030615 3300005614 Bacteria 5261
364 Ga0068856_100038942 3300005614 Bacteria 4668
365 Ga0068856_100161329 3300005614 Bacteria 2252
366 Ga0068856_100178869 3300005614 Bacteria 2134
367 Ga0068856_100261896 3300005614 Bacteria 1744
368 Ga0068856_100395348 3300005614 Bacteria 1402
369 Ga0068856_100438398 3300005614 Bacteria 1327
370 Ga0068856_100529571 3300005614 Bacteria 1199
371 Ga0068856_100831213 3300005614 Bacteria 943
372 Ga0068856_101881776 3300005614 Bacteria 609
373 Ga0068852_100000425 3300005616 Bacteria 28106
374 Ga0068852_100012952 3300005616 Bacteria 6361
375 Ga0068852_100016545 3300005616 Bacteria 5757
376 Ga0068852_100018142 3300005616 Bacteria 5539
377 Ga0068852_100021306 3300005616 Bacteria 5172
378 Ga0068852_100021530 3300005616 Bacteria 5150
379 Ga0068852_100043318 3300005616 Bacteria 3817
380 Ga0068852_100076587 3300005616 Bacteria 2954
381 Ga0068852_100123443 3300005616 Bacteria 2374
382 Ga0068852_100128993 3300005616 Bacteria 2326
383 Ga0068852_100145153 3300005616 Bacteria 2200
384 Ga0068852_100146505 3300005616 Bacteria 2191
385 Ga0068852_100177587 3300005616 Bacteria 2000
386 Ga0068852_100190841 3300005616 Bacteria 1933
387 Ga0068852_100397655 3300005616 Bacteria 1355
388 Ga0068852_100433160 3300005616 Bacteria 1299
389 Ga0068852_101173406 3300005616 Bacteria 789
390 Ga0068852_101767622 3300005616 Bacteria 641
391 Ga0068859_100019422 3300005617 Bacteria 6825
392 Ga0068859_100021440 3300005617 Bacteria 6485
393 Ga0068859_100083461 3300005617 Bacteria 3238
394 Ga0068859_100239021 3300005617 Bacteria 1905
395 Ga0068859_100355861 3300005617 Bacteria 1559
396 Ga0068859_100412879 3300005617 Bacteria 1446
397 Ga0068864_100003538 3300005618 Bacteria 12921
398 Ga0068864_100007271 3300005618 Bacteria 9106
399 Ga0068864_100028517 3300005618 Bacteria 4720
400 Ga0068864_100028619 3300005618 Bacteria 4712
401 Ga0068864_100035617 3300005618 Bacteria 4238
402 Ga0068864_100370074 3300005618 Bacteria 1356
403 Ga0068866_10001322 3300005718 Bacteria 10746
404 Ga0068866_10046918 3300005718 Bacteria 2175
405 Ga0068866_10557503 3300005718 Bacteria 767
406 Ga0068851_10005074 3300005834 Bacteria 5973
407 Ga0068851_10024522 3300005834 Bacteria 2954
408 Ga0068851_10032665 3300005834 Bacteria 2589
409 Ga0068851_10092612 3300005834 Bacteria 1593
410 Ga0068851_10180490 3300005834 Bacteria 1169
411 Ga0068851_10199181 3300005834 Bacteria 1117
412 Ga0068870_10152858 3300005840 Bacteria 1361
413 Ga0068870_10272636 3300005840 Bacteria 1058
414 Ga0068863_100002169 3300005841 Bacteria 19450
415 Ga0068863_100004752 3300005841 Bacteria 13382
416 Ga0068863_100033633 3300005841 Bacteria 4884
417 Ga0068863_100080700 3300005841 Bacteria 3082
418 Ga0068863_100084627 3300005841 Bacteria 3005
419 Ga0068863_100097222 3300005841 Bacteria 2796
420 Ga0068858_100002274 3300005842 Bacteria 19431
421 Ga0068858_100007735 3300005842 Bacteria 10371
422 Ga0068858_100024957 3300005842 Bacteria 5563
423 Ga0068858_100026952 3300005842 Bacteria 5338
424 Ga0068858_100041422 3300005842 Bacteria 4270
425 Ga0068858_100046718 3300005842 Bacteria 4013
426 Ga0068858_100093331 3300005842 Bacteria 2802
427 Ga0068858_100350358 3300005842 Bacteria 1414
428 Ga0068860_100012870 3300005843 Bacteria 8223
429 Ga0068860_100072773 3300005843 Bacteria 3267
430 Ga0068860_100083406 3300005843 Bacteria 3040
431 Ga0068860_100131338 3300005843 Bacteria 2403
432 Ga0068860_100265893 3300005843 Bacteria 1673
433 Ga0068860_100522093 3300005843 Bacteria 1187
434 Ga0068860_100694401 3300005843 Bacteria 1027
435 Ga0068862_100003518 3300005844 Bacteria 13444
436 Ga0068862_100068984 3300005844 Bacteria 3051
437 Ga0068862_100176040 3300005844 Bacteria 1918
438 Ga0068862_100235407 3300005844 Bacteria 1663
439 Ga0068862_100302601 3300005844 Bacteria 1472
440 Ga0068862_100738834 3300005844 Bacteria 956
441 Ga0068862_100760447 3300005844 Bacteria 943
442 Ga0068862_101553891 3300005844 Bacteria 668
443 Ga0081539_10044314 3300005985 Bacteria 2569
444 Ga0081539_10089260 3300005985 Bacteria 1597
445 Ga0070717_10014056 3300006028 Bacteria 6153
446 Ga0070717_10070938 3300006028 Bacteria 2904
447 Ga0075365_10088267 3300006038 Bacteria 2109
448 Ga0070715_10156354 3300006163 Bacteria 1122
449 Ga0070716_100415192 3300006173 Bacteria 972
450 Ga0097621_100002557 3300006237 Bacteria 12458
451 Ga0097621_100029704 3300006237 Bacteria 4320
452 Ga0097621_100030915 3300006237 Bacteria 4243
453 Ga0097621_100088002 3300006237 Bacteria 2595
454 Ga0097621_100109448 3300006237 Bacteria 2334
455 Ga0097621_100119814 3300006237 Bacteria 2231
456 Ga0097621_100145826 3300006237 Bacteria 2027
457 Ga0097621_100247723 3300006237 Bacteria 1559
458 Ga0097621_100442163 3300006237 Bacteria 1170
459 Ga0068871_100016378 3300006358 Bacteria 5581
460 Ga0068871_100089442 3300006358 Bacteria 2563
461 Ga0068871_100100772 3300006358 Bacteria 2420
462 Ga0068871_100111124 3300006358 Bacteria 2305
463 Ga0068871_100142090 3300006358 Bacteria 2042
464 Ga0068871_100162840 3300006358 Bacteria 1908
465 Ga0068871_100248210 3300006358 Bacteria 1549
466 Ga0075428_100259271 3300006844 Bacteria 1872
467 Ga0075428_100498708 3300006844 Bacteria 1303
468 Ga0075431_100145230 3300006847 Bacteria 2445
469 Ga0075431_100324613 3300006847 Bacteria 1552
470 Ga0075429_101031256 3300006880 Bacteria 719
471 Ga0068865_100024575 3300006881 Bacteria 3954
472 Ga0068865_100035074 3300006881 Bacteria 3371
473 Ga0068865_100094006 3300006881 Bacteria 2181
474 Ga0068865_100406903 3300006881 Bacteria 1115
475 Ga0097620_100019422 3300006931 Bacteria 6825
476 Ga0097620_100021440 3300006931 Bacteria 6485
477 Ga0097620_100083456 3300006931 Bacteria 3238
478 Ga0097620_100239022 3300006931 Bacteria 1905
479 Ga0097620_100355860 3300006931 Bacteria 1559
480 Ga0097620_100412932 3300006931 Bacteria 1446
481 Ga0105251_10040608 3300009011 Bacteria 2268
482 Ga0105240_10086368 3300009093 Bacteria 3842
483 Ga0105240_10094723 3300009093 Bacteria 3641
484 Ga0105240_10172916 3300009093 Bacteria 2556
485 Ga0105240_10432570 3300009093 Bacteria 1476
486 Ga0105240_10556687 3300009093 Bacteria 1268
487 Ga0105240_11624515 3300009093 Bacteria 676
488 Ga0111539_10073522 3300009094 Bacteria 4030
489 Ga0105245_10006243 3300009098 Bacteria 10483
490 Ga0105245_10091382 3300009098 Bacteria 2801
491 Ga0105245_10305837 3300009098 Bacteria 1562
492 Ga0105245_10570128 3300009098 Bacteria 1156
493 Ga0105245_11454078 3300009098 Bacteria 736
494 Ga0105245_11708766 3300009098 Bacteria 682
495 Ga0114129_10667060 3300009147 Bacteria 1340
496 Ga0114129_11749524 3300009147 Bacteria 757
497 Ga0105243_10114402 3300009148 Bacteria 2264
498 Ga0105243_10115079 3300009148 Bacteria 2258
499 Ga0105243_12594643 3300009148 Bacteria 546
500 Ga0105241_10239846 3300009174 Bacteria 1532
501 Ga0105241_10335543 3300009174 Bacteria 1308
502 Ga0105241_10753390 3300009174 Bacteria 893
503 Ga0105241_11002566 3300009174 Bacteria 781
504 Ga0105242_10003633 3300009176 Bacteria 12007
505 Ga0105242_12336145 3300009176 Bacteria 581
506 Ga0105248_10000544 3300009177 Bacteria 43036
507 Ga0105248_10002910 3300009177 Bacteria 18999
508 Ga0105248_10009537 3300009177 Bacteria 10682
509 Ga0105248_10023560 3300009177 Bacteria 6839
510 Ga0105248_10033496 3300009177 Bacteria 5739
511 Ga0105248_10033950 3300009177 Bacteria 5702
512 Ga0105248_10046730 3300009177 Bacteria 4853
513 Ga0105248_10069459 3300009177 Bacteria 3955
514 Ga0105248_10100816 3300009177 Bacteria 3254
515 Ga0105248_10461391 3300009177 Bacteria 1432
516 Ga0105248_10603561 3300009177 Bacteria 1238
517 Ga0105248_10622774 3300009177 Bacteria 1217
518 Ga0105248_10995290 3300009177 Bacteria 947
519 Ga0105248_11757256 3300009177 Bacteria 703
520 Ga0105237_10027692 3300009545 Bacteria 5779
521 Ga0105237_10030869 3300009545 Bacteria 5438
522 Ga0105237_10196201 3300009545 Bacteria 2019
523 Ga0105237_10319939 3300009545 Bacteria 1555
524 Ga0105238_10020220 3300009551 Bacteria 6776
525 Ga0105238_10056843 3300009551 Bacteria 3924
526 Ga0105238_10501516 3300009551 Bacteria 1215
527 Ga0105238_10729826 3300009551 Bacteria 1004
528 Ga0105238_10766027 3300009551 Bacteria 980
529 Ga0105238_10793546 3300009551 Bacteria 962
530 Ga0105238_11017123 3300009551 Bacteria 850
531 Ga0105249_10035644 3300009553 Bacteria 4512
532 Ga0105249_10075864 3300009553 Bacteria 3114
533 Ga0105249_10851861 3300009553 Bacteria 977
534 Ga0105249_11089465 3300009553 Bacteria 869
535 Ga0105239_10028632 3300010375 Bacteria 6125
536 Ga0105239_10138312 3300010375 Bacteria 2712
537 Ga0105239_10219152 3300010375 Bacteria 2134
538 Ga0105239_10897698 3300010375 Bacteria 1017
539 Ga0105239_11753282 3300010375 Bacteria 719
540 Ga0105239_11899317 3300010375 Bacteria 690
541 Ga0105239_12827792 3300010375 Bacteria 566
542 Ga0105246_10033959 3300011119 Bacteria 3394
543 Ga0105246_10089243 3300011119 Bacteria 2218
544 Ga0157373_10013050 3300013100 Bacteria 6097
545 Ga0157373_10049210 3300013100 Bacteria 3004
546 Ga0157373_10061013 3300013100 Bacteria 2671
547 Ga0157373_10065807 3300013100 Bacteria 2565
548 Ga0157373_10075161 3300013100 Bacteria 2384
549 Ga0157373_10079062 3300013100 Bacteria 2319
550 Ga0157373_10228211 3300013100 Bacteria 1315
551 Ga0157373_10243430 3300013100 Bacteria 1271
552 Ga0157373_10258306 3300013100 Bacteria 1233
553 Ga0157373_10354053 3300013100 Bacteria 1047
554 Ga0157373_10677519 3300013100 Bacteria 754
555 Ga0157373_10717286 3300013100 Bacteria 733
556 Ga0157373_10899568 3300013100 Bacteria 657
557 Ga0157371_10013748 3300013102 Bacteria 6136
558 Ga0157371_10014334 3300013102 Bacteria 5986
559 Ga0157371_10018858 3300013102 Bacteria 5097
560 Ga0157371_10064799 3300013102 Bacteria 2589
561 Ga0157371_10084297 3300013102 Bacteria 2251
562 Ga0157371_10093453 3300013102 Bacteria 2131
563 Ga0157371_10094166 3300013102 Bacteria 2122
564 Ga0157371_10100617 3300013102 Bacteria 2050
565 Ga0157371_10206480 3300013102 Bacteria 1409
566 Ga0157371_10222273 3300013102 Bacteria 1356
567 Ga0157371_10261486 3300013102 Bacteria 1248
568 Ga0157371_10454352 3300013102 Bacteria 942
569 Ga0157371_10748655 3300013102 Bacteria 734
570 Ga0157371_11217601 3300013102 Bacteria 581
571 Ga0157370_10012302 3300013104 Bacteria 8881
572 Ga0157370_10062843 3300013104 Bacteria 3520
573 Ga0157370_10100439 3300013104 Bacteria 2711
574 Ga0157370_10111197 3300013104 Bacteria 2561
575 Ga0157370_10137027 3300013104 Bacteria 2281
576 Ga0157370_10232235 3300013104 Bacteria 1707
577 Ga0157370_10251069 3300013104 Bacteria 1636
578 Ga0157370_10576520 3300013104 Bacteria 1031
579 Ga0157370_10699000 3300013104 Bacteria 925
580 Ga0157370_10814105 3300013104 Bacteria 850
581 Ga0157370_11054031 3300013104 Bacteria 735
582 Ga0157370_11273494 3300013104 Bacteria 663
583 Ga0157370_11317042 3300013104 Bacteria 651
584 Ga0157369_10002495 3300013105 Bacteria 22057
585 Ga0157369_10009057 3300013105 Bacteria 11398
586 Ga0157369_10009299 3300013105 Bacteria 11244
587 Ga0157369_10028768 3300013105 Bacteria 6146
588 Ga0157369_10096842 3300013105 Bacteria 3147
589 Ga0157369_10153395 3300013105 Bacteria 2434
590 Ga0157369_10188289 3300013105 Bacteria 2169
591 Ga0157369_10189356 3300013105 Bacteria 2162
592 Ga0157369_10196688 3300013105 Bacteria 2117
593 Ga0157369_10367306 3300013105 Bacteria 1494
594 Ga0157369_10375428 3300013105 Bacteria 1476
595 Ga0157369_10809184 3300013105 Bacteria 963
596 Ga0157369_10905261 3300013105 Bacteria 905
597 Ga0157369_11718067 3300013105 Bacteria 638
598 Ga0157374_10030191 3300013296 Bacteria 4918
599 Ga0157374_10068994 3300013296 Bacteria 3328
600 Ga0157374_10096957 3300013296 Bacteria 2821
601 Ga0157374_10165261 3300013296 Bacteria 2156
602 Ga0157374_10645625 3300013296 Bacteria 1070
603 Ga0157378_10033143 3300013297 Bacteria 4566
604 Ga0157378_10226806 3300013297 Bacteria 1778
605 Ga0157378_10235837 3300013297 Bacteria 1745
606 Ga0157378_10653515 3300013297 Bacteria 1067
607 Ga0157378_11859521 3300013297 Bacteria 651
608 Ga0157378_12088320 3300013297 Bacteria 617
609 Ga0163162_10004990 3300013306 Bacteria 12790
610 Ga0163162_10010754 3300013306 Bacteria 8903
611 Ga0163162_10048885 3300013306 Bacteria 4238
612 Ga0163162_10073515 3300013306 Bacteria 3474
613 Ga0163162_10159127 3300013306 Bacteria 2380
614 Ga0163162_10181190 3300013306 Bacteria 2233
615 Ga0163162_10194538 3300013306 Bacteria 2156
616 Ga0163162_10208939 3300013306 Bacteria 2081
617 Ga0163162_10736278 3300013306 Bacteria 1106
618 Ga0157372_10226889 3300013307 Bacteria 2165
619 Ga0157372_10252876 3300013307 Bacteria 2046
620 Ga0157372_10361242 3300013307 Bacteria 1692
621 Ga0157372_10450545 3300013307 Bacteria 1500
622 Ga0157372_10688403 3300013307 Bacteria 1190
623 Ga0157372_10753210 3300013307 Bacteria 1132
624 Ga0157372_10765312 3300013307 Bacteria 1123
625 Ga0157372_10944204 3300013307 Bacteria 1000
626 Ga0157372_11005140 3300013307 Bacteria 966
627 Ga0157372_11151569 3300013307 Bacteria 897
628 Ga0157372_11174503 3300013307 Bacteria 887
629 Ga0157372_12183860 3300013307 Bacteria 636
630 Ga0157375_10006174 3300013308 Bacteria 10442
631 Ga0157375_10021110 3300013308 Bacteria 5964
632 Ga0157375_10023031 3300013308 Bacteria 5741
633 Ga0157375_10035911 3300013308 Bacteria 4735
634 Ga0157375_10068189 3300013308 Bacteria 3558
635 Ga0157375_10117860 3300013308 Bacteria 2761
636 Ga0157375_10324566 3300013308 Bacteria 1704
637 Ga0157375_10635863 3300013308 Bacteria 1224
638 Ga0157375_11759056 3300013308 Bacteria 734
639 Ga0163163_10000258 3300014325 Bacteria 53627
640 Ga0163163_10029168 3300014325 Bacteria 5307
641 Ga0163163_10136615 3300014325 Bacteria 2493
642 Ga0163163_10311427 3300014325 Bacteria 1627
643 Ga0157380_10012365 3300014326 Bacteria 6192
644 Ga0157380_10097547 3300014326 Bacteria 2440
645 Ga0157377_10131925 3300014745 Bacteria 1527
646 Ga0157377_10132764 3300014745 Bacteria 1523
647 Ga0157377_10997172 3300014745 Bacteria 634
648 Ga0157379_10002519 3300014968 Bacteria 15338
649 Ga0157379_10105672 3300014968 Bacteria 2527
650 Ga0157379_10134614 3300014968 Bacteria 2226
651 Ga0157379_10331277 3300014968 Bacteria 1391
652 Ga0157379_10358983 3300014968 Bacteria 1335
653 Ga0157379_10409682 3300014968 Bacteria 1247
654 Ga0157379_10523848 3300014968 Bacteria 1100
655 Ga0157376_10001235 3300014969 Bacteria 16843
656 Ga0157376_10778487 3300014969 Bacteria 968
657 Ga0163161_10007048 3300017792 Bacteria 7777
658 Ga0163161_10133454 3300017792 Bacteria 1875
659 Ga0163161_10230343 3300017792 Bacteria 1438
660 Ga0213876_10105737 3300021384 Bacteria 1493
661 Ga0213875_10002933 3300021388 Bacteria 9939
662 Ga0207697_10013124 3300025315 Bacteria 3461
663 Ga0207697_10063587 3300025315 Bacteria 1538
664 Ga0207656_10006483 3300025321 Bacteria 4212
665 Ga0207656_10247420 3300025321 Bacteria 873
666 Ga0207656_10529098 3300025321 Bacteria 599
667 Ga0207682_10002812 3300025893 Bacteria 7692
668 Ga0207682_10011313 3300025893 Bacteria 3486
669 Ga0207642_10007833 3300025899 Bacteria 3628
670 Ga0207642_10073313 3300025899 Bacteria 1637
671 Ga0207642_10550317 3300025899 Bacteria 713
672 Ga0207688_10000937 3300025901 Bacteria 14744
673 Ga0207688_10058558 3300025901 Bacteria 2168
674 Ga0207688_10268006 3300025901 Bacteria 1038
675 Ga0207688_10276468 3300025901 Bacteria 1022
676 Ga0207680_10000219 3300025903 Bacteria 27636
677 Ga0207680_10000459 3300025903 Bacteria 19207
678 Ga0207680_10002571 3300025903 Bacteria 8464
679 Ga0207680_10022828 3300025903 Bacteria 3408
680 Ga0207680_10147857 3300025903 Bacteria 1564
681 Ga0207680_10236737 3300025903 Bacteria 1257
682 Ga0207680_10522366 3300025903 Bacteria 846
683 Ga0207647_10003591 3300025904 Bacteria 11626
684 Ga0207647_10005498 3300025904 Bacteria 9276
685 Ga0207647_10010619 3300025904 Bacteria 6494
686 Ga0207647_10025310 3300025904 Bacteria 3902
687 Ga0207647_10076844 3300025904 Bacteria 2008
688 Ga0207647_10079649 3300025904 Bacteria 1966
689 Ga0207647_10089713 3300025904 Bacteria 1834
690 Ga0207647_10103700 3300025904 Bacteria 1686
691 Ga0207647_10128886 3300025904 Bacteria 1488
692 Ga0207685_10127685 3300025905 Bacteria 1124
693 Ga0207699_10158228 3300025906 Bacteria 1505
694 Ga0207645_10015238 3300025907 Bacteria 5117
695 Ga0207645_10021237 3300025907 Bacteria 4236
696 Ga0207645_10026774 3300025907 Bacteria 3725
697 Ga0207645_10066454 3300025907 Bacteria 2305
698 Ga0207645_10151657 3300025907 Bacteria 1513
699 Ga0207645_10404237 3300025907 Bacteria 919
700 Ga0207643_10040308 3300025908 Bacteria 2629
701 Ga0207705_10000003 3300025909 Bacteria 709270
702 Ga0207705_10000285 3300025909 Bacteria 47658
703 Ga0207705_10000320 3300025909 Bacteria 43763
704 Ga0207705_10000330 3300025909 Bacteria 43029
705 Ga0207705_10031278 3300025909 Bacteria 3797
706 Ga0207705_10032005 3300025909 Bacteria 3757
707 Ga0207705_10037294 3300025909 Bacteria 3478
708 Ga0207705_10050084 3300025909 Bacteria 3006
709 Ga0207705_10051681 3300025909 Bacteria 2958
710 Ga0207705_10061499 3300025909 Bacteria 2712
711 Ga0207705_10069521 3300025909 Bacteria 2550
712 Ga0207705_10070872 3300025909 Bacteria 2526
713 Ga0207705_10101387 3300025909 Bacteria 2118
714 Ga0207705_10145573 3300025909 Bacteria 1772
715 Ga0207705_10150153 3300025909 Bacteria 1746
716 Ga0207705_10192725 3300025909 Bacteria 1542
717 Ga0207705_10223708 3300025909 Bacteria 1430
718 Ga0207705_10292453 3300025909 Bacteria 1248
719 Ga0207705_10307074 3300025909 Bacteria 1217
720 Ga0207705_10780373 3300025909 Bacteria 742
721 Ga0207705_11064090 3300025909 Bacteria 624
722 Ga0207654_10173937 3300025911 Bacteria 1400
723 Ga0207654_10640290 3300025911 Bacteria 761
724 Ga0207707_10016497 3300025912 Bacteria 6440
725 Ga0207707_10028296 3300025912 Bacteria 4899
726 Ga0207707_10344982 3300025912 Bacteria 1283
727 Ga0207707_10357712 3300025912 Bacteria 1257
728 Ga0207707_11049206 3300025912 Bacteria 667
729 Ga0207695_10020461 3300025913 Bacteria 7577
730 Ga0207695_10119701 3300025913 Bacteria 2603
731 Ga0207695_10160802 3300025913 Bacteria 2177
732 Ga0207695_10177477 3300025913 Bacteria 2052
733 Ga0207695_10264783 3300025913 Bacteria 1616
734 Ga0207695_11142674 3300025913 Bacteria 659
735 Ga0207671_10209505 3300025914 Bacteria 1524
736 Ga0207660_10001110 3300025917 Bacteria 17977
737 Ga0207660_10002477 3300025917 Bacteria 12136
738 Ga0207660_10004291 3300025917 Bacteria 9301
739 Ga0207660_10014391 3300025917 Bacteria 5202
740 Ga0207660_10084695 3300025917 Bacteria 2337
741 Ga0207660_10118536 3300025917 Bacteria 2002
742 Ga0207662_10071362 3300025918 Bacteria 2103
743 Ga0207657_10001027 3300025919 Bacteria 29613
744 Ga0207657_10001031 3300025919 Bacteria 29517
745 Ga0207657_10001906 3300025919 Bacteria 22540
746 Ga0207657_10004068 3300025919 Bacteria 15519
747 Ga0207657_10006395 3300025919 Bacteria 12232
748 Ga0207657_10014496 3300025919 Bacteria 7691
749 Ga0207657_10014520 3300025919 Bacteria 7681
750 Ga0207657_10016571 3300025919 Bacteria 7100
751 Ga0207657_10019015 3300025919 Bacteria 6536
752 Ga0207657_10020563 3300025919 Bacteria 6234
753 Ga0207657_10020823 3300025919 Bacteria 6188
754 Ga0207657_10021169 3300025919 Bacteria 6126
755 Ga0207657_10050513 3300025919 Bacteria 3619
756 Ga0207657_10189988 3300025919 Bacteria 1657
757 Ga0207657_10290773 3300025919 Bacteria 1296
758 Ga0207657_10351443 3300025919 Bacteria 1162
759 Ga0207657_10380020 3300025919 Bacteria 1112
760 Ga0207657_10432864 3300025919 Bacteria 1033
761 Ga0207657_10576590 3300025919 Bacteria 879
762 Ga0207657_10691127 3300025919 Bacteria 793
763 Ga0207657_10903412 3300025919 Bacteria 680
764 Ga0207657_11201455 3300025919 Bacteria 576
765 Ga0207649_10000128 3300025920 Bacteria 64425
766 Ga0207649_10000576 3300025920 Bacteria 25095
767 Ga0207649_10015845 3300025920 Bacteria 4238
768 Ga0207649_10024548 3300025920 Bacteria 3506
769 Ga0207649_10026939 3300025920 Bacteria 3368
770 Ga0207649_10055604 3300025920 Bacteria 2468
771 Ga0207649_10120558 3300025920 Bacteria 1767
772 Ga0207649_10186950 3300025920 Bacteria 1454
773 Ga0207649_10207585 3300025920 Bacteria 1388
774 Ga0207649_10209756 3300025920 Bacteria 1381
775 Ga0207652_10000356 3300025921 Bacteria 47404
776 Ga0207652_10034765 3300025921 Bacteria 4249
777 Ga0207652_10064378 3300025921 Bacteria 3172
778 Ga0207652_10338319 3300025921 Bacteria 1358
779 Ga0207652_10514558 3300025921 Bacteria 1077
780 Ga0207681_10048435 3300025923 Bacteria 2868
781 Ga0207681_10052430 3300025923 Bacteria 2766
782 Ga0207681_10075234 3300025923 Bacteria 2368
783 Ga0207681_10185943 3300025923 Bacteria 1586
784 Ga0207681_10366029 3300025923 Bacteria 1157
785 Ga0207681_10773225 3300025923 Bacteria 801
786 Ga0207694_10004227 3300025924 Bacteria 11240
787 Ga0207694_10014118 3300025924 Bacteria 6022
788 Ga0207694_10386021 3300025924 Bacteria 1163
789 Ga0207694_10966555 3300025924 Bacteria 720
