F495202

General Info

Members Datasets Scaffolds Average Seq Length
1649 701 3298 247

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|8019629233|8019636911
Length 288
Sequence TLLTLQVLVAVVCLALWQLLSTVPVFGKILLPPFFFSNPVDVFAQIVKWFSSRVIWKHLGITLTESILAFVIGSAGGVLIGFWFARQPLVAAVFDPYVKMVNALPRVVLAPIFALWLGLGIWSKVALGVTLVFFIVFFNVYQGVKEVSRTVLDNGRMLGMSERQLMQHVYWPSALSWMFSSLHTSVGFCRGRCRRRRVSGIGGGARLPHSAGRGHIRRRRRLRRHVRAVGLRHPDRFWRDIGGAETAGLAPDRGRAWLSREGPAHRASPGSRKLNPAAWCHRGPAAAS

Samples

Sample ID Description Type Environment
1 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
4 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
5 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
6 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
7 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
8 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
9 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
10 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
11 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
12 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
13 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
14 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
15 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
16 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
17 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
18 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
19 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
20 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
21 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
22 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
23 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
24 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
25 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
26 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
27 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
28 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
29 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
30 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
31 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
32 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
33 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
34 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
35 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
36 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
37 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
38 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
39 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
40 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
41 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
42 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
43 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
44 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
45 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
46 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
47 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
48 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
49 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
50 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
51 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
52 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
53 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
54 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
55 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
56 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
57 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
58 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
59 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
60 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
61 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
62 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
63 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
64 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
65 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
66 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
67 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
68 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
69 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
70 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
71 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
72 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
73 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
74 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
75 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
76 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
77 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
78 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
79 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
80 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
81 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
82 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
83 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
84 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
85 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
86 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
87 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
88 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
89 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
90 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
91 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
92 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
93 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
94 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
95 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
96 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
97 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
98 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
99 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
100 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
101 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
102 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
103 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
104 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
105 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
106 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
107 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
108 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
109 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
110 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
111 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
112 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
113 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
114 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
115 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
116 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
117 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
118 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
119 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
120 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
121 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
122 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
123 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
124 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
125 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
126 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
127 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
128 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
129 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
130 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
131 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
132 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
133 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
134 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
135 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
136 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
137 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
138 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
139 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
140 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
141 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
142 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
143 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
144 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
145 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
146 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
147 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
148 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
149 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
150 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
151 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
152 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
153 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
154 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
155 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
156 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
157 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
158 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
222 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
223 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
224 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
226 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
227 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
231 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
232 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
233 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
234 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
235 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
236 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
237 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
238 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
239 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
240 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
241 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
242 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
243 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
244 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
245 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
246 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
247 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
248 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
249 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
250 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
251 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
252 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
253 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
254 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
255 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
256 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
257 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
258 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
259 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
260 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
261 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
262 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
263 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
264 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
265 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
266 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
267 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
268 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
269 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
270 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
271 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
272 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
273 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
274 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
275 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
276 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
277 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
278 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
279 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
280 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
281 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
282 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
283 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
284 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
285 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
286 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
287 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
288 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
289 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
290 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
291 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
292 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
293 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
294 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
295 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
296 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
297 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
298 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
299 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
300 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
301 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
302 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
303 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
304 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
305 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
306 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
307 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
308 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
309 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
310 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
311 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
312 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
313 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
314 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
315 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
316 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
317 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
318 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
319 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
320 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
321 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
322 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
323 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
324 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
325 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
326 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
327 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
328 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
329 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
330 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
331 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
332 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
333 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
334 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
335 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
336 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
337 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
338 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
339 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
340 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
341 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
342 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
343 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
344 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
345 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
346 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
347 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
348 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
349 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
350 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
351 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
352 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
353 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
354 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
355 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
356 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
357 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
358 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
359 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
360 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
361 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
362 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
363 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
364 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
365 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
366 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
367 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
368 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
369 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
370 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
371 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
372 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
373 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
374 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
375 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
376 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
377 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
378 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
379 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
380 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
381 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
382 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
383 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
384 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
385 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
386 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
387 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
388 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
389 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
390 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
391 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
392 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
393 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
394 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