790 Ga0207650_10015267 3300025925 Bacteria 5345
791 Ga0207650_10039476 3300025925 Bacteria 3450
792 Ga0207650_10042919 3300025925 Bacteria 3318
793 Ga0207650_10047969 3300025925 Bacteria 3149
794 Ga0207650_10266208 3300025925 Bacteria 1392
795 Ga0207650_10315906 3300025925 Bacteria 1279
796 Ga0207650_10412514 3300025925 Bacteria 1119
797 Ga0207650_10621650 3300025925 Bacteria 909
798 Ga0207650_10668345 3300025925 Bacteria 876
799 Ga0207650_10820023 3300025925 Bacteria 789
800 Ga0207650_10933517 3300025925 Bacteria 737
801 Ga0207659_10030476 3300025926 Bacteria 3687
802 Ga0207659_10033701 3300025926 Bacteria 3528
803 Ga0207659_10049852 3300025926 Bacteria 2971
804 Ga0207659_10055831 3300025926 Bacteria 2826
805 Ga0207659_10139416 3300025926 Bacteria 1881
806 Ga0207659_10240761 3300025926 Bacteria 1463
807 Ga0207659_10392688 3300025926 Bacteria 1159
808 Ga0207687_10079455 3300025927 Bacteria 2365
809 Ga0207687_10290203 3300025927 Bacteria 1314
810 Ga0207687_10517696 3300025927 Bacteria 997
811 Ga0207700_10037863 3300025928 Bacteria 3496
812 Ga0207700_11132845 3300025928 Bacteria 699
813 Ga0207664_10018517 3300025929 Bacteria 5129
814 Ga0207664_10025529 3300025929 Bacteria 4454
815 Ga0207664_10036988 3300025929 Bacteria 3775
816 Ga0207664_10044944 3300025929 Bacteria 3461
817 Ga0207664_10065731 3300025929 Bacteria 2904
818 Ga0207664_10246461 3300025929 Bacteria 1557
819 Ga0207644_10000214 3300025931 Bacteria 39975
820 Ga0207644_10002141 3300025931 Bacteria 12807
821 Ga0207644_10003084 3300025931 Bacteria 10726
822 Ga0207644_10006352 3300025931 Bacteria 7695
823 Ga0207644_10006738 3300025931 Bacteria 7485
824 Ga0207644_10008630 3300025931 Bacteria 6668
825 Ga0207644_10010201 3300025931 Bacteria 6189
826 Ga0207644_10031319 3300025931 Bacteria 3705
827 Ga0207644_10042700 3300025931 Bacteria 3214
828 Ga0207644_10090229 3300025931 Bacteria 2283
829 Ga0207644_10139374 3300025931 Bacteria 1866
830 Ga0207644_10172072 3300025931 Bacteria 1691
831 Ga0207644_10220402 3300025931 Bacteria 1503
832 Ga0207644_10390362 3300025931 Bacteria 1136
833 Ga0207690_10000045 3300025932 Bacteria 116965
834 Ga0207690_10002794 3300025932 Bacteria 10532
835 Ga0207690_10003771 3300025932 Bacteria 8973
836 Ga0207690_10008018 3300025932 Bacteria 6270
837 Ga0207690_10009666 3300025932 Bacteria 5726
838 Ga0207690_10011186 3300025932 Bacteria 5357
839 Ga0207690_10040538 3300025932 Bacteria 3045
840 Ga0207690_10074289 3300025932 Bacteria 2354
841 Ga0207690_10083036 3300025932 Bacteria 2242
842 Ga0207690_10187305 3300025932 Bacteria 1562
843 Ga0207690_10200563 3300025932 Bacteria 1515
844 Ga0207690_10227638 3300025932 Bacteria 1430
845 Ga0207690_10283994 3300025932 Bacteria 1290
846 Ga0207690_10336086 3300025932 Bacteria 1191
847 Ga0207690_10348971 3300025932 Bacteria 1170
848 Ga0207690_10355287 3300025932 Bacteria 1160
849 Ga0207690_10357537 3300025932 Bacteria 1156
850 Ga0207690_10443403 3300025932 Bacteria 1042
851 Ga0207690_10695481 3300025932 Bacteria 836
852 Ga0207690_10865924 3300025932 Bacteria 748
853 Ga0207706_10000660 3300025933 Bacteria 36291
854 Ga0207706_10005341 3300025933 Bacteria 11974
855 Ga0207706_10015930 3300025933 Bacteria 6793
856 Ga0207706_10044324 3300025933 Bacteria 3943
857 Ga0207706_10048436 3300025933 Bacteria 3758
858 Ga0207706_10059505 3300025933 Bacteria 3364
859 Ga0207706_10076588 3300025933 Bacteria 2942
860 Ga0207706_10083789 3300025933 Bacteria 2803
861 Ga0207706_10104475 3300025933 Bacteria 2492
862 Ga0207706_10122877 3300025933 Bacteria 2284
863 Ga0207706_10129021 3300025933 Bacteria 2224
864 Ga0207706_10157650 3300025933 Bacteria 1996
865 Ga0207706_10283890 3300025933 Bacteria 1443
866 Ga0207706_10332239 3300025933 Bacteria 1322
867 Ga0207706_10374268 3300025933 Bacteria 1237
868 Ga0207706_10415727 3300025933 Bacteria 1165
869 Ga0207686_10013436 3300025934 Bacteria 4532
870 Ga0207709_10132616 3300025935 Bacteria 1700
871 Ga0207709_10292084 3300025935 Bacteria 1209
872 Ga0207709_10451895 3300025935 Bacteria 993
873 Ga0207709_11049656 3300025935 Bacteria 668
874 Ga0207669_10003979 3300025937 Bacteria 6457
875 Ga0207669_10005841 3300025937 Bacteria 5566
876 Ga0207669_10087890 3300025937 Bacteria 2014
877 Ga0207669_10101407 3300025937 Bacteria 1904
878 Ga0207669_10125465 3300025937 Bacteria 1753
879 Ga0207669_10820278 3300025937 Bacteria 772
880 Ga0207704_10068509 3300025938 Bacteria 2237
881 Ga0207704_10114157 3300025938 Bacteria 1833
882 Ga0207704_10176176 3300025938 Bacteria 1540
883 Ga0207704_10693785 3300025938 Bacteria 842
884 Ga0207665_10096045 3300025939 Bacteria 2061
885 Ga0207665_10467758 3300025939 Bacteria 970
886 Ga0207691_10002277 3300025940 Bacteria 18791
887 Ga0207691_10003283 3300025940 Bacteria 15755
888 Ga0207691_10017707 3300025940 Bacteria 6753
889 Ga0207691_10028103 3300025940 Bacteria 5268
890 Ga0207691_10056363 3300025940 Bacteria 3579
891 Ga0207691_10064601 3300025940 Bacteria 3315
892 Ga0207691_10151632 3300025940 Bacteria 2037
893 Ga0207691_10311375 3300025940 Bacteria 1351
894 Ga0207691_10579836 3300025940 Bacteria 950
895 Ga0207711_10002037 3300025941 Bacteria 18274
896 Ga0207711_10002492 3300025941 Bacteria 16434
897 Ga0207711_10003890 3300025941 Bacteria 12851
898 Ga0207711_10028155 3300025941 Bacteria 4726
899 Ga0207711_10030261 3300025941 Bacteria 4566
900 Ga0207711_10043833 3300025941 Bacteria 3818
901 Ga0207711_10053392 3300025941 Bacteria 3466
902 Ga0207711_10088519 3300025941 Bacteria 2719
903 Ga0207711_10102611 3300025941 Bacteria 2532
904 Ga0207711_10343853 3300025941 Bacteria 1381
905 Ga0207689_10011314 3300025942 Bacteria 7656
906 Ga0207689_10011824 3300025942 Bacteria 7476
907 Ga0207661_10000187 3300025944 Bacteria 40098
908 Ga0207661_10025443 3300025944 Bacteria 4499
909 Ga0207661_10314066 3300025944 Bacteria 1407
910 Ga0207661_10346849 3300025944 Bacteria 1339
911 Ga0207661_10426838 3300025944 Bacteria 1205
912 Ga0207679_10000259 3300025945 Bacteria 40381
913 Ga0207679_10023698 3300025945 Bacteria 4201
914 Ga0207679_10025169 3300025945 Bacteria 4090
915 Ga0207679_10062130 3300025945 Bacteria 2782
916 Ga0207679_10068765 3300025945 Bacteria 2662
917 Ga0207679_10077895 3300025945 Bacteria 2524
918 Ga0207679_10093097 3300025945 Bacteria 2336
919 Ga0207679_10109920 3300025945 Bacteria 2173
920 Ga0207679_10117179 3300025945 Bacteria 2113
921 Ga0207679_10136122 3300025945 Bacteria 1978
922 Ga0207679_10189779 3300025945 Bacteria 1707
923 Ga0207679_10207912 3300025945 Bacteria 1639
924 Ga0207679_10215949 3300025945 Bacteria 1611
925 Ga0207679_10229100 3300025945 Bacteria 1568
926 Ga0207679_10256414 3300025945 Bacteria 1490
927 Ga0207667_10014940 3300025949 Bacteria 8830
928 Ga0207667_10017830 3300025949 Bacteria 7982
929 Ga0207667_10023776 3300025949 Bacteria 6744
930 Ga0207667_10090693 3300025949 Bacteria 3158
931 Ga0207667_10120462 3300025949 Bacteria 2704
932 Ga0207667_10165989 3300025949 Bacteria 2270
933 Ga0207667_10166160 3300025949 Bacteria 2269
934 Ga0207667_10218209 3300025949 Bacteria 1954
935 Ga0207667_10298049 3300025949 Bacteria 1647
936 Ga0207667_10431893 3300025949 Bacteria 1339
937 Ga0207667_10468647 3300025949 Bacteria 1279
938 Ga0207651_10001209 3300025960 Bacteria 11557
939 Ga0207651_10003812 3300025960 Bacteria 7472
940 Ga0207651_10011452 3300025960 Bacteria 4968
941 Ga0207651_10019846 3300025960 Bacteria 4040
942 Ga0207651_10044737 3300025960 Bacteria 2965
943 Ga0207651_10106403 3300025960 Bacteria 2094
944 Ga0207651_10151547 3300025960 Bacteria 1805
945 Ga0207651_10818198 3300025960 Bacteria 826
946 Ga0207712_10005619 3300025961 Bacteria 7910
947 Ga0207712_10049112 3300025961 Bacteria 2938
948 Ga0207668_10013664 3300025972 Bacteria 5008
949 Ga0207668_10058705 3300025972 Bacteria 2691
950 Ga0207668_10096451 3300025972 Bacteria 2186
951 Ga0207668_10246565 3300025972 Bacteria 1448
952 Ga0207668_10536878 3300025972 Bacteria 1011
953 Ga0207668_10606784 3300025972 Bacteria 954
954 Ga0207668_10664323 3300025972 Bacteria 913
955 Ga0207668_10941270 3300025972 Bacteria 770
956 Ga0207640_10024733 3300025981 Bacteria 3628
957 Ga0207640_10035974 3300025981 Bacteria 3104
958 Ga0207640_10042310 3300025981 Bacteria 2904
959 Ga0207640_10082927 3300025981 Bacteria 2197
960 Ga0207640_10104037 3300025981 Bacteria 1998
961 Ga0207640_10174431 3300025981 Bacteria 1606
962 Ga0207640_10215248 3300025981 Bacteria 1467
963 Ga0207640_10243213 3300025981 Bacteria 1392
964 Ga0207640_10281930 3300025981 Bacteria 1306
965 Ga0207640_10405140 3300025981 Bacteria 1112
966 Ga0207640_11273061 3300025981 Bacteria 656
967 Ga0207640_11281734 3300025981 Bacteria 654
968 Ga0207658_10002468 3300025986 Bacteria 13499
969 Ga0207658_10002571 3300025986 Bacteria 13185
970 Ga0207658_10007079 3300025986 Bacteria 7641
971 Ga0207658_10009967 3300025986 Bacteria 6457
972 Ga0207658_10056825 3300025986 Bacteria 2906
973 Ga0207658_10064845 3300025986 Bacteria 2741
974 Ga0207658_10066893 3300025986 Bacteria 2705
975 Ga0207658_10071202 3300025986 Bacteria 2632
976 Ga0207658_10319260 3300025986 Bacteria 1344
977 Ga0207658_10505932 3300025986 Bacteria 1076
978 Ga0207658_10512681 3300025986 Bacteria 1069
979 Ga0207658_10521919 3300025986 Bacteria 1060
980 Ga0207658_10529954 3300025986 Bacteria 1052
981 Ga0207658_11051636 3300025986 Bacteria 743
982 Ga0207677_10009857 3300026023 Bacteria 5385
983 Ga0207677_10011080 3300026023 Bacteria 5125
984 Ga0207677_10277593 3300026023 Bacteria 1374
985 Ga0207677_10517215 3300026023 Bacteria 1035
986 Ga0207677_10613900 3300026023 Bacteria 956
987 Ga0207677_10668909 3300026023 Bacteria 918
988 Ga0207703_10001404 3300026035 Bacteria 21944
989 Ga0207703_10004700 3300026035 Bacteria 11152
990 Ga0207703_10011664 3300026035 Bacteria 6836
991 Ga0207703_10015254 3300026035 Bacteria 5995
992 Ga0207703_10026274 3300026035 Bacteria 4581
993 Ga0207703_10036004 3300026035 Bacteria 3936
994 Ga0207703_10045405 3300026035 Bacteria 3534
995 Ga0207703_11019154 3300026035 Bacteria 794
996 Ga0207703_11138577 3300026035 Bacteria 750
997 Ga0207639_10000434 3300026041 Bacteria 28905
998 Ga0207639_10002074 3300026041 Bacteria 13509
999 Ga0207639_10044857 3300026041 Bacteria 3327
1000 Ga0207639_10049186 3300026041 Bacteria 3195
1001 Ga0207639_10051972 3300026041 Bacteria 3120
1002 Ga0207639_10053904 3300026041 Bacteria 3071
1003 Ga0207639_10062995 3300026041 Bacteria 2870
1004 Ga0207639_10158053 3300026041 Bacteria 1907
1005 Ga0207639_10195441 3300026041 Bacteria 1731
1006 Ga0207639_10215327 3300026041 Bacteria 1656
1007 Ga0207639_10257338 3300026041 Bacteria 1525
1008 Ga0207639_10636708 3300026041 Bacteria 986
1009 Ga0207678_10001604 3300026067 Bacteria 20809
1010 Ga0207678_10014296 3300026067 Bacteria 6978
1011 Ga0207678_10015901 3300026067 Bacteria 6611
1012 Ga0207678_10032260 3300026067 Bacteria 4565
1013 Ga0207678_10037051 3300026067 Bacteria 4245
1014 Ga0207678_10039940 3300026067 Bacteria 4070
1015 Ga0207678_10045896 3300026067 Bacteria 3778
1016 Ga0207678_10048206 3300026067 Bacteria 3683
1017 Ga0207678_10068261 3300026067 Bacteria 3051
1018 Ga0207678_10069542 3300026067 Bacteria 3018
1019 Ga0207678_10073812 3300026067 Bacteria 2923
1020 Ga0207678_10289041 3300026067 Bacteria 1408
1021 Ga0207678_10323440 3300026067 Bacteria 1327
1022 Ga0207678_10420577 3300026067 Bacteria 1159
1023 Ga0207702_10000324 3300026078 Bacteria 54694
1024 Ga0207702_10007017 3300026078 Bacteria 9635
1025 Ga0207702_10007309 3300026078 Bacteria 9442
1026 Ga0207702_10013653 3300026078 Bacteria 6746
1027 Ga0207702_10052596 3300026078 Bacteria 3447
1028 Ga0207702_10122005 3300026078 Bacteria 2334
1029 Ga0207702_10266271 3300026078 Bacteria 1615
1030 Ga0207702_10323555 3300026078 Bacteria 1469
1031 Ga0207702_10324737 3300026078 Bacteria 1467
1032 Ga0207702_10845692 3300026078 Bacteria 906
1033 Ga0207702_10866673 3300026078 Bacteria 894
1034 Ga0207702_10985678 3300026078 Bacteria 836
1035 Ga0207702_11602395 3300026078 Bacteria 644
1036 Ga0207641_10017421 3300026088 Bacteria 5880
1037 Ga0207641_10030844 3300026088 Bacteria 4442
1038 Ga0207641_10036947 3300026088 Bacteria 4077
1039 Ga0207641_10063322 3300026088 Bacteria 3159
1040 Ga0207648_10003494 3300026089 Bacteria 16462
1041 Ga0207648_10060678 3300026089 Bacteria 3298
1042 Ga0207648_10075208 3300026089 Bacteria 2944
1043 Ga0207648_10256955 3300026089 Bacteria 1558
1044 Ga0207648_10439174 3300026089 Bacteria 1187
1045 Ga0207676_10003816 3300026095 Bacteria 10650
1046 Ga0207676_10018431 3300026095 Bacteria 5074
1047 Ga0207676_10021255 3300026095 Bacteria 4761
1048 Ga0207676_10068673 3300026095 Bacteria 2835
1049 Ga0207676_10175427 3300026095 Bacteria 1871
1050 Ga0207676_10661871 3300026095 Bacteria 1009
1051 Ga0207676_10736939 3300026095 Bacteria 957
1052 Ga0207674_10000344 3300026116 Bacteria 59855
1053 Ga0207674_10008382 3300026116 Bacteria 11953
1054 Ga0207674_10032002 3300026116 Bacteria 5520
1055 Ga0207674_10126659 3300026116 Bacteria 2520
1056 Ga0207674_10138942 3300026116 Bacteria 2390
1057 Ga0207674_10357116 3300026116 Bacteria 1413
1058 Ga0207674_10595445 3300026116 Bacteria 1068
1059 Ga0207674_10605376 3300026116 Bacteria 1058
1060 Ga0207675_100134977 3300026118 Bacteria 2341
1061 Ga0207675_100312623 3300026118 Bacteria 1532
1062 Ga0207683_10000636 3300026121 Bacteria 32084
1063 Ga0207683_10002836 3300026121 Bacteria 15133
1064 Ga0207683_10013482 3300026121 Bacteria 6974
1065 Ga0207683_10030752 3300026121 Bacteria 4654
1066 Ga0207683_10037299 3300026121 Bacteria 4232
1067 Ga0207683_10108183 3300026121 Bacteria 2488
1068 Ga0207683_10523649 3300026121 Bacteria 1096
1069 Ga0207683_10628285 3300026121 Bacteria 995
1070 Ga0207698_10000780 3300026142 Bacteria 18515
1071 Ga0207698_10003803 3300026142 Bacteria 9128
1072 Ga0207698_10003979 3300026142 Bacteria 8961
1073 Ga0207698_10007780 3300026142 Bacteria 6734
1074 Ga0207698_10008400 3300026142 Bacteria 6529
1075 Ga0207698_10008510 3300026142 Bacteria 6497
1076 Ga0207698_10011485 3300026142 Bacteria 5747
1077 Ga0207698_10011537 3300026142 Bacteria 5734
1078 Ga0207698_10018573 3300026142 Bacteria 4741
1079 Ga0207698_10035886 3300026142 Bacteria 3632
1080 Ga0207698_10094979 3300026142 Bacteria 2453
1081 Ga0207698_10143925 3300026142 Bacteria 2058
1082 Ga0207698_10158052 3300026142 Bacteria 1978
1083 Ga0207698_10171417 3300026142 Bacteria 1911
1084 Ga0207698_10397271 3300026142 Bacteria 1316
1085 Ga0207698_11278920 3300026142 Bacteria 748
1086 Ga0207698_12118948 3300026142 Bacteria 576
1087 Ga0209982_1026999 3300027552 Bacteria 896
1088 Ga0268266_10021573 3300028379 Bacteria 5486
1089 Ga0268266_10040068 3300028379 Bacteria 3991
1090 Ga0268266_10045071 3300028379 Bacteria 3772
1091 Ga0268266_10047439 3300028379 Bacteria 3680
1092 Ga0268266_10261733 3300028379 Bacteria 1603
1093 Ga0268266_10268688 3300028379 Bacteria 1582
1094 Ga0268266_10400902 3300028379 Bacteria 1297
1095 Ga0268266_11329334 3300028379 Bacteria 694
1096 Ga0268266_11780826 3300028379 Bacteria 591
1097 Ga0268265_10013897 3300028380 Bacteria 5479
1098 Ga0268265_10034915 3300028380 Bacteria 3669
1099 Ga0268265_10041746 3300028380 Bacteria 3398
1100 Ga0268265_10104130 3300028380 Bacteria 2299
1101 Ga0268265_10349809 3300028380 Bacteria 1349
1102 Ga0268265_10719055 3300028380 Bacteria 966
1103 Ga0268264_10004576 3300028381 Bacteria 11775
1104 Ga0268264_10004618 3300028381 Bacteria 11705
1105 Ga0268264_10055120 3300028381 Bacteria 3322
1106 Ga0268264_10128678 3300028381 Bacteria 2241
1107 Ga0268264_10205951 3300028381 Bacteria 1803
1108 Ga0268264_10224410 3300028381 Bacteria 1731
1109 Ga0268264_10286081 3300028381 Bacteria 1546
1110 Ga0268264_10388226 3300028381 Bacteria 1338
1111 Ga0316177_1056283 3300030731 Bacteria 3301
1112 Ga0316183_1153271 3300030742 Bacteria 1278
1113 Ga0316182_1046552 3300030745 Bacteria 1076
1114 Ga0316182_1161338 3300030745 Bacteria 4401
1115 Ga0307408_100031183 3300031548 Bacteria 3710
1116 Ga0307408_100072822 3300031548 Bacteria 2545
1117 Ga0307408_100095195 3300031548 Bacteria 2257
1118 Ga0307408_100108556 3300031548 Bacteria 2127
1119 Ga0307408_100145217 3300031548 Bacteria 1866
1120 Ga0307408_100153164 3300031548 Bacteria 1822
1121 Ga0307408_100203345 3300031548 Bacteria 1605
1122 Ga0307408_100344792 3300031548 Bacteria 1262
1123 Ga0307408_100396207 3300031548 Bacteria 1184
1124 Ga0307408_100485836 3300031548 Bacteria 1078
1125 Ga0307408_101131675 3300031548 Bacteria 727
1126 Ga0307405_10029310 3300031731 Bacteria 3216
1127 Ga0307405_10051159 3300031731 Bacteria 2562
1128 Ga0307405_10053667 3300031731 Bacteria 2512
1129 Ga0307405_10059120 3300031731 Bacteria 2415
1130 Ga0307405_10065091 3300031731 Bacteria 2319
1131 Ga0307405_10139582 3300031731 Bacteria 1687
1132 Ga0307405_10146565 3300031731 Bacteria 1654
1133 Ga0307405_10555032 3300031731 Bacteria 930
1134 Ga0307405_10838396 3300031731 Bacteria 773
1135 Ga0307413_10004053 3300031824 Bacteria 6306
1136 Ga0307413_10004614 3300031824 Bacteria 6021
1137 Ga0307413_10008267 3300031824 Bacteria 4900
1138 Ga0307413_10011043 3300031824 Bacteria 4417
1139 Ga0307413_10034875 3300031824 Bacteria 2880
1140 Ga0307413_10041039 3300031824 Bacteria 2706
1141 Ga0307413_10068728 3300031824 Bacteria 2220
1142 Ga0307413_10085108 3300031824 Bacteria 2040
1143 Ga0307413_10217053 3300031824 Bacteria 1394
1144 Ga0307413_10236565 3300031824 Bacteria 1345
1145 Ga0307413_10266708 3300031824 Bacteria 1279
1146 Ga0307413_10663607 3300031824 Bacteria 862
1147 Ga0307413_10752750 3300031824 Bacteria 814
1148 Ga0307410_10000437 3300031852 Bacteria 16691
1149 Ga0307410_10002245 3300031852 Bacteria 9229
1150 Ga0307410_10049583 3300031852 Bacteria 2819
1151 Ga0307410_10071631 3300031852 Bacteria 2404
1152 Ga0307410_10093889 3300031852 Bacteria 2135
1153 Ga0307410_10106141 3300031852 Bacteria 2023
1154 Ga0307410_10128186 3300031852 Bacteria 1860
1155 Ga0307410_10162415 3300031852 Bacteria 1675
1156 Ga0307410_10213402 3300031852 Bacteria 1480
1157 Ga0307410_10276063 3300031852 Bacteria 1317
1158 Ga0307410_10311017 3300031852 Bacteria 1246
1159 Ga0307410_10326738 3300031852 Bacteria 1219
1160 Ga0307410_10348551 3300031852 Bacteria 1182
1161 Ga0307410_11045420 3300031852 Bacteria 706
1162 Ga0307406_10058404 3300031901 Bacteria 2479
1163 Ga0307406_10063868 3300031901 Bacteria 2387
1164 Ga0307406_10067661 3300031901 Bacteria 2329
1165 Ga0307406_10085883 3300031901 Bacteria 2105
1166 Ga0307406_10139180 3300031901 Bacteria 1715
1167 Ga0307406_10194622 3300031901 Bacteria 1487
1168 Ga0307406_10202175 3300031901 Bacteria 1463
1169 Ga0307406_10235353 3300031901 Bacteria 1370
1170 Ga0307406_10483400 3300031901 Bacteria 1000
1171 Ga0307406_10604045 3300031901 Bacteria 905
1172 Ga0307406_10653381 3300031901 Bacteria 873
1173 Ga0307407_10005220 3300031903 Bacteria 5606
1174 Ga0307407_10012887 3300031903 Bacteria 4038
1175 Ga0307407_10014810 3300031903 Bacteria 3830
1176 Ga0307407_10038115 3300031903 Bacteria 2661
1177 Ga0307407_10044947 3300031903 Bacteria 2492
1178 Ga0307407_10053977 3300031903 Bacteria 2315
1179 Ga0307407_10068126 3300031903 Bacteria 2107
1180 Ga0307407_10081298 3300031903 Bacteria 1960
1181 Ga0307407_10088972 3300031903 Bacteria 1887
1182 Ga0307407_10118305 3300031903 Bacteria 1675
1183 Ga0307407_10146074 3300031903 Bacteria 1531
1184 Ga0307407_10337973 3300031903 Bacteria 1062
1185 Ga0307407_10873277 3300031903 Bacteria 688
1186 Ga0307412_10004968 3300031911 Bacteria 7431
1187 Ga0307412_10031565 3300031911 Bacteria 3347
1188 Ga0307412_10063951 3300031911 Bacteria 2484
1189 Ga0307412_10067548 3300031911 Bacteria 2428
1190 Ga0307412_10077279 3300031911 Bacteria 2289
1191 Ga0307412_10083002 3300031911 Bacteria 2220
1192 Ga0307412_10102812 3300031911 Bacteria 2024
1193 Ga0307412_10165804 3300031911 Bacteria 1647
1194 Ga0307412_10169741 3300031911 Bacteria 1630
1195 Ga0307412_10200550 3300031911 Bacteria 1515
1196 Ga0307412_10246715 3300031911 Bacteria 1384
1197 Ga0307412_10291991 3300031911 Bacteria 1284
1198 Ga0307412_10313830 3300031911 Bacteria 1244
1199 Ga0307412_10738299 3300031911 Bacteria 849
1200 Ga0307412_10851412 3300031911 Bacteria 795
1201 Ga0307412_10876370 3300031911 Bacteria 785
1202 Ga0307412_10977231 3300031911 Bacteria 747
1203 Ga0307409_100014102 3300031995 Bacteria 5181
1204 Ga0307409_100015346 3300031995 Bacteria 5025
1205 Ga0307409_100018360 3300031995 Bacteria 4699
1206 Ga0307409_100019375 3300031995 Bacteria 4605
1207 Ga0307409_100062239 3300031995 Bacteria 2921
1208 Ga0307409_100078117 3300031995 Bacteria 2661
1209 Ga0307409_100090560 3300031995 Bacteria 2504
1210 Ga0307409_100097121 3300031995 Bacteria 2432
1211 Ga0307409_100116327 3300031995 Bacteria 2253
1212 Ga0307409_100137724 3300031995 Bacteria 2098
1213 Ga0307409_100166602 3300031995 Bacteria 1934
1214 Ga0307409_100217132 3300031995 Bacteria 1723
1215 Ga0307409_100239883 3300031995 Bacteria 1649
1216 Ga0307409_100343708 3300031995 Bacteria 1405
1217 Ga0307409_100396717 3300031995 Bacteria 1316
1218 Ga0307409_100556843 3300031995 Bacteria 1126
1219 Ga0307409_100760560 3300031995 Bacteria 973
1220 Ga0307409_100925650 3300031995 Bacteria 886
1221 Ga0307409_101077141 3300031995 Bacteria 824
1222 Ga0307409_101234936 3300031995 Bacteria 771
1223 Ga0307409_101274713 3300031995 Bacteria 759
1224 Ga0307409_101866101 3300031995 Bacteria 630
1225 Ga0307416_100009723 3300032002 Bacteria 6315
1226 Ga0307416_100027084 3300032002 Bacteria 4238
1227 Ga0307416_100028325 3300032002 Bacteria 4164
1228 Ga0307416_100055345 3300032002 Bacteria 3194
1229 Ga0307416_100160391 3300032002 Bacteria 2078
1230 Ga0307416_100291495 3300032002 Bacteria 1616
1231 Ga0307416_100356763 3300032002 Bacteria 1482
1232 Ga0307416_100380876 3300032002 Bacteria 1441
1233 Ga0307416_100438946 3300032002 Bacteria 1355
1234 Ga0307416_101832378 3300032002 Bacteria 710
1235 Ga0307414_10002592 3300032004 Bacteria 9512
1236 Ga0307414_10004703 3300032004 Bacteria 7448
1237 Ga0307414_10008709 3300032004 Bacteria 5780
1238 Ga0307414_10021024 3300032004 Bacteria 4083
1239 Ga0307414_10023363 3300032004 Bacteria 3921
1240 Ga0307414_10025253 3300032004 Bacteria 3802
1241 Ga0307414_10028353 3300032004 Bacteria 3631
1242 Ga0307414_10032711 3300032004 Bacteria 3428
1243 Ga0307414_10083296 3300032004 Bacteria 2348
1244 Ga0307414_10151536 3300032004 Bacteria 1830
1245 Ga0307414_10339234 3300032004 Bacteria 1286
1246 Ga0307414_10345890 3300032004 Bacteria 1274
1247 Ga0307414_10500460 3300032004 Bacteria 1075
1248 Ga0307414_10882064 3300032004 Bacteria 819
1249 Ga0307411_10005121 3300032005 Bacteria 6400
1250 Ga0307411_10012651 3300032005 Bacteria 4617
1251 Ga0307411_10012861 3300032005 Bacteria 4588
1252 Ga0307411_10013123 3300032005 Bacteria 4556
1253 Ga0307411_10015399 3300032005 Bacteria 4294
1254 Ga0307411_10030282 3300032005 Bacteria 3315
1255 Ga0307411_10035931 3300032005 Bacteria 3099
1256 Ga0307411_10039899 3300032005 Bacteria 2974
1257 Ga0307411_10041773 3300032005 Bacteria 2921
1258 Ga0307411_10046157 3300032005 Bacteria 2806
1259 Ga0307411_10070086 3300032005 Bacteria 2371
1260 Ga0307411_10092865 3300032005 Bacteria 2111
1261 Ga0307411_10155625 3300032005 Bacteria 1705
1262 Ga0307411_10193385 3300032005 Bacteria 1555
1263 Ga0307411_10321024 3300032005 Bacteria 1250
1264 Ga0307411_10395926 3300032005 Bacteria 1140
1265 Ga0307411_10501057 3300032005 Bacteria 1026
1266 Ga0307411_10568074 3300032005 Bacteria 970
1267 Ga0307411_10855643 3300032005 Bacteria 805
1268 Ga0307415_100013186 3300032126 Bacteria 4816
1269 Ga0307415_100014106 3300032126 Bacteria 4685
1270 Ga0307415_100016404 3300032126 Bacteria 4415
1271 Ga0307415_100028708 3300032126 Bacteria 3544
1272 Ga0307415_100041470 3300032126 Bacteria 3056
1273 Ga0307415_100051385 3300032126 Bacteria 2797
1274 Ga0307415_100075503 3300032126 Bacteria 2385
1275 Ga0307415_100253026 3300032126 Bacteria 1432
1276 Ga0307415_100433505 3300032126 Bacteria 1131
1277 Ga0307415_100461380 3300032126 Bacteria 1101
1278 Ga0307415_100481680 3300032126 Bacteria 1080
1279 Ga0307415_100573579 3300032126 Bacteria 999
1280 Ga0307415_100822023 3300032126 Bacteria 850
1281 Ga0307415_101809542 3300032126 Bacteria 591
1282 Ga0373930_0058955 3300034816 Bacteria 853
1283 Ga0373928_0031955 3300035084 Bacteria 1171
1284 Ga0373951_0106795 3300035091 Bacteria 750
1285 Ga0373923_0178272 3300035111 Bacteria 975
1286 Ga0373954_0290640 3300035118 Bacteria 806
1287 Ga0373943_0004324 3300035170 Bacteria 6444
1288 Ga0373943_0306284 3300035170 Bacteria 903
1289 Ga0373946_0005985 3300035171 Bacteria 4411
1290 Ga0373946_0224190 3300035171 Bacteria 909
1291 Ga0373955_0095908 3300035172 Bacteria 1697
1292 Ga0373942_0038064 3300035207 Bacteria 1303
1293 Ga0373931_0030764 3300035691 Bacteria 2766
1294 Ga0373931_0498007 3300035691 Bacteria 785
1295 Ga0373947_0021481 3300035725 Bacteria 3736
1296 Ga0373937_0199598 3300036401 Bacteria 1880
1297 Ga0373937_0268205 3300036401 Bacteria 1611
1298 Ga0395899_0000372 3300037312 Bacteria 53863
1299 Ga0395899_0013111 3300037312 Bacteria 6339
1300 Ga0395899_0013913 3300037312 Bacteria 6144
1301 Ga0395899_0021544 3300037312 Bacteria 4887
1302 Ga0395899_0042075 3300037312 Bacteria 3411
1303 Ga0395899_0073199 3300037312 Bacteria 2506
1304 Ga0395899_0088271 3300037312 Bacteria 2250
1305 Ga0395899_0099935 3300037312 Bacteria 2095
1306 Ga0395899_0104570 3300037312 Bacteria 2040
1307 Ga0395899_0111477 3300037312 Bacteria 1966
1308 Ga0395899_0142199 3300037312 Bacteria 1706
1309 Ga0395899_0342297 3300037312 Bacteria 1002
1310 Ga0395899_0495220 3300037312 Bacteria 793
1311 Ga0395899_0532666 3300037312 Bacteria 757
1312 Ga0395899_0745361 3300037312 Bacteria 610
1313 Ga0395900_0000240 3300037418 Bacteria 86222
1314 Ga0395900_0003660 3300037418 Bacteria 16531
1315 Ga0395900_0009569 3300037418 Bacteria 9934
1316 Ga0395900_0009815 3300037418 Bacteria 9808
1317 Ga0395900_0042039 3300037418 Bacteria 4708
1318 Ga0395900_0066994 3300037418 Bacteria 3689
1319 Ga0395900_0071287 3300037418 Bacteria 3572
1320 Ga0395900_0078889 3300037418 Bacteria 3383
1321 Ga0395900_0081537 3300037418 Bacteria 3323
1322 Ga0395900_0091720 3300037418 Bacteria 3121
1323 Ga0395900_0102061 3300037418 Bacteria 2946
1324 Ga0395900_0118836 3300037418 Bacteria 2713
1325 Ga0395900_0144085 3300037418 Bacteria 2437
1326 Ga0395900_0152416 3300037418 Bacteria 2361
1327 Ga0395900_0187187 3300037418 Bacteria 2101
1328 Ga0395900_0192867 3300037418 Bacteria 2065
1329 Ga0395900_0237616 3300037418 Bacteria 1829
1330 Ga0395900_0259671 3300037418 Bacteria 1735
1331 Ga0395900_0342090 3300037418 Bacteria 1471
1332 Ga0395900_0368593 3300037418 Bacteria 1406
1333 Ga0395900_0370681 3300037418 Bacteria 1401
1334 Ga0395900_0382626 3300037418 Bacteria 1375
1335 Ga0395900_0395336 3300037418 Bacteria 1348
1336 Ga0395900_0471900 3300037418 Bacteria 1208
1337 Ga0395900_0580538 3300037418 Bacteria 1063
1338 Ga0395900_0595719 3300037418 Bacteria 1046
1339 Ga0395900_0702783 3300037418 Bacteria 944
1340 Ga0395900_0710991 3300037418 Bacteria 937
1341 Ga0395900_0711022 3300037418 Bacteria 937
1342 Ga0395900_0820433 3300037418 Bacteria 857
1343 Ga0395900_0835738 3300037418 Bacteria 847
1344 Ga0395900_0839822 3300037418 Bacteria 844
1345 Ga0395900_0871861 3300037418 Bacteria 825
1346 Ga0395900_1205805 3300037418 Bacteria 672
1347 Ga0395898_0000619 3300037466 Bacteria 65174
1348 Ga0395898_0007467 3300037466 Bacteria 11608
1349 Ga0395898_0021463 3300037466 Bacteria 6548
1350 Ga0395898_0021896 3300037466 Bacteria 6475
1351 Ga0395898_0028931 3300037466 Bacteria 5553
1352 Ga0395898_0034476 3300037466 Bacteria 5044
1353 Ga0395898_0035223 3300037466 Bacteria 4980
1354 Ga0395898_0036491 3300037466 Bacteria 4880
1355 Ga0395898_0069323 3300037466 Bacteria 3411
1356 Ga0395898_0083356 3300037466 Bacteria 3081
1357 Ga0395898_0096299 3300037466 Bacteria 2843
1358 Ga0395898_0148174 3300037466 Bacteria 2246
1359 Ga0395898_0166439 3300037466 Bacteria 2108
1360 Ga0395898_0238194 3300037466 Bacteria 1735
1361 Ga0395898_0324526 3300037466 Bacteria 1468
1362 Ga0395898_0511338 3300037466 Bacteria 1142
1363 Ga0395898_0534713 3300037466 Bacteria 1114
1364 Ga0395898_0535005 3300037466 Bacteria 1113
1365 Ga0395898_0565550 3300037466 Bacteria 1079
1366 Ga0395898_1373514 3300037466 Bacteria 634
1367 Ga0395905_0000219 3300037471 Bacteria 87705
1368 Ga0395905_0011758 3300037471 Bacteria 8450
1369 Ga0395905_0013463 3300037471 Bacteria 7838
1370 Ga0395905_0014451 3300037471 Bacteria 7537
1371 Ga0395905_0016954 3300037471 Bacteria 6915
1372 Ga0395905_0017316 3300037471 Bacteria 6842
1373 Ga0395905_0017532 3300037471 Bacteria 6797
1374 Ga0395905_0021249 3300037471 Bacteria 6142
1375 Ga0395905_0021418 3300037471 Bacteria 6114
1376 Ga0395905_0022346 3300037471 Bacteria 5984
1377 Ga0395905_0027179 3300037471 Bacteria 5397
1378 Ga0395905_0033153 3300037471 Bacteria 4853
1379 Ga0395905_0034490 3300037471 Bacteria 4752
1380 Ga0395905_0039370 3300037471 Bacteria 4435
1381 Ga0395905_0048488 3300037471 Bacteria 3981
1382 Ga0395905_0051019 3300037471 Bacteria 3875
1383 Ga0395905_0089815 3300037471 Bacteria 2879
1384 Ga0395905_0090205 3300037471 Bacteria 2873
1385 Ga0395905_0101661 3300037471 Bacteria 2698
1386 Ga0395905_0140668 3300037471 Bacteria 2270
1387 Ga0395905_0148412 3300037471 Bacteria 2206
1388 Ga0395905_0179005 3300037471 Bacteria 1990
1389 Ga0395905_0190891 3300037471 Bacteria 1921
1390 Ga0395905_0284811 3300037471 Bacteria 1539
1391 Ga0395905_0350688 3300037471 Bacteria 1368
1392 Ga0395905_0421818 3300037471 Bacteria 1230
1393 Ga0395905_0429501 3300037471 Bacteria 1218
1394 Ga0395905_0433641 3300037471 Bacteria 1211
1395 Ga0395905_0569410 3300037471 Bacteria 1034
1396 Ga0436364_0612163 3300037853 Bacteria 25384
1397 Ga0395901_0000295 3300038443 Bacteria 61830
1398 Ga0395901_0001641 3300038443 Bacteria 23129
1399 Ga0395901_0005146 3300038443 Bacteria 13202
1400 Ga0395901_0028941 3300038443 Bacteria 5700
1401 Ga0395901_0038697 3300038443 Bacteria 4933
1402 Ga0395901_0066170 3300038443 Bacteria 3765
1403 Ga0395901_0069691 3300038443 Bacteria 3662
1404 Ga0395901_0074130 3300038443 Bacteria 3550
1405 Ga0395901_0074757 3300038443 Bacteria 3534
1406 Ga0395901_0092427 3300038443 Bacteria 3167
1407 Ga0395901_0107771 3300038443 Bacteria 2925
1408 Ga0395901_0111681 3300038443 Bacteria 2870
1409 Ga0395901_0113716 3300038443 Bacteria 2842
1410 Ga0395901_0118405 3300038443 Bacteria 2782
1411 Ga0395901_0129010 3300038443 Bacteria 2658
1412 Ga0395901_0163831 3300038443 Bacteria 2334
1413 Ga0395901_0175314 3300038443 Bacteria 2249
1414 Ga0395901_0183450 3300038443 Bacteria 2195
1415 Ga0395901_0208331 3300038443 Bacteria 2047
1416 Ga0395901_0233113 3300038443 Bacteria 1921
1417 Ga0395901_0262234 3300038443 Bacteria 1798
1418 Ga0395901_0263455 3300038443 Bacteria 1794
1419 Ga0395901_0275002 3300038443 Bacteria 1751
1420 Ga0395901_0359720 3300038443 Bacteria 1501
1421 Ga0395901_0404379 3300038443 Bacteria 1402
1422 Ga0395901_0600711 3300038443 Bacteria 1109
1423 Ga0395901_0775705 3300038443 Bacteria 949
1424 Ga0395901_0821040 3300038443 Bacteria 917
1425 Ga0395901_1263733 3300038443 Bacteria 701
1426 Ga0395901_1394325 3300038443 Bacteria 659
1427 Ga0395901_1397927 3300038443 Bacteria 658
1428 Ga0395901_2057546 3300038443 Bacteria 516
1429 Ga0436365_0174261 3300039437 Bacteria 27738
1430 Ga0436363_1558974 3300039450 Bacteria 681
1431 Ga0451845_0012319 3300041501 Bacteria 647
1432 Ga0451845_0905528 3300041501 Bacteria 959
1433 Ga0439437_011551 3300042000 Bacteria 1012
1434 Ga0439445_0000015 3300042004 Bacteria 22930
1435 Ga0439432_045073 3300042006 Bacteria 1388
1436 Ga0439449_0040835 3300042007 Bacteria 1725
1437 Ga0439452_069074 3300042010 Bacteria 781
1438 Ga0450920_068982 3300042122 Bacteria 718
1439 Ga0450890_046300 3300042127 Bacteria 654
1440 Ga0450890_065818 3300042127 Bacteria 573
1441 Ga0450905_001171 3300042142 Bacteria 3319
1442 Ga0450889_003955 3300042144 Bacteria 1463
1443 Ga0439458_0000559 3300042157 Bacteria 9582
1444 Ga0439434_0043995 3300042435 Bacteria 1375
1445 Ga0439464_0000922 3300042439 Bacteria 6596
1446 Ga0439464_0128918 3300042439 Bacteria 783
1447 Ga0451577_0496662 3300042876 Bacteria 1108
1448 Ga0466969_0018568 3300044656 Bacteria 3621
1449 Ga0466969_0022242 3300044656 Bacteria 3274
1450 Ga0466969_0146376 3300044656 Bacteria 1090
1451 Ga0466972_0362432 3300044658 Bacteria 678
1452 Ga0466965_0091099 3300044683 Bacteria 1551
1453 Ga0466966_0002899 3300044684 Bacteria 11306
1454 Ga0466966_0003928 3300044684 Bacteria 9816
1455 Ga0466966_0034117 3300044684 Bacteria 3293
1456 Ga0466961_0100218 3300044693 Bacteria 1825
1457 Ga0466961_0577662 3300044693 Bacteria 676
1458 Ga0466963_0003105 3300044694 Bacteria 9422
1459 Ga0466963_0003301 3300044694 Bacteria 9202
1460 Ga0466963_0006667 3300044694 Bacteria 6858
1461 Ga0466963_0013950 3300044694 Bacteria 4949
1462 Ga0466963_0014716 3300044694 Bacteria 4827
1463 Ga0466963_0034218 3300044694 Bacteria 3305
1464 Ga0466963_0039949 3300044694 Bacteria 3074
1465 Ga0466963_0067971 3300044694 Bacteria 2392
1466 Ga0466963_0084830 3300044694 Bacteria 2149
1467 Ga0466963_0215513 3300044694 Bacteria 1344
1468 Ga0466963_0425517 3300044694 Bacteria 936
1469 Ga0466963_0490886 3300044694 Bacteria 867
1470 Ga0466963_0773301 3300044694 Bacteria 677
1471 Ga0466964_0032722 3300044706 Bacteria 2068
1472 Ga0466964_0071820 3300044706 Bacteria 1465
1473 Ga0466971_0032249 3300044719 Bacteria 2347
1474 Ga0466971_0040278 3300044719 Bacteria 2098
1475 Ga0466971_0042871 3300044719 Bacteria 2034
1476 Ga0466971_0087172 3300044719 Bacteria 1427
1477 Ga0466971_0102698 3300044719 Bacteria 1315
1478 Ga0466971_0163683 3300044719 Bacteria 1042
1479 Ga0466971_0247237 3300044719 Bacteria 849
1480 Ga0466971_0269432 3300044719 Bacteria 814
1481 Ga0466970_0577641 3300044765 Bacteria 651
1482 Ga0466970_0647446 3300044765 Bacteria 614
1483 Ga0466957_0002027 3300044842 Bacteria 10800
1484 Ga0466957_0002241 3300044842 Bacteria 10370
1485 Ga0466957_0002685 3300044842 Bacteria 9613
1486 Ga0466957_0009688 3300044842 Bacteria 5501
1487 Ga0466957_0028098 3300044842 Bacteria 3348
1488 Ga0466957_0046306 3300044842 Bacteria 2641
1489 Ga0466957_0204835 3300044842 Bacteria 1297
1490 Ga0466957_0282879 3300044842 Bacteria 1110
1491 Ga0466957_0385014 3300044842 Bacteria 957
1492 Ga0466957_0701279 3300044842 Bacteria 714
1493 Ga0466960_0473884 3300044901 Bacteria 730
1494 Ga0466959_0013667 3300045049 Bacteria 5890
1495 Ga0466959_0015106 3300045049 Bacteria 5624
1496 Ga0466959_0084882 3300045049 Bacteria 2279
1497 Ga0466959_0348155 3300045049 Bacteria 1010
1498 Ga0466958_0000399 3300045836 Bacteria 17793
1499 Ga0466958_0079676 3300045836 Bacteria 2014
1500 Ga0466958_0175462 3300045836 Bacteria 1358
1501 Ga0466958_1074930 3300045836 Bacteria 525
1502 Ga0466967_0000381 3300045976 Bacteria 20628
1503 Ga0466967_0003611 3300045976 Bacteria 10158
1504 Ga0466967_0004849 3300045976 Bacteria 9179
1505 Ga0466967_0007454 3300045976 Bacteria 7893
1506 Ga0466967_0015627 3300045976 Bacteria 5956
1507 Ga0466967_0019455 3300045976 Bacteria 5459
1508 Ga0466967_0037136 3300045976 Bacteria 4165
1509 Ga0466967_0100305 3300045976 Bacteria 2645
1510 Ga0466967_0103000 3300045976 Bacteria 2612
1511 Ga0466967_0130330 3300045976 Bacteria 2333
1512 Ga0466967_0134300 3300045976 Bacteria 2300
1513 Ga0466967_0137914 3300045976 Bacteria 2270
1514 Ga0466967_0282264 3300045976 Bacteria 1593
1515 Ga0466967_0361986 3300045976 Bacteria 1406
1516 Ga0466967_0448196 3300045976 Bacteria 1261
1517 Ga0466967_0480398 3300045976 Bacteria 1217
1518 Ga0466967_0588648 3300045976 Bacteria 1097
1519 Ga0466967_0929913 3300045976 Bacteria 865
1520 Ga0466967_1388308 3300045976 Bacteria 700
1521 Ga0466967_1559463 3300045976 Bacteria 658
1522 Ga0495605_0142417 3300046474 Bacteria 1075
1523 Ga0495663_0016097 3300046525 Bacteria 2112
1524 Ga0495663_0061892 3300046525 Bacteria 1178
1525 Ga0495663_0306497 3300046525 Bacteria 573
1526 Ga0495621_0011105 3300046539 Bacteria 2777
1527 Ga0495621_0193384 3300046539 Bacteria 816
1528 Ga0495633_0316713 3300046558 Bacteria 708
1529 Ga0495668_0006675 3300046616 Bacteria 7512
1530 Ga0495588_0673741 3300046674 Bacteria 541
1531 Ga0495647_0202537 3300046681 Bacteria 871
1532 Ga0495669_0000306 3300046684 Bacteria 27112
1533 Ga0495669_0007410 3300046684 Bacteria 4601
1534 Ga0495669_0017096 3300046684 Bacteria 3109
1535 Ga0495669_0021849 3300046684 Bacteria 2780
1536 Ga0495669_0039320 3300046684 Bacteria 2094
1537 Ga0495669_0040797 3300046684 Bacteria 2059
1538 Ga0495669_0071156 3300046684 Bacteria 1585
1539 Ga0495669_0103738 3300046684 Bacteria 1323
1540 Ga0495660_0458837 3300046810 Bacteria 550
1541 Ga0495683_0168076 3300047323 Bacteria 1010
1542 Ga0495687_100660 3300047443 Bacteria 1085
1543 Ga0495677_0106911 3300047445 Bacteria 1062
1544 Ga0495602_0155291 3300048088 Bacteria 1792
1545 Ga0496100_0005362 3300048903 Bacteria 6896
1546 Ga0496100_0038046 3300048903 Bacteria 3046
1547 Ga0496100_0219629 3300048903 Bacteria 1394
1548 Ga0496100_0441594 3300048903 Bacteria 996
1549 Ga0496101_0001845 3300048904 Bacteria 12772
1550 Ga0496101_0020761 3300048904 Bacteria 4505
1551 Ga0496101_0560807 3300048904 Bacteria 903
1552 Ga0496101_1034522 3300048904 Bacteria 645
1553 Ga0496101_1245483 3300048904 Bacteria 582
1554 Ga0496102_0186202 3300048905 Bacteria 1957
1555 Ga0496102_0223431 3300048905 Bacteria 1776
1556 Ga0496103_0077015 3300048906 Bacteria 2093
1557 Ga0496103_0422029 3300048906 Bacteria 856
1558 Ga0496104_0063254 3300048907 Bacteria 3509
1559 Ga0496104_0245469 3300048907 Bacteria 1703
1560 Ga0496105_0035375 3300048908 Bacteria 4111
1561 Ga0496106_0002590 3300048909 Bacteria 13463
1562 Ga0496106_0024920 3300048909 Bacteria 4448
1563 Ga0496106_0032636 3300048909 Bacteria 3883
1564 Ga0496107_0002051 3300048910 Bacteria 12880
1565 Ga0496107_0003122 3300048910 Bacteria 11018
1566 Ga0496107_0086333 3300048910 Bacteria 2290
1567 Ga0496107_0107809 3300048910 Bacteria 2046
1568 Ga0496107_0117606 3300048910 Bacteria 1957
1569 Ga0496107_0211239 3300048910 Bacteria 1443
1570 Ga0496107_0375785 3300048910 Bacteria 1057
1571 Ga0496107_0482313 3300048910 Bacteria 920
1572 Ga0496107_0496365 3300048910 Bacteria 905
1573 Ga0496107_0814714 3300048910 Bacteria 683
1574 Ga0496108_0004931 3300048911 Bacteria 10782
1575 Ga0496108_0010742 3300048911 Bacteria 7433
1576 Ga0496108_0016413 3300048911 Bacteria 6039
1577 Ga0496108_0024347 3300048911 Bacteria 4983
1578 Ga0496108_0252026 3300048911 Bacteria 1536
1579 Ga0496109_0014535 3300048912 Bacteria 6847
1580 Ga0496109_0027613 3300048912 Bacteria 5070
1581 Ga0496109_0132943 3300048912 Bacteria 2323
1582 Ga0496109_0144722 3300048912 Bacteria 2223
1583 Ga0496109_0205886 3300048912 Bacteria 1850
1584 Ga0496109_0339215 3300048912 Bacteria 1419
1585 Ga0496110_0009431 3300048913 Bacteria 7906
1586 Ga0496110_0029480 3300048913 Bacteria 4724
1587 Ga0496110_0036846 3300048913 Bacteria 4249
1588 Ga0496110_0056128 3300048913 Bacteria 3466
1589 Ga0496110_0127609 3300048913 Bacteria 2295
1590 Ga0496110_0155859 3300048913 Bacteria 2069
1591 Ga0496111_0001035 3300048914 Bacteria 15288
1592 Ga0496111_0003669 3300048914 Bacteria 9535
1593 Ga0496111_0004529 3300048914 Bacteria 8794
1594 Ga0496111_0023837 3300048914 Bacteria 4300
1595 Ga0496111_0060749 3300048914 Bacteria 2739
1596 Ga0496112_0002414 3300048915 Bacteria 15049
1597 Ga0496112_0005570 3300048915 Bacteria 10917
1598 Ga0496112_0013316 3300048915 Bacteria 7592
1599 Ga0496112_0032641 3300048915 Bacteria 5055
1600 Ga0496112_0064162 3300048915 Bacteria 3624
1601 Ga0496112_0074485 3300048915 Bacteria 3356
1602 Ga0496112_0076688 3300048915 Bacteria 3306
1603 Ga0496112_0264143 3300048915 Bacteria 1670
1604 Ga0496112_0635805 3300048915 Bacteria 997
1605 Ga0496113_0018400 3300048916 Bacteria 4865
1606 Ga0496113_0019087 3300048916 Bacteria 4790
1607 Ga0496113_0025796 3300048916 Bacteria 4195
1608 Ga0496113_0077172 3300048916 Bacteria 2546
1609 Ga0496113_0114623 3300048916 Bacteria 2102
1610 Ga0496113_0282054 3300048916 Bacteria 1328
1611 Ga0496114_0022765 3300048917 Bacteria 5107
1612 Ga0496114_0033866 3300048917 Bacteria 4211
1613 Ga0496115_0026126 3300048918 Bacteria 4554
1614 Ga0496115_0791928 3300048918 Bacteria 738
1615 Ga0496122_0000083 3300048925 Bacteria 208744
1616 Ga0496123_0000097 3300048926 Bacteria 173894
1617 Ga0496126_0059355 3300048929 Bacteria 3445
1618 Ga0496126_0931915 3300048929 Bacteria 656
1619 Ga0501067_0405608 3300049583 Bacteria 760
1620 Ga0501070_0872986 3300049586 Bacteria 703
1621 Ga0501070_0995623 3300049586 Bacteria 650
1622 Ga0501074_0049301 3300049590 Bacteria 3040
1623 Ga0501198_073092 3300049649 Bacteria 651
1624 Ga0501224_020851 3300049664 Bacteria 976
1625 Ga0501230_084709 3300049667 Bacteria 667
1626 Ga0501233_052972 3300049668 Bacteria 988
1627 Ga0501243_014443 3300049675 Bacteria 1262
1628 Ga0501249_047177 3300049679 Bacteria 985
1629 Ga0501257_094286 3300049686 Bacteria 781
1630 Ga0501225_0012490 3300049705 Bacteria 2386
1631 Ga0501262_008416 3300049759 Bacteria 1263
1632 Ga0501263_009557 3300049760 Bacteria 1176
1633 Ga0501268_008324 3300049765 Bacteria 1568
1634 Ga0501271_019569 3300049768 Bacteria 779
1635 Ga0501273_013457 3300049770 Bacteria 1043
1636 Ga0501273_018704 3300049770 Bacteria 924
1637 nmdc:mga0yw44_155554_c1 3300050492 Bacteria 1494
1638 nmdc:mga05p37_1380512_c1 3300050507 Bacteria 711
1639 nmdc:mga09592_885018_c1 3300050508 Bacteria 751
1640 nmdc:mga06r32_252318_c1 3300050510 Bacteria 1752
1641 nmdc:mga06r32_876226_c1 3300050510 Bacteria 855