395 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
396 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
397 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
398 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
399 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
400 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
401 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
402 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
403 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
404 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
405 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
406 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
407 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
408 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
409 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
410 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
411 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
412 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
413 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
414 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
415 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
416 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
417 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
418 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
419 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
420 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
421 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
422 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
423 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
424 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
425 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
426 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
427 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
428 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
429 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
430 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
431 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
432 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
433 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
434 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
435 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
436 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
437 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
438 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
439 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
440 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
441 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
442 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
443 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
444 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
445 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
446 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
447 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
448 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
449 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
450 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
451 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
452 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
453 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
454 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
455 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
456 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
457 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
458 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
459 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
460 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
461 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
462 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
463 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
464 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
465 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
466 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
467 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
468 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
469 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
470 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
471 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
472 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
473 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
474 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
475 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
476 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
477 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
478 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
479 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
480 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
481 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
482 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
483 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
484 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
485 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
486 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
487 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
488 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
489 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
490 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
491 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
492 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
493 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
494 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
495 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
496 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
497 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
498 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
499 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
500 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
501 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
502 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
503 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
504 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
505 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
506 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
507 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
508 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
509 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
510 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
511 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
512 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
513 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
514 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
515 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
516 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
517 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
518 2791355199
519 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
520 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
521 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
522 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
523 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
524 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
525 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
526 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
527 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
528 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
529 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
530 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
531 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
532 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
533 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
534 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
535 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
536 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
537 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
538 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
539 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
540 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
541 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
542 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
543 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
544 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
545 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
546 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
547 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
548 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
549 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
550 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
551 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
552 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
553 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
554 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
555 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
556 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
557 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
558 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
559 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
560 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
561 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
562 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
563 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
564 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
565 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
566 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
567 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
568 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
569 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
570 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
571 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
572 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
573 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
574 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
575 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
576 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
577 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
578 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
579 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
580 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
581 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
582 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
583 2904699407
584 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
585 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
586 2906610324
587 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
588 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
589 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
590 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
591 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
592 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
593 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
594 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
595 2922368715
596 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
597 2922425934
598 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
599 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
600 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
601 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
602 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
603 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
604 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
605 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
606 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
607 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
608 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
609 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
610 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
611 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
612 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
613 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
614 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
615 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
616 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
617 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
618 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
619 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
620 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
621 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
622 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
623 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
624 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
625 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
626 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
627 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
628 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
629 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
630 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
631 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
632 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
633 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
634 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
635 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
636 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
637 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
638 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
639 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
640 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
641 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
642 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
643 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
644 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
645 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
646 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
647 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
648 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
649 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
650 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
651 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
652 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
653 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
654 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
655 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
656 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
657 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
658 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
659 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
660 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
661 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
662 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
663 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
664 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
665 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
666 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
667 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
668 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
669 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
670 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
671 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
672 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
673 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
674 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
675 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
676 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
677 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
678 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
679 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
680 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
681 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
682 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
683 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
684 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
685 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
686 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
687 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
688 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
689 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
690 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
691 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
692 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
693 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
694 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
695 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
696 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
697 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
698 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
699 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
700 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
701 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 87.23
Metatranscriptomes 0.06
Isolates 12.71

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.37
Nodule 9.64
Rhizoplane 6.49
Rhizosphere 70.47
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24752J21851_1013560 3300001976 Bacteria 1063
2 JGI24739J22299_10024130 3300001989 Bacteria 2146
3 JGI24743J22301_10013812 3300001991 Bacteria 1483
4 JGI24750J21931_1001325 3300002070 Bacteria 3115
5 JGI24738J21930_10012496 3300002075 Bacteria 1855
6 JGI24744J21845_10000746 3300002077 Bacteria 6047
7 JGI24742J22300_10002634 3300002244 Bacteria 2880
8 JGI25406J46586_10000721 3300003203 Bacteria 15439
9 JGI25153J46596_10000972 3300003215 Bacteria 17390
10 JGI25153J46596_10001764 3300003215 Bacteria 12825
11 JGI25153J46596_10010358 3300003215 Bacteria 4222
12 Ga0055531_10005831 3300003794 Bacteria 7121
13 Ga0055543_1010715 3300004625 Bacteria 1909
14 Ga0065165_1000437 3300005262 Bacteria 65503
15 Ga0065165_1001951 3300005262 Bacteria 19574
16 Ga0065165_1049590 3300005262 Bacteria 1199
17 Ga0070658_10037403 3300005327 Bacteria 3913
18 Ga0070676_10019842 3300005328 Bacteria 3745
19 Ga0070690_100015880 3300005330 Bacteria 4498
20 Ga0070690_100036374 3300005330 Bacteria 3094
21 Ga0070690_100084933 3300005330 Bacteria 2076
22 Ga0070670_100015836 3300005331 Bacteria 6471
23 Ga0070670_100328135 3300005331 Bacteria 1342
24 Ga0070677_10182878 3300005333 Bacteria 1000
25 Ga0070666_10014730 3300005335 Bacteria 4981
26 Ga0070666_10073403 3300005335 Bacteria 2330
27 Ga0070666_10075916 3300005335 Bacteria 2292
28 Ga0070680_100010483 3300005336 Bacteria 7147
29 Ga0070680_100018027 3300005336 Bacteria 5576
30 Ga0070680_100018900 3300005336 Bacteria 5451