1642 nmdc:mga08y16_94019_c1 3300050511 Bacteria 3123
1643 nmdc:mga08y16_970606_c1 3300050511 Bacteria 831
1644 nmdc:mga0n895_170208_c1 3300050512 Bacteria 2210
1645 Ga0500644_0039165 3300053088 Bacteria 1561
1646 Ga0500622_0049373 3300053156 Bacteria 2170
1647 Ga0500627_0257803 3300053158 Bacteria 770
1648 Ga0590071_056454 3300059421 Bacteria 955
1649 Ga0590075_015112 3300059424 Bacteria 1893
1650 Ga0466962_0165699 3300061719 Bacteria 1075
1651 Ga0466962_0229125 3300061719 Bacteria 911

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300038443 Ga0395901_2057546 Ga0395901_2057546_10_417 133
2 3300005546 Ga0070696_100003877 Ga0070696_1000038779 147
3 3300005547 Ga0070693_100096568 Ga0070693_1000965683 147
4 3300005578 Ga0068854_100058642 Ga0068854_1000586424 147
5 3300048918 Ga0496115_0791928 Ga0496115_0791928_270_716 148
6 3300013307 Ga0157372_11151569 Ga0157372_111515692 151
7 3300037312 Ga0395899_0000372 Ga0395899_0000372_13592_14047 151
8 3300037418 Ga0395900_0000240 Ga0395900_0000240_55557_56012 151
9 3300037466 Ga0395898_0000619 Ga0395898_0000619_7702_8157 151
10 3300037471 Ga0395905_0000219 Ga0395905_0000219_56977_57432 151
11 3300038443 Ga0395901_0001641 Ga0395901_0001641_13791_14246 151
12 3300025939 Ga0207665_10096045 Ga0207665_100960451 154
13 3300005293 Ga0065715_10212777 Ga0065715_102127772 158
14 3300005293 Ga0065715_10547467 Ga0065715_105474672 158
15 3300005295 Ga0065707_10587971 Ga0065707_105879711 158
16 3300005347 Ga0070668_100659438 Ga0070668_1006594381 158
17 3300005441 Ga0070700_101264982 Ga0070700_1012649821 158
18 3300005539 Ga0068853_100025705 Ga0068853_1000257052 158
19 3300005843 Ga0068860_100083406 Ga0068860_1000834062 158
20 3300006038 Ga0075365_10088267 Ga0075365_100882672 158
21 3300006844 Ga0075428_100498708 Ga0075428_1004987082 158
22 3300006847 Ga0075431_100145230 Ga0075431_1001452302 158
23 3300006847 Ga0075431_100324613 Ga0075431_1003246132 158
24 3300009147 Ga0114129_10667060 Ga0114129_106670602 158
25 3300009174 Ga0105241_11002566 Ga0105241_110025662 158
26 3300009553 Ga0105249_10035644 Ga0105249_100356444 158
27 3300013102 Ga0157371_10748655 Ga0157371_107486552 158
28 3300014326 Ga0157380_10012365 Ga0157380_100123659 158
29 3300025961 Ga0207712_10049112 Ga0207712_100491123 158
30 3300025972 Ga0207668_10664323 Ga0207668_106643232 158
31 3300026041 Ga0207639_10257338 Ga0207639_102573382 158
32 3300026067 Ga0207678_10323440 Ga0207678_103234402 158
33 3300028381 Ga0268264_10055120 Ga0268264_100551206 158
34 3300031548 Ga0307408_100396207 Ga0307408_1003962072 158
35 3300031911 Ga0307412_10200550 Ga0307412_102005502 158
36 3300031995 Ga0307409_100062239 Ga0307409_1000622394 158
37 3300035171 Ga0373946_0224190 Ga0373946_0224190_24_506 158
38 3300042004 Ga0439445_0000015 Ga0439445_0000015_21148_21636 158
39 3300042122 Ga0450920_068982 Ga0450920_068982_95_571 158
40 3300046539 Ga0495621_0011105 Ga0495621_0011105_898_1386 158
41 3300050492 nmdc:mga0yw44_155554_c1 nmdc:mga0yw44_155554_c1_691_1179 158
42 3300050510 nmdc:mga06r32_252318_c1 nmdc:mga06r32_252318_c1_103_591 158
43 3300050510 nmdc:mga06r32_876226_c1 nmdc:mga06r32_876226_c1_334_822 158
44 3300031548 Ga0307408_100095195 Ga0307408_1000951952 159
45 3300031731 Ga0307405_10059120 Ga0307405_100591203 159
46 3300031731 Ga0307405_10838396 Ga0307405_108383962 159
47 3300031824 Ga0307413_10041039 Ga0307413_100410393 159
48 3300031824 Ga0307413_10217053 Ga0307413_102170532 159
49 3300031824 Ga0307413_10236565 Ga0307413_102365652 159
50 3300031852 Ga0307410_10049583 Ga0307410_100495834 159
51 3300031852 Ga0307410_10071631 Ga0307410_100716314 159
52 3300031901 Ga0307406_10235353 Ga0307406_102353532 159
53 3300031901 Ga0307406_10653381 Ga0307406_106533812 159
54 3300031911 Ga0307412_10067548 Ga0307412_100675483 159
55 3300031911 Ga0307412_10077279 Ga0307412_100772793 159
56 3300031911 Ga0307412_10165804 Ga0307412_101658042 159
57 3300031995 Ga0307409_100343708 Ga0307409_1003437082 159
58 3300032002 Ga0307416_100438946 Ga0307416_1004389462 159
59 3300032002 Ga0307416_101832378 Ga0307416_1018323782 159
60 3300032004 Ga0307414_10002592 Ga0307414_100025926 159
61 3300032004 Ga0307414_10339234 Ga0307414_103392341 159
62 3300032005 Ga0307411_10070086 Ga0307411_100700862 159
63 3300032005 Ga0307411_10092865 Ga0307411_100928653 159
64 3300032005 Ga0307411_10155625 Ga0307411_101556253 159
65 3300032005 Ga0307411_10855643 Ga0307411_108556432 159
66 3300032126 Ga0307415_100253026 Ga0307415_1002530262 159
67 3300032126 Ga0307415_100481680 Ga0307415_1004816802 159
68 3300042435 Ga0439434_0043995 Ga0439434_0043995_22_513 159
69 3300044683 Ga0466965_0091099 Ga0466965_0091099_49_531 159
70 iso_pu_bacteria 2751185897 2753767337 159
71 3300001979 JGI24740J21852_10009585 JGI24740J21852_100095854 160
72 3300005293 Ga0065715_10232064 Ga0065715_102320642 160
73 3300005329 Ga0070683_100074304 Ga0070683_1000743043 160
74 3300005331 Ga0070670_100357568 Ga0070670_1003575682 160
75 3300005335 Ga0070666_10752873 Ga0070666_107528731 160
76 3300005339 Ga0070660_100040747 Ga0070660_1000407474 160
77 3300005344 Ga0070661_100010511 Ga0070661_1000105117 160
78 3300005347 Ga0070668_100362847 Ga0070668_1003628472 160
79 3300005353 Ga0070669_100443433 Ga0070669_1004434332 160
80 3300005353 Ga0070669_100572518 Ga0070669_1005725182 160
81 3300005355 Ga0070671_100033513 Ga0070671_1000335134 160
82 3300005366 Ga0070659_100008476 Ga0070659_1000084766 160
83 3300005367 Ga0070667_100003547 Ga0070667_10000354716 160
84 3300005455 Ga0070663_100018151 Ga0070663_1000181514 160
85 3300005455 Ga0070663_100085711 Ga0070663_1000857111 160
86 3300005455 Ga0070663_100286005 Ga0070663_1002860052 160
87 3300005535 Ga0070684_100668957 Ga0070684_1006689572 160
88 3300005539 Ga0068853_100301621 Ga0068853_1003016212 160
89 3300005563 Ga0068855_100044979 Ga0068855_1000449794 160
90 3300005563 Ga0068855_100350828 Ga0068855_1003508281 160
91 3300005578 Ga0068854_100047436 Ga0068854_1000474364 160
92 3300005614 Ga0068856_100030615 Ga0068856_1000306154 160
93 3300005614 Ga0068856_100161329 Ga0068856_1001613291 160
94 3300005614 Ga0068856_101881776 Ga0068856_1018817761 160
95 3300005616 Ga0068852_100016545 Ga0068852_1000165452 160
96 3300005616 Ga0068852_100177587 Ga0068852_1001775874 160
97 3300005843 Ga0068860_100694401 Ga0068860_1006944012 160
98 3300006881 Ga0068865_100094006 Ga0068865_1000940062 160
99 3300009093 Ga0105240_10556687 Ga0105240_105566872 160
100 3300009148 Ga0105243_12594643 Ga0105243_125946431 160
101 3300009174 Ga0105241_10239846 Ga0105241_102398462 160
102 3300009177 Ga0105248_10009537 Ga0105248_100095372 160
103 3300009545 Ga0105237_10319939 Ga0105237_103199392 160
104 3300009551 Ga0105238_10501516 Ga0105238_105015162 160
105 3300010375 Ga0105239_10897698 Ga0105239_108976982 160
106 3300013100 Ga0157373_10075161 Ga0157373_100751612 160
107 3300013102 Ga0157371_10013748 Ga0157371_100137486 160
108 3300013102 Ga0157371_10014334 Ga0157371_100143344 160
109 3300013102 Ga0157371_10018858 Ga0157371_100188584 160
110 3300013102 Ga0157371_10222273 Ga0157371_102222732 160
111 3300013104 Ga0157370_11054031 Ga0157370_110540312 160
112 3300013104 Ga0157370_11317042 Ga0157370_113170422 160
113 3300013105 Ga0157369_10009299 Ga0157369_100092991 160
114 3300013105 Ga0157369_10028768 Ga0157369_100287686 160
115 3300013105 Ga0157369_10905261 Ga0157369_109052612 160
116 3300013296 Ga0157374_10068994 Ga0157374_100689944 160
117 3300013306 Ga0163162_10048885 Ga0163162_100488855 160
118 3300013306 Ga0163162_10208939 Ga0163162_102089392 160
119 3300013308 Ga0157375_10006174 Ga0157375_100061744 160
120 3300014325 Ga0163163_10311427 Ga0163163_103114272 160
121 3300014968 Ga0157379_10105672 Ga0157379_101056723 160
122 3300017792 Ga0163161_10007048 Ga0163161_100070484 160
123 3300017792 Ga0163161_10230343 Ga0163161_102303433 160
124 3300025904 Ga0207647_10025310 Ga0207647_100253105 160
125 3300025909 Ga0207705_10000003 Ga0207705_10000003420 160
126 3300025913 Ga0207695_10020461 Ga0207695_100204618 160
127 3300025919 Ga0207657_10001027 Ga0207657_100010278 160
128 3300025920 Ga0207649_10000576 Ga0207649_100005769 160
129 3300025923 Ga0207681_10075234 Ga0207681_100752343 160
130 3300025923 Ga0207681_10773225 Ga0207681_107732251 160
131 3300025924 Ga0207694_10386021 Ga0207694_103860212 160
132 3300025925 Ga0207650_10315906 Ga0207650_103159062 160
133 3300025925 Ga0207650_10668345 Ga0207650_106683452 160
134 3300025931 Ga0207644_10003084 Ga0207644_1000308412 160
135 3300025931 Ga0207644_10090229 Ga0207644_100902293 160
136 3300025932 Ga0207690_10011186 Ga0207690_100111865 160
137 3300025941 Ga0207711_10030261 Ga0207711_100302613 160
138 3300025941 Ga0207711_10088519 Ga0207711_100885194 160
139 3300025944 Ga0207661_10314066 Ga0207661_103140662 160
140 3300025949 Ga0207667_10014940 Ga0207667_100149405 160
141 3300025949 Ga0207667_10017830 Ga0207667_100178306 160
142 3300025972 Ga0207668_10096451 Ga0207668_100964512 160
143 3300025972 Ga0207668_10536878 Ga0207668_105368782 160
144 3300025981 Ga0207640_10035974 Ga0207640_100359744 160
145 3300025986 Ga0207658_10002571 Ga0207658_1000257112 160
146 3300026035 Ga0207703_11019154 Ga0207703_110191542 160
147 3300026041 Ga0207639_10053904 Ga0207639_100539043 160
148 3300026067 Ga0207678_10032260 Ga0207678_100322604 160
149 3300026067 Ga0207678_10039940 Ga0207678_100399404 160
150 3300026078 Ga0207702_10013653 Ga0207702_100136534 160
151 3300026078 Ga0207702_10866673 Ga0207702_108666732 160
152 3300026142 Ga0207698_10003803 Ga0207698_100038039 160
153 3300026142 Ga0207698_10008510 Ga0207698_100085106 160
154 3300028381 Ga0268264_10205951 Ga0268264_102059512 160
155 3300030742 Ga0316183_1153271 Ga0316183_11532712 160
156 3300030745 Ga0316182_1161338 Ga0316182_11613383 160
157 3300031548 Ga0307408_100072822 Ga0307408_1000728224 160
158 3300031548 Ga0307408_100203345 Ga0307408_1002033453 160
159 3300031548 Ga0307408_100485836 Ga0307408_1004858362 160
160 3300031731 Ga0307405_10051159 Ga0307405_100511594 160
161 3300031731 Ga0307405_10065091 Ga0307405_100650913 160
162 3300031731 Ga0307405_10555032 Ga0307405_105550321 160
163 3300031824 Ga0307413_10004053 Ga0307413_100040535 160
164 3300031824 Ga0307413_10034875 Ga0307413_100348753 160
165 3300031824 Ga0307413_10085108 Ga0307413_100851082 160
166 3300031852 Ga0307410_10128186 Ga0307410_101281862 160
167 3300031852 Ga0307410_10162415 Ga0307410_101624152 160
168 3300031852 Ga0307410_10213402 Ga0307410_102134022 160
169 3300031901 Ga0307406_10067661 Ga0307406_100676613 160
170 3300031901 Ga0307406_10194622 Ga0307406_101946222 160
171 3300031901 Ga0307406_10604045 Ga0307406_106040452 160
172 3300031903 Ga0307407_10005220 Ga0307407_100052203 160
173 3300031903 Ga0307407_10038115 Ga0307407_100381152 160
174 3300031903 Ga0307407_10068126 Ga0307407_100681264 160
175 3300031911 Ga0307412_10031565 Ga0307412_100315653 160
176 3300031911 Ga0307412_10169741 Ga0307412_101697412 160
177 3300031911 Ga0307412_10246715 Ga0307412_102467152 160
178 3300031911 Ga0307412_10313830 Ga0307412_103138302 160
179 3300031911 Ga0307412_10977231 Ga0307412_109772312 160
180 3300031995 Ga0307409_100018360 Ga0307409_1000183606 160
181 3300031995 Ga0307409_100019375 Ga0307409_1000193755 160
182 3300031995 Ga0307409_100217132 Ga0307409_1002171322 160
183 3300031995 Ga0307409_100556843 Ga0307409_1005568432 160
184 3300031995 Ga0307409_101234936 Ga0307409_1012349362 160
185 3300032002 Ga0307416_100027084 Ga0307416_1000270842 160
186 3300032002 Ga0307416_100356763 Ga0307416_1003567632 160
187 3300032004 Ga0307414_10004703 Ga0307414_100047037 160
188 3300032004 Ga0307414_10028353 Ga0307414_100283535 160
189 3300032004 Ga0307414_10032711 Ga0307414_100327112 160
190 3300032004 Ga0307414_10500460 Ga0307414_105004602 160
191 3300032005 Ga0307411_10012861 Ga0307411_100128612 160
192 3300032005 Ga0307411_10568074 Ga0307411_105680741 160
193 3300032126 Ga0307415_100014106 Ga0307415_1000141064 160
194 3300032126 Ga0307415_100016404 Ga0307415_1000164046 160
195 3300032126 Ga0307415_100051385 Ga0307415_1000513853 160
196 3300032126 Ga0307415_100461380 Ga0307415_1004613802 160
197 3300037312 Ga0395899_0013111 Ga0395899_0013111_3119_3607 160
198 3300037312 Ga0395899_0088271 Ga0395899_0088271_1299_1787 160
199 3300037312 Ga0395899_0111477 Ga0395899_0111477_12_500 160
200 3300037312 Ga0395899_0532666 Ga0395899_0532666_258_746 160
201 3300037418 Ga0395900_0066994 Ga0395900_0066994_957_1445 160
202 3300037418 Ga0395900_0710991 Ga0395900_0710991_12_500 160
203 3300037418 Ga0395900_0711022 Ga0395900_0711022_12_500 160
204 3300037466 Ga0395898_0021896 Ga0395898_0021896_2329_2817 160
205 3300037466 Ga0395898_0034476 Ga0395898_0034476_665_1153 160
206 3300037466 Ga0395898_0148174 Ga0395898_0148174_725_1213 160
207 3300037471 Ga0395905_0433641 Ga0395905_0433641_50_538 160
208 3300038443 Ga0395901_0038697 Ga0395901_0038697_4008_4496 160
209 3300038443 Ga0395901_0092427 Ga0395901_0092427_2256_2744 160
210 3300042006 Ga0439432_045073 Ga0439432_045073_594_1088 160
211 3300044656 Ga0466969_0018568 Ga0466969_0018568_1322_1810 160
212 3300044684 Ga0466966_0002899 Ga0466966_0002899_7708_8196 160
213 3300044694 Ga0466963_0003105 Ga0466963_0003105_4028_4516 160
214 3300044694 Ga0466963_0014716 Ga0466963_0014716_1483_1971 160
215 3300044719 Ga0466971_0040278 Ga0466971_0040278_328_816 160
216 3300044842 Ga0466957_0002241 Ga0466957_0002241_3917_4405 160
217 3300045049 Ga0466959_0015106 Ga0466959_0015106_5112_5600 160
218 3300045049 Ga0466959_0348155 Ga0466959_0348155_374_862 160
219 3300045836 Ga0466958_0000399 Ga0466958_0000399_8826_9314 160
220 3300045976 Ga0466967_0137914 Ga0466967_0137914_1122_1610 160
221 3300046674 Ga0495588_0673741 Ga0495588_0673741_34_528 160
222 3300048904 Ga0496101_0020761 Ga0496101_0020761_253_747 160
223 3300048910 Ga0496107_0086333 Ga0496107_0086333_1556_2050 160
224 3300048910 Ga0496107_0211239 Ga0496107_0211239_217_699 160
225 3300048912 Ga0496109_0144722 Ga0496109_0144722_790_1284 160
226 3300048913 Ga0496110_0155859 Ga0496110_0155859_543_1037 160
227 3300048917 Ga0496114_0022765 Ga0496114_0022765_2484_2978 160
228 3300049765 Ga0501268_008324 Ga0501268_008324_113_607 160
229 3300005336 Ga0070680_100042036 Ga0070680_1000420366 161
230 3300005336 Ga0070680_100199350 Ga0070680_1001993502 161
231 3300005336 Ga0070680_100532012 Ga0070680_1005320121 161
232 3300005339 Ga0070660_100260684 Ga0070660_1002606841 161
233 3300005339 Ga0070660_100537131 Ga0070660_1005371312 161
234 3300005347 Ga0070668_100021509 Ga0070668_1000215096 161
235 3300005366 Ga0070659_100079588 Ga0070659_1000795882 161
236 3300005444 Ga0070694_101231807 Ga0070694_1012318071 161
237 3300005457 Ga0070662_100044799 Ga0070662_1000447994 161
238 3300005458 Ga0070681_10426345 Ga0070681_104263452 161
239 3300005530 Ga0070679_100380371 Ga0070679_1003803712 161
240 3300005539 Ga0068853_100217176 Ga0068853_1002171762 161
241 3300005545 Ga0070695_100011571 Ga0070695_1000115714 161
242 3300005546 Ga0070696_100006531 Ga0070696_1000065316 161
243 3300005546 Ga0070696_100251807 Ga0070696_1002518072 161
244 3300005549 Ga0070704_100763071 Ga0070704_1007630712 161
245 3300005563 Ga0068855_100155487 Ga0068855_1001554872 161
246 3300005578 Ga0068854_100048961 Ga0068854_1000489612 161
247 3300005578 Ga0068854_100492527 Ga0068854_1004925272 161
248 3300005578 Ga0068854_101446863 Ga0068854_1014468631 161
249 3300005614 Ga0068856_100529571 Ga0068856_1005295711 161
250 3300005616 Ga0068852_100145153 Ga0068852_1001451532 161
251 3300005841 Ga0068863_100084627 Ga0068863_1000846273 161
252 3300005844 Ga0068862_100302601 Ga0068862_1003026012 161
253 3300006844 Ga0075428_100259271 Ga0075428_1002592712 161
254 3300006880 Ga0075429_101031256 Ga0075429_1010312561 161
255 3300009093 Ga0105240_10094723 Ga0105240_100947232 161
256 3300009094 Ga0111539_10073522 Ga0111539_100735223 161
257 3300009098 Ga0105245_11708766 Ga0105245_117087661 161
258 3300009147 Ga0114129_11749524 Ga0114129_117495241 161
259 3300010375 Ga0105239_12827792 Ga0105239_128277921 161
260 3300013100 Ga0157373_10243430 Ga0157373_102434302 161
261 3300013100 Ga0157373_10899568 Ga0157373_108995681 161
262 3300013104 Ga0157370_10100439 Ga0157370_101004393 161
263 3300013307 Ga0157372_10450545 Ga0157372_104505452 161
264 3300013307 Ga0157372_10688403 Ga0157372_106884032 161
265 3300021388 Ga0213875_10002933 Ga0213875_100029339 161
266 3300025321 Ga0207656_10247420 Ga0207656_102474201 161
267 3300025904 Ga0207647_10076844 Ga0207647_100768442 161
268 3300025907 Ga0207645_10151657 Ga0207645_101516572 161
269 3300025909 Ga0207705_10037294 Ga0207705_100372941 161
270 3300025909 Ga0207705_10145573 Ga0207705_101455731 161
271 3300025909 Ga0207705_10292453 Ga0207705_102924532 161
272 3300025912 Ga0207707_10357712 Ga0207707_103577121 161
273 3300025913 Ga0207695_10264783 Ga0207695_102647832 161
274 3300025917 Ga0207660_10014391 Ga0207660_100143917 161
275 3300025917 Ga0207660_10084695 Ga0207660_100846952 161
276 3300025919 Ga0207657_10021169 Ga0207657_100211691 161
277 3300025919 Ga0207657_10290773 Ga0207657_102907732 161
278 3300025919 Ga0207657_10351443 Ga0207657_103514432 161
279 3300025921 Ga0207652_10064378 Ga0207652_100643782 161
280 3300025932 Ga0207690_10074289 Ga0207690_100742892 161
281 3300025932 Ga0207690_10695481 Ga0207690_106954812 161
282 3300025933 Ga0207706_10332239 Ga0207706_103322391 161
283 3300025949 Ga0207667_10218209 Ga0207667_102182092 161
284 3300025972 Ga0207668_10013664 Ga0207668_100136646 161
285 3300025981 Ga0207640_10281930 Ga0207640_102819302 161
286 3300026041 Ga0207639_10044857 Ga0207639_100448575 161
287 3300026067 Ga0207678_10289041 Ga0207678_102890412 161
288 3300026078 Ga0207702_10266271 Ga0207702_102662712 161
289 3300026142 Ga0207698_10007780 Ga0207698_100077803 161
290 3300028379 Ga0268266_10045071 Ga0268266_100450714 161
291 3300028380 Ga0268265_10349809 Ga0268265_103498092 161
292 3300030731 Ga0316177_1056283 Ga0316177_10562834 161
293 3300030745 Ga0316182_1046552 Ga0316182_10465522 161
294 3300031824 Ga0307413_10008267 Ga0307413_100082676 161
295 3300031852 Ga0307410_10002245 Ga0307410_100022455 161
296 3300031903 Ga0307407_10044947 Ga0307407_100449472 161
297 3300031903 Ga0307407_10053977 Ga0307407_100539774 161
298 3300031995 Ga0307409_100097121 Ga0307409_1000971214 161
299 3300031995 Ga0307409_100760560 Ga0307409_1007605602 161
300 3300032002 Ga0307416_100380876 Ga0307416_1003808761 161
301 3300032005 Ga0307411_10015399 Ga0307411_100153995 161
302 3300032005 Ga0307411_10046157 Ga0307411_100461572 161
303 3300032126 Ga0307415_101809542 Ga0307415_1018095421 161
304 3300035170 Ga0373943_0306284 Ga0373943_0306284_279_764 161
305 3300037312 Ga0395899_0104570 Ga0395899_0104570_1520_2005 161
306 3300037418 Ga0395900_0009569 Ga0395900_0009569_3887_4372 161
307 3300037466 Ga0395898_0035223 Ga0395898_0035223_3083_3568 161
308 3300037853 Ga0436364_0612163 Ga0436364_0612163_17633_18121 161
309 3300038443 Ga0395901_0074757 Ga0395901_0074757_1413_1898 161
310 3300042000 Ga0439437_011551 Ga0439437_011551_181_678 161
311 3300042127 Ga0450890_046300 Ga0450890_046300_58_543 161
312 3300042142 Ga0450905_001171 Ga0450905_001171_2460_2945 161
313 3300042144 Ga0450889_003955 Ga0450889_003955_464_949 161
314 3300042439 Ga0439464_0128918 Ga0439464_0128918_180_671 161
315 3300044694 Ga0466963_0084830 Ga0466963_0084830_331_816 161
316 3300044694 Ga0466963_0215513 Ga0466963_0215513_429_920 161
317 3300044719 Ga0466971_0042871 Ga0466971_0042871_1529_2014 161
318 3300044842 Ga0466957_0282879 Ga0466957_0282879_102_587 161
319 3300045836 Ga0466958_0175462 Ga0466958_0175462_225_710 161
320 3300045976 Ga0466967_0004849 Ga0466967_0004849_459_944 161
321 3300045976 Ga0466967_0929913 Ga0466967_0929913_191_682 161
322 3300050507 nmdc:mga05p37_1380512_c1 nmdc:mga05p37_1380512_c1_177_662 161
323 3300050508 nmdc:mga09592_885018_c1 nmdc:mga09592_885018_c1_175_660 161
324 3300050511 nmdc:mga08y16_94019_c1 nmdc:mga08y16_94019_c1_308_793 161
325 3300001976 JGI24752J21851_1022930 JGI24752J21851_10229302 162
326 3300001979 JGI24740J21852_10037431 JGI24740J21852_100374311 162
327 3300001989 JGI24739J22299_10027151 JGI24739J22299_100271512 162
328 3300001990 JGI24737J22298_10023111 JGI24737J22298_100231112 162
329 3300002067 JGI24735J21928_10036572 JGI24735J21928_100365722 162
330 3300002067 JGI24735J21928_10060810 JGI24735J21928_100608101 162
331 3300002075 JGI24738J21930_10010970 JGI24738J21930_100109702 162
332 3300005327 Ga0070658_10000154 Ga0070658_1000015433 162
333 3300005327 Ga0070658_10018026 Ga0070658_100180265 162
334 3300005327 Ga0070658_10372454 Ga0070658_103724542 162
335 3300005327 Ga0070658_10565327 Ga0070658_105653272 162