31 Ga0070680_100030562 3300005336 Bacteria 4327
32 Ga0070680_100173015 3300005336 Bacteria 1817
33 Ga0070680_100248283 3300005336 Bacteria 1504
34 Ga0070682_100004250 3300005337 Bacteria 7949
35 Ga0070682_100072098 3300005337 Bacteria 2212
36 Ga0068868_100024743 3300005338 Bacteria 4558
37 Ga0068868_100039833 3300005338 Bacteria 3654
38 Ga0070660_100021209 3300005339 Bacteria 4787
39 Ga0070660_100089367 3300005339 Bacteria 2427
40 Ga0070660_100103432 3300005339 Bacteria 2259
41 Ga0070660_100110684 3300005339 Bacteria 2184
42 Ga0070660_100145179 3300005339 Bacteria 1905
43 Ga0070660_100275583 3300005339 Bacteria 1376
44 Ga0070689_100005294 3300005340 Bacteria 8792
45 Ga0070689_100050960 3300005340 Bacteria 3198
46 Ga0070689_100259276 3300005340 Bacteria 1436
47 Ga0070691_10029205 3300005341 Bacteria 2579
48 Ga0070687_100081192 3300005343 Bacteria 1770
49 Ga0070687_100085120 3300005343 Bacteria 1735
50 Ga0070687_100191189 3300005343 Bacteria 1233
51 Ga0070661_100056508 3300005344 Bacteria 2876
52 Ga0070661_100074196 3300005344 Bacteria 2505
53 Ga0070661_100097961 3300005344 Bacteria 2178
54 Ga0070661_100275869 3300005344 Bacteria 1303
55 Ga0070692_10008935 3300005345 Bacteria 4492
56 Ga0070668_100002961 3300005347 Bacteria 12555
57 Ga0070668_100016017 3300005347 Bacteria 5609
58 Ga0070669_100034136 3300005353 Bacteria 3683
59 Ga0070669_100207283 3300005353 Bacteria 1545
60 Ga0070675_100080368 3300005354 Bacteria 2717
61 Ga0070675_100113008 3300005354 Bacteria 2300
62 Ga0070671_100028027 3300005355 Bacteria 4637
63 Ga0070671_100095258 3300005355 Bacteria 2495
64 Ga0070671_100164379 3300005355 Bacteria 1876
65 Ga0070674_100017252 3300005356 Bacteria 4537
66 Ga0070674_100236345 3300005356 Bacteria 1428
67 Ga0070673_100164389 3300005364 Bacteria 1889
68 Ga0070688_100039441 3300005365 Bacteria 2890
69 Ga0070688_100066702 3300005365 Bacteria 2291
70 Ga0070688_100288638 3300005365 Bacteria 1181
71 Ga0070659_100009176 3300005366 Bacteria 7256
72 Ga0070659_100018698 3300005366 Bacteria 5231
73 Ga0070659_100278351 3300005366 Bacteria 1391
74 Ga0070667_100013737 3300005367 Bacteria 6693
75 Ga0070667_100060010 3300005367 Bacteria 3219
76 Ga0070667_100281734 3300005367 Bacteria 1493
77 Ga0070667_100409866 3300005367 Bacteria 1235
78 Ga0070709_10000436 3300005434 Bacteria 25236
79 Ga0070709_10067371 3300005434 Bacteria 2299
80 Ga0070709_10257862 3300005434 Bacteria 1259
81 Ga0070714_100010313 3300005435 Bacteria 7382
82 Ga0070714_100054416 3300005435 Bacteria 3419
83 Ga0070714_100229512 3300005435 Bacteria 1709
84 Ga0070714_100395797 3300005435 Bacteria 1305
85 Ga0070713_100013145 3300005436 Bacteria 6101
86 Ga0070713_100035772 3300005436 Bacteria 4002
87 Ga0070713_100048882 3300005436 Bacteria 3486
88 Ga0070713_100072680 3300005436 Bacteria 2910
89 Ga0070713_100138796 3300005436 Bacteria 2151
90 Ga0070713_100461949 3300005436 Bacteria 1194
91 Ga0070710_10000185 3300005437 Bacteria 28883
92 Ga0070710_10133350 3300005437 Bacteria 1516
93 Ga0070701_10011181 3300005438 Bacteria 4002
94 Ga0070701_10054610 3300005438 Bacteria 2083
95 Ga0070701_10320750 3300005438 Bacteria 958
96 Ga0070711_100014594 3300005439 Bacteria 4950
97 Ga0070711_100033297 3300005439 Bacteria 3431
98 Ga0070711_100274802 3300005439 Bacteria 1331
99 Ga0070711_100364544 3300005439 Bacteria 1164
100 Ga0070705_100037865 3300005440 Bacteria 2724
101 Ga0070700_100039639 3300005441 Bacteria 2879
102 Ga0070700_100201761 3300005441 Bacteria 1397
103 Ga0070694_100037437 3300005444 Bacteria 3218
104 Ga0070663_100014170 3300005455 Bacteria 5111
105 Ga0070663_100041743 3300005455 Bacteria 3220
106 Ga0070663_100069500 3300005455 Bacteria 2559
107 Ga0070663_100141143 3300005455 Bacteria 1839
108 Ga0070678_100016308 3300005456 Bacteria 4750
109 Ga0070678_100120292 3300005456 Bacteria 2070
110 Ga0070678_100194581 3300005456 Bacteria 1669
111 Ga0070662_100038911 3300005457 Bacteria 3381
112 Ga0070662_100077588 3300005457 Bacteria 2465
113 Ga0070662_100163917 3300005457 Bacteria 1740
114 Ga0070662_100173824 3300005457 Bacteria 1693
115 Ga0070662_100490243 3300005457 Bacteria 1024
116 Ga0070681_10009008 3300005458 Bacteria 9810
117 Ga0070681_10020592 3300005458 Bacteria 6610
118 Ga0070681_10044892 3300005458 Bacteria 4423
119 Ga0070681_10058748 3300005458 Bacteria 3826
120 Ga0070681_10097480 3300005458 Bacteria 2887
121 Ga0070681_10131503 3300005458 Bacteria 2435
122 Ga0070681_10164638 3300005458 Bacteria 2141
123 Ga0070681_10165253 3300005458 Bacteria 2136
124 Ga0070681_10273786 3300005458 Bacteria 1599
125 Ga0068867_100031505 3300005459 Bacteria 3829
126 Ga0068867_100089468 3300005459 Bacteria 2334
127 Ga0070685_10000890 3300005466 Bacteria 16081
128 Ga0070706_100113232 3300005467 Bacteria 2526
129 Ga0070707_100171193 3300005468 Bacteria 2116
130 Ga0070707_100655223 3300005468 Bacteria 1013
131 Ga0070698_100585944 3300005471 Bacteria 1055
132 Ga0070699_100348923 3300005518 Bacteria 1333
133 Ga0070699_100840283 3300005518 Bacteria 841
134 Ga0070679_100002598 3300005530 Bacteria 16417
135 Ga0070679_100008820 3300005530 Bacteria 9513
136 Ga0070679_100051260 3300005530 Bacteria 4110
137 Ga0070679_100074260 3300005530 Bacteria 3391
138 Ga0070679_100252295 3300005530 Bacteria 1720
139 Ga0070679_100750639 3300005530 Bacteria 919
140 Ga0070684_100038931 3300005535 Bacteria 4087
141 Ga0070684_100199218 3300005535 Bacteria 1823
142 Ga0070697_100012281 3300005536 Bacteria 6708
143 Ga0068853_100029267 3300005539 Bacteria 4641
144 Ga0068853_100069718 3300005539 Bacteria 3059
145 Ga0070672_100009850 3300005543 Bacteria 6605
146 Ga0070672_100433895 3300005543 Bacteria 1130
147 Ga0070686_100006389 3300005544 Bacteria 6547
148 Ga0070686_100044827 3300005544 Bacteria 2782
149 Ga0070686_100045395 3300005544 Bacteria 2767
150 Ga0070693_100037496 3300005547 Bacteria 2703
151 Ga0070693_100052962 3300005547 Bacteria 2328
152 Ga0070693_100069131 3300005547 Bacteria 2074
153 Ga0070693_100162973 3300005547 Bacteria 1422
154 Ga0070693_100216442 3300005547 Bacteria 1253
155 Ga0070693_100287298 3300005547 Bacteria 1104
156 Ga0070665_100020991 3300005548 Bacteria 6566
157 Ga0070665_100074134 3300005548 Bacteria 3409
158 Ga0070665_100245363 3300005548 Bacteria 1791
159 Ga0068855_100011578 3300005563 Bacteria 10652
160 Ga0068855_100048966 3300005563 Bacteria 4986
161 Ga0068855_100072165 3300005563 Bacteria 4013
162 Ga0068855_100232871 3300005563 Bacteria 2061
163 Ga0068855_100252752 3300005563 Bacteria 1965
164 Ga0068855_100278379 3300005563 Bacteria 1859
165 Ga0068855_100773992 3300005563 Bacteria 1022
166 Ga0070664_100133646 3300005564 Bacteria 2180
167 Ga0070664_100472174 3300005564 Bacteria 1153
168 Ga0068857_100048191 3300005577 Bacteria 3783
169 Ga0068857_100144805 3300005577 Bacteria 2150
170 Ga0068857_100306489 3300005577 Bacteria 1465
171 Ga0068857_100497490 3300005577 Bacteria 1144
172 Ga0068854_100000633 3300005578 Bacteria 20845
173 Ga0068854_100024255 3300005578 Bacteria 4150
174 Ga0068854_100108051 3300005578 Bacteria 2095
175 Ga0068854_100132186 3300005578 Bacteria 1907
176 Ga0068856_100000024 3300005614 Bacteria 141222
177 Ga0068856_100079660 3300005614 Bacteria 3248
178 Ga0068856_100093716 3300005614 Bacteria 2989
179 Ga0068856_100115016 3300005614 Bacteria 2689
180 Ga0068856_100162111 3300005614 Bacteria 2247
181 Ga0068856_100495384 3300005614 Bacteria 1243
182 Ga0070702_100008171 3300005615 Bacteria 5055
183 Ga0070702_100183565 3300005615 Bacteria 1371
184 Ga0068852_100009742 3300005616 Bacteria 7142
185 Ga0068852_100027366 3300005616 Bacteria 4647
186 Ga0068852_100111045 3300005616 Bacteria 2492
187 Ga0068852_100154490 3300005616 Bacteria 2136
188 Ga0068852_100342575 3300005616 Bacteria 1457
189 Ga0068852_100352830 3300005616 Bacteria 1437
190 Ga0068852_100495032 3300005616 Bacteria 1216
191 Ga0068859_100616763 3300005617 Bacteria 1178
192 Ga0068859_100711471 3300005617 Bacteria 1095
193 Ga0068864_100040289 3300005618 Bacteria 3996
194 Ga0068864_100436867 3300005618 Bacteria 1249
195 Ga0068866_10011785 3300005718 Bacteria 3793
196 Ga0068861_100006389 3300005719 Bacteria 8028
197 Ga0068851_10009390 3300005834 Bacteria 4547
198 Ga0068851_10011243 3300005834 Bacteria 4194
199 Ga0068851_10043174 3300005834 Bacteria 2272
200 Ga0068870_10022396 3300005840 Bacteria 3104
201 Ga0068870_10026249 3300005840 Bacteria 2902
202 Ga0068863_100034483 3300005841 Bacteria 4820
203 Ga0068863_100038510 3300005841 Bacteria 4548
204 Ga0068863_100475125 3300005841 Bacteria 1229
205 Ga0068858_100043618 3300005842 Bacteria 4159
206 Ga0068858_100088144 3300005842 Bacteria 2887
207 Ga0068858_100138500 3300005842 Bacteria 2284
208 Ga0068860_100000533 3300005843 Bacteria 46479
209 Ga0081455_10004098 3300005937 Bacteria 16494
210 Ga0081455_10005318 3300005937 Bacteria 14137
211 Ga0081538_10051528 3300005981 Bacteria 2470
212 Ga0081540_1000027 3300005983 Bacteria 151880
213 Ga0081540_1010304 3300005983 Bacteria 6341
214 Ga0081539_10000486 3300005985 Bacteria 84009
215 Ga0081539_10000748 3300005985 Bacteria 64594
216 Ga0070717_10001555 3300006028 Bacteria 15906
217 Ga0070717_10027524 3300006028 Bacteria 4544
218 Ga0070717_10066839 3300006028 Bacteria 2990
219 Ga0070717_10078344 3300006028 Bacteria 2769
220 Ga0070717_10232931 3300006028 Bacteria 1622
221 Ga0070717_10321973 3300006028 Bacteria 1378
222 Ga0075365_10006261 3300006038 Bacteria 6528
223 Ga0075365_10051569 3300006038 Bacteria 2718
224 Ga0075365_10066677 3300006038 Bacteria 2415
225 Ga0075365_10105525 3300006038 Bacteria 1933
226 Ga0075365_10219551 3300006038 Bacteria 1333
227 Ga0075368_10031959 3300006042 Bacteria 2042
228 Ga0075363_100056500 3300006048 Bacteria 2104
229 Ga0075363_100332126 3300006048 Bacteria 885
230 Ga0075364_10064444 3300006051 Bacteria 2405
231 Ga0075364_10105987 3300006051 Bacteria 1873
232 Ga0075432_10013314 3300006058 Bacteria 2795
233 Ga0075432_10099965 3300006058 Bacteria 1071
234 Ga0070715_10052633 3300006163 Bacteria 1757
235 Ga0070716_100033604 3300006173 Bacteria 2807
236 Ga0070712_100047942 3300006175 Bacteria 2959
237 Ga0070712_100085211 3300006175 Bacteria 2299
238 Ga0070712_100109960 3300006175 Bacteria 2055
239 Ga0070712_100166089 3300006175 Bacteria 1709
240 Ga0070712_100235614 3300006175 Bacteria 1456
241 Ga0075362_10055027 3300006177 Bacteria 1789
242 Ga0075362_10150681 3300006177 Bacteria 1116
243 Ga0075367_10193800 3300006178 Bacteria 1268
244 Ga0075369_10080685 3300006186 Bacteria 1442
245 Ga0075427_10002297 3300006194 Bacteria 2552
246 Ga0075366_10071167 3300006195 Bacteria 2072
247 Ga0097621_100012752 3300006237 Bacteria 6245
248 Ga0097621_100035743 3300006237 Bacteria 3971
249 Ga0097621_100160257 3300006237 Bacteria 1934
250 Ga0097621_100199664 3300006237 Bacteria 1736
251 Ga0097621_100345090 3300006237 Bacteria 1323
252 Ga0075370_10078423 3300006353 Bacteria 1896
253 Ga0075370_10236851 3300006353 Bacteria 1080
254 Ga0068871_100005825 3300006358 Bacteria 8660
255 Ga0068871_100024591 3300006358 Bacteria 4673
256 Ga0068871_100273988 3300006358 Bacteria 1475
257 Ga0075428_100011938 3300006844 Bacteria 9663
258 Ga0075428_100018375 3300006844 Bacteria 7731
259 Ga0075428_100056300 3300006844 Bacteria 4307
260 Ga0075428_100350082 3300006844 Bacteria 1585
261 Ga0075428_100445740 3300006844 Bacteria 1387
262 Ga0075430_100001810 3300006846 Bacteria 17493
263 Ga0075430_100100805 3300006846 Bacteria 2411
264 Ga0075431_100009712 3300006847 Bacteria 9663
265 Ga0075431_100044879 3300006847 Bacteria 4558
266 Ga0075433_10000766 3300006852 Bacteria 22081
267 Ga0075434_100002178 3300006871 Bacteria 17081
268 Ga0075434_100018782 3300006871 Bacteria 6683
269 Ga0075434_100122198 3300006871 Bacteria 2620
270 Ga0075429_100019327 3300006880 Bacteria 5900
271 Ga0075429_100034915 3300006880 Bacteria 4370
272 Ga0068865_100242962 3300006881 Bacteria 1417
273 Ga0075436_100003019 3300006914 Bacteria 11531
274 Ga0075436_100008760 3300006914 Bacteria 6918
275 Ga0075436_100068876 3300006914 Bacteria 2445
276 Ga0075436_100338020 3300006914 Bacteria 1083
277 Ga0097620_100616776 3300006931 Bacteria 1178
278 Ga0097620_100711494 3300006931 Bacteria 1095
279 Ga0099824_1004900 3300006942 Bacteria 19056
280 Ga0099822_1000677 3300006943 Bacteria 34391
281 Ga0075435_100007621 3300007076 Bacteria 7730
282 Ga0075435_100131225 3300007076 Bacteria 2097
283 Ga0075435_100239220 3300007076 Bacteria 1544
284 Ga0105240_10006156 3300009093 Bacteria 17687
285 Ga0105240_10013828 3300009093 Bacteria 11055
286 Ga0105240_10018559 3300009093 Bacteria 9336
287 Ga0105240_10027519 3300009093 Bacteria 7441
288 Ga0105240_10044366 3300009093 Bacteria 5650
289 Ga0105240_10072015 3300009093 Bacteria 4272
290 Ga0105240_10138125 3300009093 Bacteria 2916
291 Ga0105240_10516447 3300009093 Bacteria 1326
292 Ga0111539_10002672 3300009094 Bacteria 23612
293 Ga0111539_10084856 3300009094 Bacteria 3722
294 Ga0111539_10107005 3300009094 Bacteria 3281
295 Ga0111539_10353568 3300009094 Bacteria 1710
296 Ga0105245_10050761 3300009098 Bacteria 3719
297 Ga0105245_10078640 3300009098 Bacteria 3010
298 Ga0105245_10426735 3300009098 Bacteria 1330
299 Ga0105245_10701519 3300009098 Bacteria 1045
300 Ga0105247_10019831 3300009101 Bacteria 4039
301 Ga0105247_10026371 3300009101 Bacteria 3508
302 Ga0105247_10089700 3300009101 Bacteria 1950
303 Ga0114129_10004982 3300009147 Bacteria 18716
304 Ga0114129_10010606 3300009147 Bacteria 13139
305 Ga0114129_10012982 3300009147 Bacteria 11860
306 Ga0114129_10054096 3300009147 Bacteria 5629
307 Ga0114129_10206213 3300009147 Bacteria 2660
308 Ga0114129_10221799 3300009147 Bacteria 2550
309 Ga0105243_10082094 3300009148 Bacteria 2633
310 Ga0105243_10130925 3300009148 Bacteria 2128
311 Ga0105243_10252460 3300009148 Bacteria 1575
312 Ga0105241_10018533 3300009174 Bacteria 5120
313 Ga0105242_10031555 3300009176 Bacteria 4233
314 Ga0105242_10168190 3300009176 Bacteria 1925
315 Ga0105248_10008661 3300009177 Bacteria 11178
316 Ga0105248_10058252 3300009177 Bacteria 4337
317 Ga0105248_10074783 3300009177 Bacteria 3807
318 Ga0105248_10184177 3300009177 Bacteria 2353
319 Ga0105248_10557608 3300009177 Bacteria 1293
320 Ga0105237_10003348 3300009545 Bacteria 19080
321 Ga0105237_10013574 3300009545 Bacteria 8534
322 Ga0105237_10015745 3300009545 Bacteria 7863
323 Ga0105237_10081927 3300009545 Bacteria 3218
324 Ga0105237_10151761 3300009545 Bacteria 2313
325 Ga0105237_10236393 3300009545 Bacteria 1828
326 Ga0105238_10016265 3300009551 Bacteria 7529
327 Ga0105238_10016948 3300009551 Bacteria 7393
328 Ga0105238_10019638 3300009551 Bacteria 6881
329 Ga0105238_10605824 3300009551 Bacteria 1103
330 Ga0105249_10028908 3300009553 Bacteria 5004
331 Ga0105249_10259361 3300009553 Bacteria 1726
332 Ga0099796_10071784 3300010159 Bacteria 1251
333 Ga0105239_10125290 3300010375 Bacteria 2855
334 Ga0105239_10165500 3300010375 Bacteria 2473
335 Ga0105239_10169086 3300010375 Bacteria 2444
336 Ga0105239_10209456 3300010375 Bacteria 2185
337 Ga0105239_10674726 3300010375 Bacteria 1181
338 Ga0105246_10038063 3300011119 Bacteria 3231
339 Ga0105246_10078014 3300011119 Bacteria 2351
340 Ga0105246_10175380 3300011119 Bacteria 1646
341 Ga0157373_10152063 3300013100 Bacteria 1628
342 Ga0157373_10167597 3300013100 Bacteria 1546
343 Ga0157373_10224689 3300013100 Bacteria 1325
344 Ga0157373_10226519 3300013100 Bacteria 1319
345 Ga0157371_10231160 3300013102 Bacteria 1329
346 Ga0157370_10012471 3300013104 Bacteria 8809
347 Ga0157370_10021928 3300013104 Bacteria 6361
348 Ga0157369_10029155 3300013105 Bacteria 6101
349 Ga0157369_10029245 3300013105 Bacteria 6090
350 Ga0157369_10360705 3300013105 Bacteria 1509
351 Ga0157369_10382204 3300013105 Bacteria 1461
352 Ga0157374_10045210 3300013296 Bacteria 4075
353 Ga0157374_10061407 3300013296 Bacteria 3520
354 Ga0157374_10442474 3300013296 Bacteria 1300
355 Ga0157378_10006828 3300013297 Bacteria 9956
356 Ga0157378_10406954 3300013297 Bacteria 1342
357 Ga0157378_10633444 3300013297 Bacteria 1083
358 Ga0163162_10123078 3300013306 Bacteria 2699
359 Ga0163162_10336447 3300013306 Bacteria 1642
360 Ga0163162_10521000 3300013306 Bacteria 1318
361 Ga0163162_10563717 3300013306 Bacteria 1266
362 Ga0157375_10010993 3300013308 Bacteria 7983
363 Ga0157375_10268468 3300013308 Bacteria 1868
364 Ga0157375_10710101 3300013308 Bacteria 1159
365 Ga0163163_10006916 3300014325 Bacteria 9958
366 Ga0163163_10012936 3300014325 Bacteria 7620
367 Ga0163163_10169200 3300014325 Bacteria 2232
368 Ga0163163_10739400 3300014325 Bacteria 1047
369 Ga0157380_10042206 3300014326 Bacteria 3564
370 Ga0157380_10124915 3300014326 Bacteria 2185
371 Ga0157380_10226525 3300014326 Bacteria 1676
372 Ga0182008_10098424 3300014497 Bacteria 1444
373 Ga0157377_10094929 3300014745 Bacteria 1767
374 Ga0157377_10190826 3300014745 Bacteria 1295
375 Ga0157379_10057220 3300014968 Bacteria 3484
376 Ga0157379_10348649 3300014968 Bacteria 1355
377 Ga0157379_10349932 3300014968 Bacteria 1352
378 Ga0157376_10130643 3300014969 Bacteria 2240
379 Ga0182005_1050508 3300015265 Bacteria 1130
380 Ga0163161_10102316 3300017792 Bacteria 2133
381 Ga0163161_10144311 3300017792 Bacteria 1804
382 Ga0197907_10526031 3300020069 Bacteria 1464
383 Ga0213872_10044763 3300021361 Bacteria 2014
384 Ga0213874_10001231 3300021377 Bacteria 5269
385 Ga0213876_10002022 3300021384 Bacteria 12093
386 Ga0213871_10002645 3300021441 Bacteria 3326
387 Ga0209563_102633 3300025230 Bacteria 3980
388 Ga0207425_1022885 3300025245 Bacteria 1312
389 Ga0209677_101136 3300025253 Bacteria 12437
390 Ga0209677_102452 3300025253 Bacteria 6965
391 Ga0209233_1001880 3300025261 Bacteria 8058
392 Ga0209233_1006454 3300025261 Bacteria 3777
393 Ga0209233_1007122 3300025261 Bacteria 3564
394 Ga0209455_1000714 3300025272 Bacteria 19245
395 Ga0209758_1000139 3300025297 Bacteria 175148
396 Ga0209758_1000141 3300025297 Bacteria 172481
397 Ga0209758_1001019 3300025297 Bacteria 37066
398 Ga0209758_1002921 3300025297 Bacteria 16464
399 Ga0209758_1007677 3300025297 Bacteria 7258
400 Ga0209758_1020105 3300025297 Bacteria 3179
401 Ga0209758_1059295 3300025297 Bacteria 1274
402 Ga0209256_1002956 3300025299 Bacteria 12733
403 Ga0209256_1044291 3300025299 Bacteria 1112
404 Ga0207426_1001139 3300025302 Bacteria 24022
405 Ga0207426_1007470 3300025302 Bacteria 4572
406 Ga0207426_1010967 3300025302 Bacteria 3483
407 Ga0209257_1006467 3300025304 Bacteria 7527
408 Ga0207656_10135628 3300025321 Bacteria 1156
409 Ga0207656_10168989 3300025321 Bacteria 1044
410 Ga0207682_10049528 3300025893 Bacteria 1735
411 Ga0207692_10000719 3300025898 Bacteria 11649
412 Ga0207692_10291648 3300025898 Bacteria 990
413 Ga0207642_10024407 3300025899 Bacteria 2430
414 Ga0207710_10155982 3300025900 Bacteria 1110
415 Ga0207688_10000092 3300025901 Bacteria 34911
416 Ga0207680_10049447 3300025903 Bacteria 2503
417 Ga0207680_10069773 3300025903 Bacteria 2173
418 Ga0207680_10356930 3300025903 Bacteria 1027
419 Ga0207647_10001257 3300025904 Bacteria 19505
420 Ga0207647_10051357 3300025904 Bacteria 2548
421 Ga0207647_10093484 3300025904 Bacteria 1792
422 Ga0207685_10019049 3300025905 Bacteria 2254
423 Ga0207685_10161466 3300025905 Bacteria 1023
424 Ga0207699_10000426 3300025906 Bacteria 21558
425 Ga0207699_10027047 3300025906 Bacteria 3171
426 Ga0207699_10101379 3300025906 Bacteria 1827
427 Ga0207699_10133571 3300025906 Bacteria 1622
428 Ga0207645_10001966 3300025907 Bacteria 16515
429 Ga0207645_10040592 3300025907 Bacteria 2980
430 Ga0207643_10001083 3300025908 Bacteria 16109
431 Ga0207705_10071393 3300025909 Bacteria 2517
432 Ga0207705_10073715 3300025909 Bacteria 2477
433 Ga0207705_10158465 3300025909 Bacteria 1699
434 Ga0207705_10334694 3300025909 Bacteria 1165
435 Ga0207684_10031999 3300025910 Bacteria 4474
436 Ga0207654_10001372 3300025911 Bacteria 12920
437 Ga0207654_10039611 3300025911 Bacteria 2651
438 Ga0207707_10000455 3300025912 Bacteria 42610
439 Ga0207707_10000754 3300025912 Bacteria 31878
440 Ga0207707_10068643 3300025912 Bacteria 3089
441 Ga0207707_10080025 3300025912 Bacteria 2853
442 Ga0207707_10091782 3300025912 Bacteria 2654
443 Ga0207707_10149064 3300025912 Bacteria 2045
444 Ga0207707_10182248 3300025912 Bacteria 1833
445 Ga0207707_10511341 3300025912 Bacteria 1023
446 Ga0207707_10567280 3300025912 Bacteria 963
447 Ga0207695_10000062 3300025913 Bacteria 351979
448 Ga0207695_10003366 3300025913 Bacteria 22590
449 Ga0207695_10026753 3300025913 Bacteria 6433
450 Ga0207695_10047053 3300025913 Bacteria 4568
451 Ga0207695_10175013 3300025913 Bacteria 2069
452 Ga0207695_10394481 3300025913 Bacteria 1269
453 Ga0207695_10653076 3300025913 Bacteria 933
454 Ga0207671_10001897 3300025914 Bacteria 23245
455 Ga0207671_10010070 3300025914 Bacteria 7837
456 Ga0207671_10017745 3300025914 Bacteria 5478
457 Ga0207671_10205913 3300025914 Bacteria 1538
458 Ga0207671_10231857 3300025914 Bacteria 1448
459 Ga0207693_10009769 3300025915 Bacteria 7810
460 Ga0207693_10016557 3300025915 Bacteria 5891
461 Ga0207663_10001359 3300025916 Bacteria 11334
462 Ga0207663_10090587 3300025916 Bacteria 2028
463 Ga0207663_10188430 3300025916 Bacteria 1479
464 Ga0207663_10203487 3300025916 Bacteria 1430
465 Ga0207660_10000925 3300025917 Bacteria 19374
466 Ga0207660_10036522 3300025917 Bacteria 3416
467 Ga0207660_10043144 3300025917 Bacteria 3168
468 Ga0207660_10046032 3300025917 Bacteria 3077
469 Ga0207660_10093980 3300025917 Bacteria 2228
470 Ga0207660_10163794 3300025917 Bacteria 1718
471 Ga0207662_10001580 3300025918 Bacteria 11150
472 Ga0207662_10020951 3300025918 Bacteria 3731
473 Ga0207657_10000702 3300025919 Bacteria 35592
474 Ga0207657_10023596 3300025919 Bacteria 5723
475 Ga0207657_10034662 3300025919 Bacteria 4536
476 Ga0207657_10054719 3300025919 Bacteria 3449
477 Ga0207657_10124086 3300025919 Bacteria 2122
478 Ga0207657_10232918 3300025919 Bacteria 1472
479 Ga0207649_10151555 3300025920 Bacteria 1597
480 Ga0207649_10244282 3300025920 Bacteria 1290
481 Ga0207652_10005840 3300025921 Bacteria 9970
482 Ga0207652_10007328 3300025921 Bacteria 8890
483 Ga0207652_10028141 3300025921 Bacteria 4687
484 Ga0207652_10029294 3300025921 Bacteria 4602
485 Ga0207652_10065888 3300025921 Bacteria 3138
486 Ga0207652_10186611 3300025921 Bacteria 1865
487 Ga0207652_10629737 3300025921 Bacteria 960
488 Ga0207681_10024566 3300025923 Bacteria 3869
489 Ga0207694_10005693 3300025924 Bacteria 9554
490 Ga0207694_10009233 3300025924 Bacteria 7442
491 Ga0207694_10034165 3300025924 Bacteria 3898
492 Ga0207694_10049584 3300025924 Bacteria 3250
493 Ga0207694_10397213 3300025924 Bacteria 1146
494 Ga0207650_10045983 3300025925 Bacteria 3213
495 Ga0207650_10075147 3300025925 Bacteria 2549
496 Ga0207659_10057286 3300025926 Bacteria 2793
497 Ga0207659_10114345 3300025926 Bacteria 2057
498 Ga0207659_10118807 3300025926 Bacteria 2023
499 Ga0207687_10010386 3300025927 Bacteria 6084
500 Ga0207687_10018589 3300025927 Bacteria 4591
501 Ga0207687_10151887 3300025927 Bacteria 1768
502 Ga0207700_10040939 3300025928 Bacteria 3386
503 Ga0207700_10052109 3300025928 Bacteria 3058
504 Ga0207700_10054848 3300025928 Bacteria 2993
505 Ga0207664_10006153 3300025929 Bacteria 8229
506 Ga0207664_10082042 3300025929 Bacteria 2626
507 Ga0207664_10166139 3300025929 Bacteria 1885
508 Ga0207664_10431081 3300025929 Bacteria 1175
509 Ga0207664_10723476 3300025929 Bacteria 895
510 Ga0207644_10043862 3300025931 Bacteria 3175
511 Ga0207644_10146486 3300025931 Bacteria 1823
512 Ga0207644_10286598 3300025931 Bacteria 1323
513 Ga0207690_10038008 3300025932 Bacteria 3129
514 Ga0207690_10456031 3300025932 Bacteria 1028
515 Ga0207706_10015496 3300025933 Bacteria 6887
516 Ga0207706_10034566 3300025933 Bacteria 4496
517 Ga0207706_10043327 3300025933 Bacteria 3988
518 Ga0207706_10441964 3300025933 Bacteria 1126
519 Ga0207686_10034442 3300025934 Bacteria 3031
520 Ga0207686_10107708 3300025934 Bacteria 1873
521 Ga0207686_10221488 3300025934 Bacteria 1366
522 Ga0207686_10287097 3300025934 Bacteria 1217
523 Ga0207709_10075840 3300025935 Bacteria 2151
524 Ga0207709_10117974 3300025935 Bacteria 1787
525 Ga0207709_10278794 3300025935 Bacteria 1234
526 Ga0207670_10020741 3300025936 Bacteria 4042
527 Ga0207670_10226528 3300025936 Bacteria 1434
528 Ga0207670_10290460 3300025936 Bacteria 1277
529 Ga0207669_10006478 3300025937 Bacteria 5354
530 Ga0207669_10010047 3300025937 Bacteria 4540
531 Ga0207669_10020955 3300025937 Bacteria 3439
532 Ga0207669_10028974 3300025937 Bacteria 3055
533 Ga0207665_10005437 3300025939 Bacteria 8507
534 Ga0207665_10034364 3300025939 Bacteria 3364
535 Ga0207665_10200976 3300025939 Bacteria 1452
536 Ga0207691_10002822 3300025940 Bacteria 16936
537 Ga0207711_10011989 3300025941 Bacteria 7204
538 Ga0207711_10166799 3300025941 Bacteria 1996
539 Ga0207711_10424877 3300025941 Bacteria 1236
540 Ga0207689_10009648 3300025942 Bacteria 8320
541 Ga0207661_10082464 3300025944 Bacteria 2658
542 Ga0207661_10144438 3300025944 Bacteria 2051
543 Ga0207661_10221609 3300025944 Bacteria 1672
544 Ga0207679_10023352 3300025945 Bacteria 4227
545 Ga0207679_10205475 3300025945 Bacteria 1648
546 Ga0207667_10006124 3300025949 Bacteria 14614
547 Ga0207667_10016626 3300025949 Bacteria 8306
548 Ga0207667_10037813 3300025949 Bacteria 5159
549 Ga0207667_10042144 3300025949 Bacteria 4854
550 Ga0207667_10063594 3300025949 Bacteria 3856
551 Ga0207667_10082010 3300025949 Bacteria 3341
552 Ga0207667_10131286 3300025949 Bacteria 2580
553 Ga0207667_10182890 3300025949 Bacteria 2152
554 Ga0207667_10267083 3300025949 Bacteria 1749
555 Ga0207667_10296643 3300025949 Bacteria 1651
556 Ga0207667_10599705 3300025949 Bacteria 1111
557 Ga0207712_10012776 3300025961 Bacteria 5369
558 Ga0207712_10208825 3300025961 Bacteria 1553
559 Ga0207668_10012977 3300025972 Bacteria 5119
560 Ga0207668_10042958 3300025972 Bacteria 3064
561 Ga0207668_10111603 3300025972 Bacteria 2053
562 Ga0207640_10021189 3300025981 Bacteria 3870
563 Ga0207640_10026938 3300025981 Bacteria 3497
564 Ga0207640_10048930 3300025981 Bacteria 2735
565 Ga0207640_10082342 3300025981 Bacteria 2204
566 Ga0207640_10090881 3300025981 Bacteria 2114
567 Ga0207640_10112194 3300025981 Bacteria 1935
568 Ga0207640_10141381 3300025981 Bacteria 1755
569 Ga0207658_10036453 3300025986 Bacteria 3526
570 Ga0207658_10056068 3300025986 Bacteria 2923
571 Ga0207677_10083478 3300026023 Bacteria 2300
572 Ga0207703_10054421 3300026035 Bacteria 3254
573 Ga0207703_10312192 3300026035 Bacteria 1437
574 Ga0207639_10025317 3300026041 Bacteria 4302
575 Ga0207639_10074465 3300026041 Bacteria 2666
576 Ga0207639_10091792 3300026041 Bacteria 2432
577 Ga0207639_10119411 3300026041 Bacteria 2164
578 Ga0207639_10280026 3300026041 Bacteria 1466
579 Ga0207639_10282306 3300026041 Bacteria 1461
580 Ga0207678_10005024 3300026067 Bacteria 11867
581 Ga0207678_10009376 3300026067 Bacteria 8615
582 Ga0207678_10059036 3300026067 Bacteria 3301
583 Ga0207678_10093753 3300026067 Bacteria 2565
584 Ga0207708_10000679 3300026075 Bacteria 26002
585 Ga0207708_10071266 3300026075 Bacteria 2662
586 Ga0207702_10000092 3300026078 Bacteria 103972
587 Ga0207702_10000429 3300026078 Bacteria 48259
588 Ga0207702_10049753 3300026078 Bacteria 3537
589 Ga0207702_10337059 3300026078 Bacteria 1440
590 Ga0207641_10011167 3300026088 Bacteria 7367
591 Ga0207641_10106664 3300026088 Bacteria 2477
592 Ga0207641_10248241 3300026088 Bacteria 1661
593 Ga0207648_10037843 3300026089 Bacteria 4247
594 Ga0207648_10134147 3300026089 Bacteria 2180
595 Ga0207648_10354149 3300026089 Bacteria 1324
596 Ga0207648_10403073 3300026089 Bacteria 1240
597 Ga0207676_10011235 3300026095 Bacteria 6397
598 Ga0207676_10022158 3300026095 Bacteria 4671
599 Ga0207676_10023321 3300026095 Bacteria 4564
600 Ga0207676_10383910 3300026095 Bacteria 1308
601 Ga0207674_10003755 3300026116 Bacteria 18527
602 Ga0207674_10013221 3300026116 Bacteria 9177
603 Ga0207674_10060943 3300026116 Bacteria 3814
604 Ga0207674_10146889 3300026116 Bacteria 2316
605 Ga0207674_10721224 3300026116 Bacteria 962
606 Ga0207675_100004582 3300026118 Bacteria 13325
607 Ga0207675_100133242 3300026118 Bacteria 2357
608 Ga0207683_10016895 3300026121 Bacteria 6209
609 Ga0207683_10065573 3300026121 Bacteria 3202
610 Ga0207683_10110796 3300026121 Bacteria 2457
611 Ga0207698_10054121 3300026142 Bacteria 3086
612 Ga0207698_10063903 3300026142 Bacteria 2883
613 Ga0207698_10333251 3300026142 Bacteria 1426
614 Ga0207698_10690492 3300026142 Bacteria 1015
615 Ga0209589_1000006 3300027357 Bacteria 436292
616 Ga0209489_100007 3300027361 Bacteria 436292
617 Ga0209700_100008 3300027363 Bacteria 436292
618 Ga0209588_1013347 3300027671 Bacteria 2504
619 Ga0209966_1002388 3300027695 Bacteria 3127
620 Ga0207428_10001181 3300027907 Bacteria 28103
621 Ga0207428_10034949 3300027907 Bacteria 4112
622 Ga0207428_10307301 3300027907 Bacteria 1173
623 Ga0268266_10029034 3300028379 Bacteria 4700
624 Ga0268266_10331459 3300028379 Bacteria 1426
625 Ga0268266_10452100 3300028379 Bacteria 1221
626 Ga0268266_10609945 3300028379 Bacteria 1048
627 Ga0268265_10018788 3300028380 Bacteria 4795
628 Ga0268264_10000038 3300028381 Bacteria 383623
629 Ga0268264_10070546 3300028381 Bacteria 2958
630 Ga0268264_10136863 3300028381 Bacteria 2179
631 Ga0268264_10148903 3300028381 Bacteria 2096
632 Ga0268264_10184053 3300028381 Bacteria 1899
633 Ga0268264_10449362 3300028381 Bacteria 1248
634 Ga0265337_1001512 3300028556 Bacteria 11408
635 Ga0265337_1086894 3300028556 Bacteria 853
636 Ga0265326_10003349 3300028558 Bacteria 5270
637 Ga0265319_1005298 3300028563 Bacteria 6207
638 Ga0265323_10001506 3300028653 Bacteria 11377
639 Ga0265336_10000930 3300028666 Bacteria 14828
640 Ga0307517_10077356 3300028786 Bacteria 2892
641 Ga0265338_10000013 3300028800 Bacteria 379065
642 Ga0265338_10018836 3300028800 Bacteria 7363
643 Ga0265330_10047217 3300031235 Bacteria 1895
644 Ga0265325_10000036 3300031241 Bacteria 96858
645 Ga0265325_10075086 3300031241 Bacteria 1689
646 Ga0265325_10118249 3300031241 Bacteria 1280
647 Ga0265340_10032799 3300031247 Bacteria 2590
648 Ga0307509_10214684 3300031507 Bacteria 1744
649 Ga0307509_10296220 3300031507 Bacteria 1369
650 Ga0307509_10342182 3300031507 Bacteria 1222
651 Ga0265313_10007874 3300031595 Bacteria 7182
652 Ga0265313_10055072 3300031595 Bacteria 1885
653 Ga0307508_10000034 3300031616 Bacteria 160115
654 Ga0307508_10084750 3300031616 Bacteria 2751
655 Ga0265314_10000771 3300031711 Bacteria 38181
656 Ga0265314_10006228 3300031711 Bacteria 10596
657 Ga0265342_10000715 3300031712 Bacteria 34304
658 Ga0265342_10037172 3300031712 Bacteria 2971
659 Ga0307516_10015179 3300031730 Bacteria 8113
660 Ga0307516_10090518 3300031730 Bacteria 2888
661 Ga0307516_10130481 3300031730 Bacteria 2293
662 Ga0307411_10417767 3300032005 Bacteria 1113
663 Ga0307415_100070472 3300032126 Bacteria 2455
664 Ga0307415_100091352 3300032126 Bacteria 2205
665 Ga0316583_10000468 3300032133 Bacteria 11990
666 Ga0307507_10068870 3300033179 Bacteria 3225
667 Ga0307510_10015915 3300033180 Bacteria 8888
668 Ga0307510_10025917 3300033180 Bacteria 6755
669 Ga0307510_10040325 3300033180 Bacteria 5127
670 Ga0307510_10050413 3300033180 Bacteria 4416
671 Ga0307510_10259358 3300033180 Bacteria 1220
672 Ga0315911_1000010 3300033442 Bacteria 322197
673 Ga0373930_0013435 3300034816 Bacteria 1509
674 Ga0373934_0029959 3300035086 Bacteria 2127
675 Ga0373944_0003355 3300035089 Bacteria 4126
676 Ga0373923_0003159 3300035111 Bacteria 5235
677 Ga0373923_0081132 3300035111 Bacteria 1407
678 Ga0373936_0016278 3300035113 Bacteria 2860
679 Ga0373936_0016449 3300035113 Bacteria 2846
680 Ga0373939_0014731 3300035114 Bacteria 2034
681 Ga0373939_0041457 3300035114 Bacteria 1388
682 Ga0373939_0043711 3300035114 Bacteria 1361
683 Ga0373945_0124051 3300035116 Bacteria 1029
684 Ga0373945_0151693 3300035116 Bacteria 940
685 Ga0373953_0014392 3300035117 Bacteria 2844
686 Ga0373953_0067831 3300035117 Bacteria 1468
687 Ga0373953_0116814 3300035117 Bacteria 1131
688 Ga0373954_0005645 3300035118 Bacteria 5420
689 Ga0373956_0002992 3300035119 Bacteria 6845
690 Ga0373956_0023889 3300035119 Bacteria 2628
691 Ga0373956_0038909 3300035119 Bacteria 2106
692 Ga0373956_0101905 3300035119 Bacteria 1332
693 Ga0373957_0016398 3300035120 Bacteria 2563
694 Ga0373943_0002425 3300035170 Bacteria 8461
695 Ga0373943_0103432 3300035170 Bacteria 1493
696 Ga0373946_0009713 3300035171 Bacteria 3552
697 Ga0373946_0122069 3300035171 Bacteria 1190
698 Ga0373946_0169790 3300035171 Bacteria 1029
699 Ga0373955_0002414 3300035172 Bacteria 8140
700 Ga0373955_0002681 3300035172 Bacteria 7784
701 Ga0373955_0003006 3300035172 Bacteria 7389
702 Ga0373955_0005476 3300035172 Bacteria 5708
703 Ga0373955_0022938 3300035172 Bacteria 3173
704 Ga0373955_0055725 3300035172 Bacteria 2166
705 Ga0373961_0008362 3300035241 Bacteria 2516
706 Ga0373924_0005315 3300035410 Bacteria 4554
707 Ga0373924_0014286 3300035410 Bacteria 2999
708 Ga0373924_0022245 3300035410 Bacteria 2478
709 Ga0373924_0047661 3300035410 Bacteria 1768
710 Ga0373931_0003537 3300035691 Bacteria 7043
711 Ga0373931_0029986 3300035691 Bacteria 2797
712 Ga0373931_0126225 3300035691 Bacteria 1468
713 Ga0373935_0000100 3300035692 Bacteria 38385
714 Ga0373935_0092322 3300035692 Bacteria 1983
715 Ga0373935_0105305 3300035692 Bacteria 1865
716 Ga0373927_0001937 3300035695 Bacteria 15284
717 Ga0373927_0010867 3300035695 Bacteria 6063
718 Ga0373927_0019455 3300035695 Bacteria 4452
719 Ga0373927_0029680 3300035695 Bacteria 3566
720 Ga0373927_0104617 3300035695 Bacteria 1843
721 Ga0373927_0244051 3300035695 Bacteria 1180
722 Ga0373927_0384467 3300035695 Bacteria 926
723 Ga0373927_0419228 3300035695 Bacteria 883
724 Ga0373933_0007683 3300035724 Bacteria 5888
725 Ga0373933_0020293 3300035724 Bacteria 3766
726 Ga0373933_0030028 3300035724 Bacteria 3145
727 Ga0373933_0354595 3300035724 Bacteria 953
728 Ga0373947_0004147 3300035725 Bacteria 8522
729 Ga0373947_0014655 3300035725 Bacteria 4496
730 Ga0373947_0031395 3300035725 Bacteria 3126
731 Ga0373947_0052924 3300035725 Bacteria 2446
732 Ga0373947_0157346 3300035725 Bacteria 1467
733 Ga0373947_0183479 3300035725 Bacteria 1363
734 Ga0373937_0000028 3300036401 Bacteria 123801
735 Ga0373937_0005428 3300036401 Bacteria 10911
736 Ga0373937_0040922 3300036401 Bacteria 4226
737 Ga0373937_0042854 3300036401 Bacteria 4130
738 Ga0373937_0043962 3300036401 Bacteria 4079
739 Ga0373937_0092567 3300036401 Bacteria 2802
740 Ga0373937_0234160 3300036401 Bacteria 1730
741 Ga0373925_0000034 3300037068 Bacteria 144257
742 Ga0373925_0040808 3300037068 Bacteria 3437
743 Ga0373925_0056896 3300037068 Bacteria 2930
744 Ga0373925_0118793 3300037068 Bacteria 2050
745 Ga0373925_0137551 3300037068 Bacteria 1910
746 Ga0373925_0308902 3300037068 Bacteria 1278
747 Ga0373925_0387944 3300037068 Bacteria 1138
748 Ga0395899_0002233 3300037312 Bacteria 15864
749 Ga0395899_0109507 3300037312 Bacteria 1987
750 Ga0395900_0001351 3300037418 Bacteria 29638
751 Ga0395900_0033149 3300037418 Bacteria 5315
752 Ga0395900_0055199 3300037418 Bacteria 4090
753 Ga0395898_0014184 3300037466 Bacteria 8194
754 Ga0395898_0015935 3300037466 Bacteria 7703
755 Ga0395898_0021905 3300037466 Bacteria 6473
756 Ga0395901_0013773 3300038443 Bacteria 8221
757 Ga0395901_0059357 3300038443 Bacteria 3980
758 Ga0395901_0118991 3300038443 Bacteria 2775
759 Ga0395901_0394195 3300038443 Bacteria 1423
760 Ga0436365_1319250 3300039437 Bacteria 5395
761 Ga0436365_1537157 3300039437 Bacteria 1318
762 Ga0436365_1622752 3300039437 Bacteria 1584
763 Ga0436365_1782951 3300039437 Bacteria 2426
764 Ga0436360_0233758 3300039438 Bacteria 1070
765 Ga0436360_0356281 3300039438 Bacteria 2003
766 Ga0436360_0892341 3300039438 Bacteria 4886
767 Ga0436363_1624790 3300039450 Bacteria 7433
768 Ga0436362_0309256 3300039453 Bacteria 1154
769 Ga0439453_0001021 3300041408 Bacteria 3427
770 Ga0451802_0333791 3300041460 Bacteria 1350
771 Ga0451833_0234451 3300041491 Bacteria 970
772 Ga0439432_066866 3300042006 Bacteria 1100
773 Ga0439444_0007375 3300042437 Bacteria 1688
774 Ga0439460_0073024 3300042461 Bacteria 1066
775 Ga0466969_0049764 3300044656 Bacteria 2067
776 Ga0466972_0000193 3300044658 Bacteria 46863
777 Ga0466972_0000998 3300044658 Bacteria 13595
778 Ga0466965_0093165 3300044683 Bacteria 1534
779 Ga0466966_0000551 3300044684 Bacteria 23873
780 Ga0466966_0105056 3300044684 Bacteria 1744
781 Ga0466961_0000020 3300044693 Bacteria 107610
782 Ga0466963_0374226 3300044694 Bacteria 1004
783 Ga0466971_0170252 3300044719 Bacteria 1022
784 Ga0466970_0012506 3300044765 Bacteria 4342
785 Ga0466957_0075190 3300044842 Bacteria 2096
786 Ga0466960_0035273 3300044901 Bacteria 2336
787 Ga0466960_0153292 3300044901 Bacteria 1233
788 Ga0466959_0067589 3300045049 Bacteria 2591
789 Ga0466959_0135055 3300045049 Bacteria 1746
790 Ga0466959_0358472 3300045049 Bacteria 994
791 Ga0466958_0047710 3300045836 Bacteria 2586
792 Ga0466967_0002756 3300045976 Bacteria 11112
793 Ga0466967_0103083 3300045976 Bacteria 2611
794 Ga0466967_0557848 3300045976 Bacteria 1128
795 Ga0495592_0000772 3300046454 Bacteria 22234
796 Ga0495592_0016974 3300046454 Bacteria 5526
797 Ga0495592_0040724 3300046454 Bacteria 3485
798 Ga0495592_0074058 3300046454 Bacteria 2474
799 Ga0495592_0225102 3300046454 Bacteria 1252
800 Ga0495603_0022413 3300046455 Bacteria 3823
801 Ga0495603_0024245 3300046455 Bacteria 3669
802 Ga0495603_0029491 3300046455 Bacteria 3307
803 Ga0495603_0153225 3300046455 Bacteria 1338
804 Ga0495603_0264064 3300046455 Bacteria 990
805 Ga0495629_0001770 3300046459 Bacteria 16944
806 Ga0495629_0002258 3300046459 Bacteria 14852
807 Ga0495629_0007137 3300046459 Bacteria 8232
808 Ga0495629_0047400 3300046459 Bacteria 3014
809 Ga0495629_0066332 3300046459 Bacteria 2519
810 Ga0495638_0004483 3300046460 Bacteria 10577
811 Ga0495638_0044456 3300046460 Bacteria 2797
812 Ga0495641_0018980 3300046461 Bacteria 3531
813 Ga0495641_0084718 3300046461 Bacteria 1419
814 Ga0495651_0002092 3300046462 Bacteria 15393
815 Ga0495651_0010286 3300046462 Bacteria 7188
816 Ga0495651_0010762 3300046462 Bacteria 7033
817 Ga0495651_0038613 3300046462 Bacteria 3718
818 Ga0495651_0054347 3300046462 Bacteria 3080
819 Ga0495651_0081672 3300046462 Bacteria 2439
820 Ga0495651_0094920 3300046462 Bacteria 2231
821 Ga0495651_0302868 3300046462 Bacteria 1071
822 Ga0495653_0000012 3300046463 Bacteria 266880
823 Ga0495653_0019952 3300046463 Bacteria 5433
824 Ga0495653_0045878 3300046463 Bacteria 3386
825 Ga0495653_0089535 3300046463 Bacteria 2254
826 Ga0495580_0152550 3300046472 Bacteria 1600
827 Ga0495582_0245429 3300046473 Bacteria 1026
828 Ga0495605_0026489 3300046474 Bacteria 3014
829 Ga0495605_0108078 3300046474 Bacteria 1272
830 Ga0495605_0170267 3300046474 Bacteria 962
831 Ga0495639_0005522 3300046475 Bacteria 5443
832 Ga0495639_0015685 3300046475 Bacteria 3286
833 Ga0495639_0023240 3300046475 Bacteria 2723