336 3300005327 Ga0070658_11413826 Ga0070658_114138261 162
337 3300005328 Ga0070676_10013713 Ga0070676_100137132 162
338 3300005329 Ga0070683_100070643 Ga0070683_1000706434 162
339 3300005330 Ga0070690_100347373 Ga0070690_1003473732 162
340 3300005331 Ga0070670_100063614 Ga0070670_1000636143 162
341 3300005331 Ga0070670_100132061 Ga0070670_1001320612 162
342 3300005335 Ga0070666_10104057 Ga0070666_101040573 162
343 3300005336 Ga0070680_100000647 Ga0070680_10000064719 162
344 3300005336 Ga0070680_100009749 Ga0070680_1000097494 162
345 3300005336 Ga0070680_100036669 Ga0070680_1000366694 162
346 3300005337 Ga0070682_100037224 Ga0070682_1000372244 162
347 3300005339 Ga0070660_100000284 Ga0070660_10000028429 162
348 3300005339 Ga0070660_100035753 Ga0070660_1000357533 162
349 3300005339 Ga0070660_100179233 Ga0070660_1001792333 162
350 3300005339 Ga0070660_100220678 Ga0070660_1002206782 162
351 3300005344 Ga0070661_100000195 Ga0070661_10000019533 162
352 3300005344 Ga0070661_100020477 Ga0070661_1000204772 162
353 3300005344 Ga0070661_100033985 Ga0070661_1000339852 162
354 3300005344 Ga0070661_100101419 Ga0070661_1001014193 162
355 3300005345 Ga0070692_10073944 Ga0070692_100739443 162
356 3300005355 Ga0070671_100029406 Ga0070671_1000294062 162
357 3300005355 Ga0070671_100077647 Ga0070671_1000776474 162
358 3300005355 Ga0070671_100475417 Ga0070671_1004754172 162
359 3300005356 Ga0070674_100381421 Ga0070674_1003814212 162
360 3300005366 Ga0070659_100002125 Ga0070659_1000021257 162
361 3300005366 Ga0070659_100043883 Ga0070659_1000438832 162
362 3300005366 Ga0070659_100341901 Ga0070659_1003419012 162
363 3300005367 Ga0070667_100011149 Ga0070667_1000111498 162
364 3300005435 Ga0070714_100054824 Ga0070714_1000548244 162
365 3300005435 Ga0070714_100135274 Ga0070714_1001352742 162
366 3300005440 Ga0070705_100196603 Ga0070705_1001966032 162
367 3300005455 Ga0070663_100047107 Ga0070663_1000471072 162
368 3300005455 Ga0070663_100171858 Ga0070663_1001718582 162
369 3300005457 Ga0070662_100000049 Ga0070662_10000004929 162
370 3300005457 Ga0070662_100046556 Ga0070662_1000465563 162
371 3300005457 Ga0070662_100658143 Ga0070662_1006581432 162
372 3300005458 Ga0070681_10025826 Ga0070681_100258266 162
373 3300005530 Ga0070679_100094978 Ga0070679_1000949782 162
374 3300005530 Ga0070679_100102138 Ga0070679_1001021385 162
375 3300005535 Ga0070684_100036973 Ga0070684_1000369736 162
376 3300005535 Ga0070684_100636332 Ga0070684_1006363322 162
377 3300005539 Ga0068853_100000098 Ga0068853_10000009833 162
378 3300005539 Ga0068853_100096279 Ga0068853_1000962793 162
379 3300005539 Ga0068853_100183563 Ga0068853_1001835633 162
380 3300005539 Ga0068853_100221042 Ga0068853_1002210422 162
381 3300005544 Ga0070686_101445201 Ga0070686_1014452011 162
382 3300005547 Ga0070693_100001644 Ga0070693_1000016447 162
383 3300005547 Ga0070693_100335088 Ga0070693_1003350882 162
384 3300005548 Ga0070665_101159651 Ga0070665_1011596511 162
385 3300005563 Ga0068855_100000546 Ga0068855_10000054612 162
386 3300005563 Ga0068855_100126744 Ga0068855_1001267441 162
387 3300005563 Ga0068855_100307820 Ga0068855_1003078202 162
388 3300005564 Ga0070664_100000162 Ga0070664_10000016228 162
389 3300005564 Ga0070664_100042269 Ga0070664_1000422694 162
390 3300005564 Ga0070664_100062965 Ga0070664_1000629655 162
391 3300005564 Ga0070664_100118431 Ga0070664_1001184313 162
392 3300005564 Ga0070664_100358890 Ga0070664_1003588902 162
393 3300005564 Ga0070664_100518833 Ga0070664_1005188332 162
394 3300005577 Ga0068857_100022989 Ga0068857_1000229893 162
395 3300005578 Ga0068854_100053370 Ga0068854_1000533702 162
396 3300005578 Ga0068854_100202155 Ga0068854_1002021553 162
397 3300005614 Ga0068856_100000788 Ga0068856_10000078828 162
398 3300005614 Ga0068856_100178869 Ga0068856_1001788692 162
399 3300005614 Ga0068856_100261896 Ga0068856_1002618961 162
400 3300005616 Ga0068852_100000425 Ga0068852_1000004257 162
401 3300005616 Ga0068852_100128993 Ga0068852_1001289933 162
402 3300005616 Ga0068852_100433160 Ga0068852_1004331602 162
403 3300005617 Ga0068859_100019422 Ga0068859_1000194223 162
404 3300005617 Ga0068859_100239021 Ga0068859_1002390213 162
405 3300005617 Ga0068859_100355861 Ga0068859_1003558612 162
406 3300005618 Ga0068864_100007271 Ga0068864_1000072714 162
407 3300005618 Ga0068864_100028517 Ga0068864_1000285175 162
408 3300005834 Ga0068851_10005074 Ga0068851_100050744 162
409 3300005840 Ga0068870_10152858 Ga0068870_101528582 162
410 3300005841 Ga0068863_100004752 Ga0068863_1000047525 162
411 3300005842 Ga0068858_100024957 Ga0068858_1000249573 162
412 3300005842 Ga0068858_100041422 Ga0068858_1000414226 162
413 3300005842 Ga0068858_100046718 Ga0068858_1000467184 162
414 3300005842 Ga0068858_100093331 Ga0068858_1000933313 162
415 3300005843 Ga0068860_100265893 Ga0068860_1002658932 162
416 3300005844 Ga0068862_100068984 Ga0068862_1000689843 162
417 3300005844 Ga0068862_100176040 Ga0068862_1001760403 162
418 3300005985 Ga0081539_10089260 Ga0081539_100892603 162
419 3300006237 Ga0097621_100029704 Ga0097621_1000297043 162
420 3300006237 Ga0097621_100030915 Ga0097621_1000309155 162
421 3300006237 Ga0097621_100119814 Ga0097621_1001198142 162
422 3300006358 Ga0068871_100089442 Ga0068871_1000894423 162
423 3300006358 Ga0068871_100111124 Ga0068871_1001111242 162
424 3300006931 Ga0097620_100019422 Ga0097620_1000194223 162
425 3300006931 Ga0097620_100239022 Ga0097620_1002390223 162
426 3300006931 Ga0097620_100355860 Ga0097620_1003558602 162
427 3300009011 Ga0105251_10040608 Ga0105251_100406082 162
428 3300009177 Ga0105248_10000544 Ga0105248_1000054429 162
429 3300009177 Ga0105248_10100816 Ga0105248_101008161 162
430 3300009177 Ga0105248_11757256 Ga0105248_117572561 162
431 3300009545 Ga0105237_10027692 Ga0105237_100276926 162
432 3300009551 Ga0105238_10766027 Ga0105238_107660272 162
433 3300010375 Ga0105239_11753282 Ga0105239_117532822 162
434 3300013100 Ga0157373_10013050 Ga0157373_100130504 162
435 3300013100 Ga0157373_10061013 Ga0157373_100610132 162
436 3300013100 Ga0157373_10065807 Ga0157373_100658072 162
437 3300013100 Ga0157373_10258306 Ga0157373_102583062 162
438 3300013100 Ga0157373_10354053 Ga0157373_103540532 162
439 3300013102 Ga0157371_10093453 Ga0157371_100934533 162
440 3300013102 Ga0157371_10100617 Ga0157371_101006173 162
441 3300013102 Ga0157371_10454352 Ga0157371_104543522 162
442 3300013104 Ga0157370_10062843 Ga0157370_100628432 162
443 3300013105 Ga0157369_10188289 Ga0157369_101882892 162
444 3300013105 Ga0157369_10196688 Ga0157369_101966883 162
445 3300013105 Ga0157369_10367306 Ga0157369_103673062 162
446 3300013297 Ga0157378_12088320 Ga0157378_120883201 162
447 3300013307 Ga0157372_10753210 Ga0157372_107532102 162
448 3300013307 Ga0157372_11005140 Ga0157372_110051402 162
449 3300013308 Ga0157375_11759056 Ga0157375_117590561 162
450 3300014325 Ga0163163_10000258 Ga0163163_1000025820 162
451 3300014968 Ga0157379_10002519 Ga0157379_1000251915 162
452 3300014968 Ga0157379_10409682 Ga0157379_104096822 162
453 3300025903 Ga0207680_10000459 Ga0207680_1000045916 162
454 3300025904 Ga0207647_10103700 Ga0207647_101037002 162
455 3300025904 Ga0207647_10128886 Ga0207647_101288862 162
456 3300025907 Ga0207645_10021237 Ga0207645_100212376 162
457 3300025909 Ga0207705_10000285 Ga0207705_1000028534 162
458 3300025909 Ga0207705_10050084 Ga0207705_100500842 162
459 3300025909 Ga0207705_10051681 Ga0207705_100516813 162
460 3300025909 Ga0207705_10223708 Ga0207705_102237082 162
461 3300025909 Ga0207705_10780373 Ga0207705_107803731 162
462 3300025909 Ga0207705_11064090 Ga0207705_110640901 162
463 3300025911 Ga0207654_10640290 Ga0207654_106402901 162
464 3300025912 Ga0207707_10028296 Ga0207707_100282962 162
465 3300025912 Ga0207707_10344982 Ga0207707_103449822 162
466 3300025917 Ga0207660_10001110 Ga0207660_100011106 162
467 3300025917 Ga0207660_10002477 Ga0207660_100024776 162
468 3300025917 Ga0207660_10118536 Ga0207660_101185362 162
469 3300025919 Ga0207657_10004068 Ga0207657_1000406812 162
470 3300025919 Ga0207657_10006395 Ga0207657_100063953 162
471 3300025919 Ga0207657_10016571 Ga0207657_100165718 162
472 3300025919 Ga0207657_10432864 Ga0207657_104328642 162
473 3300025919 Ga0207657_10691127 Ga0207657_106911272 162
474 3300025920 Ga0207649_10000128 Ga0207649_1000012836 162
475 3300025920 Ga0207649_10055604 Ga0207649_100556042 162
476 3300025920 Ga0207649_10209756 Ga0207649_102097562 162
477 3300025921 Ga0207652_10034765 Ga0207652_100347655 162
478 3300025925 Ga0207650_10039476 Ga0207650_100394764 162
479 3300025925 Ga0207650_10047969 Ga0207650_100479694 162
480 3300025929 Ga0207664_10018517 Ga0207664_100185176 162
481 3300025929 Ga0207664_10246461 Ga0207664_102464612 162
482 3300025931 Ga0207644_10006352 Ga0207644_100063525 162
483 3300025931 Ga0207644_10042700 Ga0207644_100427001 162
484 3300025932 Ga0207690_10000045 Ga0207690_1000004588 162
485 3300025932 Ga0207690_10040538 Ga0207690_100405384 162
486 3300025932 Ga0207690_10187305 Ga0207690_101873052 162
487 3300025932 Ga0207690_10336086 Ga0207690_103360862 162
488 3300025933 Ga0207706_10000660 Ga0207706_100006608 162
489 3300025933 Ga0207706_10076588 Ga0207706_100765882 162
490 3300025937 Ga0207669_10101407 Ga0207669_101014072 162
491 3300025941 Ga0207711_10003890 Ga0207711_100038908 162
492 3300025941 Ga0207711_10053392 Ga0207711_100533924 162
493 3300025944 Ga0207661_10000187 Ga0207661_1000018728 162
494 3300025945 Ga0207679_10000259 Ga0207679_100002599 162
495 3300025945 Ga0207679_10062130 Ga0207679_100621303 162
496 3300025945 Ga0207679_10093097 Ga0207679_100930972 162
497 3300025945 Ga0207679_10215949 Ga0207679_102159492 162
498 3300025949 Ga0207667_10165989 Ga0207667_101659893 162
499 3300025949 Ga0207667_10166160 Ga0207667_101661603 162
500 3300025972 Ga0207668_10058705 Ga0207668_100587054 162
501 3300025981 Ga0207640_10042310 Ga0207640_100423103 162
502 3300025981 Ga0207640_10215248 Ga0207640_102152483 162
503 3300025986 Ga0207658_10064845 Ga0207658_100648453 162
504 3300025986 Ga0207658_10505932 Ga0207658_105059322 162
505 3300025986 Ga0207658_10521919 Ga0207658_105219192 162
506 3300026035 Ga0207703_10011664 Ga0207703_100116644 162
507 3300026035 Ga0207703_10026274 Ga0207703_100262744 162
508 3300026035 Ga0207703_10045405 Ga0207703_100454053 162
509 3300026041 Ga0207639_10000434 Ga0207639_100004343 162
510 3300026041 Ga0207639_10049186 Ga0207639_100491864 162
511 3300026041 Ga0207639_10062995 Ga0207639_100629953 162
512 3300026041 Ga0207639_10158053 Ga0207639_101580532 162
513 3300026067 Ga0207678_10048206 Ga0207678_100482064 162
514 3300026067 Ga0207678_10069542 Ga0207678_100695423 162
515 3300026067 Ga0207678_10073812 Ga0207678_100738124 162
516 3300026067 Ga0207678_10420577 Ga0207678_104205772 162
517 3300026078 Ga0207702_10000324 Ga0207702_100003247 162
518 3300026078 Ga0207702_10007017 Ga0207702_100070174 162
519 3300026078 Ga0207702_10845692 Ga0207702_108456922 162
520 3300026078 Ga0207702_11602395 Ga0207702_116023951 162
521 3300026088 Ga0207641_10036947 Ga0207641_100369473 162
522 3300026089 Ga0207648_10256955 Ga0207648_102569553 162
523 3300026095 Ga0207676_10021255 Ga0207676_100212556 162
524 3300026095 Ga0207676_10175427 Ga0207676_101754272 162
525 3300026116 Ga0207674_10000344 Ga0207674_1000034439 162
526 3300026116 Ga0207674_10138942 Ga0207674_101389423 162
527 3300026142 Ga0207698_10000780 Ga0207698_1000078019 162
528 3300028379 Ga0268266_10021573 Ga0268266_100215733 162
529 3300028379 Ga0268266_11329334 Ga0268266_113293342 162
530 3300028380 Ga0268265_10034915 Ga0268265_100349155 162
531 3300028380 Ga0268265_10041746 Ga0268265_100417466 162
532 3300028380 Ga0268265_10104130 Ga0268265_101041302 162
533 3300028381 Ga0268264_10224410 Ga0268264_102244102 162
534 3300031548 Ga0307408_101131675 Ga0307408_1011316752 162
535 3300031852 Ga0307410_10276063 Ga0307410_102760632 162
536 3300032005 Ga0307411_10193385 Ga0307411_101933852 162
537 3300032126 Ga0307415_100822023 Ga0307415_1008220232 162
538 3300034816 Ga0373930_0058955 Ga0373930_0058955_157_645 162
539 3300035084 Ga0373928_0031955 Ga0373928_0031955_543_1031 162
540 3300035691 Ga0373931_0030764 Ga0373931_0030764_1378_1866 162
541 3300037312 Ga0395899_0142199 Ga0395899_0142199_639_1127 162
542 3300037312 Ga0395899_0745361 Ga0395899_0745361_49_537 162
543 3300037418 Ga0395900_0003660 Ga0395900_0003660_13139_13627 162
544 3300037418 Ga0395900_0102061 Ga0395900_0102061_963_1451 162
545 3300037418 Ga0395900_0144085 Ga0395900_0144085_1370_1858 162
546 3300037418 Ga0395900_0187187 Ga0395900_0187187_1129_1617 162
547 3300037418 Ga0395900_0192867 Ga0395900_0192867_592_1080 162
548 3300037418 Ga0395900_0342090 Ga0395900_0342090_769_1266 162
549 3300037418 Ga0395900_0395336 Ga0395900_0395336_840_1328 162
550 3300037418 Ga0395900_0471900 Ga0395900_0471900_282_770 162
551 3300037418 Ga0395900_0820433 Ga0395900_0820433_67_555 162
552 3300037466 Ga0395898_0021463 Ga0395898_0021463_3779_4267 162
553 3300037466 Ga0395898_0166439 Ga0395898_0166439_251_739 162
554 3300037466 Ga0395898_0238194 Ga0395898_0238194_138_626 162
555 3300037466 Ga0395898_0511338 Ga0395898_0511338_498_986 162
556 3300037471 Ga0395905_0016954 Ga0395905_0016954_6056_6544 162
557 3300037471 Ga0395905_0017316 Ga0395905_0017316_2472_2963 162
558 3300037471 Ga0395905_0021418 Ga0395905_0021418_1998_2486 162
559 3300037471 Ga0395905_0179005 Ga0395905_0179005_533_1021 162
560 3300037471 Ga0395905_0421818 Ga0395905_0421818_492_989 162
561 3300038443 Ga0395901_0000295 Ga0395901_0000295_40644_41132 162
562 3300038443 Ga0395901_0005146 Ga0395901_0005146_10433_10921 162
563 3300038443 Ga0395901_0066170 Ga0395901_0066170_417_905 162
564 3300038443 Ga0395901_0113716 Ga0395901_0113716_1496_1984 162
565 3300038443 Ga0395901_0263455 Ga0395901_0263455_196_693 162
566 3300038443 Ga0395901_1397927 Ga0395901_1397927_142_630 162
567 3300041501 Ga0451845_0012319 Ga0451845_0012319_68_571 162
568 3300042439 Ga0439464_0000922 Ga0439464_0000922_2604_3092 162
569 3300044694 Ga0466963_0006667 Ga0466963_0006667_1083_1571 162
570 3300044694 Ga0466963_0425517 Ga0466963_0425517_413_901 162
571 3300044719 Ga0466971_0247237 Ga0466971_0247237_217_705 162
572 3300044842 Ga0466957_0002685 Ga0466957_0002685_5697_6185 162
573 3300044842 Ga0466957_0028098 Ga0466957_0028098_1567_2055 162
574 3300044842 Ga0466957_0385014 Ga0466957_0385014_101_589 162
575 3300045976 Ga0466967_0000381 Ga0466967_0000381_2875_3363 162
576 3300045976 Ga0466967_0100305 Ga0466967_0100305_1022_1510 162
577 3300045976 Ga0466967_0282264 Ga0466967_0282264_913_1401 162
578 3300045976 Ga0466967_0361986 Ga0466967_0361986_303_791 162
579 3300045976 Ga0466967_1559463 Ga0466967_1559463_92_580 162
580 3300046525 Ga0495663_0016097 Ga0495663_0016097_1596_2087 162
581 3300046539 Ga0495621_0193384 Ga0495621_0193384_81_572 162
582 3300046558 Ga0495633_0316713 Ga0495633_0316713_204_695 162
583 3300046684 Ga0495669_0040797 Ga0495669_0040797_603_1094 162
584 3300048903 Ga0496100_0038046 Ga0496100_0038046_834_1325 162
585 3300048903 Ga0496100_0219629 Ga0496100_0219629_165_653 162
586 3300048904 Ga0496101_1034522 Ga0496101_1034522_71_562 162
587 3300048904 Ga0496101_1245483 Ga0496101_1245483_68_556 162
588 3300048905 Ga0496102_0223431 Ga0496102_0223431_26_514 162
589 3300048906 Ga0496103_0077015 Ga0496103_0077015_740_1228 162
590 3300048907 Ga0496104_0245469 Ga0496104_0245469_982_1470 162
591 3300048909 Ga0496106_0032636 Ga0496106_0032636_2742_3230 162
592 3300048910 Ga0496107_0482313 Ga0496107_0482313_241_729 162
593 3300048910 Ga0496107_0496365 Ga0496107_0496365_348_839 162
594 3300048911 Ga0496108_0010742 Ga0496108_0010742_6140_6628 162
595 3300048912 Ga0496109_0205886 Ga0496109_0205886_58_546 162
596 3300048913 Ga0496110_0036846 Ga0496110_0036846_2682_3170 162
597 3300048914 Ga0496111_0003669 Ga0496111_0003669_4780_5268 162
598 3300048915 Ga0496112_0002414 Ga0496112_0002414_7022_7510 162
599 3300048915 Ga0496112_0064162 Ga0496112_0064162_1275_1763 162
600 3300048917 Ga0496114_0033866 Ga0496114_0033866_2996_3487 162
601 3300048918 Ga0496115_0026126 Ga0496115_0026126_379_870 162
602 3300048929 Ga0496126_0931915 Ga0496126_0931915_151_642 162
603 3300049586 Ga0501070_0872986 Ga0501070_0872986_78_566 162
604 3300001904 JGI24736J21556_1010212 JGI24736J21556_10102122 163
605 3300001915 JGI24741J21665_1013179 JGI24741J21665_10131792 163
606 3300001978 JGI24747J21853_1003964 JGI24747J21853_10039642 163
607 3300001979 JGI24740J21852_10001610 JGI24740J21852_100016102 163
608 3300001989 JGI24739J22299_10081330 JGI24739J22299_100813302 163
609 3300001990 JGI24737J22298_10010753 JGI24737J22298_100107532 163
610 3300001990 JGI24737J22298_10011933 JGI24737J22298_100119333 163
611 3300001990 JGI24737J22298_10017178 JGI24737J22298_100171782 163
612 3300001990 JGI24737J22298_10091450 JGI24737J22298_100914502 163
613 3300001990 JGI24737J22298_10133509 JGI24737J22298_101335092 163
614 3300001991 JGI24743J22301_10003208 JGI24743J22301_100032082 163
615 3300002067 JGI24735J21928_10001242 JGI24735J21928_100012429 163
616 3300002067 JGI24735J21928_10022584 JGI24735J21928_100225842 163
617 3300002067 JGI24735J21928_10034548 JGI24735J21928_100345482 163
618 3300002073 JGI24745J21846_1005838 JGI24745J21846_10058382 163
619 3300002075 JGI24738J21930_10065341 JGI24738J21930_100653412 163
620 3300002155 JGI24033J26618_1011448 JGI24033J26618_10114482 163
621 3300002239 JGI24034J26672_10006369 JGI24034J26672_100063692 163
622 3300005290 Ga0065712_10427053 Ga0065712_104270532 163
623 3300005293 Ga0065715_10022198 Ga0065715_100221982 163
624 3300005293 Ga0065715_10048310 Ga0065715_100483102 163
625 3300005293 Ga0065715_10662080 Ga0065715_106620801 163
626 3300005327 Ga0070658_10006912 Ga0070658_1000691210 163
627 3300005327 Ga0070658_10007616 Ga0070658_100076167 163
628 3300005327 Ga0070658_10014349 Ga0070658_100143493 163
629 3300005327 Ga0070658_10031224 Ga0070658_100312243 163
630 3300005327 Ga0070658_10065514 Ga0070658_100655144 163
631 3300005327 Ga0070658_10104324 Ga0070658_101043242 163
632 3300005327 Ga0070658_10116223 Ga0070658_101162233 163
633 3300005327 Ga0070658_10300052 Ga0070658_103000522 163
634 3300005327 Ga0070658_10332441 Ga0070658_103324412 163
635 3300005327 Ga0070658_10401122 Ga0070658_104011222 163
636 3300005327 Ga0070658_10486022 Ga0070658_104860221 163
637 3300005328 Ga0070676_10137099 Ga0070676_101370992 163
638 3300005328 Ga0070676_10253127 Ga0070676_102531272 163
639 3300005328 Ga0070676_10437416 Ga0070676_104374161 163
640 3300005328 Ga0070676_11038355 Ga0070676_110383551 163
641 3300005329 Ga0070683_100015278 Ga0070683_1000152783 163
642 3300005329 Ga0070683_100279139 Ga0070683_1002791392 163
643 3300005330 Ga0070690_100072043 Ga0070690_1000720434 163
644 3300005331 Ga0070670_100015694 Ga0070670_1000156945 163
645 3300005331 Ga0070670_100025000 Ga0070670_1000250005 163
646 3300005331 Ga0070670_100163672 Ga0070670_1001636722 163
647 3300005331 Ga0070670_100212640 Ga0070670_1002126401 163
648 3300005331 Ga0070670_100312968 Ga0070670_1003129682 163
649 3300005333 Ga0070677_10027263 Ga0070677_100272633 163
650 3300005333 Ga0070677_10035868 Ga0070677_100358682 163
651 3300005333 Ga0070677_10044301 Ga0070677_100443012 163
652 3300005334 Ga0068869_100185828 Ga0068869_1001858282 163
653 3300005335 Ga0070666_10004574 Ga0070666_100045745 163
654 3300005335 Ga0070666_10010482 Ga0070666_100104822 163
655 3300005335 Ga0070666_10068344 Ga0070666_100683442 163
656 3300005335 Ga0070666_10135122 Ga0070666_101351223 163
657 3300005335 Ga0070666_10343047 Ga0070666_103430471 163
658 3300005335 Ga0070666_10470227 Ga0070666_104702272 163
659 3300005336 Ga0070680_100000628 Ga0070680_10000062816 163
660 3300005338 Ga0068868_100004431 Ga0068868_10000443110 163
661 3300005338 Ga0068868_100032833 Ga0068868_1000328335 163
662 3300005338 Ga0068868_101141153 Ga0068868_1011411531 163
663 3300005338 Ga0068868_101272016 Ga0068868_1012720161 163
664 3300005338 Ga0068868_101272017 Ga0068868_1012720171 163
665 3300005339 Ga0070660_100003772 Ga0070660_1000037723 163
666 3300005339 Ga0070660_100010071 Ga0070660_1000100713 163
667 3300005339 Ga0070660_100013141 Ga0070660_1000131417 163
668 3300005339 Ga0070660_100015745 Ga0070660_1000157456 163
669 3300005339 Ga0070660_100035397 Ga0070660_1000353976 163
670 3300005339 Ga0070660_100041543 Ga0070660_1000415432 163
671 3300005339 Ga0070660_100395978 Ga0070660_1003959782 163
672 3300005339 Ga0070660_100399442 Ga0070660_1003994422 163
673 3300005339 Ga0070660_100660189 Ga0070660_1006601892 163
674 3300005339 Ga0070660_100709214 Ga0070660_1007092142 163
675 3300005343 Ga0070687_100270074 Ga0070687_1002700741 163
676 3300005343 Ga0070687_100684188 Ga0070687_1006841882 163