834 Ga0495639_0077736 3300046475 Bacteria 1541
835 Ga0495639_0109977 3300046475 Bacteria 1307
836 Ga0495662_0001204 3300046476 Bacteria 12770
837 Ga0495662_0014876 3300046476 Bacteria 3781
838 Ga0495662_0155183 3300046476 Bacteria 1128
839 Ga0495662_0219345 3300046476 Bacteria 937
840 Ga0495664_0000004 3300046477 Bacteria 489411
841 Ga0495664_0045364 3300046477 Bacteria 2607
842 Ga0495664_0046265 3300046477 Bacteria 2582
843 Ga0495664_0217581 3300046477 Bacteria 1156
844 Ga0495664_0267097 3300046477 Bacteria 1034
845 Ga0495584_0046097 3300046491 Bacteria 2199
846 Ga0495585_0052615 3300046492 Bacteria 2254
847 Ga0495594_0066391 3300046499 Bacteria 2001
848 Ga0495594_0211616 3300046499 Bacteria 1105
849 Ga0495607_0105221 3300046501 Bacteria 1505
850 Ga0495583_0133009 3300046506 Bacteria 1040
851 Ga0495606_0009544 3300046507 Bacteria 8193
852 Ga0495606_0023943 3300046507 Bacteria 4412
853 Ga0495608_0000005 3300046511 Bacteria 350726
854 Ga0495608_0057224 3300046511 Bacteria 2573
855 Ga0495608_0067807 3300046511 Bacteria 2333
856 Ga0495608_0157439 3300046511 Bacteria 1445
857 Ga0495616_0183838 3300046513 Bacteria 927
858 Ga0495618_0000024 3300046514 Bacteria 122536
859 Ga0495618_0008220 3300046514 Bacteria 6320
860 Ga0495618_0057501 3300046514 Bacteria 2463
861 Ga0495618_0194098 3300046514 Bacteria 1286
862 Ga0495628_0000001 3300046516 Bacteria 917742
863 Ga0495628_0002495 3300046516 Bacteria 16570
864 Ga0495628_0006309 3300046516 Bacteria 10358
865 Ga0495628_0017364 3300046516 Bacteria 5992
866 Ga0495630_0001801 3300046517 Bacteria 14948
867 Ga0495630_0007480 3300046517 Bacteria 7806
868 Ga0495630_0027933 3300046517 Bacteria 4191
869 Ga0495630_0211249 3300046517 Bacteria 1481
870 Ga0495630_0324451 3300046517 Bacteria 1177
871 Ga0495630_0327435 3300046517 Bacteria 1171
872 Ga0495630_0397800 3300046517 Bacteria 1055
873 Ga0495631_0215270 3300046518 Bacteria 820
874 Ga0495632_0044867 3300046519 Bacteria 2204
875 Ga0495632_0069847 3300046519 Bacteria 1690
876 Ga0495643_0171893 3300046522 Bacteria 1059
877 Ga0495644_0043288 3300046523 Bacteria 1694
878 Ga0495648_0001038 3300046524 Bacteria 28176
879 Ga0495648_0057693 3300046524 Bacteria 2326
880 Ga0495648_0133256 3300046524 Bacteria 1318
881 Ga0495652_0000002 3300046529 Bacteria 946606
882 Ga0495652_0016360 3300046529 Bacteria 6636
883 Ga0495652_0033706 3300046529 Bacteria 4467
884 Ga0495652_0052604 3300046529 Bacteria 3472
885 Ga0495652_0118036 3300046529 Bacteria 2121
886 Ga0495652_0245657 3300046529 Bacteria 1329
887 Ga0495652_0279190 3300046529 Bacteria 1224
888 Ga0495652_0471325 3300046529 Bacteria 875
889 Ga0495665_0014525 3300046531 Bacteria 4247
890 Ga0495640_0000001 3300046533 Bacteria 853827
891 Ga0495640_0008420 3300046533 Bacteria 8091
892 Ga0495640_0018683 3300046533 Bacteria 5132
893 Ga0495640_0026031 3300046533 Bacteria 4234
894 Ga0495640_0049879 3300046533 Bacteria 2884
895 Ga0495640_0108865 3300046533 Bacteria 1812
896 Ga0495640_0190571 3300046533 Bacteria 1303
897 Ga0495586_0347591 3300046535 Bacteria 852
898 Ga0495587_0000016 3300046536 Bacteria 185585
899 Ga0495587_0006873 3300046536 Bacteria 7395
900 Ga0495587_0029527 3300046536 Bacteria 3328
901 Ga0495587_0052835 3300046536 Bacteria 2396
902 Ga0495609_0189708 3300046538 Bacteria 862
903 Ga0495621_0115325 3300046539 Bacteria 1034
904 Ga0495645_0000002 3300046543 Bacteria 651644
905 Ga0495645_0005780 3300046543 Bacteria 8531
906 Ga0495645_0007450 3300046543 Bacteria 7618
907 Ga0495645_0012816 3300046543 Bacteria 5917
908 Ga0495645_0014661 3300046543 Bacteria 5565
909 Ga0495645_0130007 3300046543 Bacteria 1765
910 Ga0495622_0001657 3300046557 Bacteria 11014
911 Ga0495622_0025498 3300046557 Bacteria 2761
912 Ga0495667_0000007 3300046559 Bacteria 234736
913 Ga0495667_0007799 3300046559 Bacteria 7249
914 Ga0495667_0009673 3300046559 Bacteria 6534
915 Ga0495667_0019728 3300046559 Bacteria 4550
916 Ga0495667_0029808 3300046559 Bacteria 3671
917 Ga0495667_0062841 3300046559 Bacteria 2432
918 Ga0495667_0100116 3300046559 Bacteria 1876
919 Ga0495667_0337688 3300046559 Bacteria 953
920 Ga0495656_0075427 3300046615 Bacteria 1508
921 Ga0495656_0086601 3300046615 Bacteria 1425
922 Ga0495656_0108056 3300046615 Bacteria 1297
923 Ga0495668_0030694 3300046616 Bacteria 3033
924 Ga0495634_0000003 3300046642 Bacteria 206222
925 Ga0495634_0006397 3300046642 Bacteria 8952
926 Ga0495634_0010275 3300046642 Bacteria 6859
927 Ga0495634_0019169 3300046642 Bacteria 4862
928 Ga0495634_0038773 3300046642 Bacteria 3247
929 Ga0495634_0068415 3300046642 Bacteria 2346
930 Ga0495625_0035691 3300046660 Bacteria 3662
931 Ga0495625_0048607 3300046660 Bacteria 3053
932 Ga0495625_0086733 3300046660 Bacteria 2171
933 Ga0495635_0000002 3300046663 Bacteria 490490
934 Ga0495635_0001380 3300046663 Bacteria 16199
935 Ga0495635_0004910 3300046663 Bacteria 9301
936 Ga0495635_0014990 3300046663 Bacteria 5422
937 Ga0495635_0045668 3300046663 Bacteria 3022
938 Ga0495635_0051194 3300046663 Bacteria 2846
939 Ga0495635_0146127 3300046663 Bacteria 1609
940 Ga0495588_0007228 3300046674 Bacteria 5040
941 Ga0495588_0012723 3300046674 Bacteria 3986
942 Ga0495588_0055806 3300046674 Bacteria 2039
943 Ga0495657_0000131 3300046675 Bacteria 66938
944 Ga0495657_0007004 3300046675 Bacteria 8746
945 Ga0495657_0010352 3300046675 Bacteria 7018
946 Ga0495657_0011353 3300046675 Bacteria 6664
947 Ga0495657_0015626 3300046675 Bacteria 5548
948 Ga0495657_0065283 3300046675 Bacteria 2394
949 Ga0495657_0263337 3300046675 Bacteria 1035
950 Ga0495599_0000005 3300046678 Bacteria 300169
951 Ga0495599_0017214 3300046678 Bacteria 4492
952 Ga0495599_0046843 3300046678 Bacteria 2710
953 Ga0495599_0092868 3300046678 Bacteria 1883
954 Ga0495599_0139647 3300046678 Bacteria 1503
955 Ga0495623_0000457 3300046679 Bacteria 26827
956 Ga0495623_0000629 3300046679 Bacteria 23493
957 Ga0495623_0005103 3300046679 Bacteria 8614
958 Ga0495623_0023789 3300046679 Bacteria 3952
959 Ga0495623_0044228 3300046679 Bacteria 2830
960 Ga0495623_0094251 3300046679 Bacteria 1832
961 Ga0495646_0000002 3300046680 Bacteria 310568
962 Ga0495646_0018477 3300046680 Bacteria 4415
963 Ga0495646_0024420 3300046680 Bacteria 3806
964 Ga0495646_0032263 3300046680 Bacteria 3259
965 Ga0495646_0070867 3300046680 Bacteria 2052
966 Ga0495647_0116536 3300046681 Bacteria 1120
967 Ga0495658_0003824 3300046683 Bacteria 7450
968 Ga0495658_0024440 3300046683 Bacteria 3219
969 Ga0495658_0038520 3300046683 Bacteria 2648
970 Ga0495658_0174994 3300046683 Bacteria 1330
971 Ga0495658_0208225 3300046683 Bacteria 1221
972 Ga0495669_0003415 3300046684 Bacteria 6539
973 Ga0495669_0050947 3300046684 Bacteria 1857
974 Ga0495669_0139513 3300046684 Bacteria 1144
975 Ga0495613_0051585 3300046689 Bacteria 3031
976 Ga0495613_0056838 3300046689 Bacteria 2873
977 Ga0495613_0074174 3300046689 Bacteria 2478
978 Ga0495613_0117038 3300046689 Bacteria 1916
979 Ga0495624_0004020 3300046690 Bacteria 10818
980 Ga0495624_0025443 3300046690 Bacteria 3886
981 Ga0495624_0027226 3300046690 Bacteria 3744
982 Ga0495624_0119653 3300046690 Bacteria 1618
983 Ga0495624_0288763 3300046690 Bacteria 990
984 Ga0495670_0110133 3300046691 Bacteria 1424
985 Ga0495649_0022922 3300046694 Bacteria 3490
986 Ga0495649_0056799 3300046694 Bacteria 2112
987 Ga0495649_0272636 3300046694 Bacteria 865
988 Ga0495600_0000054 3300046809 Bacteria 69299
989 Ga0495600_0005659 3300046809 Bacteria 7549
990 Ga0495600_0008503 3300046809 Bacteria 6308
991 Ga0495600_0010734 3300046809 Bacteria 5694
992 Ga0495600_0014057 3300046809 Bacteria 5041
993 Ga0495600_0048600 3300046809 Bacteria 2767
994 Ga0495600_0103430 3300046809 Bacteria 1856
995 Ga0495600_0147695 3300046809 Bacteria 1523
996 Ga0495660_0113899 3300046810 Bacteria 1377
997 Ga0495660_0200823 3300046810 Bacteria 952
998 Ga0495581_0029251 3300047315 Bacteria 3194
999 Ga0495581_0040627 3300047315 Bacteria 2691
1000 Ga0495581_0045465 3300047315 Bacteria 2538
1001 Ga0495581_0299874 3300047315 Bacteria 939
1002 Ga0495604_0000020 3300047317 Bacteria 171989
1003 Ga0495604_0007736 3300047317 Bacteria 8512
1004 Ga0495604_0011322 3300047317 Bacteria 7080
1005 Ga0495604_0022876 3300047317 Bacteria 4989
1006 Ga0495604_0029158 3300047317 Bacteria 4390
1007 Ga0495604_0034557 3300047317 Bacteria 3999
1008 Ga0495604_0098037 3300047317 Bacteria 2160
1009 Ga0495636_0011599 3300047318 Bacteria 3489
1010 Ga0495674_0000002 3300047319 Bacteria 642785
1011 Ga0495674_0006598 3300047319 Bacteria 11129
1012 Ga0495674_0060722 3300047319 Bacteria 3297
1013 Ga0495674_0076952 3300047319 Bacteria 2869
1014 Ga0495674_0154035 3300047319 Bacteria 1926
1015 Ga0495674_0212708 3300047319 Bacteria 1601
1016 Ga0495674_0425197 3300047319 Bacteria 1070
1017 Ga0495672_0102585 3300047320 Bacteria 1549
1018 Ga0495676_0034955 3300047321 Bacteria 4210
1019 Ga0495676_0055945 3300047321 Bacteria 3124
1020 Ga0495676_0113948 3300047321 Bacteria 1979
1021 Ga0495680_0005803 3300047322 Bacteria 11552
1022 Ga0495680_0007406 3300047322 Bacteria 10066
1023 Ga0495680_0019787 3300047322 Bacteria 5676
1024 Ga0495680_0022327 3300047322 Bacteria 5277
1025 Ga0495680_0110682 3300047322 Bacteria 2035
1026 Ga0495680_0170836 3300047322 Bacteria 1574
1027 Ga0495680_0381294 3300047322 Bacteria 976
1028 Ga0495675_0000421 3300047444 Bacteria 28694
1029 Ga0495675_0003046 3300047444 Bacteria 10079
1030 Ga0495675_0024467 3300047444 Bacteria 3849
1031 Ga0495675_0047833 3300047444 Bacteria 2721
1032 Ga0495675_0048896 3300047444 Bacteria 2689
1033 Ga0495685_022061 3300047447 Bacteria 2191
1034 Ga0495673_0067610 3300047469 Bacteria 1512
1035 Ga0495673_0100132 3300047469 Bacteria 1173
1036 Ga0495673_0120736 3300047469 Bacteria 1038
1037 Ga0495684_0000017 3300047471 Bacteria 160663
1038 Ga0495684_0004704 3300047471 Bacteria 10654
1039 Ga0495684_0010743 3300047471 Bacteria 7080
1040 Ga0495684_0085620 3300047471 Bacteria 2390
1041 Ga0495684_0178484 3300047471 Bacteria 1575
1042 Ga0495684_0376978 3300047471 Bacteria 1001
1043 Ga0495593_0000790 3300047673 Bacteria 18345
1044 Ga0495593_0006607 3300047673 Bacteria 6786
1045 Ga0495593_0011390 3300047673 Bacteria 5110
1046 Ga0495593_0052545 3300047673 Bacteria 2153
1047 Ga0495593_0143146 3300047673 Bacteria 1211
1048 Ga0495602_0000005 3300048088 Bacteria 325957
1049 Ga0495602_0001719 3300048088 Bacteria 21809
1050 Ga0495602_0008247 3300048088 Bacteria 10879
1051 Ga0495602_0126604 3300048088 Bacteria 2045
1052 Ga0495614_0030413 3300048089 Bacteria 2324
1053 Ga0495614_0087942 3300048089 Bacteria 1350
1054 Ga0496100_0010727 3300048903 Bacteria 5195
1055 Ga0496100_0039643 3300048903 Bacteria 2992
1056 Ga0496100_0042647 3300048903 Bacteria 2898
1057 Ga0496100_0062446 3300048903 Bacteria 2458
1058 Ga0496101_0004289 3300048904 Bacteria 8946
1059 Ga0496101_0011229 3300048904 Bacteria 5932
1060 Ga0496101_0018829 3300048904 Bacteria 4702
1061 Ga0496101_0049042 3300048904 Bacteria 3036
1062 Ga0496101_0054741 3300048904 Bacteria 2880
1063 Ga0496101_0127908 3300048904 Bacteria 1926
1064 Ga0496101_0224179 3300048904 Bacteria 1459
1065 Ga0496102_0010809 3300048905 Bacteria 7862
1066 Ga0496102_0062757 3300048905 Bacteria 3402
1067 Ga0496102_0153977 3300048905 Bacteria 2161
1068 Ga0496102_0342871 3300048905 Bacteria 1407
1069 Ga0496102_0491911 3300048905 Bacteria 1148
1070 Ga0496103_0015307 3300048906 Bacteria 4562
1071 Ga0496103_0016126 3300048906 Bacteria 4458
1072 Ga0496103_0083756 3300048906 Bacteria 2008
1073 Ga0496104_0000819 3300048907 Bacteria 26767
1074 Ga0496104_0002128 3300048907 Bacteria 17188
1075 Ga0496104_0007769 3300048907 Bacteria 9502
1076 Ga0496104_0010459 3300048907 Bacteria 8287
1077 Ga0496104_0041522 3300048907 Bacteria 4313
1078 Ga0496104_0045249 3300048907 Bacteria 4138
1079 Ga0496104_0184090 3300048907 Bacteria 1999
1080 Ga0496104_0308383 3300048907 Bacteria 1495
1081 Ga0496104_0742630 3300048907 Bacteria 888
1082 Ga0496105_0000862 3300048908 Bacteria 20730
1083 Ga0496105_0026411 3300048908 Bacteria 4735
1084 Ga0496105_0029225 3300048908 Bacteria 4511
1085 Ga0496105_0032403 3300048908 Bacteria 4288
1086 Ga0496105_0037311 3300048908 Bacteria 4002
1087 Ga0496105_0077652 3300048908 Bacteria 2742
1088 Ga0496105_0086680 3300048908 Bacteria 2587
1089 Ga0496105_0126795 3300048908 Bacteria 2104
1090 Ga0496105_0171132 3300048908 Bacteria 1780
1091 Ga0496106_0010290 3300048909 Bacteria 6915
1092 Ga0496106_0015767 3300048909 Bacteria 5589
1093 Ga0496106_0018741 3300048909 Bacteria 5125
1094 Ga0496106_0055167 3300048909 Bacteria 3002
1095 Ga0496107_0001840 3300048910 Bacteria 13399
1096 Ga0496107_0008370 3300048910 Bacteria 7156
1097 Ga0496107_0034947 3300048910 Bacteria 3602
1098 Ga0496107_0054198 3300048910 Bacteria 2894
1099 Ga0496107_0063957 3300048910 Bacteria 2667
1100 Ga0496107_0097349 3300048910 Bacteria 2154
1101 Ga0496108_0009733 3300048911 Bacteria 7788
1102 Ga0496108_0019236 3300048911 Bacteria 5605
1103 Ga0496108_0034029 3300048911 Bacteria 4232
1104 Ga0496108_0114430 3300048911 Bacteria 2309
1105 Ga0496108_0248639 3300048911 Bacteria 1547
1106 Ga0496108_0258907 3300048911 Bacteria 1514
1107 Ga0496109_0000725 3300048912 Bacteria 27459
1108 Ga0496109_0001849 3300048912 Bacteria 17531
1109 Ga0496109_0004415 3300048912 Bacteria 11751
1110 Ga0496109_0047066 3300048912 Bacteria 3919
1111 Ga0496109_0059228 3300048912 Bacteria 3498
1112 Ga0496109_0231691 3300048912 Bacteria 1738
1113 Ga0496109_0324400 3300048912 Bacteria 1453
1114 Ga0496109_0475833 3300048912 Bacteria 1179
1115 Ga0496109_0796222 3300048912 Bacteria 883
1116 Ga0496110_0006296 3300048913 Bacteria 9370
1117 Ga0496110_0007953 3300048913 Bacteria 8492
1118 Ga0496110_0032386 3300048913 Bacteria 4514
1119 Ga0496110_0071595 3300048913 Bacteria 3074
1120 Ga0496110_0111381 3300048913 Bacteria 2460
1121 Ga0496110_0137761 3300048913 Bacteria 2206
1122 Ga0496110_0206798 3300048913 Bacteria 1784
1123 Ga0496110_0223784 3300048913 Bacteria 1711
1124 Ga0496110_0395804 3300048913 Bacteria 1259
1125 Ga0496110_0657175 3300048913 Bacteria 948
1126 Ga0496111_0001813 3300048914 Bacteria 12548
1127 Ga0496111_0073252 3300048914 Bacteria 2494
1128 Ga0496111_0174499 3300048914 Bacteria 1597
1129 Ga0496111_0368024 3300048914 Bacteria 1063
1130 Ga0496112_0000008 3300048915 Bacteria 310323
1131 Ga0496112_0000650 3300048915 Bacteria 24136
1132 Ga0496112_0008057 3300048915 Bacteria 9403
1133 Ga0496112_0039338 3300048915 Bacteria 4621
1134 Ga0496112_0057366 3300048915 Bacteria 3833
1135 Ga0496112_0138531 3300048915 Bacteria 2403
1136 Ga0496113_0000194 3300048916 Bacteria 27842
1137 Ga0496113_0004856 3300048916 Bacteria 8323
1138 Ga0496113_0022970 3300048916 Bacteria 4419
1139 Ga0496113_0122223 3300048916 Bacteria 2036
1140 Ga0496113_0201198 3300048916 Bacteria 1583
1141 Ga0496113_0302551 3300048916 Bacteria 1281
1142 Ga0496114_0004204 3300048917 Bacteria 11157
1143 Ga0496114_0036619 3300048917 Bacteria 4056
1144 Ga0496114_0044624 3300048917 Bacteria 3679
1145 Ga0496114_0048264 3300048917 Bacteria 3541
1146 Ga0496114_0064292 3300048917 Bacteria 3072
1147 Ga0496114_0071900 3300048917 Bacteria 2908
1148 Ga0496114_0157909 3300048917 Bacteria 1970
1149 Ga0496114_0197842 3300048917 Bacteria 1759
1150 Ga0496114_0258998 3300048917 Bacteria 1531
1151 Ga0496114_0331257 3300048917 Bacteria 1346
1152 Ga0496115_0001528 3300048918 Bacteria 16623
1153 Ga0496115_0021264 3300048918 Bacteria 5011
1154 Ga0496115_0062630 3300048918 Bacteria 3001
1155 Ga0496115_0073375 3300048918 Bacteria 2777
1156 Ga0496115_0084782 3300048918 Bacteria 2584
1157 Ga0496115_0087518 3300048918 Bacteria 2542
1158 Ga0496115_0090316 3300048918 Bacteria 2502
1159 Ga0496116_0043792 3300048919 Bacteria 3046
1160 Ga0496116_0144323 3300048919 Bacteria 1333
1161 Ga0496117_0051107 3300048920 Bacteria 2925
1162 Ga0496117_0119629 3300048920 Bacteria 1621
1163 Ga0496118_0020418 3300048921 Bacteria 5874
1164 Ga0496118_0034465 3300048921 Bacteria 4129
1165 Ga0496118_0103853 3300048921 Bacteria 1910
1166 Ga0496119_0078585 3300048922 Bacteria 1908
1167 Ga0496120_0006845 3300048923 Bacteria 8625
1168 Ga0496121_0000099 3300048924 Bacteria 200160
1169 Ga0496121_0007398 3300048924 Bacteria 13268
1170 Ga0496121_0024122 3300048924 Bacteria 5827
1171 Ga0496121_0024578 3300048924 Bacteria 5756
1172 Ga0496121_0028159 3300048924 Bacteria 5237
1173 Ga0496121_0029535 3300048924 Bacteria 5066
1174 Ga0496121_0042542 3300048924 Bacteria 3948
1175 Ga0496121_0116234 3300048924 Bacteria 2029
1176 Ga0496122_0013666 3300048925 Bacteria 7924
1177 Ga0496122_0192734 3300048925 Bacteria 1201
1178 Ga0496124_0005312 3300048927 Bacteria 14556
1179 Ga0496124_0191816 3300048927 Bacteria 1563
1180 Ga0496124_0258213 3300048927 Bacteria 1284
1181 Ga0496124_0353124 3300048927 Bacteria 1039
1182 Ga0496125_0000203 3300048928 Bacteria 125569
1183 Ga0496125_0045016 3300048928 Bacteria 3721
1184 Ga0496125_0187600 3300048928 Bacteria 1369
1185 Ga0496126_0008220 3300048929 Bacteria 11283
1186 Ga0496126_0008519 3300048929 Bacteria 11052
1187 Ga0496126_0018064 3300048929 Bacteria 7005
1188 Ga0496126_0025409 3300048929 Bacteria 5698
1189 Ga0496126_0084481 3300048929 Bacteria 2800
1190 Ga0496126_0189567 3300048929 Bacteria 1742
1191 Ga0496126_0363836 3300048929 Bacteria 1181
1192 Ga0496126_0378870 3300048929 Bacteria 1152
1193 Ga0501031_0010491 3300049568 Bacteria 6035
1194 Ga0501031_0013001 3300049568 Bacteria 5431
1195 Ga0501031_0046008 3300049568 Bacteria 2848
1196 Ga0501032_0001266 3300049569 Bacteria 20268
1197 Ga0501032_0006324 3300049569 Bacteria 8728
1198 Ga0501032_0040390 3300049569 Bacteria 3171
1199 Ga0501032_0053293 3300049569 Bacteria 2725
1200 Ga0501032_0064578 3300049569 Bacteria 2450
1201 Ga0501033_0000399 3300049570 Bacteria 41761
1202 Ga0501034_0000039 3300049571 Bacteria 237357
1203 Ga0501034_0000300 3300049571 Bacteria 88018
1204 Ga0501034_0012992 3300049571 Bacteria 8583
1205 Ga0501034_0023461 3300049571 Bacteria 6286
1206 Ga0501034_0039368 3300049571 Bacteria 4788
1207 Ga0501034_0058884 3300049571 Bacteria 3859
1208 Ga0501034_0066993 3300049571 Bacteria 3604
1209 Ga0501036_0000067 3300049572 Bacteria 66279
1210 Ga0501036_0000214 3300049572 Bacteria 38627
1211 Ga0501036_0009310 3300049572 Bacteria 8077
1212 Ga0501036_0085541 3300049572 Bacteria 2665
1213 Ga0501036_0150702 3300049572 Bacteria 1961
1214 Ga0501036_0399508 3300049572 Bacteria 1146
1215 Ga0501037_0000279 3300049573 Bacteria 43594
1216 Ga0501037_0003013 3300049573 Bacteria 12234
1217 Ga0501037_0008244 3300049573 Bacteria 7640
1218 Ga0501037_0026796 3300049573 Bacteria 4258
1219 Ga0501037_0120884 3300049573 Bacteria 1883
1220 Ga0501038_0000133 3300049574 Bacteria 63587
1221 Ga0501038_0005787 3300049574 Bacteria 11451
1222 Ga0501038_0036660 3300049574 Bacteria 4302
1223 Ga0501039_0000146 3300049575 Bacteria 47895
1224 Ga0501039_0008994 3300049575 Bacteria 7607
1225 Ga0501040_0024816 3300049576 Bacteria 4027
1226 Ga0501040_0438722 3300049576 Bacteria 939
1227 Ga0501042_0104782 3300049578 Bacteria 2035
1228 Ga0501043_0000257 3300049579 Bacteria 48196
1229 Ga0501043_0004568 3300049579 Bacteria 11238
1230 Ga0501043_0013941 3300049579 Bacteria 6289
1231 Ga0501043_0057948 3300049579 Bacteria 3040
1232 Ga0501043_0077640 3300049579 Bacteria 2609
1233 Ga0501043_0104728 3300049579 Bacteria 2223
1234 Ga0501046_0000218 3300049580 Bacteria 59989
1235 Ga0501046_0016813 3300049580 Bacteria 6117
1236 Ga0501046_0371345 3300049580 Bacteria 1036
1237 Ga0501047_0000186 3300049581 Bacteria 75102
1238 Ga0501047_0000892 3300049581 Bacteria 30468
1239 Ga0501047_0011653 3300049581 Bacteria 8313
1240 Ga0501047_0011704 3300049581 Bacteria 8294
1241 Ga0501047_0012443 3300049581 Bacteria 8055
1242 Ga0501047_0026450 3300049581 Bacteria 5582
1243 Ga0501047_0078272 3300049581 Bacteria 3180
1244 Ga0501048_0000306 3300049582 Bacteria 33320
1245 Ga0501048_0033900 3300049582 Bacteria 3686
1246 Ga0501067_0001472 3300049583 Bacteria 12790
1247 Ga0501067_0027254 3300049583 Bacteria 3166
1248 Ga0501067_0295133 3300049583 Bacteria 902
1249 Ga0501068_0003699 3300049584 Bacteria 8271
1250 Ga0501068_0017076 3300049584 Bacteria 4194
1251 Ga0501068_0110338 3300049584 Bacteria 1710
1252 Ga0501069_0009809 3300049585 Bacteria 5062
1253 Ga0501069_0028559 3300049585 Bacteria 3059
1254 Ga0501069_0066548 3300049585 Bacteria 2015
1255 Ga0501069_0410870 3300049585 Bacteria 802
1256 Ga0501070_0009316 3300049586 Bacteria 8305
1257 Ga0501070_0024887 3300049586 Bacteria 5020
1258 Ga0501071_0025400 3300049587 Bacteria 4150
1259 Ga0501071_0164192 3300049587 Bacteria 1661
1260 Ga0501071_0266923 3300049587 Bacteria 1293
1261 Ga0501072_0052274 3300049588 Bacteria 3217
1262 Ga0501072_0439882 3300049588 Bacteria 1033
1263 Ga0501073_0000131 3300049589 Bacteria 48153
1264 Ga0501073_0025742 3300049589 Bacteria 4216
1265 Ga0501073_0066255 3300049589 Bacteria 2518
1266 Ga0501073_0096348 3300049589 Bacteria 2054
1267 Ga0501073_0105470 3300049589 Bacteria 1956
1268 Ga0501073_0270909 3300049589 Bacteria 1171
1269 Ga0501074_0003028 3300049590 Bacteria 11838
1270 Ga0501074_0007730 3300049590 Bacteria 7785
1271 Ga0501074_0023396 3300049590 Bacteria 4492
1272 Ga0501074_0078039 3300049590 Bacteria 2377
1273 Ga0501074_0194076 3300049590 Bacteria 1447
1274 Ga0501076_0163161 3300049592 Bacteria 1816
1275 Ga0501079_0027693 3300049741 Bacteria 4347
1276 Ga0501079_0108328 3300049741 Bacteria 2157
1277 Ga0501079_0141908 3300049741 Bacteria 1871
1278 Ga0501080_0000299 3300049742 Bacteria 37707
1279 Ga0501080_0000387 3300049742 Bacteria 33900
1280 Ga0501080_0017584 3300049742 Bacteria 6611
1281 Ga0501080_0030766 3300049742 Bacteria 5002
1282 Ga0501080_0040498 3300049742 Bacteria 4345
1283 Ga0501080_0125009 3300049742 Bacteria 2382
1284 Ga0501080_0559748 3300049742 Bacteria 1018
1285 Ga0501081_0219139 3300049743 Bacteria 1384
1286 Ga0501083_0000213 3300049744 Bacteria 37485
1287 Ga0501083_0000302 3300049744 Bacteria 31114
1288 Ga0501083_0013760 3300049744 Bacteria 5657
1289 Ga0501083_0066813 3300049744 Bacteria 2394
1290 Ga0501083_0096090 3300049744 Bacteria 1955
1291 Ga0501083_0143242 3300049744 Bacteria 1565
1292 Ga0501035_0001847 3300049822 Bacteria 21321
1293 Ga0501035_0033501 3300049822 Bacteria 4672
1294 Ga0501035_0113842 3300049822 Bacteria 2369
1295 Ga0501035_0122560 3300049822 Bacteria 2271
1296 Ga0501035_0369169 3300049822 Bacteria 1198
1297 Ga0501044_0000140 3300049823 Bacteria 88672
1298 Ga0501044_0000911 3300049823 Bacteria 35591
1299 Ga0501044_0009195 3300049823 Bacteria 10793
1300 Ga0501044_0037281 3300049823 Bacteria 5082
1301 Ga0501044_0101277 3300049823 Bacteria 2898
1302 Ga0501044_0115602 3300049823 Bacteria 2688
1303 Ga0501044_0156305 3300049823 Bacteria 2260
1304 Ga0501044_0163189 3300049823 Bacteria 2203
1305 Ga0501044_0190025 3300049823 Bacteria 2017
1306 Ga0501045_0034745 3300049824 Bacteria 3660
1307 nmdc:mga03683_100966_c1 3300050489 Bacteria 1268
1308 nmdc:mga03683_31972_c1 3300050489 Bacteria 2114
1309 nmdc:mga03683_86984_c1 3300050489 Bacteria 1358
1310 nmdc:mga00v17_51378_c1 3300050491 Bacteria 2507
1311 nmdc:mga0yw44_148217_c1 3300050492 Bacteria 1529
1312 nmdc:mga0yw44_191068_c1 3300050492 Bacteria 1351
1313 nmdc:mga0yw44_20099_c1 3300050492 Bacteria 3699
1314 nmdc:mga0yw44_61539_c1 3300050492 Bacteria 2304
1315 nmdc:mga0k408_268877_c1 3300050493 Bacteria 1018
1316 nmdc:mga0k408_345665_c1 3300050493 Bacteria 887
1317 nmdc:mga06z11_170909_c1 3300050494 Bacteria 1248
1318 nmdc:mga05p37_123298_c1 3300050507 Bacteria 3183
1319 nmdc:mga05p37_126679_c1 3300050507 Bacteria 3136
1320 nmdc:mga05p37_1804_c1 3300050507 Bacteria 24969
1321 nmdc:mga05p37_255850_c1 3300050507 Bacteria 2098
1322 nmdc:mga05p37_48521_c1 3300050507 Bacteria 5222
1323 nmdc:mga05p37_58714_c2 3300050507 Bacteria 1600
1324 nmdc:mga05p37_762399_c1 3300050507 Bacteria 1065
1325 nmdc:mga09592_15767_c1 3300050508 Bacteria 6174
1326 nmdc:mga09592_4406_c1 3300050508 Bacteria 11391
1327 nmdc:mga0qj67_1353_c1 3300050509 Bacteria 17245
1328 nmdc:mga0qj67_323904_c1 3300050509 Bacteria 1247
1329 nmdc:mga06r32_4623_c1 3300050510 Bacteria 12343
1330 nmdc:mga06r32_47529_c1 3300050510 Bacteria 4099
1331 nmdc:mga06r32_85631_c1 3300050510 Bacteria 3073
1332 nmdc:mga08y16_188955_c1 3300050511 Bacteria 2137
1333 nmdc:mga08y16_239474_c1 3300050511 Bacteria 1876
1334 nmdc:mga08y16_3182_c1 3300050511 Bacteria 16989
1335 nmdc:mga08y16_768706_c1 3300050511 Bacteria 958
1336 nmdc:mga0n895_128985_c1 3300050512 Bacteria 2553
1337 nmdc:mga0n895_188715_c1 3300050512 Bacteria 2092
1338 nmdc:mga0n895_1891_c1 3300050512 Bacteria 16022
1339 nmdc:mga0n895_221370_c1 3300050512 Bacteria 1921
1340 nmdc:mga0n895_276198_c1 3300050512 Bacteria 1704
1341 nmdc:mga0n895_358334_c1 3300050512 Bacteria 1477
1342 nmdc:mga0rr50_185272_c1 3300050513 Bacteria 1703
1343 nmdc:mga0rr50_222996_c1 3300050513 Bacteria 1557
1344 nmdc:mga0rr50_246394_c1 3300050513 Bacteria 1482
1345 nmdc:mga0rr50_2542_c1 3300050513 Bacteria 10332
1346 nmdc:mga08x19_119813_c1 3300050514 Bacteria 1763
1347 nmdc:mga08x19_35_c1 3300050514 Bacteria 185171
1348 nmdc:mga08x19_90631_c1 3300050514 Bacteria 2018
1349 nmdc:mga0a205_19744_c1 3300050515 Bacteria 5226
1350 nmdc:mga0a205_720_c1 3300050515 Bacteria 26644
1351 Ga0495601_0000018 3300053077 Bacteria 171665
1352 Ga0495601_0000699 3300053077 Bacteria 18013
1353 Ga0495601_0002661 3300053077 Bacteria 10127
1354 Ga0495601_0004059 3300053077 Bacteria 8442
1355 Ga0495601_0005636 3300053077 Bacteria 7300
1356 Ga0495601_0055526 3300053077 Bacteria 2508
1357 Ga0495601_0117604 3300053077 Bacteria 1725
1358 Ga0495601_0244378 3300053077 Bacteria 1172
1359 Ga0495612_0000011 3300053078 Bacteria 224729
1360 Ga0495612_0001444 3300053078 Bacteria 9785
1361 Ga0495612_0006482 3300053078 Bacteria 4808
1362 Ga0495612_0023553 3300053078 Bacteria 2471
1363 Ga0495612_0112654 3300053078 Bacteria 1166
1364 Ga0500635_0002244 3300053080 Bacteria 4757
1365 Ga0495655_0018897 3300053083 Bacteria 1522
1366 Ga0495595_0000016 3300053084 Bacteria 134329
1367 Ga0495595_0000380 3300053084 Bacteria 16825
1368 Ga0495595_0001380 3300053084 Bacteria 9423
1369 Ga0495595_0007849 3300053084 Bacteria 4371
1370 Ga0495595_0008260 3300053084 Bacteria 4274
1371 Ga0495619_0000014 3300053085 Bacteria 261449
1372 Ga0495619_0000085 3300053085 Bacteria 70073
1373 Ga0495619_0000442 3300053085 Bacteria 27859
1374 Ga0495619_0011298 3300053085 Bacteria 5618
1375 Ga0495619_0020082 3300053085 Bacteria 4251
1376 Ga0495619_0045225 3300053085 Bacteria 2892
1377 Ga0495619_0066101 3300053085 Bacteria 2413
1378 Ga0495619_0160594 3300053085 Bacteria 1552
1379 Ga0500643_000018 3300053087 Bacteria 296505
1380 Ga0500644_0001192 3300053088 Bacteria 7386
1381 Ga0500647_0062219 3300053091 Bacteria 1796
1382 Ga0500651_0049609 3300053093 Bacteria 2636
1383 Ga0500566_0048657 3300053094 Bacteria 2430
1384 Ga0500641_0038577 3300053096 Bacteria 1920
1385 Ga0500554_001980 3300053102 Bacteria 3976
1386 Ga0500555_005820 3300053103 Bacteria 3498
1387 Ga0500556_0053713 3300053104 Bacteria 1465
1388 Ga0500557_000008 3300053105 Bacteria 127284
1389 Ga0500572_051994 3300053111 Bacteria 1223
1390 Ga0500595_000024 3300053119 Bacteria 144160
1391 Ga0500595_000146 3300053119 Bacteria 46362
1392 Ga0500595_000232 3300053119 Bacteria 37646
1393 Ga0500595_007153 3300053119 Bacteria 4656
1394 Ga0500595_021184 3300053119 Bacteria 2324
1395 Ga0500597_078318 3300053120 Bacteria 1433
1396 Ga0500614_032569 3300053123 Bacteria 1283
1397 Ga0500618_056369 3300053125 Bacteria 886
1398 Ga0500642_0000294 3300053130 Bacteria 18100
1399 Ga0500658_0088826 3300053134 Bacteria 1333
1400 Ga0500559_0000823 3300053136 Bacteria 20133
1401 Ga0500559_0051981 3300053136 Bacteria 1810
1402 Ga0500559_0056905 3300053136 Bacteria 1736
1403 Ga0500568_0120334 3300053139 Bacteria 978
1404 Ga0500577_0006365 3300053142 Bacteria 3252
1405 Ga0500588_0106467 3300053146 Bacteria 973
1406 Ga0500603_001424 3300053150 Bacteria 5468
1407 Ga0500603_025353 3300053150 Bacteria 1491
1408 Ga0500616_0000547 3300053153 Bacteria 46727
1409 Ga0500620_001197 3300053155 Bacteria 4637
1410 Ga0500633_0014438 3300053160 Bacteria 2242
1411 Ga0500634_0173098 3300053161 Bacteria 981
1412 Ga0500639_139761 3300053163 Bacteria 1134
1413 Ga0500636_0000550 3300053177 Bacteria 20404
1414 Ga0500636_0123009 3300053177 Bacteria 1453
1415 Ga0500636_0147410 3300053177 Bacteria 1296
1416 Ga0500637_0000405 3300053178 Bacteria 16453
1417 Ga0500637_0013869 3300053178 Bacteria 4237
1418 Ga0500637_0031034 3300053178 Bacteria 2976
1419 Ga0500611_039293 3300053727 Bacteria 1030
1420 Ga0500625_011535 3300053729 Bacteria 4016
1421 Ga0500645_000102 3300053730 Bacteria 67660
1422 Ga0500645_033560 3300053730 Bacteria 1535
1423 Ga0500609_005852 3300053731 Bacteria 1678
1424 Ga0500599_002533 3300053736 Bacteria 2194
1425 Ga0501084_0019137 3300054114 Bacteria 5703
1426 Ga0501084_0092215 3300054114 Bacteria 2543
1427 Ga0500661_000586 3300055283 Bacteria 6789
1428 Ga0501082_0006966 3300060353 Bacteria 9764
1429 Ga0501082_0036240 3300060353 Bacteria 4250
1430 Ga0501082_0060106 3300060353 Bacteria 3274
1431 Ga0501082_0263684 3300060353 Bacteria 1499
1432 Ga0501082_0537263 3300060353 Bacteria 1022
1433 Ga0530510_0119731 3300061734 Bacteria 1932
1434 Ga0530510_0159487 3300061734 Bacteria 1668
1435 Ga0530510_0194814 3300061734 Bacteria 1505
1436 8019636911 8019629233 Bacteria 8687553
1437 2507510898 2507262055 Bacteria 8048963
1438 2508544711 2508501009 Bacteria 7784016
1439 2508697061 2508501042 Bacteria 8719808
1440 2509147168 2508501128 Bacteria 8613869
1441 2511394415 2511231028 Bacteria 8046582
1442 2513637592 2513237094 Bacteria 8789602
1443 2513649563 2513237095 Bacteria 8976980
1444 2513654916 2513237096 Bacteria 8722461
1445 2513671147 2513237098 Bacteria 9902361
1446 2513700048 2513237102 Bacteria 7703324
1447 2513719250 2513237104 Bacteria 10034502
1448 2513861285 2513237137 Bacteria 9558895
1449 2513874549 2513237139 Bacteria 8737671
1450 2513894491 2513237141 Bacteria 8496279
1451 2513916061 2513237145 Bacteria 8979722
1452 2514015549 2513237161 Bacteria 8871253
1453 2515625558 2515154112 Bacteria 8294334
1454 2517100477 2517093001 Bacteria 9002274
1455 2517894635 2517572143 Bacteria 9484767
1456 2524437338 2524023205 Bacteria 8918781
1457 2524534378 2524023228 Bacteria 10118060
1458 2528853228 2528768022 Bacteria 10457665
1459 2617350655 2617270735 Bacteria 9163226
1460 2617377935 2617270741 Bacteria 8201522
1461 2671119065 2667528175 Bacteria 7532676
1462 2728747706 2728368998 Bacteria 8720350
1463 2745076813 2744054633 Bacteria 8678936
1464 2793065181 2791355196 Bacteria 7323613
1465 2793071112 2791355197 Bacteria 8420563
1466 2793083122
1467 2805916544 2802429603 Bacteria 8777136
1468 2818238033 2816332527 Bacteria 8933356
1469 2824606131 2824600985 Bacteria 8488197
1470 2824616041 2824609381 Bacteria 8672835
1471 2824618964 2824617872 Bacteria 8814715
1472 2824627516 2824626560 Bacteria 8813858
1473 2824638841 2824635225 Bacteria 8785348
1474 2824649002 2824644064 Bacteria 8743947
1475 2824657339 2824653114 Bacteria 8493680
1476 2824663096 2824661429 Bacteria 9877870
1477 2824676959 2824671348 Bacteria 8369588
1478 2824682046 2824679649 Bacteria 8248951
1479 2824693648 2824687955 Bacteria 8360029
1480 2824698717 2824696289 Bacteria 8335049
1481 2824706507 2824704595 Bacteria 9667483
1482 2824716468 2824714736 Bacteria 8717648
1483 2824726414 2824723954 Bacteria 8758240
1484 2824737947 2824732956 Bacteria 7810675
1485 2824753009 2824746037 Bacteria 7911610
1486 2824756945 2824753945 Bacteria 9787441
1487 2824769741 2824763712 Bacteria 9792355
1488 2824778482 2824773399 Bacteria 8360218
1489 2838127787 2838122688 Bacteria 8803140
1490 2841943080 2841941048 Bacteria 8688029
1491 2841956101 2841949485 Bacteria 8680857
1492 2841960327 2841957949 Bacteria 8652217
1493 2841968278 2841966195 Bacteria 8673214
1494 2841976508 2841974524 Bacteria 8931498
1495 2841987884 2841983080 Bacteria 8395090
1496 2842042813 2842038055 Bacteria 8002051
1497 2842050854 2842045827 Bacteria 8006841
1498 2844317029 2844315083 Bacteria 8138177
1499 2847938461 2847930680 Bacteria 9342022
1500 2847944341 2847939898 Bacteria 8606328
1501 2849081419 2849076700 Bacteria 7039503
1502 2857512078 2857509624 Bacteria 7472071
1503 2874597623 2874590934 Bacteria 8299676
1504 2874618408 2874612657 Bacteria 8252029
1505 2874623536 2874620515 Bacteria 8290088
1506 2874630527 2874628541 Bacteria 8630250
1507 2874649187 2874645413 Bacteria 8214782
1508 2876767789 2876761206 Bacteria 10111113
1509 2876774904 2876771140 Bacteria 8287509
1510 2876822344 2876818435 Bacteria 8274608
1511 2879077992 2879074833 Bacteria 8279565
1512 2879088700 2879083081 Bacteria 8587928
1513 2879103935 2879099564 Bacteria 10442239
1514 2879117942 2879110137 Bacteria 8907982
1515 2879132457 2879127579 Bacteria 8294491
1516 2879145243 2879142872 Bacteria 8267021
1517 2881370578 2881364244 Bacteria 7710352
1518 2881667339 2881665667 Bacteria 8175609
1519 2885367036 2885366525 Bacteria 8326213
1520 2885379361 2885374607 Bacteria 8927485
1521 2885390866 2885383462 Bacteria 9473874
1522 2885416543 2885409591 Bacteria 9235467
1523 2888381650 2888378607 Bacteria 9652610
1524 2888388984 2888388044 Bacteria 7304136
1525 2888422044 2888419890 Bacteria 7857137
1526 2889033528 2889033259 Bacteria 9099371
1527 2903734996 2903727486 Bacteria 8281579
1528 2903758066 2903748898 Bacteria 9972761
1529 2904667660 2904666416 Bacteria 8226587
1530 2904697018 2904690495 Bacteria 9412302
1531 2904705671
1532 2904719091 2904711408 Bacteria 9771557
1533 2906604112 2906602504 Bacteria 8295279
1534 2906611371
1535 2906633014 2906626472 Bacteria 8826946
1536 2906641598 2906635258 Bacteria 8601019
1537 2906648251 2906643746 Bacteria 8722424
1538 2906661302 2906660503 Bacteria 8595048
1539 2908744954 2908739725 Bacteria 8628932
1540 2908762714 2908756301 Bacteria 8864324
1541 2908782015 2908775508 Bacteria 8092255
1542 2922362688 2922361189 Bacteria 7436256
1543 2922371319
1544 2922393772 2922393267 Bacteria 8285685
1545 2922428004
1546 2929619698 2929615660 Bacteria 9193770
1547 2929627831 2929624759 Bacteria 9339455
1548 2932786030 2932784394 Bacteria 9704911
1549 2932798198 2932794094 Bacteria 7915132
1550 2932803991 2932801729 Bacteria 7987968
1551 2932817022 2932809354 Bacteria 9135765
1552 2932822487 2932818245 Bacteria 9955613
1553 2932831074 2932828146 Bacteria 9745859
1554 2933581617 2933577622 Bacteria 9116884
1555 2935612884 2935608549 Bacteria 8203142
1556 2935624139 2935616580 Bacteria 9032984
1557 2935632079 2935630451 Bacteria 8169952
1558 2935640215 2935638405 Bacteria 10015038
1559 2935655009 2935648319 Bacteria 8801166
1560 2935663889 2935656913 Bacteria 8965014
1561 2935666947 2935665750 Bacteria 9571747
1562 2935680414 2935675223 Bacteria 9928132
1563 2935690078 2935684952 Bacteria 9590419
1564 2935699840 2935694250 Bacteria 9291695
1565 2935704702 2935703347 Bacteria 10242284
1566 2935722210 2935713505 Bacteria 9608509
1567 2935731519 2935722832 Bacteria 9608746
1568 2935735393 2935732158 Bacteria 9706831
1569 2935745336 2935741537 Bacteria 9707219
1570 2935755089 2935750917 Bacteria 9590372
1571 2935762397 2935760218 Bacteria 9817913
1572 2935775431 2935769743 Bacteria 7878163
1573 2935780333 2935777560 Bacteria 8077691
1574 2935790680 2935785616 Bacteria 7962367
1575 2935799137 2935793552 Bacteria 8012592
1576 2935803895 2935801545 Bacteria 9301974
1577 2935811813 2935810662 Bacteria 9401221
1578 2935824372 2935819856 Bacteria 8261050
1579 2935829698 2935827899 Bacteria 10038562
1580 2935842970 2935837841 Bacteria 9454360
1581 2935852483 2935847175 Bacteria 8228321
1582 2935862361 2935855204 Bacteria 9035059
1583 2935870496 2935864058 Bacteria 9784707
1584 2935881078 2935873716 Bacteria 9632195
1585 2935884203 2935883170 Bacteria 7964738
1586 2935912362 2935908558 Bacteria 8568796
1587 2935923964 2935916978 Bacteria 9113783
1588 2935929391 2935926038 Bacteria 8601059
1589 2935936022 2935934488 Bacteria 8602579
1590 2935949922 2935942939 Bacteria 8599779
1591 2935957312 2935951376 Bacteria 8602333
1592 2935962169 2935959822 Bacteria 7869783
1593 2935968343 2935967501 Bacteria 8603075
1594 2935976529 2935975950 Bacteria 8347125
1595 2935988025 2935984226 Bacteria 8302647
1596 2935993575 2935992306 Bacteria 9802711
1597 2936004471 2936002035 Bacteria 9362176
1598 2936018042 2936011229 Bacteria 8801034
1599 2936026548 2936019824 Bacteria 8804134
1600 2936035291 2936028420 Bacteria 8965941
1601 2936038396 2936037263 Bacteria 9446081
1602 2936053437 2936046547 Bacteria 8903709
1603 2936059418 2936055302 Bacteria 8785755
1604 2940561631 2940556831 Bacteria 9590747
1605 2941508027 2941507105 Bacteria 8166816
1606 2941515468 2941515067 Bacteria 8166720
1607 2941523957 2941523033 Bacteria 8169134
1608 2941533813 2941531003 Bacteria 7653939
1609 2941544194 2941538514 Bacteria 9402094
1610 3005477703 3005474847 Bacteria 9259049
1611 3005485391 3005483717 Bacteria 7877331
1612 3005507231 3005506211 Bacteria 6943378
1613 3005594597 3005587118 Bacteria 7794411
1614 3005596671 3005594810 Bacteria 8716512
1615 3005712744 3005710791 Bacteria 7622528
1616 3005719796 3005718088 Bacteria 8283608
1617 8006933149 8006926726 Bacteria 6749210
1618 8006933516 8006933436 Bacteria 10410654
1619 8006971311 8006964411 Bacteria 8966052
1620 8006983189 8006973647 Bacteria 10679141
1621 8006989264 8006984368 Bacteria 9651211
1622 8016516306 8016511872 Bacteria 9921665
1623 8016523703 8016522445 Bacteria 8156687
1624 8016537226 8016530956 Bacteria 8155261
1625 8016551767 8016548790 Bacteria 8155074
1626 8016560157 8016557553 Bacteria 8154380
1627 8016579610 8016575299 Bacteria 8154085
1628 8016589262 8016583857 Bacteria 10421953
1629 8016598074 8016595262 Bacteria 8149947
1630 8016604213 8016603502 Bacteria 8731218
1631 8016620794 8016613128 Bacteria 8794220
1632 8016629193 8016622563 Bacteria 7999408
1633 8016633713 8016630954 Bacteria 9217207
1634 8017060227 8017057580 Bacteria 10023680
1635 8019536915 8019530166 Bacteria 8155624
1636 8019542613 8019538911 Bacteria 7872763
1637 8019559429 8019555841 Bacteria 9642137
1638 8019569527 8019565922 Bacteria 9639779
1639 8019579749 8019576017 Bacteria 10049540
1640 8019603885 8019597564 Bacteria 10041141
1641 8019614655 8019608314 Bacteria 10042931
1642 8019625270 8019619141 Bacteria 9218857
1643 8019649890 8019648815 Bacteria 10014479
1644 8019681800 8019678201 Bacteria 8863603
1645 8019693980 8019687851 Bacteria 8712826
1646 8055749046 8055742211 Bacteria 9226248
1647 8056686291 8056681323 Bacteria 8472857
1648 8056695067 8056689827 Bacteria 6712655
1649 8056969895 8056967851 Bacteria 9038162
1650 JGI24752J21851_1013560
1651 JGI24739J22299_10024130
1652 JGI24743J22301_10013812
1653 JGI24750J21931_1001325
1654 JGI24738J21930_10012496
1655 JGI24744J21845_10000746
1656 JGI24742J22300_10002634