677 3300005344 Ga0070661_100020750 Ga0070661_1000207505 163
678 3300005344 Ga0070661_100024157 Ga0070661_1000241574 163
679 3300005344 Ga0070661_100095126 Ga0070661_1000951263 163
680 3300005344 Ga0070661_100338097 Ga0070661_1003380972 163
681 3300005344 Ga0070661_100437589 Ga0070661_1004375891 163
682 3300005344 Ga0070661_100904404 Ga0070661_1009044041 163
683 3300005345 Ga0070692_10028975 Ga0070692_100289753 163
684 3300005345 Ga0070692_10212899 Ga0070692_102128992 163
685 3300005347 Ga0070668_100150543 Ga0070668_1001505433 163
686 3300005347 Ga0070668_101033471 Ga0070668_1010334712 163
687 3300005347 Ga0070668_101573519 Ga0070668_1015735191 163
688 3300005353 Ga0070669_100046758 Ga0070669_1000467585 163
689 3300005353 Ga0070669_100122427 Ga0070669_1001224273 163
690 3300005353 Ga0070669_100591849 Ga0070669_1005918492 163
691 3300005353 Ga0070669_100904251 Ga0070669_1009042512 163
692 3300005353 Ga0070669_101088612 Ga0070669_1010886121 163
693 3300005354 Ga0070675_100015199 Ga0070675_1000151995 163
694 3300005354 Ga0070675_100045875 Ga0070675_1000458755 163
695 3300005354 Ga0070675_100156310 Ga0070675_1001563103 163
696 3300005354 Ga0070675_100183220 Ga0070675_1001832202 163
697 3300005354 Ga0070675_100247955 Ga0070675_1002479552 163
698 3300005354 Ga0070675_100551124 Ga0070675_1005511242 163
699 3300005354 Ga0070675_100957301 Ga0070675_1009573012 163
700 3300005355 Ga0070671_100003815 Ga0070671_10000381513 163
701 3300005355 Ga0070671_100004097 Ga0070671_1000040973 163
702 3300005355 Ga0070671_100004402 Ga0070671_1000044023 163
703 3300005355 Ga0070671_100028487 Ga0070671_1000284874 163
704 3300005355 Ga0070671_100043806 Ga0070671_1000438064 163
705 3300005355 Ga0070671_100111200 Ga0070671_1001112002 163
706 3300005355 Ga0070671_100181039 Ga0070671_1001810392 163
707 3300005355 Ga0070671_100238165 Ga0070671_1002381652 163
708 3300005355 Ga0070671_100340850 Ga0070671_1003408502 163
709 3300005355 Ga0070671_100363668 Ga0070671_1003636682 163
710 3300005355 Ga0070671_100440675 Ga0070671_1004406752 163
711 3300005355 Ga0070671_100641918 Ga0070671_1006419181 163
712 3300005356 Ga0070674_100008681 Ga0070674_1000086817 163
713 3300005356 Ga0070674_100039115 Ga0070674_1000391153 163
714 3300005356 Ga0070674_100049403 Ga0070674_1000494032 163
715 3300005356 Ga0070674_100536021 Ga0070674_1005360212 163
716 3300005364 Ga0070673_100018613 Ga0070673_1000186135 163
717 3300005364 Ga0070673_100019179 Ga0070673_1000191792 163
718 3300005364 Ga0070673_100024623 Ga0070673_1000246235 163
719 3300005364 Ga0070673_100025930 Ga0070673_1000259307 163
720 3300005364 Ga0070673_100070621 Ga0070673_1000706212 163
721 3300005364 Ga0070673_100147342 Ga0070673_1001473423 163
722 3300005364 Ga0070673_100321249 Ga0070673_1003212492 163
723 3300005364 Ga0070673_101010394 Ga0070673_1010103941 163
724 3300005366 Ga0070659_100003347 Ga0070659_1000033476 163
725 3300005366 Ga0070659_100005974 Ga0070659_1000059746 163
726 3300005366 Ga0070659_100030702 Ga0070659_1000307025 163
727 3300005366 Ga0070659_100035537 Ga0070659_1000355372 163
728 3300005366 Ga0070659_100052732 Ga0070659_1000527324 163
729 3300005366 Ga0070659_100108950 Ga0070659_1001089502 163
730 3300005366 Ga0070659_100125137 Ga0070659_1001251372 163
731 3300005366 Ga0070659_100148952 Ga0070659_1001489522 163
732 3300005366 Ga0070659_100254489 Ga0070659_1002544892 163
733 3300005366 Ga0070659_100340224 Ga0070659_1003402242 163
734 3300005366 Ga0070659_100411701 Ga0070659_1004117012 163
735 3300005366 Ga0070659_100446074 Ga0070659_1004460742 163
736 3300005367 Ga0070667_100007016 Ga0070667_10000701610 163
737 3300005367 Ga0070667_100016604 Ga0070667_1000166047 163
738 3300005367 Ga0070667_100022481 Ga0070667_1000224816 163
739 3300005367 Ga0070667_100043386 Ga0070667_1000433864 163
740 3300005367 Ga0070667_100149042 Ga0070667_1001490422 163
741 3300005367 Ga0070667_100198696 Ga0070667_1001986962 163
742 3300005367 Ga0070667_100237995 Ga0070667_1002379951 163
743 3300005367 Ga0070667_100263655 Ga0070667_1002636552 163
744 3300005367 Ga0070667_100824342 Ga0070667_1008243422 163
745 3300005367 Ga0070667_101234963 Ga0070667_1012349631 163
746 3300005434 Ga0070709_10037136 Ga0070709_100371364 163
747 3300005435 Ga0070714_100031841 Ga0070714_1000318415 163
748 3300005435 Ga0070714_100046761 Ga0070714_1000467614 163
749 3300005435 Ga0070714_100106101 Ga0070714_1001061012 163
750 3300005435 Ga0070714_100335657 Ga0070714_1003356572 163
751 3300005435 Ga0070714_100814473 Ga0070714_1008144732 163
752 3300005435 Ga0070714_101385422 Ga0070714_1013854222 163
753 3300005436 Ga0070713_100014363 Ga0070713_1000143635 163
754 3300005436 Ga0070713_100355619 Ga0070713_1003556192 163
755 3300005436 Ga0070713_100726083 Ga0070713_1007260831 163
756 3300005438 Ga0070701_10245048 Ga0070701_102450482 163
757 3300005440 Ga0070705_101188271 Ga0070705_1011882711 163
758 3300005444 Ga0070694_101041799 Ga0070694_1010417991 163
759 3300005445 Ga0070708_101014853 Ga0070708_1010148532 163
760 3300005455 Ga0070663_100000199 Ga0070663_10000019929 163
761 3300005455 Ga0070663_100051792 Ga0070663_1000517924 163
762 3300005455 Ga0070663_100071562 Ga0070663_1000715622 163
763 3300005455 Ga0070663_100082163 Ga0070663_1000821633 163
764 3300005455 Ga0070663_100099714 Ga0070663_1000997142 163
765 3300005455 Ga0070663_100107220 Ga0070663_1001072204 163
766 3300005455 Ga0070663_100354069 Ga0070663_1003540692 163
767 3300005456 Ga0070678_100001565 Ga0070678_1000015656 163
768 3300005456 Ga0070678_100008600 Ga0070678_1000086003 163
769 3300005456 Ga0070678_100019238 Ga0070678_1000192385 163
770 3300005456 Ga0070678_100027353 Ga0070678_1000273532 163
771 3300005456 Ga0070678_100044842 Ga0070678_1000448421 163
772 3300005456 Ga0070678_100053056 Ga0070678_1000530563 163
773 3300005456 Ga0070678_100083643 Ga0070678_1000836433 163
774 3300005456 Ga0070678_100608282 Ga0070678_1006082821 163
775 3300005457 Ga0070662_100005871 Ga0070662_1000058715 163
776 3300005457 Ga0070662_100027358 Ga0070662_1000273584 163
777 3300005457 Ga0070662_100047746 Ga0070662_1000477463 163
778 3300005457 Ga0070662_100048090 Ga0070662_1000480905 163
779 3300005457 Ga0070662_100090223 Ga0070662_1000902232 163
780 3300005457 Ga0070662_100090904 Ga0070662_1000909043 163
781 3300005457 Ga0070662_100103914 Ga0070662_1001039142 163
782 3300005457 Ga0070662_100132815 Ga0070662_1001328152 163
783 3300005457 Ga0070662_100370091 Ga0070662_1003700911 163
784 3300005457 Ga0070662_100875406 Ga0070662_1008754062 163
785 3300005458 Ga0070681_10800030 Ga0070681_108000301 163
786 3300005458 Ga0070681_11349937 Ga0070681_113499372 163
787 3300005459 Ga0068867_100029493 Ga0068867_1000294932 163
788 3300005459 Ga0068867_100058181 Ga0068867_1000581812 163
789 3300005459 Ga0068867_100068890 Ga0068867_1000688904 163
790 3300005459 Ga0068867_100403000 Ga0068867_1004030002 163
791 3300005459 Ga0068867_101208085 Ga0068867_1012080851 163
792 3300005530 Ga0070679_100005648 Ga0070679_1000056483 163
793 3300005539 Ga0068853_100048436 Ga0068853_1000484364 163
794 3300005539 Ga0068853_100066503 Ga0068853_1000665035 163
795 3300005539 Ga0068853_100143516 Ga0068853_1001435161 163
796 3300005539 Ga0068853_100304055 Ga0068853_1003040552 163
797 3300005539 Ga0068853_100545494 Ga0068853_1005454942 163
798 3300005539 Ga0068853_101027378 Ga0068853_1010273782 163
799 3300005543 Ga0070672_100006310 Ga0070672_1000063108 163
800 3300005543 Ga0070672_100011514 Ga0070672_1000115144 163
801 3300005543 Ga0070672_100067546 Ga0070672_1000675463 163
802 3300005543 Ga0070672_100154815 Ga0070672_1001548152 163
803 3300005543 Ga0070672_100167953 Ga0070672_1001679532 163
804 3300005543 Ga0070672_100176369 Ga0070672_1001763692 163
805 3300005543 Ga0070672_100328221 Ga0070672_1003282213 163
806 3300005543 Ga0070672_100435920 Ga0070672_1004359202 163
807 3300005544 Ga0070686_100504144 Ga0070686_1005041442 163
808 3300005545 Ga0070695_100109345 Ga0070695_1001093452 163
809 3300005547 Ga0070693_100332780 Ga0070693_1003327802 163
810 3300005547 Ga0070693_100365932 Ga0070693_1003659321 163
811 3300005548 Ga0070665_100006682 Ga0070665_1000066827 163
812 3300005548 Ga0070665_100009494 Ga0070665_1000094949 163
813 3300005548 Ga0070665_100068148 Ga0070665_1000681482 163
814 3300005548 Ga0070665_100069005 Ga0070665_1000690052 163
815 3300005548 Ga0070665_100313008 Ga0070665_1003130082 163
816 3300005548 Ga0070665_100690446 Ga0070665_1006904462 163
817 3300005563 Ga0068855_100018927 Ga0068855_1000189278 163
818 3300005563 Ga0068855_100169119 Ga0068855_1001691194 163
819 3300005563 Ga0068855_100216320 Ga0068855_1002163202 163
820 3300005563 Ga0068855_100228774 Ga0068855_1002287742 163
821 3300005563 Ga0068855_100307823 Ga0068855_1003078232 163
822 3300005563 Ga0068855_100660662 Ga0068855_1006606622 163
823 3300005563 Ga0068855_100680617 Ga0068855_1006806172 163
824 3300005563 Ga0068855_101480917 Ga0068855_1014809171 163
825 3300005564 Ga0070664_100002252 Ga0070664_10000225215 163
826 3300005564 Ga0070664_100003267 Ga0070664_1000032678 163
827 3300005564 Ga0070664_100017302 Ga0070664_1000173023 163
828 3300005564 Ga0070664_100025951 Ga0070664_1000259516 163
829 3300005564 Ga0070664_100033729 Ga0070664_1000337296 163
830 3300005564 Ga0070664_100042227 Ga0070664_1000422272 163
831 3300005564 Ga0070664_100467171 Ga0070664_1004671712 163
832 3300005564 Ga0070664_100711728 Ga0070664_1007117282 163
833 3300005564 Ga0070664_100715172 Ga0070664_1007151722 163
834 3300005577 Ga0068857_100015202 Ga0068857_1000152024 163
835 3300005577 Ga0068857_100088253 Ga0068857_1000882534 163
836 3300005577 Ga0068857_100972997 Ga0068857_1009729972 163
837 3300005578 Ga0068854_100029180 Ga0068854_1000291803 163
838 3300005578 Ga0068854_100061906 Ga0068854_1000619062 163
839 3300005578 Ga0068854_100169973 Ga0068854_1001699733 163
840 3300005578 Ga0068854_100278998 Ga0068854_1002789982 163
841 3300005578 Ga0068854_100288064 Ga0068854_1002880642 163
842 3300005614 Ga0068856_100019423 Ga0068856_1000194235 163
843 3300005614 Ga0068856_100038942 Ga0068856_1000389425 163
844 3300005614 Ga0068856_100395348 Ga0068856_1003953482 163
845 3300005614 Ga0068856_100438398 Ga0068856_1004383982 163
846 3300005614 Ga0068856_100831213 Ga0068856_1008312131 163
847 3300005616 Ga0068852_100012952 Ga0068852_1000129521 163
848 3300005616 Ga0068852_100018142 Ga0068852_1000181425 163
849 3300005616 Ga0068852_100021306 Ga0068852_1000213061 163
850 3300005616 Ga0068852_100021530 Ga0068852_1000215305 163
851 3300005616 Ga0068852_100043318 Ga0068852_1000433185 163
852 3300005616 Ga0068852_100076587 Ga0068852_1000765872 163
853 3300005616 Ga0068852_100123443 Ga0068852_1001234432 163
854 3300005616 Ga0068852_100146505 Ga0068852_1001465053 163
855 3300005616 Ga0068852_100190841 Ga0068852_1001908411 163
856 3300005616 Ga0068852_100397655 Ga0068852_1003976552 163
857 3300005616 Ga0068852_101173406 Ga0068852_1011734061 163
858 3300005616 Ga0068852_101767622 Ga0068852_1017676221 163
859 3300005617 Ga0068859_100021440 Ga0068859_1000214408 163
860 3300005617 Ga0068859_100083461 Ga0068859_1000834612 163
861 3300005617 Ga0068859_100412879 Ga0068859_1004128792 163
862 3300005618 Ga0068864_100003538 Ga0068864_10000353812 163
863 3300005618 Ga0068864_100028619 Ga0068864_1000286197 163
864 3300005618 Ga0068864_100035617 Ga0068864_1000356174 163
865 3300005618 Ga0068864_100370074 Ga0068864_1003700741 163
866 3300005718 Ga0068866_10001322 Ga0068866_100013228 163
867 3300005718 Ga0068866_10046918 Ga0068866_100469183 163
868 3300005718 Ga0068866_10557503 Ga0068866_105575032 163
869 3300005834 Ga0068851_10024522 Ga0068851_100245225 163
870 3300005834 Ga0068851_10032665 Ga0068851_100326653 163
871 3300005834 Ga0068851_10092612 Ga0068851_100926122 163
872 3300005834 Ga0068851_10180490 Ga0068851_101804901 163
873 3300005834 Ga0068851_10199181 Ga0068851_101991812 163
874 3300005840 Ga0068870_10272636 Ga0068870_102726362 163
875 3300005841 Ga0068863_100002169 Ga0068863_10000216911 163
876 3300005841 Ga0068863_100033633 Ga0068863_1000336333 163
877 3300005841 Ga0068863_100080700 Ga0068863_1000807005 163
878 3300005841 Ga0068863_100097222 Ga0068863_1000972224 163
879 3300005842 Ga0068858_100002274 Ga0068858_10000227422 163
880 3300005842 Ga0068858_100007735 Ga0068858_1000077355 163
881 3300005842 Ga0068858_100026952 Ga0068858_1000269525 163
882 3300005842 Ga0068858_100350358 Ga0068858_1003503581 163
883 3300005843 Ga0068860_100012870 Ga0068860_1000128708 163
884 3300005843 Ga0068860_100072773 Ga0068860_1000727732 163
885 3300005843 Ga0068860_100131338 Ga0068860_1001313382 163
886 3300005843 Ga0068860_100522093 Ga0068860_1005220932 163
887 3300005844 Ga0068862_100003518 Ga0068862_1000035189 163
888 3300005844 Ga0068862_100235407 Ga0068862_1002354071 163
889 3300005844 Ga0068862_100738834 Ga0068862_1007388342 163
890 3300005844 Ga0068862_100760447 Ga0068862_1007604472 163
891 3300005844 Ga0068862_101553891 Ga0068862_1015538911 163
892 3300005985 Ga0081539_10044314 Ga0081539_100443144 163
893 3300006028 Ga0070717_10014056 Ga0070717_100140561 163
894 3300006028 Ga0070717_10070938 Ga0070717_100709384 163
895 3300006163 Ga0070715_10156354 Ga0070715_101563542 163
896 3300006173 Ga0070716_100415192 Ga0070716_1004151922 163
897 3300006237 Ga0097621_100002557 Ga0097621_1000025578 163
898 3300006237 Ga0097621_100088002 Ga0097621_1000880023 163
899 3300006237 Ga0097621_100109448 Ga0097621_1001094483 163
900 3300006237 Ga0097621_100145826 Ga0097621_1001458262 163
901 3300006237 Ga0097621_100247723 Ga0097621_1002477232 163
902 3300006237 Ga0097621_100442163 Ga0097621_1004421632 163
903 3300006358 Ga0068871_100016378 Ga0068871_1000163782 163
904 3300006358 Ga0068871_100100772 Ga0068871_1001007722 163
905 3300006358 Ga0068871_100142090 Ga0068871_1001420903 163
906 3300006358 Ga0068871_100162840 Ga0068871_1001628403 163
907 3300006358 Ga0068871_100248210 Ga0068871_1002482103 163
908 3300006881 Ga0068865_100024575 Ga0068865_1000245754 163
909 3300006881 Ga0068865_100035074 Ga0068865_1000350743 163
910 3300006881 Ga0068865_100406903 Ga0068865_1004069032 163
911 3300006931 Ga0097620_100021440 Ga0097620_1000214403 163
912 3300006931 Ga0097620_100083456 Ga0097620_1000834562 163
913 3300006931 Ga0097620_100412932 Ga0097620_1004129322 163
914 3300009093 Ga0105240_10086368 Ga0105240_100863684 163
915 3300009093 Ga0105240_10172916 Ga0105240_101729162 163
916 3300009093 Ga0105240_10432570 Ga0105240_104325702 163
917 3300009093 Ga0105240_11624515 Ga0105240_116245152 163
918 3300009098 Ga0105245_10006243 Ga0105245_100062438 163
919 3300009098 Ga0105245_10091382 Ga0105245_100913825 163
920 3300009098 Ga0105245_10305837 Ga0105245_103058372 163
921 3300009098 Ga0105245_10570128 Ga0105245_105701282 163
922 3300009098 Ga0105245_11454078 Ga0105245_114540781 163
923 3300009148 Ga0105243_10114402 Ga0105243_101144023 163
924 3300009148 Ga0105243_10115079 Ga0105243_101150793 163
925 3300009174 Ga0105241_10335543 Ga0105241_103355431 163
926 3300009174 Ga0105241_10753390 Ga0105241_107533902 163
927 3300009176 Ga0105242_10003633 Ga0105242_1000363310 163
928 3300009176 Ga0105242_12336145 Ga0105242_123361451 163
929 3300009177 Ga0105248_10002910 Ga0105248_100029109 163
930 3300009177 Ga0105248_10023560 Ga0105248_100235606 163
931 3300009177 Ga0105248_10033496 Ga0105248_100334961 163
932 3300009177 Ga0105248_10033950 Ga0105248_100339505 163
933 3300009177 Ga0105248_10046730 Ga0105248_100467303 163
934 3300009177 Ga0105248_10069459 Ga0105248_100694593 163
935 3300009177 Ga0105248_10461391 Ga0105248_104613912 163
936 3300009177 Ga0105248_10603561 Ga0105248_106035612 163
937 3300009177 Ga0105248_10622774 Ga0105248_106227742 163
938 3300009177 Ga0105248_10995290 Ga0105248_109952902 163
939 3300009545 Ga0105237_10030869 Ga0105237_100308697 163
940 3300009545 Ga0105237_10196201 Ga0105237_101962012 163
941 3300009551 Ga0105238_10020220 Ga0105238_100202206 163
942 3300009551 Ga0105238_10056843 Ga0105238_100568433 163
943 3300009551 Ga0105238_10729826 Ga0105238_107298262 163
944 3300009551 Ga0105238_10793546 Ga0105238_107935462 163
945 3300009551 Ga0105238_11017123 Ga0105238_110171231 163
946 3300009553 Ga0105249_10075864 Ga0105249_100758644 163
947 3300009553 Ga0105249_10851861 Ga0105249_108518611 163
948 3300009553 Ga0105249_11089465 Ga0105249_110894652 163
949 3300010375 Ga0105239_10028632 Ga0105239_100286327 163
950 3300010375 Ga0105239_10138312 Ga0105239_101383123 163
951 3300010375 Ga0105239_10219152 Ga0105239_102191523 163
952 3300010375 Ga0105239_11899317 Ga0105239_118993172 163
953 3300011119 Ga0105246_10033959 Ga0105246_100339592 163
954 3300011119 Ga0105246_10089243 Ga0105246_100892432 163
955 3300013100 Ga0157373_10049210 Ga0157373_100492104 163
956 3300013100 Ga0157373_10079062 Ga0157373_100790622 163
957 3300013100 Ga0157373_10228211 Ga0157373_102282112 163
958 3300013100 Ga0157373_10677519 Ga0157373_106775191 163
959 3300013100 Ga0157373_10717286 Ga0157373_107172862 163
960 3300013102 Ga0157371_10064799 Ga0157371_100647992 163
961 3300013102 Ga0157371_10084297 Ga0157371_100842973 163
962 3300013102 Ga0157371_10094166 Ga0157371_100941663 163
963 3300013102 Ga0157371_10206480 Ga0157371_102064802 163
964 3300013102 Ga0157371_10261486 Ga0157371_102614862 163
965 3300013102 Ga0157371_11217601 Ga0157371_112176011 163
966 3300013104 Ga0157370_10012302 Ga0157370_100123024 163
967 3300013104 Ga0157370_10111197 Ga0157370_101111974 163
968 3300013104 Ga0157370_10137027 Ga0157370_101370273 163
969 3300013104 Ga0157370_10232235 Ga0157370_102322353 163
970 3300013104 Ga0157370_10251069 Ga0157370_102510692 163
971 3300013104 Ga0157370_10576520 Ga0157370_105765201 163
972 3300013104 Ga0157370_10699000 Ga0157370_106990002 163
973 3300013104 Ga0157370_10814105 Ga0157370_108141051 163
974 3300013104 Ga0157370_11273494 Ga0157370_112734941 163
975 3300013105 Ga0157369_10002495 Ga0157369_100024956 163
976 3300013105 Ga0157369_10009057 Ga0157369_100090576 163
977 3300013105 Ga0157369_10096842 Ga0157369_100968424 163
978 3300013105 Ga0157369_10153395 Ga0157369_101533952 163
979 3300013105 Ga0157369_10189356 Ga0157369_101893563 163
980 3300013105 Ga0157369_10375428 Ga0157369_103754281 163
981 3300013105 Ga0157369_10809184 Ga0157369_108091842 163
982 3300013105 Ga0157369_11718067 Ga0157369_117180671 163
983 3300013296 Ga0157374_10030191 Ga0157374_100301915 163
984 3300013296 Ga0157374_10096957 Ga0157374_100969574 163
985 3300013296 Ga0157374_10165261 Ga0157374_101652613 163
986 3300013296 Ga0157374_10645625 Ga0157374_106456252 163
987 3300013297 Ga0157378_10033143 Ga0157378_100331433 163
988 3300013297 Ga0157378_10226806 Ga0157378_102268063 163
989 3300013297 Ga0157378_10235837 Ga0157378_102358372 163
990 3300013297 Ga0157378_10653515 Ga0157378_106535152 163
991 3300013297 Ga0157378_11859521 Ga0157378_118595211 163
992 3300013306 Ga0163162_10004990 Ga0163162_1000499013 163
993 3300013306 Ga0163162_10010754 Ga0163162_100107549 163
994 3300013306 Ga0163162_10073515 Ga0163162_100735154 163
995 3300013306 Ga0163162_10159127 Ga0163162_101591273 163
996 3300013306 Ga0163162_10181190 Ga0163162_101811903 163
997 3300013306 Ga0163162_10194538 Ga0163162_101945383 163
998 3300013306 Ga0163162_10736278 Ga0163162_107362782 163
999 3300013307 Ga0157372_10226889 Ga0157372_102268893 163
1000 3300013307 Ga0157372_10252876 Ga0157372_102528761 163
1001 3300013307 Ga0157372_10361242 Ga0157372_103612422 163
1002 3300013307 Ga0157372_10765312 Ga0157372_107653122 163
1003 3300013307 Ga0157372_10944204 Ga0157372_109442042 163
1004 3300013307 Ga0157372_11174503 Ga0157372_111745031 163
1005 3300013307 Ga0157372_12183860 Ga0157372_121838601 163
1006 3300013308 Ga0157375_10021110 Ga0157375_100211102 163
1007 3300013308 Ga0157375_10023031 Ga0157375_100230316 163
1008 3300013308 Ga0157375_10035911 Ga0157375_100359112 163
1009 3300013308 Ga0157375_10068189 Ga0157375_100681893 163
1010 3300013308 Ga0157375_10117860 Ga0157375_101178604 163
1011 3300013308 Ga0157375_10324566 Ga0157375_103245662 163
1012 3300013308 Ga0157375_10635863 Ga0157375_106358632 163
1013 3300014325 Ga0163163_10029168 Ga0163163_100291684 163
1014 3300014325 Ga0163163_10136615 Ga0163163_101366152 163
1015 3300014326 Ga0157380_10097547 Ga0157380_100975474 163
1016 3300014745 Ga0157377_10131925 Ga0157377_101319252 163
1017 3300014745 Ga0157377_10132764 Ga0157377_101327643 163
1018 3300014745 Ga0157377_10997172 Ga0157377_109971721 163
1019 3300014968 Ga0157379_10134614 Ga0157379_101346142 163
1020 3300014968 Ga0157379_10331277 Ga0157379_103312771 163
1021 3300014968 Ga0157379_10358983 Ga0157379_103589833 163
1022 3300014968 Ga0157379_10523848 Ga0157379_105238482 163
1023 3300014969 Ga0157376_10001235 Ga0157376_1000123515 163