1657 JGI25406J46586_10000721
1658 JGI25153J46596_10000972
1659 JGI25153J46596_10001764
1660 JGI25153J46596_10010358
1661 Ga0055531_10005831
1662 Ga0055543_1010715
1663 Ga0065165_1000437
1664 Ga0065165_1001951
1665 Ga0065165_1049590
1666 Ga0070658_10037403
1667 Ga0070676_10019842
1668 Ga0070690_100015880
1669 Ga0070690_100036374
1670 Ga0070690_100084933
1671 Ga0070670_100015836
1672 Ga0070670_100328135
1673 Ga0070677_10182878
1674 Ga0070666_10014730
1675 Ga0070666_10073403
1676 Ga0070666_10075916
1677 Ga0070680_100010483
1678 Ga0070680_100018027
1679 Ga0070680_100018900
1680 Ga0070680_100030562
1681 Ga0070680_100173015
1682 Ga0070680_100248283
1683 Ga0070682_100004250
1684 Ga0070682_100072098
1685 Ga0068868_100024743
1686 Ga0068868_100039833
1687 Ga0070660_100021209
1688 Ga0070660_100089367
1689 Ga0070660_100103432
1690 Ga0070660_100110684
1691 Ga0070660_100145179
1692 Ga0070660_100275583
1693 Ga0070689_100005294
1694 Ga0070689_100050960
1695 Ga0070689_100259276
1696 Ga0070691_10029205
1697 Ga0070687_100081192
1698 Ga0070687_100085120
1699 Ga0070687_100191189
1700 Ga0070661_100056508
1701 Ga0070661_100074196
1702 Ga0070661_100097961
1703 Ga0070661_100275869
1704 Ga0070692_10008935
1705 Ga0070668_100002961
1706 Ga0070668_100016017
1707 Ga0070669_100034136
1708 Ga0070669_100207283
1709 Ga0070675_100080368
1710 Ga0070675_100113008
1711 Ga0070671_100028027
1712 Ga0070671_100095258
1713 Ga0070671_100164379
1714 Ga0070674_100017252
1715 Ga0070674_100236345
1716 Ga0070673_100164389
1717 Ga0070688_100039441
1718 Ga0070688_100066702
1719 Ga0070688_100288638
1720 Ga0070659_100009176
1721 Ga0070659_100018698
1722 Ga0070659_100278351
1723 Ga0070667_100013737
1724 Ga0070667_100060010
1725 Ga0070667_100281734
1726 Ga0070667_100409866
1727 Ga0070709_10000436
1728 Ga0070709_10067371
1729 Ga0070709_10257862
1730 Ga0070714_100010313
1731 Ga0070714_100054416
1732 Ga0070714_100229512
1733 Ga0070714_100395797
1734 Ga0070713_100013145
1735 Ga0070713_100035772
1736 Ga0070713_100048882
1737 Ga0070713_100072680
1738 Ga0070713_100138796
1739 Ga0070713_100461949
1740 Ga0070710_10000185
1741 Ga0070710_10133350
1742 Ga0070701_10011181
1743 Ga0070701_10054610
1744 Ga0070701_10320750
1745 Ga0070711_100014594
1746 Ga0070711_100033297
1747 Ga0070711_100274802
1748 Ga0070711_100364544
1749 Ga0070705_100037865
1750 Ga0070700_100039639
1751 Ga0070700_100201761
1752 Ga0070694_100037437
1753 Ga0070663_100014170
1754 Ga0070663_100041743
1755 Ga0070663_100069500
1756 Ga0070663_100141143
1757 Ga0070678_100016308
1758 Ga0070678_100120292
1759 Ga0070678_100194581
1760 Ga0070662_100038911
1761 Ga0070662_100077588
1762 Ga0070662_100163917
1763 Ga0070662_100173824
1764 Ga0070662_100490243
1765 Ga0070681_10009008
1766 Ga0070681_10020592
1767 Ga0070681_10044892
1768 Ga0070681_10058748
1769 Ga0070681_10097480
1770 Ga0070681_10131503
1771 Ga0070681_10164638
1772 Ga0070681_10165253
1773 Ga0070681_10273786
1774 Ga0068867_100031505
1775 Ga0068867_100089468
1776 Ga0070685_10000890
1777 Ga0070706_100113232
1778 Ga0070707_100171193
1779 Ga0070707_100655223
1780 Ga0070698_100585944
1781 Ga0070699_100348923
1782 Ga0070699_100840283
1783 Ga0070679_100002598
1784 Ga0070679_100008820
1785 Ga0070679_100051260
1786 Ga0070679_100074260
1787 Ga0070679_100252295
1788 Ga0070679_100750639
1789 Ga0070684_100038931
1790 Ga0070684_100199218
1791 Ga0070697_100012281
1792 Ga0068853_100029267
1793 Ga0068853_100069718
1794 Ga0070672_100009850
1795 Ga0070672_100433895
1796 Ga0070686_100006389
1797 Ga0070686_100044827
1798 Ga0070686_100045395
1799 Ga0070693_100037496
1800 Ga0070693_100052962
1801 Ga0070693_100069131
1802 Ga0070693_100162973
1803 Ga0070693_100216442
1804 Ga0070693_100287298
1805 Ga0070665_100020991
1806 Ga0070665_100074134
1807 Ga0070665_100245363
1808 Ga0068855_100011578
1809 Ga0068855_100048966
1810 Ga0068855_100072165
1811 Ga0068855_100232871
1812 Ga0068855_100252752
1813 Ga0068855_100278379
1814 Ga0068855_100773992
1815 Ga0070664_100133646
1816 Ga0070664_100472174
1817 Ga0068857_100048191
1818 Ga0068857_100144805
1819 Ga0068857_100306489
1820 Ga0068857_100497490
1821 Ga0068854_100000633
1822 Ga0068854_100024255
1823 Ga0068854_100108051
1824 Ga0068854_100132186
1825 Ga0068856_100000024
1826 Ga0068856_100079660
1827 Ga0068856_100093716
1828 Ga0068856_100115016
1829 Ga0068856_100162111
1830 Ga0068856_100495384
1831 Ga0070702_100008171
1832 Ga0070702_100183565
1833 Ga0068852_100009742
1834 Ga0068852_100027366
1835 Ga0068852_100111045
1836 Ga0068852_100154490
1837 Ga0068852_100342575
1838 Ga0068852_100352830
1839 Ga0068852_100495032
1840 Ga0068859_100616763
1841 Ga0068859_100711471
1842 Ga0068864_100040289
1843 Ga0068864_100436867
1844 Ga0068866_10011785
1845 Ga0068861_100006389
1846 Ga0068851_10009390
1847 Ga0068851_10011243
1848 Ga0068851_10043174
1849 Ga0068870_10022396
1850 Ga0068870_10026249
1851 Ga0068863_100034483
1852 Ga0068863_100038510
1853 Ga0068863_100475125
1854 Ga0068858_100043618
1855 Ga0068858_100088144
1856 Ga0068858_100138500
1857 Ga0068860_100000533
1858 Ga0081455_10004098
1859 Ga0081455_10005318
1860 Ga0081538_10051528
1861 Ga0081540_1000027
1862 Ga0081540_1010304
1863 Ga0081539_10000486
1864 Ga0081539_10000748
1865 Ga0070717_10001555
1866 Ga0070717_10027524
1867 Ga0070717_10066839
1868 Ga0070717_10078344
1869 Ga0070717_10232931
1870 Ga0070717_10321973
1871 Ga0075365_10006261
1872 Ga0075365_10051569
1873 Ga0075365_10066677
1874 Ga0075365_10105525
1875 Ga0075365_10219551
1876 Ga0075368_10031959
1877 Ga0075363_100056500
1878 Ga0075363_100332126
1879 Ga0075364_10064444
1880 Ga0075364_10105987
1881 Ga0075432_10013314
1882 Ga0075432_10099965
1883 Ga0070715_10052633
1884 Ga0070716_100033604
1885 Ga0070712_100047942
1886 Ga0070712_100085211
1887 Ga0070712_100109960
1888 Ga0070712_100166089
1889 Ga0070712_100235614
1890 Ga0075362_10055027
1891 Ga0075362_10150681
1892 Ga0075367_10193800
1893 Ga0075369_10080685
1894 Ga0075427_10002297
1895 Ga0075366_10071167
1896 Ga0097621_100012752
1897 Ga0097621_100035743
1898 Ga0097621_100160257
1899 Ga0097621_100199664
1900 Ga0097621_100345090
1901 Ga0075370_10078423
1902 Ga0075370_10236851
1903 Ga0068871_100005825
1904 Ga0068871_100024591
1905 Ga0068871_100273988
1906 Ga0075428_100011938
1907 Ga0075428_100018375
1908 Ga0075428_100056300
1909 Ga0075428_100350082
1910 Ga0075428_100445740
1911 Ga0075430_100001810
1912 Ga0075430_100100805
1913 Ga0075431_100009712
1914 Ga0075431_100044879
1915 Ga0075433_10000766
1916 Ga0075434_100002178
1917 Ga0075434_100018782
1918 Ga0075434_100122198
1919 Ga0075429_100019327
1920 Ga0075429_100034915
1921 Ga0068865_100242962
1922 Ga0075436_100003019
1923 Ga0075436_100008760
1924 Ga0075436_100068876
1925 Ga0075436_100338020
1926 Ga0097620_100616776
1927 Ga0097620_100711494
1928 Ga0099824_1004900
1929 Ga0099822_1000677
1930 Ga0075435_100007621
1931 Ga0075435_100131225
1932 Ga0075435_100239220
1933 Ga0105240_10006156
1934 Ga0105240_10013828
1935 Ga0105240_10018559
1936 Ga0105240_10027519
1937 Ga0105240_10044366
1938 Ga0105240_10072015
1939 Ga0105240_10138125
1940 Ga0105240_10516447
1941 Ga0111539_10002672
1942 Ga0111539_10084856
1943 Ga0111539_10107005
1944 Ga0111539_10353568
1945 Ga0105245_10050761
1946 Ga0105245_10078640
1947 Ga0105245_10426735
1948 Ga0105245_10701519
1949 Ga0105247_10019831
1950 Ga0105247_10026371
1951 Ga0105247_10089700
1952 Ga0114129_10004982
1953 Ga0114129_10010606
1954 Ga0114129_10012982
1955 Ga0114129_10054096
1956 Ga0114129_10206213
1957 Ga0114129_10221799
1958 Ga0105243_10082094
1959 Ga0105243_10130925
1960 Ga0105243_10252460
1961 Ga0105241_10018533
1962 Ga0105242_10031555
1963 Ga0105242_10168190
1964 Ga0105248_10008661
1965 Ga0105248_10058252
1966 Ga0105248_10074783
1967 Ga0105248_10184177
1968 Ga0105248_10557608
1969 Ga0105237_10003348
1970 Ga0105237_10013574
1971 Ga0105237_10015745
1972 Ga0105237_10081927
1973 Ga0105237_10151761
1974 Ga0105237_10236393
1975 Ga0105238_10016265
1976 Ga0105238_10016948
1977 Ga0105238_10019638
1978 Ga0105238_10605824
1979 Ga0105249_10028908
1980 Ga0105249_10259361
1981 Ga0099796_10071784
1982 Ga0105239_10125290
1983 Ga0105239_10165500
1984 Ga0105239_10169086
1985 Ga0105239_10209456
1986 Ga0105239_10674726
1987 Ga0105246_10038063
1988 Ga0105246_10078014
1989 Ga0105246_10175380
1990 Ga0157373_10152063
1991 Ga0157373_10167597
1992 Ga0157373_10224689
1993 Ga0157373_10226519
1994 Ga0157371_10231160
1995 Ga0157370_10012471
1996 Ga0157370_10021928
1997 Ga0157369_10029155
1998 Ga0157369_10029245
1999 Ga0157369_10360705
2000 Ga0157369_10382204
2001 Ga0157374_10045210
2002 Ga0157374_10061407
2003 Ga0157374_10442474
2004 Ga0157378_10006828
2005 Ga0157378_10406954
2006 Ga0157378_10633444
2007 Ga0163162_10123078
2008 Ga0163162_10336447
2009 Ga0163162_10521000
2010 Ga0163162_10563717
2011 Ga0157375_10010993
2012 Ga0157375_10268468
2013 Ga0157375_10710101
2014 Ga0163163_10006916
2015 Ga0163163_10012936
2016 Ga0163163_10169200
2017 Ga0163163_10739400
2018 Ga0157380_10042206
2019 Ga0157380_10124915
2020 Ga0157380_10226525
2021 Ga0182008_10098424
2022 Ga0157377_10094929
2023 Ga0157377_10190826
2024 Ga0157379_10057220
2025 Ga0157379_10348649
2026 Ga0157379_10349932
2027 Ga0157376_10130643
2028 Ga0182005_1050508
2029 Ga0163161_10102316
2030 Ga0163161_10144311
2031 Ga0197907_10526031
2032 Ga0213872_10044763
2033 Ga0213874_10001231
2034 Ga0213876_10002022
2035 Ga0213871_10002645
2036 Ga0209563_102633
2037 Ga0207425_1022885
2038 Ga0209677_101136
2039 Ga0209677_102452
2040 Ga0209233_1001880
2041 Ga0209233_1006454
2042 Ga0209233_1007122
2043 Ga0209455_1000714
2044 Ga0209758_1000139
2045 Ga0209758_1000141
2046 Ga0209758_1001019
2047 Ga0209758_1002921
2048 Ga0209758_1007677
2049 Ga0209758_1020105
2050 Ga0209758_1059295
2051 Ga0209256_1002956
2052 Ga0209256_1044291
2053 Ga0207426_1001139
2054 Ga0207426_1007470
2055 Ga0207426_1010967
2056 Ga0209257_1006467
2057 Ga0207656_10135628
2058 Ga0207656_10168989
2059 Ga0207682_10049528
2060 Ga0207692_10000719
2061 Ga0207692_10291648
2062 Ga0207642_10024407
2063 Ga0207710_10155982
2064 Ga0207688_10000092
2065 Ga0207680_10049447
2066 Ga0207680_10069773
2067 Ga0207680_10356930
2068 Ga0207647_10001257
2069 Ga0207647_10051357
2070 Ga0207647_10093484
2071 Ga0207685_10019049
2072 Ga0207685_10161466
2073 Ga0207699_10000426
2074 Ga0207699_10027047
2075 Ga0207699_10101379
2076 Ga0207699_10133571
2077 Ga0207645_10001966
2078 Ga0207645_10040592
2079 Ga0207643_10001083
2080 Ga0207705_10071393
2081 Ga0207705_10073715
2082 Ga0207705_10158465
2083 Ga0207705_10334694
2084 Ga0207684_10031999
2085 Ga0207654_10001372
2086 Ga0207654_10039611
2087 Ga0207707_10000455
2088 Ga0207707_10000754
2089 Ga0207707_10068643
2090 Ga0207707_10080025
2091 Ga0207707_10091782
2092 Ga0207707_10149064
2093 Ga0207707_10182248
2094 Ga0207707_10511341
2095 Ga0207707_10567280
2096 Ga0207695_10000062
2097 Ga0207695_10003366
2098 Ga0207695_10026753
2099 Ga0207695_10047053
2100 Ga0207695_10175013
2101 Ga0207695_10394481
2102 Ga0207695_10653076
2103 Ga0207671_10001897
2104 Ga0207671_10010070
2105 Ga0207671_10017745
2106 Ga0207671_10205913
2107 Ga0207671_10231857
2108 Ga0207693_10009769
2109 Ga0207693_10016557
2110 Ga0207663_10001359
2111 Ga0207663_10090587
2112 Ga0207663_10188430
2113 Ga0207663_10203487
2114 Ga0207660_10000925
2115 Ga0207660_10036522
2116 Ga0207660_10043144
2117 Ga0207660_10046032
2118 Ga0207660_10093980
2119 Ga0207660_10163794
2120 Ga0207662_10001580
2121 Ga0207662_10020951
2122 Ga0207657_10000702
2123 Ga0207657_10023596
2124 Ga0207657_10034662
2125 Ga0207657_10054719
2126 Ga0207657_10124086
2127 Ga0207657_10232918
2128 Ga0207649_10151555
2129 Ga0207649_10244282
2130 Ga0207652_10005840
2131 Ga0207652_10007328
2132 Ga0207652_10028141
2133 Ga0207652_10029294
2134 Ga0207652_10065888
2135 Ga0207652_10186611
2136 Ga0207652_10629737
2137 Ga0207681_10024566
2138 Ga0207694_10005693
2139 Ga0207694_10009233
2140 Ga0207694_10034165
2141 Ga0207694_10049584
2142 Ga0207694_10397213
2143 Ga0207650_10045983
2144 Ga0207650_10075147
2145 Ga0207659_10057286
2146 Ga0207659_10114345
2147 Ga0207659_10118807
2148 Ga0207687_10010386
2149 Ga0207687_10018589
2150 Ga0207687_10151887
2151 Ga0207700_10040939
2152 Ga0207700_10052109
2153 Ga0207700_10054848
2154 Ga0207664_10006153
2155 Ga0207664_10082042
2156 Ga0207664_10166139
2157 Ga0207664_10431081
2158 Ga0207664_10723476
2159 Ga0207644_10043862
2160 Ga0207644_10146486
2161 Ga0207644_10286598
2162 Ga0207690_10038008
2163 Ga0207690_10456031
2164 Ga0207706_10015496
2165 Ga0207706_10034566
2166 Ga0207706_10043327
2167 Ga0207706_10441964
2168 Ga0207686_10034442
2169 Ga0207686_10107708
2170 Ga0207686_10221488
2171 Ga0207686_10287097
2172 Ga0207709_10075840
2173 Ga0207709_10117974
2174 Ga0207709_10278794
2175 Ga0207670_10020741
2176 Ga0207670_10226528
2177 Ga0207670_10290460
2178 Ga0207669_10006478
2179 Ga0207669_10010047
2180 Ga0207669_10020955
2181 Ga0207669_10028974
2182 Ga0207665_10005437
2183 Ga0207665_10034364
2184 Ga0207665_10200976
2185 Ga0207691_10002822
2186 Ga0207711_10011989
2187 Ga0207711_10166799
2188 Ga0207711_10424877
2189 Ga0207689_10009648
2190 Ga0207661_10082464
2191 Ga0207661_10144438
2192 Ga0207661_10221609
2193 Ga0207679_10023352
2194 Ga0207679_10205475
2195 Ga0207667_10006124
2196 Ga0207667_10016626
2197 Ga0207667_10037813
2198 Ga0207667_10042144
2199 Ga0207667_10063594
2200 Ga0207667_10082010
2201 Ga0207667_10131286
2202 Ga0207667_10182890
2203 Ga0207667_10267083
2204 Ga0207667_10296643
2205 Ga0207667_10599705
2206 Ga0207712_10012776
2207 Ga0207712_10208825
2208 Ga0207668_10012977
2209 Ga0207668_10042958
2210 Ga0207668_10111603
2211 Ga0207640_10021189
2212 Ga0207640_10026938
2213 Ga0207640_10048930
2214 Ga0207640_10082342
2215 Ga0207640_10090881
2216 Ga0207640_10112194
2217 Ga0207640_10141381
2218 Ga0207658_10036453
2219 Ga0207658_10056068
2220 Ga0207677_10083478
2221 Ga0207703_10054421
2222 Ga0207703_10312192
2223 Ga0207639_10025317
2224 Ga0207639_10074465
2225 Ga0207639_10091792
2226 Ga0207639_10119411
2227 Ga0207639_10280026
2228 Ga0207639_10282306
2229 Ga0207678_10005024
2230 Ga0207678_10009376
2231 Ga0207678_10059036
2232 Ga0207678_10093753
2233 Ga0207708_10000679
2234 Ga0207708_10071266
2235 Ga0207702_10000092
2236 Ga0207702_10000429
2237 Ga0207702_10049753
2238 Ga0207702_10337059
2239 Ga0207641_10011167
2240 Ga0207641_10106664
2241 Ga0207641_10248241
2242 Ga0207648_10037843
2243 Ga0207648_10134147
2244 Ga0207648_10354149
2245 Ga0207648_10403073
2246 Ga0207676_10011235
2247 Ga0207676_10022158
2248 Ga0207676_10023321
2249 Ga0207676_10383910
2250 Ga0207674_10003755
2251 Ga0207674_10013221
2252 Ga0207674_10060943
2253 Ga0207674_10146889
2254 Ga0207674_10721224
2255 Ga0207675_100004582
2256 Ga0207675_100133242
2257 Ga0207683_10016895
2258 Ga0207683_10065573
2259 Ga0207683_10110796
2260 Ga0207698_10054121
2261 Ga0207698_10063903
2262 Ga0207698_10333251
2263 Ga0207698_10690492
2264 Ga0209589_1000006
2265 Ga0209489_100007
2266 Ga0209700_100008
2267 Ga0209588_1013347
2268 Ga0209966_1002388
2269 Ga0207428_10001181
2270 Ga0207428_10034949
2271 Ga0207428_10307301
2272 Ga0268266_10029034
2273 Ga0268266_10331459
2274 Ga0268266_10452100
2275 Ga0268266_10609945
2276 Ga0268265_10018788
2277 Ga0268264_10000038
2278 Ga0268264_10070546
2279 Ga0268264_10136863
2280 Ga0268264_10148903
2281 Ga0268264_10184053
2282 Ga0268264_10449362
2283 Ga0265337_1001512
2284 Ga0265337_1086894
2285 Ga0265326_10003349
2286 Ga0265319_1005298
2287 Ga0265323_10001506
2288 Ga0265336_10000930
2289 Ga0307517_10077356
2290 Ga0265338_10000013
2291 Ga0265338_10018836
2292 Ga0265330_10047217
2293 Ga0265325_10000036
2294 Ga0265325_10075086
2295 Ga0265325_10118249
2296 Ga0265340_10032799
2297 Ga0307509_10214684
2298 Ga0307509_10296220
2299 Ga0307509_10342182
2300 Ga0265313_10007874
2301 Ga0265313_10055072
2302 Ga0307508_10000034
2303 Ga0307508_10084750
2304 Ga0265314_10000771
2305 Ga0265314_10006228
2306 Ga0265342_10000715
2307 Ga0265342_10037172
2308 Ga0307516_10015179
2309 Ga0307516_10090518
2310 Ga0307516_10130481
2311 Ga0307411_10417767
2312 Ga0307415_100070472
2313 Ga0307415_100091352
2314 Ga0316583_10000468
2315 Ga0307507_10068870
2316 Ga0307510_10015915
2317 Ga0307510_10025917
2318 Ga0307510_10040325
2319 Ga0307510_10050413
2320 Ga0307510_10259358
2321 Ga0315911_1000010
2322 Ga0373930_0013435
2323 Ga0373934_0029959
2324 Ga0373944_0003355
2325 Ga0373923_0003159
2326 Ga0373923_0081132
2327 Ga0373936_0016278
2328 Ga0373936_0016449
2329 Ga0373939_0014731
2330 Ga0373939_0041457
2331 Ga0373939_0043711
2332 Ga0373945_0124051
2333 Ga0373945_0151693
2334 Ga0373953_0014392
2335 Ga0373953_0067831
2336 Ga0373953_0116814
2337 Ga0373954_0005645
2338 Ga0373956_0002992
2339 Ga0373956_0023889
2340 Ga0373956_0038909
2341 Ga0373956_0101905
2342 Ga0373957_0016398
2343 Ga0373943_0002425
2344 Ga0373943_0103432
2345 Ga0373946_0009713
2346 Ga0373946_0122069
2347 Ga0373946_0169790
2348 Ga0373955_0002414
2349 Ga0373955_0002681
2350 Ga0373955_0003006
2351 Ga0373955_0005476
2352 Ga0373955_0022938
2353 Ga0373955_0055725
2354 Ga0373961_0008362
2355 Ga0373924_0005315
2356 Ga0373924_0014286
2357 Ga0373924_0022245
2358 Ga0373924_0047661
2359 Ga0373931_0003537
2360 Ga0373931_0029986
2361 Ga0373931_0126225
2362 Ga0373935_0000100
2363 Ga0373935_0092322
2364 Ga0373935_0105305
2365 Ga0373927_0001937
2366 Ga0373927_0010867
2367 Ga0373927_0019455
2368 Ga0373927_0029680
2369 Ga0373927_0104617
2370 Ga0373927_0244051
2371 Ga0373927_0384467
2372 Ga0373927_0419228
2373 Ga0373933_0007683
2374 Ga0373933_0020293
2375 Ga0373933_0030028
2376 Ga0373933_0354595
2377 Ga0373947_0004147
2378 Ga0373947_0014655
2379 Ga0373947_0031395
2380 Ga0373947_0052924
2381 Ga0373947_0157346
2382 Ga0373947_0183479
2383 Ga0373937_0000028
2384 Ga0373937_0005428
2385 Ga0373937_0040922
2386 Ga0373937_0042854
2387 Ga0373937_0043962
2388 Ga0373937_0092567
2389 Ga0373937_0234160
2390 Ga0373925_0000034
2391 Ga0373925_0040808
2392 Ga0373925_0056896
2393 Ga0373925_0118793
2394 Ga0373925_0137551
2395 Ga0373925_0308902
2396 Ga0373925_0387944
2397 Ga0395899_0002233
2398 Ga0395899_0109507
2399 Ga0395900_0001351
2400 Ga0395900_0033149
2401 Ga0395900_0055199
2402 Ga0395898_0014184
2403 Ga0395898_0015935
2404 Ga0395898_0021905
2405 Ga0395901_0013773
2406 Ga0395901_0059357
2407 Ga0395901_0118991
2408 Ga0395901_0394195
2409 Ga0436365_1319250
2410 Ga0436365_1537157
2411 Ga0436365_1622752
2412 Ga0436365_1782951
2413 Ga0436360_0233758
2414 Ga0436360_0356281
2415 Ga0436360_0892341
2416 Ga0436363_1624790
2417 Ga0436362_0309256
2418 Ga0439453_0001021
2419 Ga0451802_0333791
2420 Ga0451833_0234451
2421 Ga0439432_066866
2422 Ga0439444_0007375
2423 Ga0439460_0073024
2424 Ga0466969_0049764
2425 Ga0466972_0000193
2426 Ga0466972_0000998
2427 Ga0466965_0093165
2428 Ga0466966_0000551
2429 Ga0466966_0105056
2430 Ga0466961_0000020
2431 Ga0466963_0374226
2432 Ga0466971_0170252
2433 Ga0466970_0012506
2434 Ga0466957_0075190
2435 Ga0466960_0035273
2436 Ga0466960_0153292
2437 Ga0466959_0067589
2438 Ga0466959_0135055
2439 Ga0466959_0358472
2440 Ga0466958_0047710
2441 Ga0466967_0002756
2442 Ga0466967_0103083
2443 Ga0466967_0557848
2444 Ga0495592_0000772
2445 Ga0495592_0016974
2446 Ga0495592_0040724
2447 Ga0495592_0074058
2448 Ga0495592_0225102
2449 Ga0495603_0022413
2450 Ga0495603_0024245
2451 Ga0495603_0029491
2452 Ga0495603_0153225
2453 Ga0495603_0264064
2454 Ga0495629_0001770
2455 Ga0495629_0002258
2456 Ga0495629_0007137
2457 Ga0495629_0047400