1024 3300014969 Ga0157376_10778487 Ga0157376_107784872 163
1025 3300017792 Ga0163161_10133454 Ga0163161_101334542 163
1026 3300021384 Ga0213876_10105737 Ga0213876_101057372 163
1027 3300025315 Ga0207697_10013124 Ga0207697_100131245 163
1028 3300025315 Ga0207697_10063587 Ga0207697_100635872 163
1029 3300025321 Ga0207656_10006483 Ga0207656_100064835 163
1030 3300025321 Ga0207656_10529098 Ga0207656_105290981 163
1031 3300025893 Ga0207682_10002812 Ga0207682_100028125 163
1032 3300025893 Ga0207682_10011313 Ga0207682_100113133 163
1033 3300025899 Ga0207642_10007833 Ga0207642_100078331 163
1034 3300025899 Ga0207642_10073313 Ga0207642_100733132 163
1035 3300025899 Ga0207642_10550317 Ga0207642_105503172 163
1036 3300025901 Ga0207688_10000937 Ga0207688_1000093712 163
1037 3300025901 Ga0207688_10058558 Ga0207688_100585582 163
1038 3300025901 Ga0207688_10268006 Ga0207688_102680062 163
1039 3300025901 Ga0207688_10276468 Ga0207688_102764682 163
1040 3300025903 Ga0207680_10000219 Ga0207680_1000021914 163
1041 3300025903 Ga0207680_10002571 Ga0207680_100025718 163
1042 3300025903 Ga0207680_10022828 Ga0207680_100228283 163
1043 3300025903 Ga0207680_10147857 Ga0207680_101478572 163
1044 3300025903 Ga0207680_10236737 Ga0207680_102367372 163
1045 3300025903 Ga0207680_10522366 Ga0207680_105223662 163
1046 3300025904 Ga0207647_10003591 Ga0207647_100035913 163
1047 3300025904 Ga0207647_10005498 Ga0207647_100054982 163
1048 3300025904 Ga0207647_10010619 Ga0207647_100106197 163
1049 3300025904 Ga0207647_10079649 Ga0207647_100796493 163
1050 3300025904 Ga0207647_10089713 Ga0207647_100897132 163
1051 3300025905 Ga0207685_10127685 Ga0207685_101276852 163
1052 3300025906 Ga0207699_10158228 Ga0207699_101582281 163
1053 3300025907 Ga0207645_10015238 Ga0207645_100152383 163
1054 3300025907 Ga0207645_10026774 Ga0207645_100267741 163
1055 3300025907 Ga0207645_10066454 Ga0207645_100664543 163
1056 3300025907 Ga0207645_10404237 Ga0207645_104042371 163
1057 3300025908 Ga0207643_10040308 Ga0207643_100403082 163
1058 3300025909 Ga0207705_10000320 Ga0207705_1000032036 163
1059 3300025909 Ga0207705_10000330 Ga0207705_1000033031 163
1060 3300025909 Ga0207705_10031278 Ga0207705_100312785 163
1061 3300025909 Ga0207705_10032005 Ga0207705_100320052 163
1062 3300025909 Ga0207705_10061499 Ga0207705_100614994 163
1063 3300025909 Ga0207705_10069521 Ga0207705_100695213 163
1064 3300025909 Ga0207705_10070872 Ga0207705_100708724 163
1065 3300025909 Ga0207705_10101387 Ga0207705_101013872 163
1066 3300025909 Ga0207705_10150153 Ga0207705_101501533 163
1067 3300025909 Ga0207705_10192725 Ga0207705_101927252 163
1068 3300025909 Ga0207705_10307074 Ga0207705_103070742 163
1069 3300025911 Ga0207654_10173937 Ga0207654_101739372 163
1070 3300025912 Ga0207707_10016497 Ga0207707_100164974 163
1071 3300025912 Ga0207707_11049206 Ga0207707_110492061 163
1072 3300025913 Ga0207695_10119701 Ga0207695_101197012 163
1073 3300025913 Ga0207695_10160802 Ga0207695_101608022 163
1074 3300025913 Ga0207695_10177477 Ga0207695_101774773 163
1075 3300025913 Ga0207695_11142674 Ga0207695_111426742 163
1076 3300025914 Ga0207671_10209505 Ga0207671_102095053 163
1077 3300025917 Ga0207660_10004291 Ga0207660_100042913 163
1078 3300025918 Ga0207662_10071362 Ga0207662_100713623 163
1079 3300025919 Ga0207657_10001031 Ga0207657_1000103121 163
1080 3300025919 Ga0207657_10001906 Ga0207657_1000190623 163
1081 3300025919 Ga0207657_10014496 Ga0207657_100144968 163
1082 3300025919 Ga0207657_10014520 Ga0207657_100145205 163
1083 3300025919 Ga0207657_10019015 Ga0207657_100190158 163
1084 3300025919 Ga0207657_10020563 Ga0207657_100205637 163
1085 3300025919 Ga0207657_10020823 Ga0207657_100208236 163
1086 3300025919 Ga0207657_10050513 Ga0207657_100505132 163
1087 3300025919 Ga0207657_10189988 Ga0207657_101899882 163
1088 3300025919 Ga0207657_10380020 Ga0207657_103800202 163
1089 3300025919 Ga0207657_10576590 Ga0207657_105765902 163
1090 3300025919 Ga0207657_10903412 Ga0207657_109034122 163
1091 3300025919 Ga0207657_11201455 Ga0207657_112014551 163
1092 3300025920 Ga0207649_10015845 Ga0207649_100158455 163
1093 3300025920 Ga0207649_10024548 Ga0207649_100245484 163
1094 3300025920 Ga0207649_10026939 Ga0207649_100269392 163
1095 3300025920 Ga0207649_10120558 Ga0207649_101205583 163
1096 3300025920 Ga0207649_10186950 Ga0207649_101869502 163
1097 3300025920 Ga0207649_10207585 Ga0207649_102075851 163
1098 3300025921 Ga0207652_10000356 Ga0207652_1000035612 163
1099 3300025921 Ga0207652_10338319 Ga0207652_103383193 163
1100 3300025921 Ga0207652_10514558 Ga0207652_105145582 163
1101 3300025923 Ga0207681_10048435 Ga0207681_100484355 163
1102 3300025923 Ga0207681_10052430 Ga0207681_100524304 163
1103 3300025923 Ga0207681_10185943 Ga0207681_101859432 163
1104 3300025923 Ga0207681_10366029 Ga0207681_103660291 163
1105 3300025924 Ga0207694_10004227 Ga0207694_1000422714 163
1106 3300025924 Ga0207694_10014118 Ga0207694_100141184 163
1107 3300025924 Ga0207694_10966555 Ga0207694_109665552 163
1108 3300025925 Ga0207650_10015267 Ga0207650_100152674 163
1109 3300025925 Ga0207650_10042919 Ga0207650_100429194 163
1110 3300025925 Ga0207650_10266208 Ga0207650_102662082 163
1111 3300025925 Ga0207650_10412514 Ga0207650_104125142 163
1112 3300025925 Ga0207650_10621650 Ga0207650_106216502 163
1113 3300025925 Ga0207650_10820023 Ga0207650_108200232 163
1114 3300025925 Ga0207650_10933517 Ga0207650_109335171 163
1115 3300025926 Ga0207659_10030476 Ga0207659_100304761 163
1116 3300025926 Ga0207659_10033701 Ga0207659_100337015 163
1117 3300025926 Ga0207659_10049852 Ga0207659_100498523 163
1118 3300025926 Ga0207659_10055831 Ga0207659_100558313 163
1119 3300025926 Ga0207659_10139416 Ga0207659_101394162 163
1120 3300025926 Ga0207659_10240761 Ga0207659_102407612 163
1121 3300025926 Ga0207659_10392688 Ga0207659_103926882 163
1122 3300025927 Ga0207687_10079455 Ga0207687_100794553 163
1123 3300025927 Ga0207687_10290203 Ga0207687_102902032 163
1124 3300025927 Ga0207687_10517696 Ga0207687_105176962 163
1125 3300025928 Ga0207700_10037863 Ga0207700_100378634 163
1126 3300025928 Ga0207700_11132845 Ga0207700_111328451 163
1127 3300025929 Ga0207664_10025529 Ga0207664_100255296 163
1128 3300025929 Ga0207664_10036988 Ga0207664_100369885 163
1129 3300025929 Ga0207664_10044944 Ga0207664_100449443 163
1130 3300025929 Ga0207664_10065731 Ga0207664_100657312 163
1131 3300025931 Ga0207644_10000214 Ga0207644_1000021419 163
1132 3300025931 Ga0207644_10002141 Ga0207644_1000214114 163
1133 3300025931 Ga0207644_10006738 Ga0207644_100067385 163
1134 3300025931 Ga0207644_10008630 Ga0207644_100086305 163
1135 3300025931 Ga0207644_10010201 Ga0207644_100102015 163
1136 3300025931 Ga0207644_10031319 Ga0207644_100313192 163
1137 3300025931 Ga0207644_10139374 Ga0207644_101393743 163
1138 3300025931 Ga0207644_10172072 Ga0207644_101720723 163
1139 3300025931 Ga0207644_10220402 Ga0207644_102204022 163
1140 3300025931 Ga0207644_10390362 Ga0207644_103903622 163
1141 3300025932 Ga0207690_10002794 Ga0207690_100027945 163
1142 3300025932 Ga0207690_10003771 Ga0207690_100037712 163
1143 3300025932 Ga0207690_10008018 Ga0207690_100080186 163
1144 3300025932 Ga0207690_10009666 Ga0207690_100096666 163
1145 3300025932 Ga0207690_10083036 Ga0207690_100830364 163
1146 3300025932 Ga0207690_10200563 Ga0207690_102005632 163
1147 3300025932 Ga0207690_10227638 Ga0207690_102276382 163
1148 3300025932 Ga0207690_10283994 Ga0207690_102839942 163
1149 3300025932 Ga0207690_10348971 Ga0207690_103489712 163
1150 3300025932 Ga0207690_10355287 Ga0207690_103552872 163
1151 3300025932 Ga0207690_10357537 Ga0207690_103575372 163
1152 3300025932 Ga0207690_10443403 Ga0207690_104434032 163
1153 3300025932 Ga0207690_10865924 Ga0207690_108659241 163
1154 3300025933 Ga0207706_10005341 Ga0207706_100053418 163
1155 3300025933 Ga0207706_10015930 Ga0207706_100159308 163
1156 3300025933 Ga0207706_10044324 Ga0207706_100443244 163
1157 3300025933 Ga0207706_10048436 Ga0207706_100484363 163
1158 3300025933 Ga0207706_10059505 Ga0207706_100595053 163
1159 3300025933 Ga0207706_10083789 Ga0207706_100837893 163
1160 3300025933 Ga0207706_10104475 Ga0207706_101044752 163
1161 3300025933 Ga0207706_10122877 Ga0207706_101228772 163
1162 3300025933 Ga0207706_10129021 Ga0207706_101290213 163
1163 3300025933 Ga0207706_10157650 Ga0207706_101576502 163
1164 3300025933 Ga0207706_10283890 Ga0207706_102838902 163
1165 3300025933 Ga0207706_10374268 Ga0207706_103742682 163
1166 3300025933 Ga0207706_10415727 Ga0207706_104157272 163
1167 3300025934 Ga0207686_10013436 Ga0207686_100134364 163
1168 3300025935 Ga0207709_10132616 Ga0207709_101326162 163
1169 3300025935 Ga0207709_10292084 Ga0207709_102920842 163
1170 3300025935 Ga0207709_10451895 Ga0207709_104518952 163
1171 3300025935 Ga0207709_11049656 Ga0207709_110496561 163
1172 3300025937 Ga0207669_10003979 Ga0207669_100039795 163
1173 3300025937 Ga0207669_10005841 Ga0207669_100058415 163
1174 3300025937 Ga0207669_10087890 Ga0207669_100878903 163
1175 3300025937 Ga0207669_10125465 Ga0207669_101254652 163
1176 3300025937 Ga0207669_10820278 Ga0207669_108202781 163
1177 3300025938 Ga0207704_10068509 Ga0207704_100685092 163
1178 3300025938 Ga0207704_10114157 Ga0207704_101141572 163
1179 3300025938 Ga0207704_10176176 Ga0207704_101761762 163
1180 3300025938 Ga0207704_10693785 Ga0207704_106937851 163
1181 3300025939 Ga0207665_10467758 Ga0207665_104677582 163
1182 3300025940 Ga0207691_10002277 Ga0207691_100022776 163
1183 3300025940 Ga0207691_10003283 Ga0207691_100032838 163
1184 3300025940 Ga0207691_10017707 Ga0207691_100177076 163
1185 3300025940 Ga0207691_10028103 Ga0207691_100281033 163
1186 3300025940 Ga0207691_10056363 Ga0207691_100563633 163
1187 3300025940 Ga0207691_10064601 Ga0207691_100646012 163
1188 3300025940 Ga0207691_10151632 Ga0207691_101516323 163
1189 3300025940 Ga0207691_10311375 Ga0207691_103113752 163
1190 3300025940 Ga0207691_10579836 Ga0207691_105798362 163
1191 3300025941 Ga0207711_10002037 Ga0207711_100020375 163
1192 3300025941 Ga0207711_10002492 Ga0207711_100024929 163
1193 3300025941 Ga0207711_10028155 Ga0207711_100281553 163
1194 3300025941 Ga0207711_10043833 Ga0207711_100438334 163
1195 3300025941 Ga0207711_10102611 Ga0207711_101026112 163
1196 3300025941 Ga0207711_10343853 Ga0207711_103438532 163
1197 3300025942 Ga0207689_10011314 Ga0207689_100113149 163
1198 3300025942 Ga0207689_10011824 Ga0207689_100118241 163
1199 3300025944 Ga0207661_10025443 Ga0207661_100254436 163
1200 3300025944 Ga0207661_10346849 Ga0207661_103468491 163
1201 3300025944 Ga0207661_10426838 Ga0207661_104268382 163
1202 3300025945 Ga0207679_10023698 Ga0207679_100236982 163
1203 3300025945 Ga0207679_10025169 Ga0207679_100251695 163
1204 3300025945 Ga0207679_10068765 Ga0207679_100687654 163
1205 3300025945 Ga0207679_10077895 Ga0207679_100778954 163
1206 3300025945 Ga0207679_10109920 Ga0207679_101099203 163
1207 3300025945 Ga0207679_10117179 Ga0207679_101171792 163
1208 3300025945 Ga0207679_10136122 Ga0207679_101361222 163
1209 3300025945 Ga0207679_10189779 Ga0207679_101897792 163
1210 3300025945 Ga0207679_10207912 Ga0207679_102079122 163
1211 3300025945 Ga0207679_10229100 Ga0207679_102291002 163
1212 3300025945 Ga0207679_10256414 Ga0207679_102564142 163
1213 3300025949 Ga0207667_10023776 Ga0207667_100237768 163
1214 3300025949 Ga0207667_10090693 Ga0207667_100906934 163
1215 3300025949 Ga0207667_10120462 Ga0207667_101204622 163
1216 3300025949 Ga0207667_10298049 Ga0207667_102980492 163
1217 3300025949 Ga0207667_10431893 Ga0207667_104318932 163
1218 3300025949 Ga0207667_10468647 Ga0207667_104686472 163
1219 3300025960 Ga0207651_10001209 Ga0207651_1000120912 163
1220 3300025960 Ga0207651_10003812 Ga0207651_100038123 163
1221 3300025960 Ga0207651_10011452 Ga0207651_100114524 163
1222 3300025960 Ga0207651_10019846 Ga0207651_100198465 163
1223 3300025960 Ga0207651_10044737 Ga0207651_100447372 163
1224 3300025960 Ga0207651_10106403 Ga0207651_101064033 163
1225 3300025960 Ga0207651_10151547 Ga0207651_101515472 163
1226 3300025960 Ga0207651_10818198 Ga0207651_108181982 163
1227 3300025961 Ga0207712_10005619 Ga0207712_100056198 163
1228 3300025972 Ga0207668_10246565 Ga0207668_102465652 163
1229 3300025972 Ga0207668_10606784 Ga0207668_106067842 163
1230 3300025972 Ga0207668_10941270 Ga0207668_109412702 163
1231 3300025981 Ga0207640_10024733 Ga0207640_100247333 163
1232 3300025981 Ga0207640_10082927 Ga0207640_100829273 163
1233 3300025981 Ga0207640_10104037 Ga0207640_101040373 163
1234 3300025981 Ga0207640_10174431 Ga0207640_101744313 163
1235 3300025981 Ga0207640_10243213 Ga0207640_102432132 163
1236 3300025981 Ga0207640_10405140 Ga0207640_104051402 163
1237 3300025981 Ga0207640_11273061 Ga0207640_112730612 163
1238 3300025981 Ga0207640_11281734 Ga0207640_112817341 163
1239 3300025986 Ga0207658_10002468 Ga0207658_100024689 163
1240 3300025986 Ga0207658_10007079 Ga0207658_100070795 163
1241 3300025986 Ga0207658_10009967 Ga0207658_100099676 163
1242 3300025986 Ga0207658_10056825 Ga0207658_100568253 163
1243 3300025986 Ga0207658_10066893 Ga0207658_100668933 163
1244 3300025986 Ga0207658_10071202 Ga0207658_100712022 163
1245 3300025986 Ga0207658_10319260 Ga0207658_103192602 163
1246 3300025986 Ga0207658_10512681 Ga0207658_105126812 163
1247 3300025986 Ga0207658_10529954 Ga0207658_105299542 163
1248 3300025986 Ga0207658_11051636 Ga0207658_110516362 163
1249 3300026023 Ga0207677_10009857 Ga0207677_100098574 163
1250 3300026023 Ga0207677_10011080 Ga0207677_100110805 163
1251 3300026023 Ga0207677_10277593 Ga0207677_102775932 163
1252 3300026023 Ga0207677_10517215 Ga0207677_105172152 163
1253 3300026023 Ga0207677_10613900 Ga0207677_106139002 163
1254 3300026023 Ga0207677_10668909 Ga0207677_106689091 163
1255 3300026035 Ga0207703_10001404 Ga0207703_1000140419 163
1256 3300026035 Ga0207703_10004700 Ga0207703_100047002 163
1257 3300026035 Ga0207703_10015254 Ga0207703_100152542 163
1258 3300026035 Ga0207703_10036004 Ga0207703_100360043 163
1259 3300026035 Ga0207703_11138577 Ga0207703_111385771 163
1260 3300026041 Ga0207639_10002074 Ga0207639_1000207411 163
1261 3300026041 Ga0207639_10051972 Ga0207639_100519721 163
1262 3300026041 Ga0207639_10195441 Ga0207639_101954412 163
1263 3300026041 Ga0207639_10215327 Ga0207639_102153271 163
1264 3300026041 Ga0207639_10636708 Ga0207639_106367082 163
1265 3300026067 Ga0207678_10001604 Ga0207678_1000160413 163
1266 3300026067 Ga0207678_10014296 Ga0207678_100142964 163
1267 3300026067 Ga0207678_10015901 Ga0207678_100159018 163
1268 3300026067 Ga0207678_10037051 Ga0207678_100370513 163
1269 3300026067 Ga0207678_10045896 Ga0207678_100458962 163
1270 3300026067 Ga0207678_10068261 Ga0207678_100682613 163
1271 3300026078 Ga0207702_10007309 Ga0207702_100073096 163
1272 3300026078 Ga0207702_10052596 Ga0207702_100525966 163
1273 3300026078 Ga0207702_10122005 Ga0207702_101220053 163
1274 3300026078 Ga0207702_10323555 Ga0207702_103235552 163
1275 3300026078 Ga0207702_10324737 Ga0207702_103247372 163
1276 3300026078 Ga0207702_10985678 Ga0207702_109856781 163
1277 3300026088 Ga0207641_10017421 Ga0207641_100174214 163
1278 3300026088 Ga0207641_10030844 Ga0207641_100308445 163
1279 3300026088 Ga0207641_10063322 Ga0207641_100633222 163
1280 3300026089 Ga0207648_10003494 Ga0207648_100034948 163
1281 3300026089 Ga0207648_10060678 Ga0207648_100606784 163
1282 3300026089 Ga0207648_10075208 Ga0207648_100752084 163
1283 3300026089 Ga0207648_10439174 Ga0207648_104391742 163
1284 3300026095 Ga0207676_10003816 Ga0207676_100038169 163
1285 3300026095 Ga0207676_10018431 Ga0207676_100184314 163
1286 3300026095 Ga0207676_10068673 Ga0207676_100686732 163
1287 3300026095 Ga0207676_10661871 Ga0207676_106618712 163
1288 3300026095 Ga0207676_10736939 Ga0207676_107369392 163
1289 3300026116 Ga0207674_10008382 Ga0207674_100083822 163
1290 3300026116 Ga0207674_10032002 Ga0207674_100320028 163
1291 3300026116 Ga0207674_10126659 Ga0207674_101266593 163
1292 3300026116 Ga0207674_10357116 Ga0207674_103571163 163
1293 3300026116 Ga0207674_10595445 Ga0207674_105954452 163
1294 3300026116 Ga0207674_10605376 Ga0207674_106053762 163
1295 3300026118 Ga0207675_100134977 Ga0207675_1001349773 163
1296 3300026118 Ga0207675_100312623 Ga0207675_1003126233 163
1297 3300026121 Ga0207683_10000636 Ga0207683_1000063625 163
1298 3300026121 Ga0207683_10002836 Ga0207683_100028368 163
1299 3300026121 Ga0207683_10013482 Ga0207683_100134828 163
1300 3300026121 Ga0207683_10030752 Ga0207683_100307522 163
1301 3300026121 Ga0207683_10037299 Ga0207683_100372993 163
1302 3300026121 Ga0207683_10108183 Ga0207683_101081834 163
1303 3300026121 Ga0207683_10523649 Ga0207683_105236492 163
1304 3300026121 Ga0207683_10628285 Ga0207683_106282852 163
1305 3300026142 Ga0207698_10003979 Ga0207698_1000397910 163
1306 3300026142 Ga0207698_10008400 Ga0207698_100084001 163
1307 3300026142 Ga0207698_10011485 Ga0207698_100114855 163
1308 3300026142 Ga0207698_10011537 Ga0207698_100115376 163
1309 3300026142 Ga0207698_10018573 Ga0207698_100185735 163
1310 3300026142 Ga0207698_10035886 Ga0207698_100358863 163
1311 3300026142 Ga0207698_10094979 Ga0207698_100949792 163
1312 3300026142 Ga0207698_10143925 Ga0207698_101439253 163
1313 3300026142 Ga0207698_10158052 Ga0207698_101580522 163
1314 3300026142 Ga0207698_10171417 Ga0207698_101714173 163
1315 3300026142 Ga0207698_10397271 Ga0207698_103972712 163
1316 3300026142 Ga0207698_11278920 Ga0207698_112789202 163
1317 3300026142 Ga0207698_12118948 Ga0207698_121189481 163
1318 3300027552 Ga0209982_1026999 Ga0209982_10269992 163
1319 3300028379 Ga0268266_10040068 Ga0268266_100400683 163
1320 3300028379 Ga0268266_10047439 Ga0268266_100474394 163
1321 3300028379 Ga0268266_10261733 Ga0268266_102617332 163
1322 3300028379 Ga0268266_10268688 Ga0268266_102686882 163
1323 3300028379 Ga0268266_10400902 Ga0268266_104009022 163
1324 3300028379 Ga0268266_11780826 Ga0268266_117808261 163
1325 3300028380 Ga0268265_10013897 Ga0268265_100138977 163
1326 3300028380 Ga0268265_10719055 Ga0268265_107190551 163
1327 3300028381 Ga0268264_10004576 Ga0268264_100045763 163
1328 3300028381 Ga0268264_10004618 Ga0268264_1000461812 163
1329 3300028381 Ga0268264_10128678 Ga0268264_101286784 163
1330 3300028381 Ga0268264_10286081 Ga0268264_102860812 163
1331 3300028381 Ga0268264_10388226 Ga0268264_103882262 163
1332 3300031548 Ga0307408_100031183 Ga0307408_1000311834 163
1333 3300031548 Ga0307408_100108556 Ga0307408_1001085562 163
1334 3300031548 Ga0307408_100145217 Ga0307408_1001452172 163
1335 3300031548 Ga0307408_100153164 Ga0307408_1001531642 163
1336 3300031548 Ga0307408_100344792 Ga0307408_1003447922 163
1337 3300031731 Ga0307405_10029310 Ga0307405_100293104 163
1338 3300031731 Ga0307405_10053667 Ga0307405_100536673 163
1339 3300031731 Ga0307405_10139582 Ga0307405_101395822 163
1340 3300031731 Ga0307405_10146565 Ga0307405_101465652 163
1341 3300031824 Ga0307413_10004614 Ga0307413_100046142 163
1342 3300031824 Ga0307413_10011043 Ga0307413_100110433 163
1343 3300031824 Ga0307413_10068728 Ga0307413_100687283 163
1344 3300031824 Ga0307413_10266708 Ga0307413_102667082 163
1345 3300031824 Ga0307413_10663607 Ga0307413_106636072 163
1346 3300031824 Ga0307413_10752750 Ga0307413_107527501 163
1347 3300031852 Ga0307410_10000437 Ga0307410_100004374 163
1348 3300031852 Ga0307410_10093889 Ga0307410_100938892 163
1349 3300031852 Ga0307410_10106141 Ga0307410_101061414 163
1350 3300031852 Ga0307410_10311017 Ga0307410_103110172 163
1351 3300031852 Ga0307410_10326738 Ga0307410_103267381 163
1352 3300031852 Ga0307410_10348551 Ga0307410_103485512 163
1353 3300031852 Ga0307410_11045420 Ga0307410_110454202 163
1354 3300031901 Ga0307406_10058404 Ga0307406_100584044 163
1355 3300031901 Ga0307406_10063868 Ga0307406_100638683 163
1356 3300031901 Ga0307406_10085883 Ga0307406_100858832 163
1357 3300031901 Ga0307406_10139180 Ga0307406_101391802 163
1358 3300031901 Ga0307406_10202175 Ga0307406_102021752 163
1359 3300031901 Ga0307406_10483400 Ga0307406_104834002 163
1360 3300031903 Ga0307407_10012887 Ga0307407_100128872 163
1361 3300031903 Ga0307407_10014810 Ga0307407_100148102 163
1362 3300031903 Ga0307407_10081298 Ga0307407_100812983 163
1363 3300031903 Ga0307407_10088972 Ga0307407_100889723 163
1364 3300031903 Ga0307407_10118305 Ga0307407_101183053 163
1365 3300031903 Ga0307407_10146074 Ga0307407_101460742 163
1366 3300031903 Ga0307407_10337973 Ga0307407_103379732 163
1367 3300031903 Ga0307407_10873277 Ga0307407_108732771 163
1368 3300031911 Ga0307412_10004968 Ga0307412_100049688 163
1369 3300031911 Ga0307412_10063951 Ga0307412_100639512 163
1370 3300031911 Ga0307412_10083002 Ga0307412_100830023 163
1371 3300031911 Ga0307412_10102812 Ga0307412_101028123 163
1372 3300031911 Ga0307412_10291991 Ga0307412_102919911 163
1373 3300031911 Ga0307412_10738299 Ga0307412_107382992 163
1374 3300031911 Ga0307412_10851412 Ga0307412_108514122 163
1375 3300031911 Ga0307412_10876370 Ga0307412_108763702 163
1376 3300031995 Ga0307409_100014102 Ga0307409_1000141023 163
1377 3300031995 Ga0307409_100015346 Ga0307409_1000153465 163
1378 3300031995 Ga0307409_100078117 Ga0307409_1000781174 163
1379 3300031995 Ga0307409_100090560 Ga0307409_1000905603 163
1380 3300031995 Ga0307409_100116327 Ga0307409_1001163272 163
1381 3300031995 Ga0307409_100137724 Ga0307409_1001377241 163
1382 3300031995 Ga0307409_100166602 Ga0307409_1001666022 163
1383 3300031995 Ga0307409_100239883 Ga0307409_1002398832 163
1384 3300031995 Ga0307409_100396717 Ga0307409_1003967173 163
1385 3300031995 Ga0307409_100925650 Ga0307409_1009256501 163
1386 3300031995 Ga0307409_101077141 Ga0307409_1010771412 163
1387 3300031995 Ga0307409_101274713 Ga0307409_1012747132 163
1388 3300031995 Ga0307409_101866101 Ga0307409_1018661011 163
1389 3300032002 Ga0307416_100009723 Ga0307416_1000097234 163
1390 3300032002 Ga0307416_100028325 Ga0307416_1000283255 163
1391 3300032002 Ga0307416_100055345 Ga0307416_1000553453 163
1392 3300032002 Ga0307416_100160391 Ga0307416_1001603912 163
1393 3300032002 Ga0307416_100291495 Ga0307416_1002914951 163
1394 3300032004 Ga0307414_10008709 Ga0307414_100087093 163
1395 3300032004 Ga0307414_10021024 Ga0307414_100210241 163
1396 3300032004 Ga0307414_10023363 Ga0307414_100233634 163
1397 3300032004 Ga0307414_10025253 Ga0307414_100252536 163
1398 3300032004 Ga0307414_10083296 Ga0307414_100832963 163
1399 3300032004 Ga0307414_10151536 Ga0307414_101515361 163
1400 3300032004 Ga0307414_10345890 Ga0307414_103458901 163
1401 3300032004 Ga0307414_10882064 Ga0307414_108820642 163
1402 3300032005 Ga0307411_10005121 Ga0307411_100051216 163
1403 3300032005 Ga0307411_10012651 Ga0307411_100126516 163
1404 3300032005 Ga0307411_10013123 Ga0307411_100131234 163
1405 3300032005 Ga0307411_10030282 Ga0307411_100302824 163
1406 3300032005 Ga0307411_10035931 Ga0307411_100359314 163
1407 3300032005 Ga0307411_10039899 Ga0307411_100398993 163
1408 3300032005 Ga0307411_10041773 Ga0307411_100417732 163
1409 3300032005 Ga0307411_10321024 Ga0307411_103210241 163
1410 3300032005 Ga0307411_10395926 Ga0307411_103959262 163
1411 3300032005 Ga0307411_10501057 Ga0307411_105010572 163
1412 3300032126 Ga0307415_100013186 Ga0307415_1000131864 163
1413 3300032126 Ga0307415_100028708 Ga0307415_1000287083 163
1414 3300032126 Ga0307415_100041470 Ga0307415_1000414703 163
1415 3300032126 Ga0307415_100075503 Ga0307415_1000755033 163
1416 3300032126 Ga0307415_100433505 Ga0307415_1004335052 163
1417 3300032126 Ga0307415_100573579 Ga0307415_1005735792 163
1418 3300035091 Ga0373951_0106795 Ga0373951_0106795_155_652 163
1419 3300035111 Ga0373923_0178272 Ga0373923_0178272_19_510 163
1420 3300035118 Ga0373954_0290640 Ga0373954_0290640_298_789 163
1421 3300035170 Ga0373943_0004324 Ga0373943_0004324_4317_4808 163
1422 3300035171 Ga0373946_0005985 Ga0373946_0005985_168_659 163
1423 3300035172 Ga0373955_0095908 Ga0373955_0095908_252_743 163
1424 3300035207 Ga0373942_0038064 Ga0373942_0038064_247_738 163
1425 3300035691 Ga0373931_0498007 Ga0373931_0498007_141_632 163
1426 3300035725 Ga0373947_0021481 Ga0373947_0021481_1249_1740 163
1427 3300036401 Ga0373937_0199598 Ga0373937_0199598_775_1266 163
1428 3300036401 Ga0373937_0268205 Ga0373937_0268205_814_1305 163
1429 3300037312 Ga0395899_0013913 Ga0395899_0013913_2311_2802 163
1430 3300037312 Ga0395899_0021544 Ga0395899_0021544_1923_2414 163
1431 3300037312 Ga0395899_0042075 Ga0395899_0042075_1784_2275 163
1432 3300037312 Ga0395899_0073199 Ga0395899_0073199_1447_1938 163
1433 3300037312 Ga0395899_0099935 Ga0395899_0099935_575_1066 163
1434 3300037312 Ga0395899_0342297 Ga0395899_0342297_42_533 163
1435 3300037312 Ga0395899_0495220 Ga0395899_0495220_207_698 163
1436 3300037418 Ga0395900_0009815 Ga0395900_0009815_373_864 163
1437 3300037418 Ga0395900_0042039 Ga0395900_0042039_1094_1585 163
1438 3300037418 Ga0395900_0071287 Ga0395900_0071287_972_1463 163
1439 3300037418 Ga0395900_0078889 Ga0395900_0078889_887_1378 163
1440 3300037418 Ga0395900_0081537 Ga0395900_0081537_485_976 163
1441 3300037418 Ga0395900_0091720 Ga0395900_0091720_847_1338 163
1442 3300037418 Ga0395900_0118836 Ga0395900_0118836_1833_2324 163
1443 3300037418 Ga0395900_0152416 Ga0395900_0152416_917_1408 163
1444 3300037418 Ga0395900_0237616 Ga0395900_0237616_451_942 163
1445 3300037418 Ga0395900_0259671 Ga0395900_0259671_1036_1527 163
1446 3300037418 Ga0395900_0368593 Ga0395900_0368593_138_629 163
1447 3300037418 Ga0395900_0370681 Ga0395900_0370681_589_1080 163
1448 3300037418 Ga0395900_0382626 Ga0395900_0382626_704_1210 163
1449 3300037418 Ga0395900_0580538 Ga0395900_0580538_377_868 163
1450 3300037418 Ga0395900_0595719 Ga0395900_0595719_88_579 163
1451 3300037418 Ga0395900_0702783 Ga0395900_0702783_38_529 163
1452 3300037418 Ga0395900_0835738 Ga0395900_0835738_50_541 163
1453 3300037418 Ga0395900_0839822 Ga0395900_0839822_179_670 163
1454 3300037418 Ga0395900_0871861 Ga0395900_0871861_234_725 163
1455 3300037418 Ga0395900_1205805 Ga0395900_1205805_89_580 163
1456 3300037466 Ga0395898_0007467 Ga0395898_0007467_3632_4123 163
1457 3300037466 Ga0395898_0028931 Ga0395898_0028931_4118_4609 163
1458 3300037466 Ga0395898_0036491 Ga0395898_0036491_1384_1875 163
1459 3300037466 Ga0395898_0069323 Ga0395898_0069323_1784_2275 163
1460 3300037466 Ga0395898_0083356 Ga0395898_0083356_1217_1708 163
1461 3300037466 Ga0395898_0096299 Ga0395898_0096299_2071_2562 163
1462 3300037466 Ga0395898_0324526 Ga0395898_0324526_343_834 163
1463 3300037466 Ga0395898_0534713 Ga0395898_0534713_215_706 163
1464 3300037466 Ga0395898_0535005 Ga0395898_0535005_477_968 163
1465 3300037466 Ga0395898_0565550 Ga0395898_0565550_507_998 163
1466 3300037466 Ga0395898_1373514 Ga0395898_1373514_62_553 163
1467 3300037471 Ga0395905_0011758 Ga0395905_0011758_369_860 163
1468 3300037471 Ga0395905_0013463 Ga0395905_0013463_1914_2405 163
1469 3300037471 Ga0395905_0014451 Ga0395905_0014451_2410_2901 163
1470 3300037471 Ga0395905_0017532 Ga0395905_0017532_2277_2768 163
1471 3300037471 Ga0395905_0021249 Ga0395905_0021249_4078_4569 163
1472 3300037471 Ga0395905_0022346 Ga0395905_0022346_5271_5762 163
1473 3300037471 Ga0395905_0027179 Ga0395905_0027179_1814_2305 163
1474 3300037471 Ga0395905_0033153 Ga0395905_0033153_966_1457 163
1475 3300037471 Ga0395905_0034490 Ga0395905_0034490_1921_2412 163
1476 3300037471 Ga0395905_0039370 Ga0395905_0039370_1107_1598 163
1477 3300037471 Ga0395905_0048488 Ga0395905_0048488_226_717 163
1478 3300037471 Ga0395905_0051019 Ga0395905_0051019_1601_2092 163
1479 3300037471 Ga0395905_0089815 Ga0395905_0089815_134_625 163
1480 3300037471 Ga0395905_0090205 Ga0395905_0090205_866_1357 163
1481 3300037471 Ga0395905_0101661 Ga0395905_0101661_1588_2079 163
1482 3300037471 Ga0395905_0140668 Ga0395905_0140668_546_1037 163
1483 3300037471 Ga0395905_0148412 Ga0395905_0148412_967_1458 163
1484 3300037471 Ga0395905_0190891 Ga0395905_0190891_1374_1865 163
1485 3300037471 Ga0395905_0284811 Ga0395905_0284811_981_1472 163
1486 3300037471 Ga0395905_0350688 Ga0395905_0350688_795_1286 163
1487 3300037471 Ga0395905_0429501 Ga0395905_0429501_338_844 163
1488 3300037471 Ga0395905_0569410 Ga0395905_0569410_413_904 163
1489 3300038443 Ga0395901_0028941 Ga0395901_0028941_4389_4880 163
1490 3300038443 Ga0395901_0069691 Ga0395901_0069691_3115_3606 163
1491 3300038443 Ga0395901_0074130 Ga0395901_0074130_1784_2275 163
1492 3300038443 Ga0395901_0107771 Ga0395901_0107771_1281_1787 163
1493 3300038443 Ga0395901_0111681 Ga0395901_0111681_1153_1644 163
1494 3300038443 Ga0395901_0118405 Ga0395901_0118405_1945_2436 163
1495 3300038443 Ga0395901_0129010 Ga0395901_0129010_1859_2350 163
1496 3300038443 Ga0395901_0163831 Ga0395901_0163831_282_773 163
1497 3300038443 Ga0395901_0175314 Ga0395901_0175314_718_1209 163
1498 3300038443 Ga0395901_0183450 Ga0395901_0183450_973_1464 163
1499 3300038443 Ga0395901_0208331 Ga0395901_0208331_407_898 163
1500 3300038443 Ga0395901_0233113 Ga0395901_0233113_1374_1865 163
1501 3300038443 Ga0395901_0262234 Ga0395901_0262234_572_1063 163
1502 3300038443 Ga0395901_0275002 Ga0395901_0275002_33_554 163
1503 3300038443 Ga0395901_0359720 Ga0395901_0359720_687_1178 163
1504 3300038443 Ga0395901_0404379 Ga0395901_0404379_695_1186 163
1505 3300038443 Ga0395901_0600711 Ga0395901_0600711_523_1014 163
1506 3300038443 Ga0395901_0775705 Ga0395901_0775705_41_532 163
1507 3300038443 Ga0395901_0821040 Ga0395901_0821040_156_647 163
1508 3300038443 Ga0395901_1263733 Ga0395901_1263733_41_532 163
1509 3300038443 Ga0395901_1394325 Ga0395901_1394325_96_587 163
1510 3300039437 Ga0436365_0174261 Ga0436365_0174261_20820_21311 163
1511 3300039450 Ga0436363_1558974 Ga0436363_1558974_169_660 163
1512 3300041501 Ga0451845_0905528 Ga0451845_0905528_26_529 163
1513 3300042007 Ga0439449_0040835 Ga0439449_0040835_470_961 163
1514 3300042010 Ga0439452_069074 Ga0439452_069074_208_699 163
1515 3300042127 Ga0450890_065818 Ga0450890_065818_37_528 163
1516 3300042157 Ga0439458_0000559 Ga0439458_0000559_5724_6215 163
1517 3300042876 Ga0451577_0496662 Ga0451577_0496662_255_767 163
1518 3300044656 Ga0466969_0022242 Ga0466969_0022242_177_668 163
1519 3300044656 Ga0466969_0146376 Ga0466969_0146376_377_871 163
1520 3300044658 Ga0466972_0362432 Ga0466972_0362432_132_623 163
1521 3300044684 Ga0466966_0003928 Ga0466966_0003928_3854_4345 163
1522 3300044684 Ga0466966_0034117 Ga0466966_0034117_2434_2925 163
1523 3300044693 Ga0466961_0100218 Ga0466961_0100218_131_622 163
1524 3300044693 Ga0466961_0577662 Ga0466961_0577662_89_580 163
1525 3300044694 Ga0466963_0003301 Ga0466963_0003301_5331_5822 163
1526 3300044694 Ga0466963_0013950 Ga0466963_0013950_4311_4802 163
1527 3300044694 Ga0466963_0034218 Ga0466963_0034218_2173_2664 163
1528 3300044694 Ga0466963_0039949 Ga0466963_0039949_1306_1797 163
1529 3300044694 Ga0466963_0067971 Ga0466963_0067971_115_606 163
1530 3300044694 Ga0466963_0490886 Ga0466963_0490886_97_588 163
1531 3300044694 Ga0466963_0773301 Ga0466963_0773301_119_610 163
1532 3300044706 Ga0466964_0032722 Ga0466964_0032722_1526_2017 163
1533 3300044706 Ga0466964_0071820 Ga0466964_0071820_862_1353 163
1534 3300044719 Ga0466971_0032249 Ga0466971_0032249_1171_1662 163
1535 3300044719 Ga0466971_0087172 Ga0466971_0087172_552_1043 163
1536 3300044719 Ga0466971_0102698 Ga0466971_0102698_523_1014 163
1537 3300044719 Ga0466971_0163683 Ga0466971_0163683_136_627 163
1538 3300044719 Ga0466971_0269432 Ga0466971_0269432_97_588 163
1539 3300044765 Ga0466970_0577641 Ga0466970_0577641_98_589 163
1540 3300044765 Ga0466970_0647446 Ga0466970_0647446_111_602 163
1541 3300044842 Ga0466957_0002027 Ga0466957_0002027_4471_4962 163
1542 3300044842 Ga0466957_0009688 Ga0466957_0009688_3712_4203 163
1543 3300044842 Ga0466957_0046306 Ga0466957_0046306_1619_2110 163
1544 3300044842 Ga0466957_0204835 Ga0466957_0204835_536_1027 163
1545 3300044842 Ga0466957_0701279 Ga0466957_0701279_208_699 163
1546 3300044901 Ga0466960_0473884 Ga0466960_0473884_35_526 163
1547 3300045049 Ga0466959_0013667 Ga0466959_0013667_2529_3020 163
1548 3300045049 Ga0466959_0084882 Ga0466959_0084882_1269_1760 163
1549 3300045836 Ga0466958_0079676 Ga0466958_0079676_635_1126 163
1550 3300045836 Ga0466958_1074930 Ga0466958_1074930_11_502 163
1551 3300045976 Ga0466967_0003611 Ga0466967_0003611_4454_4945 163
1552 3300045976 Ga0466967_0007454 Ga0466967_0007454_1901_2392 163
1553 3300045976 Ga0466967_0015627 Ga0466967_0015627_1425_1916 163
1554 3300045976 Ga0466967_0019455 Ga0466967_0019455_2532_3023 163
1555 3300045976 Ga0466967_0037136 Ga0466967_0037136_1098_1589 163
1556 3300045976 Ga0466967_0103000 Ga0466967_0103000_1253_1756 163
1557 3300045976 Ga0466967_0130330 Ga0466967_0130330_305_796 163
1558 3300045976 Ga0466967_0134300 Ga0466967_0134300_1115_1606 163
1559 3300045976 Ga0466967_0448196 Ga0466967_0448196_611_1102 163
1560 3300045976 Ga0466967_0480398 Ga0466967_0480398_575_1066 163
1561 3300045976 Ga0466967_0588648 Ga0466967_0588648_537_1028 163
1562 3300045976 Ga0466967_1388308 Ga0466967_1388308_162_653 163
1563 3300046474 Ga0495605_0142417 Ga0495605_0142417_116_619 163
1564 3300046525 Ga0495663_0061892 Ga0495663_0061892_425_916 163
1565 3300046525 Ga0495663_0306497 Ga0495663_0306497_11_502 163
1566 3300046616 Ga0495668_0006675 Ga0495668_0006675_4760_5251 163
1567 3300046681 Ga0495647_0202537 Ga0495647_0202537_210_701 163
1568 3300046684 Ga0495669_0000306 Ga0495669_0000306_22102_22593 163
1569 3300046684 Ga0495669_0007410 Ga0495669_0007410_1196_1687 163
1570 3300046684 Ga0495669_0017096 Ga0495669_0017096_1041_1541 163
1571 3300046684 Ga0495669_0021849 Ga0495669_0021849_861_1352 163
1572 3300046684 Ga0495669_0039320 Ga0495669_0039320_759_1250 163
1573 3300046684 Ga0495669_0071156 Ga0495669_0071156_286_777 163
1574 3300046684 Ga0495669_0103738 Ga0495669_0103738_357_848 163
1575 3300046810 Ga0495660_0458837 Ga0495660_0458837_23_514 163
1576 3300047323 Ga0495683_0168076 Ga0495683_0168076_366_857 163
1577 3300047443 Ga0495687_100660 Ga0495687_100660_238_729 163
1578 3300047445 Ga0495677_0106911 Ga0495677_0106911_49_540 163
1579 3300048088 Ga0495602_0155291 Ga0495602_0155291_990_1481 163
1580 3300048903 Ga0496100_0005362 Ga0496100_0005362_5021_5512 163
1581 3300048903 Ga0496100_0441594 Ga0496100_0441594_276_767 163
1582 3300048904 Ga0496101_0001845 Ga0496101_0001845_7110_7601 163
1583 3300048904 Ga0496101_0560807 Ga0496101_0560807_281_772 163
1584 3300048905 Ga0496102_0186202 Ga0496102_0186202_933_1424 163
1585 3300048906 Ga0496103_0422029 Ga0496103_0422029_300_791 163
1586 3300048907 Ga0496104_0063254 Ga0496104_0063254_2777_3268 163
1587 3300048908 Ga0496105_0035375 Ga0496105_0035375_3462_3953 163
1588 3300048909 Ga0496106_0002590 Ga0496106_0002590_1577_2068 163
1589 3300048909 Ga0496106_0024920 Ga0496106_0024920_2367_2858 163
1590 3300048910 Ga0496107_0002051 Ga0496107_0002051_6943_7434 163
1591 3300048910 Ga0496107_0003122 Ga0496107_0003122_4980_5471 163
1592 3300048910 Ga0496107_0107809 Ga0496107_0107809_702_1193 163
1593 3300048910 Ga0496107_0117606 Ga0496107_0117606_1371_1862 163
1594 3300048910 Ga0496107_0375785 Ga0496107_0375785_296_787 163
1595 3300048910 Ga0496107_0814714 Ga0496107_0814714_28_519 163
1596 3300048911 Ga0496108_0004931 Ga0496108_0004931_7581_8072 163
1597 3300048911 Ga0496108_0016413 Ga0496108_0016413_2450_2941 163
1598 3300048911 Ga0496108_0024347 Ga0496108_0024347_827_1318 163
1599 3300048911 Ga0496108_0252026 Ga0496108_0252026_971_1465 163
1600 3300048912 Ga0496109_0014535 Ga0496109_0014535_5412_5903 163
1601 3300048912 Ga0496109_0027613 Ga0496109_0027613_3254_3745 163
1602 3300048912 Ga0496109_0132943 Ga0496109_0132943_751_1242 163
1603 3300048912 Ga0496109_0339215 Ga0496109_0339215_798_1289 163
1604 3300048913 Ga0496110_0009431 Ga0496110_0009431_4153_4644 163
1605 3300048913 Ga0496110_0029480 Ga0496110_0029480_196_687 163
1606 3300048913 Ga0496110_0056128 Ga0496110_0056128_2168_2659 163
1607 3300048913 Ga0496110_0127609 Ga0496110_0127609_215_706 163
1608 3300048914 Ga0496111_0001035 Ga0496111_0001035_5398_5889 163
1609 3300048914 Ga0496111_0004529 Ga0496111_0004529_3925_4416 163
1610 3300048914 Ga0496111_0023837 Ga0496111_0023837_1723_2214 163
1611 3300048914 Ga0496111_0060749 Ga0496111_0060749_410_901 163
1612 3300048915 Ga0496112_0005570 Ga0496112_0005570_7906_8397 163
1613 3300048915 Ga0496112_0013316 Ga0496112_0013316_2788_3279 163
1614 3300048915 Ga0496112_0032641 Ga0496112_0032641_383_874 163
1615 3300048915 Ga0496112_0074485 Ga0496112_0074485_702_1193 163
1616 3300048915 Ga0496112_0076688 Ga0496112_0076688_822_1313 163
1617 3300048915 Ga0496112_0264143 Ga0496112_0264143_723_1214 163
1618 3300048915 Ga0496112_0635805 Ga0496112_0635805_173_664 163
1619 3300048916 Ga0496113_0018400 Ga0496113_0018400_2415_2906 163
1620 3300048916 Ga0496113_0019087 Ga0496113_0019087_382_873 163
1621 3300048916 Ga0496113_0025796 Ga0496113_0025796_1157_1648 163
1622 3300048916 Ga0496113_0077172 Ga0496113_0077172_683_1174 163
1623 3300048916 Ga0496113_0114623 Ga0496113_0114623_1565_2056 163
1624 3300048916 Ga0496113_0282054 Ga0496113_0282054_504_995 163
1625 3300048925 Ga0496122_0000083 Ga0496122_0000083_173369_173869 163
1626 3300048926 Ga0496123_0000097 Ga0496123_0000097_87562_88062 163
1627 3300048929 Ga0496126_0059355 Ga0496126_0059355_2727_3227 163
1628 3300049583 Ga0501067_0405608 Ga0501067_0405608_203_694 163
1629 3300049586 Ga0501070_0995623 Ga0501070_0995623_67_558 163
1630 3300049590 Ga0501074_0049301 Ga0501074_0049301_703_1194 163
1631 3300049649 Ga0501198_073092 Ga0501198_073092_146_637 163
1632 3300049664 Ga0501224_020851 Ga0501224_020851_202_693 163
1633 3300049667 Ga0501230_084709 Ga0501230_084709_153_644 163
1634 3300049668 Ga0501233_052972 Ga0501233_052972_288_779 163
1635 3300049675 Ga0501243_014443 Ga0501243_014443_183_674 163
1636 3300049679 Ga0501249_047177 Ga0501249_047177_190_690 163
1637 3300049686 Ga0501257_094286 Ga0501257_094286_253_753 163
1638 3300049705 Ga0501225_0012490 Ga0501225_0012490_791_1282 163
1639 3300049759 Ga0501262_008416 Ga0501262_008416_636_1127 163
1640 3300049760 Ga0501263_009557 Ga0501263_009557_18_509 163
1641 3300049768 Ga0501271_019569 Ga0501271_019569_268_759 163
1642 3300049770 Ga0501273_013457 Ga0501273_013457_188_679 163
1643 3300049770 Ga0501273_018704 Ga0501273_018704_423_914 163
1644 3300050511 nmdc:mga08y16_970606_c1 nmdc:mga08y16_970606_c1_80_574 163
1645 3300050512 nmdc:mga0n895_170208_c1 nmdc:mga0n895_170208_c1_1444_1935 163
1646 3300053088 Ga0500644_0039165 Ga0500644_0039165_734_1249 163
1647 3300053156 Ga0500622_0049373 Ga0500622_0049373_1553_2068 163
1648 3300053158 Ga0500627_0257803 Ga0500627_0257803_255_746 163
1649 3300059421 Ga0590071_056454 Ga0590071_056454_211_711 163
1650 3300059424 Ga0590075_015112 Ga0590075_015112_830_1330 163
1651 3300061719 Ga0466962_0165699 Ga0466962_0165699_574_1065 163
1652 3300061719 Ga0466962_0229125 Ga0466962_0229125_314_805 163

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01467

CTP_transf_like

Cytidylyltransferase-like

7

138

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
6b7d-assembly1.cif.gz_A crystal structure of e.coli phosphopantetheine adenylyltransferase (ppat/coad) in complex with 3-(4-chlorophenyl)-6-methoxy-4,5-dimethylpyridazine 0.975 2 159
6b7b-assembly1.cif.gz_A crystal structure of e.coli phosphopantetheine adenylyltransferase (ppat/coad) in complex with 5-methoxy-2-methyl-1h-indole 0.9733 2 159
3l93-assembly1.cif.gz_A phosphopantetheine adenylyltransferase from yersinia pestis. 0.9703 1 158
1qjc-assembly1.cif.gz_B phosphopantetheine adenylyltransferase from escherichia coli in complex with 4'-phosphopantetheine 0.969 2 158
8i8i-assembly2.cif.gz_C-2 crystal structure of phosphopantetheine adenylyltransferase from klebsiella pneumoniae at 2.59 a resolution 0.9641 2 158
ID Description Score Start End Superfamily
6g7vA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9635 1 158 3.40.50.620
5ts2A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9578 1 158 3.40.50.620
3nbkD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9573 1 158 3.40.50.620
6g7vA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9507 1 158 3.40.50.620
3nd7D00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9417 2 156 3.40.50.620
ID Description Score Start End GO Terms
AF-A0A7G9SKH7-F1-model_v4 Phosphopantetheine adenylyltransferase (EC 2.7.7.3) (Dephospho-CoA pyrophosphorylase) (Pantetheine-phosphate adenylyltransferase) (PPAT) 0.9949 1 159 GO:0004595
GO:0005524
GO:0005737
GO:0015937
AF-A0A3A0EP61-F1-model_v4 Phosphopantetheine adenylyltransferase (EC 2.7.7.3) (Dephospho-CoA pyrophosphorylase) (Pantetheine-phosphate adenylyltransferase) (PPAT) 0.9827 2 160 GO:0004595
GO:0005524
GO:0005737
GO:0015937
AF-A0A0Q4CFV7-F1-model_v4 Phosphopantetheine adenylyltransferase (EC 2.7.7.3) (Dephospho-CoA pyrophosphorylase) (Pantetheine-phosphate adenylyltransferase) (PPAT) 0.9807 19 163 GO:0004595
GO:0005524
GO:0005737
GO:0015937
AF-A5V280-F1-model_v4 Phosphopantetheine adenylyltransferase (EC 2.7.7.3) (Dephospho-CoA pyrophosphorylase) (Pantetheine-phosphate adenylyltransferase) (PPAT) 0.9805 1 160 GO:0004595
GO:0005524
GO:0005737
GO:0015937
AF-A0A7G6VR98-F1-model_v4 Phosphopantetheine adenylyltransferase (EC 2.7.7.3) (Dephospho-CoA pyrophosphorylase) (Pantetheine-phosphate adenylyltransferase) (PPAT) 0.9791 2 162 GO:0004595
GO:0005524
GO:0005737
GO:0015937

Feature Viewer

pLDDT pTM Quality
90.55 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map