2458 Ga0495629_0066332
2459 Ga0495638_0004483
2460 Ga0495638_0044456
2461 Ga0495641_0018980
2462 Ga0495641_0084718
2463 Ga0495651_0002092
2464 Ga0495651_0010286
2465 Ga0495651_0010762
2466 Ga0495651_0038613
2467 Ga0495651_0054347
2468 Ga0495651_0081672
2469 Ga0495651_0094920
2470 Ga0495651_0302868
2471 Ga0495653_0000012
2472 Ga0495653_0019952
2473 Ga0495653_0045878
2474 Ga0495653_0089535
2475 Ga0495580_0152550
2476 Ga0495582_0245429
2477 Ga0495605_0026489
2478 Ga0495605_0108078
2479 Ga0495605_0170267
2480 Ga0495639_0005522
2481 Ga0495639_0015685
2482 Ga0495639_0023240
2483 Ga0495639_0077736
2484 Ga0495639_0109977
2485 Ga0495662_0001204
2486 Ga0495662_0014876
2487 Ga0495662_0155183
2488 Ga0495662_0219345
2489 Ga0495664_0000004
2490 Ga0495664_0045364
2491 Ga0495664_0046265
2492 Ga0495664_0217581
2493 Ga0495664_0267097
2494 Ga0495584_0046097
2495 Ga0495585_0052615
2496 Ga0495594_0066391
2497 Ga0495594_0211616
2498 Ga0495607_0105221
2499 Ga0495583_0133009
2500 Ga0495606_0009544
2501 Ga0495606_0023943
2502 Ga0495608_0000005
2503 Ga0495608_0057224
2504 Ga0495608_0067807
2505 Ga0495608_0157439
2506 Ga0495616_0183838
2507 Ga0495618_0000024
2508 Ga0495618_0008220
2509 Ga0495618_0057501
2510 Ga0495618_0194098
2511 Ga0495628_0000001
2512 Ga0495628_0002495
2513 Ga0495628_0006309
2514 Ga0495628_0017364
2515 Ga0495630_0001801
2516 Ga0495630_0007480
2517 Ga0495630_0027933
2518 Ga0495630_0211249
2519 Ga0495630_0324451
2520 Ga0495630_0327435
2521 Ga0495630_0397800
2522 Ga0495631_0215270
2523 Ga0495632_0044867
2524 Ga0495632_0069847
2525 Ga0495643_0171893
2526 Ga0495644_0043288
2527 Ga0495648_0001038
2528 Ga0495648_0057693
2529 Ga0495648_0133256
2530 Ga0495652_0000002
2531 Ga0495652_0016360
2532 Ga0495652_0033706
2533 Ga0495652_0052604
2534 Ga0495652_0118036
2535 Ga0495652_0245657
2536 Ga0495652_0279190
2537 Ga0495652_0471325
2538 Ga0495665_0014525
2539 Ga0495640_0000001
2540 Ga0495640_0008420
2541 Ga0495640_0018683
2542 Ga0495640_0026031
2543 Ga0495640_0049879
2544 Ga0495640_0108865
2545 Ga0495640_0190571
2546 Ga0495586_0347591
2547 Ga0495587_0000016
2548 Ga0495587_0006873
2549 Ga0495587_0029527
2550 Ga0495587_0052835
2551 Ga0495609_0189708
2552 Ga0495621_0115325
2553 Ga0495645_0000002
2554 Ga0495645_0005780
2555 Ga0495645_0007450
2556 Ga0495645_0012816
2557 Ga0495645_0014661
2558 Ga0495645_0130007
2559 Ga0495622_0001657
2560 Ga0495622_0025498
2561 Ga0495667_0000007
2562 Ga0495667_0007799
2563 Ga0495667_0009673
2564 Ga0495667_0019728
2565 Ga0495667_0029808
2566 Ga0495667_0062841
2567 Ga0495667_0100116
2568 Ga0495667_0337688
2569 Ga0495656_0075427
2570 Ga0495656_0086601
2571 Ga0495656_0108056
2572 Ga0495668_0030694
2573 Ga0495634_0000003
2574 Ga0495634_0006397
2575 Ga0495634_0010275
2576 Ga0495634_0019169
2577 Ga0495634_0038773
2578 Ga0495634_0068415
2579 Ga0495625_0035691
2580 Ga0495625_0048607
2581 Ga0495625_0086733
2582 Ga0495635_0000002
2583 Ga0495635_0001380
2584 Ga0495635_0004910
2585 Ga0495635_0014990
2586 Ga0495635_0045668
2587 Ga0495635_0051194
2588 Ga0495635_0146127
2589 Ga0495588_0007228
2590 Ga0495588_0012723
2591 Ga0495588_0055806
2592 Ga0495657_0000131
2593 Ga0495657_0007004
2594 Ga0495657_0010352
2595 Ga0495657_0011353
2596 Ga0495657_0015626
2597 Ga0495657_0065283
2598 Ga0495657_0263337
2599 Ga0495599_0000005
2600 Ga0495599_0017214
2601 Ga0495599_0046843
2602 Ga0495599_0092868
2603 Ga0495599_0139647
2604 Ga0495623_0000457
2605 Ga0495623_0000629
2606 Ga0495623_0005103
2607 Ga0495623_0023789
2608 Ga0495623_0044228
2609 Ga0495623_0094251
2610 Ga0495646_0000002
2611 Ga0495646_0018477
2612 Ga0495646_0024420
2613 Ga0495646_0032263
2614 Ga0495646_0070867
2615 Ga0495647_0116536
2616 Ga0495658_0003824
2617 Ga0495658_0024440
2618 Ga0495658_0038520
2619 Ga0495658_0174994
2620 Ga0495658_0208225
2621 Ga0495669_0003415
2622 Ga0495669_0050947
2623 Ga0495669_0139513
2624 Ga0495613_0051585
2625 Ga0495613_0056838
2626 Ga0495613_0074174
2627 Ga0495613_0117038
2628 Ga0495624_0004020
2629 Ga0495624_0025443
2630 Ga0495624_0027226
2631 Ga0495624_0119653
2632 Ga0495624_0288763
2633 Ga0495670_0110133
2634 Ga0495649_0022922
2635 Ga0495649_0056799
2636 Ga0495649_0272636
2637 Ga0495600_0000054
2638 Ga0495600_0005659
2639 Ga0495600_0008503
2640 Ga0495600_0010734
2641 Ga0495600_0014057
2642 Ga0495600_0048600
2643 Ga0495600_0103430
2644 Ga0495600_0147695
2645 Ga0495660_0113899
2646 Ga0495660_0200823
2647 Ga0495581_0029251
2648 Ga0495581_0040627
2649 Ga0495581_0045465
2650 Ga0495581_0299874
2651 Ga0495604_0000020
2652 Ga0495604_0007736
2653 Ga0495604_0011322
2654 Ga0495604_0022876
2655 Ga0495604_0029158
2656 Ga0495604_0034557
2657 Ga0495604_0098037
2658 Ga0495636_0011599
2659 Ga0495674_0000002
2660 Ga0495674_0006598
2661 Ga0495674_0060722
2662 Ga0495674_0076952
2663 Ga0495674_0154035
2664 Ga0495674_0212708
2665 Ga0495674_0425197
2666 Ga0495672_0102585
2667 Ga0495676_0034955
2668 Ga0495676_0055945
2669 Ga0495676_0113948
2670 Ga0495680_0005803
2671 Ga0495680_0007406
2672 Ga0495680_0019787
2673 Ga0495680_0022327
2674 Ga0495680_0110682
2675 Ga0495680_0170836
2676 Ga0495680_0381294
2677 Ga0495675_0000421
2678 Ga0495675_0003046
2679 Ga0495675_0024467
2680 Ga0495675_0047833
2681 Ga0495675_0048896
2682 Ga0495685_022061
2683 Ga0495673_0067610
2684 Ga0495673_0100132
2685 Ga0495673_0120736
2686 Ga0495684_0000017
2687 Ga0495684_0004704
2688 Ga0495684_0010743
2689 Ga0495684_0085620
2690 Ga0495684_0178484
2691 Ga0495684_0376978
2692 Ga0495593_0000790
2693 Ga0495593_0006607
2694 Ga0495593_0011390
2695 Ga0495593_0052545
2696 Ga0495593_0143146
2697 Ga0495602_0000005
2698 Ga0495602_0001719
2699 Ga0495602_0008247
2700 Ga0495602_0126604
2701 Ga0495614_0030413
2702 Ga0495614_0087942
2703 Ga0496100_0010727
2704 Ga0496100_0039643
2705 Ga0496100_0042647
2706 Ga0496100_0062446
2707 Ga0496101_0004289
2708 Ga0496101_0011229
2709 Ga0496101_0018829
2710 Ga0496101_0049042
2711 Ga0496101_0054741
2712 Ga0496101_0127908
2713 Ga0496101_0224179
2714 Ga0496102_0010809
2715 Ga0496102_0062757
2716 Ga0496102_0153977
2717 Ga0496102_0342871
2718 Ga0496102_0491911
2719 Ga0496103_0015307
2720 Ga0496103_0016126
2721 Ga0496103_0083756
2722 Ga0496104_0000819
2723 Ga0496104_0002128
2724 Ga0496104_0007769
2725 Ga0496104_0010459
2726 Ga0496104_0041522
2727 Ga0496104_0045249
2728 Ga0496104_0184090
2729 Ga0496104_0308383
2730 Ga0496104_0742630
2731 Ga0496105_0000862
2732 Ga0496105_0026411
2733 Ga0496105_0029225
2734 Ga0496105_0032403
2735 Ga0496105_0037311
2736 Ga0496105_0077652
2737 Ga0496105_0086680
2738 Ga0496105_0126795
2739 Ga0496105_0171132
2740 Ga0496106_0010290
2741 Ga0496106_0015767
2742 Ga0496106_0018741
2743 Ga0496106_0055167
2744 Ga0496107_0001840
2745 Ga0496107_0008370
2746 Ga0496107_0034947
2747 Ga0496107_0054198
2748 Ga0496107_0063957
2749 Ga0496107_0097349
2750 Ga0496108_0009733
2751 Ga0496108_0019236
2752 Ga0496108_0034029
2753 Ga0496108_0114430
2754 Ga0496108_0248639
2755 Ga0496108_0258907
2756 Ga0496109_0000725
2757 Ga0496109_0001849
2758 Ga0496109_0004415
2759 Ga0496109_0047066
2760 Ga0496109_0059228
2761 Ga0496109_0231691
2762 Ga0496109_0324400
2763 Ga0496109_0475833
2764 Ga0496109_0796222
2765 Ga0496110_0006296
2766 Ga0496110_0007953
2767 Ga0496110_0032386
2768 Ga0496110_0071595
2769 Ga0496110_0111381
2770 Ga0496110_0137761
2771 Ga0496110_0206798
2772 Ga0496110_0223784
2773 Ga0496110_0395804
2774 Ga0496110_0657175
2775 Ga0496111_0001813
2776 Ga0496111_0073252
2777 Ga0496111_0174499
2778 Ga0496111_0368024
2779 Ga0496112_0000008
2780 Ga0496112_0000650
2781 Ga0496112_0008057
2782 Ga0496112_0039338
2783 Ga0496112_0057366
2784 Ga0496112_0138531
2785 Ga0496113_0000194
2786 Ga0496113_0004856
2787 Ga0496113_0022970
2788 Ga0496113_0122223
2789 Ga0496113_0201198
2790 Ga0496113_0302551
2791 Ga0496114_0004204
2792 Ga0496114_0036619
2793 Ga0496114_0044624
2794 Ga0496114_0048264
2795 Ga0496114_0064292
2796 Ga0496114_0071900
2797 Ga0496114_0157909
2798 Ga0496114_0197842
2799 Ga0496114_0258998
2800 Ga0496114_0331257
2801 Ga0496115_0001528
2802 Ga0496115_0021264
2803 Ga0496115_0062630
2804 Ga0496115_0073375
2805 Ga0496115_0084782
2806 Ga0496115_0087518
2807 Ga0496115_0090316
2808 Ga0496116_0043792
2809 Ga0496116_0144323
2810 Ga0496117_0051107
2811 Ga0496117_0119629
2812 Ga0496118_0020418
2813 Ga0496118_0034465
2814 Ga0496118_0103853
2815 Ga0496119_0078585
2816 Ga0496120_0006845
2817 Ga0496121_0000099
2818 Ga0496121_0007398
2819 Ga0496121_0024122
2820 Ga0496121_0024578
2821 Ga0496121_0028159
2822 Ga0496121_0029535
2823 Ga0496121_0042542
2824 Ga0496121_0116234
2825 Ga0496122_0013666
2826 Ga0496122_0192734
2827 Ga0496124_0005312
2828 Ga0496124_0191816
2829 Ga0496124_0258213
2830 Ga0496124_0353124
2831 Ga0496125_0000203
2832 Ga0496125_0045016
2833 Ga0496125_0187600
2834 Ga0496126_0008220
2835 Ga0496126_0008519
2836 Ga0496126_0018064
2837 Ga0496126_0025409
2838 Ga0496126_0084481
2839 Ga0496126_0189567
2840 Ga0496126_0363836
2841 Ga0496126_0378870
2842 Ga0501031_0010491
2843 Ga0501031_0013001
2844 Ga0501031_0046008
2845 Ga0501032_0001266
2846 Ga0501032_0006324
2847 Ga0501032_0040390
2848 Ga0501032_0053293
2849 Ga0501032_0064578
2850 Ga0501033_0000399
2851 Ga0501034_0000039
2852 Ga0501034_0000300
2853 Ga0501034_0012992
2854 Ga0501034_0023461
2855 Ga0501034_0039368
2856 Ga0501034_0058884
2857 Ga0501034_0066993
2858 Ga0501036_0000067
2859 Ga0501036_0000214
2860 Ga0501036_0009310
2861 Ga0501036_0085541
2862 Ga0501036_0150702
2863 Ga0501036_0399508
2864 Ga0501037_0000279
2865 Ga0501037_0003013
2866 Ga0501037_0008244
2867 Ga0501037_0026796
2868 Ga0501037_0120884
2869 Ga0501038_0000133
2870 Ga0501038_0005787
2871 Ga0501038_0036660
2872 Ga0501039_0000146
2873 Ga0501039_0008994
2874 Ga0501040_0024816
2875 Ga0501040_0438722
2876 Ga0501042_0104782
2877 Ga0501043_0000257
2878 Ga0501043_0004568
2879 Ga0501043_0013941
2880 Ga0501043_0057948
2881 Ga0501043_0077640
2882 Ga0501043_0104728
2883 Ga0501046_0000218
2884 Ga0501046_0016813
2885 Ga0501046_0371345
2886 Ga0501047_0000186
2887 Ga0501047_0000892
2888 Ga0501047_0011653
2889 Ga0501047_0011704
2890 Ga0501047_0012443
2891 Ga0501047_0026450
2892 Ga0501047_0078272
2893 Ga0501048_0000306
2894 Ga0501048_0033900
2895 Ga0501067_0001472
2896 Ga0501067_0027254
2897 Ga0501067_0295133
2898 Ga0501068_0003699
2899 Ga0501068_0017076
2900 Ga0501068_0110338
2901 Ga0501069_0009809
2902 Ga0501069_0028559
2903 Ga0501069_0066548
2904 Ga0501069_0410870
2905 Ga0501070_0009316
2906 Ga0501070_0024887
2907 Ga0501071_0025400
2908 Ga0501071_0164192
2909 Ga0501071_0266923
2910 Ga0501072_0052274
2911 Ga0501072_0439882
2912 Ga0501073_0000131
2913 Ga0501073_0025742
2914 Ga0501073_0066255
2915 Ga0501073_0096348
2916 Ga0501073_0105470
2917 Ga0501073_0270909
2918 Ga0501074_0003028
2919 Ga0501074_0007730
2920 Ga0501074_0023396
2921 Ga0501074_0078039
2922 Ga0501074_0194076
2923 Ga0501076_0163161
2924 Ga0501079_0027693
2925 Ga0501079_0108328
2926 Ga0501079_0141908
2927 Ga0501080_0000299
2928 Ga0501080_0000387
2929 Ga0501080_0017584
2930 Ga0501080_0030766
2931 Ga0501080_0040498
2932 Ga0501080_0125009
2933 Ga0501080_0559748
2934 Ga0501081_0219139
2935 Ga0501083_0000213
2936 Ga0501083_0000302
2937 Ga0501083_0013760
2938 Ga0501083_0066813
2939 Ga0501083_0096090
2940 Ga0501083_0143242
2941 Ga0501035_0001847
2942 Ga0501035_0033501
2943 Ga0501035_0113842
2944 Ga0501035_0122560
2945 Ga0501035_0369169
2946 Ga0501044_0000140
2947 Ga0501044_0000911
2948 Ga0501044_0009195
2949 Ga0501044_0037281
2950 Ga0501044_0101277
2951 Ga0501044_0115602
2952 Ga0501044_0156305
2953 Ga0501044_0163189
2954 Ga0501044_0190025
2955 Ga0501045_0034745
2956 nmdc:mga03683_100966_c1
2957 nmdc:mga03683_31972_c1
2958 nmdc:mga03683_86984_c1
2959 nmdc:mga00v17_51378_c1
2960 nmdc:mga0yw44_148217_c1
2961 nmdc:mga0yw44_191068_c1
2962 nmdc:mga0yw44_20099_c1
2963 nmdc:mga0yw44_61539_c1
2964 nmdc:mga0k408_268877_c1
2965 nmdc:mga0k408_345665_c1
2966 nmdc:mga06z11_170909_c1
2967 nmdc:mga05p37_123298_c1
2968 nmdc:mga05p37_126679_c1
2969 nmdc:mga05p37_1804_c1
2970 nmdc:mga05p37_255850_c1
2971 nmdc:mga05p37_48521_c1
2972 nmdc:mga05p37_58714_c2
2973 nmdc:mga05p37_762399_c1
2974 nmdc:mga09592_15767_c1
2975 nmdc:mga09592_4406_c1
2976 nmdc:mga0qj67_1353_c1
2977 nmdc:mga0qj67_323904_c1
2978 nmdc:mga06r32_4623_c1
2979 nmdc:mga06r32_47529_c1
2980 nmdc:mga06r32_85631_c1
2981 nmdc:mga08y16_188955_c1
2982 nmdc:mga08y16_239474_c1
2983 nmdc:mga08y16_3182_c1
2984 nmdc:mga08y16_768706_c1
2985 nmdc:mga0n895_128985_c1
2986 nmdc:mga0n895_188715_c1
2987 nmdc:mga0n895_1891_c1
2988 nmdc:mga0n895_221370_c1
2989 nmdc:mga0n895_276198_c1
2990 nmdc:mga0n895_358334_c1
2991 nmdc:mga0rr50_185272_c1
2992 nmdc:mga0rr50_222996_c1
2993 nmdc:mga0rr50_246394_c1
2994 nmdc:mga0rr50_2542_c1
2995 nmdc:mga08x19_119813_c1
2996 nmdc:mga08x19_35_c1
2997 nmdc:mga08x19_90631_c1
2998 nmdc:mga0a205_19744_c1
2999 nmdc:mga0a205_720_c1
3000 Ga0495601_0000018
3001 Ga0495601_0000699
3002 Ga0495601_0002661
3003 Ga0495601_0004059
3004 Ga0495601_0005636
3005 Ga0495601_0055526
3006 Ga0495601_0117604
3007 Ga0495601_0244378
3008 Ga0495612_0000011
3009 Ga0495612_0001444
3010 Ga0495612_0006482
3011 Ga0495612_0023553
3012 Ga0495612_0112654
3013 Ga0500635_0002244
3014 Ga0495655_0018897
3015 Ga0495595_0000016
3016 Ga0495595_0000380
3017 Ga0495595_0001380
3018 Ga0495595_0007849
3019 Ga0495595_0008260
3020 Ga0495619_0000014
3021 Ga0495619_0000085
3022 Ga0495619_0000442
3023 Ga0495619_0011298
3024 Ga0495619_0020082
3025 Ga0495619_0045225
3026 Ga0495619_0066101
3027 Ga0495619_0160594
3028 Ga0500643_000018
3029 Ga0500644_0001192
3030 Ga0500647_0062219
3031 Ga0500651_0049609
3032 Ga0500566_0048657
3033 Ga0500641_0038577
3034 Ga0500554_001980
3035 Ga0500555_005820
3036 Ga0500556_0053713
3037 Ga0500557_000008
3038 Ga0500572_051994
3039 Ga0500595_000024
3040 Ga0500595_000146
3041 Ga0500595_000232
3042 Ga0500595_007153
3043 Ga0500595_021184
3044 Ga0500597_078318
3045 Ga0500614_032569
3046 Ga0500618_056369
3047 Ga0500642_0000294
3048 Ga0500658_0088826
3049 Ga0500559_0000823
3050 Ga0500559_0051981
3051 Ga0500559_0056905
3052 Ga0500568_0120334
3053 Ga0500577_0006365
3054 Ga0500588_0106467
3055 Ga0500603_001424
3056 Ga0500603_025353
3057 Ga0500616_0000547
3058 Ga0500620_001197
3059 Ga0500633_0014438
3060 Ga0500634_0173098
3061 Ga0500639_139761
3062 Ga0500636_0000550
3063 Ga0500636_0123009
3064 Ga0500636_0147410
3065 Ga0500637_0000405
3066 Ga0500637_0013869
3067 Ga0500637_0031034
3068 Ga0500611_039293
3069 Ga0500625_011535
3070 Ga0500645_000102
3071 Ga0500645_033560
3072 Ga0500609_005852
3073 Ga0500599_002533
3074 Ga0501084_0019137
3075 Ga0501084_0092215
3076 Ga0500661_000586
3077 Ga0501082_0006966
3078 Ga0501082_0036240
3079 Ga0501082_0060106
3080 Ga0501082_0263684
3081 Ga0501082_0537263
3082 Ga0530510_0119731
3083 Ga0530510_0159487
3084 Ga0530510_0194814
3085 8019636911
3086 2507510898
3087 2508544711
3088 2508697061
3089 2509147168
3090 2511394415
3091 2513637592
3092 2513649563
3093 2513654916
3094 2513671147
3095 2513700048
3096 2513719250
3097 2513861285
3098 2513874549
3099 2513894491
3100 2513916061
3101 2514015549
3102 2515625558
3103 2517100477
3104 2517894635
3105 2524437338
3106 2524534378
3107 2528853228
3108 2617350655
3109 2617377935
3110 2671119065
3111 2728747706
3112 2745076813
3113 2793065181
3114 2793071112
3115 2793083122
3116 2805916544
3117 2818238033
3118 2824606131
3119 2824616041
3120 2824618964
3121 2824627516
3122 2824638841
3123 2824649002
3124 2824657339
3125 2824663096
3126 2824676959
3127 2824682046
3128 2824693648
3129 2824698717
3130 2824706507
3131 2824716468
3132 2824726414
3133 2824737947
3134 2824753009
3135 2824756945
3136 2824769741
3137 2824778482
3138 2838127787
3139 2841943080
3140 2841956101
3141 2841960327
3142 2841968278
3143 2841976508
3144 2841987884
3145 2842042813
3146 2842050854
3147 2844317029
3148 2847938461
3149 2847944341
3150 2849081419
3151 2857512078
3152 2874597623
3153 2874618408
3154 2874623536
3155 2874630527
3156 2874649187
3157 2876767789
3158 2876774904
3159 2876822344
3160 2879077992
3161 2879088700
3162 2879103935
3163 2879117942
3164 2879132457
3165 2879145243
3166 2881370578
3167 2881667339
3168 2885367036
3169 2885379361
3170 2885390866
3171 2885416543
3172 2888381650
3173 2888388984
3174 2888422044
3175 2889033528
3176 2903734996
3177 2903758066
3178 2904667660
3179 2904697018
3180 2904705671
3181 2904719091
3182 2906604112
3183 2906611371
3184 2906633014
3185 2906641598
3186 2906648251
3187 2906661302
3188 2908744954
3189 2908762714
3190 2908782015
3191 2922362688
3192 2922371319
3193 2922393772
3194 2922428004
3195 2929619698
3196 2929627831
3197 2932786030
3198 2932798198
3199 2932803991
3200 2932817022
3201 2932822487
3202 2932831074
3203 2933581617
3204 2935612884
3205 2935624139
3206 2935632079
3207 2935640215
3208 2935655009
3209 2935663889
3210 2935666947
3211 2935680414
3212 2935690078
3213 2935699840
3214 2935704702
3215 2935722210
3216 2935731519
3217 2935735393
3218 2935745336
3219 2935755089
3220 2935762397
3221 2935775431
3222 2935780333
3223 2935790680
3224 2935799137
3225 2935803895
3226 2935811813
3227 2935824372
3228 2935829698
3229 2935842970
3230 2935852483
3231 2935862361
3232 2935870496
3233 2935881078
3234 2935884203
3235 2935912362
3236 2935923964
3237 2935929391
3238 2935936022
3239 2935949922
3240 2935957312
3241 2935962169
3242 2935968343
3243 2935976529
3244 2935988025
3245 2935993575
3246 2936004471
3247 2936018042
3248 2936026548
3249 2936035291
3250 2936038396
3251 2936053437
3252 2936059418
3253 2940561631
3254 2941508027
3255 2941515468
3256 2941523957
3257 2941533813
3258 2941544194
3259 3005477703
3260 3005485391
3261 3005507231
3262 3005594597
3263 3005596671
3264 3005712744
3265 3005719796
3266 8006933149
3267 8006933516
3268 8006971311
3269 8006983189
3270 8006989264
3271 8016516306
3272 8016523703
3273 8016537226
3274 8016551767
3275 8016560157
3276 8016579610
3277 8016589262
3278 8016598074
3279 8016604213
3280 8016620794
3281 8016629193
3282 8016633713
3283 8017060227
3284 8019536915
3285 8019542613
3286 8019559429
3287 8019569527
3288 8019579749
3289 8019603885
3290 8019614655
3291 8019625270
3292 8019649890
3293 8019681800
3294 8019693980
3295 8055749046
3296 8056686291
3297 8056695067
3298 8056969895

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

77

189

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ymu-assembly1.cif.gz_C crystal structure of an amino acid abc transporter complex with arginines and atps 0.5509 47 234
4jbw-assembly2.cif.gz_H crystal structure of e. coli maltose transporter malfgk2 in complex with its regulatory protein eiiaglc 0.5005 41 185
7ahh-assembly1.cif.gz_B opua inhibited inward-facing, sbd docked 0.4969 13 191
4ymu-assembly1.cif.gz_C crystal structure of an amino acid abc transporter complex with arginines and atps 0.4938 47 234
7ahh-assembly1.cif.gz_A opua inhibited inward-facing, sbd docked 0.4859 5 191
ID Description Score Start End Superfamily
af_P75851_53_247_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.7018 55 191 1.10.3720.10
af_Q2FVX5_4_220_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.5959 64 186 1.10.3720.10
af_Q2FYQ6_61_267_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.5957 66 191 1.10.3720.10
af_Q2FX86_270_484_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.5916 48 188 1.10.3720.10
af_P9WG07_21_330_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.5799 66 191 1.10.3720.10
ID Description Score Start End GO Terms
AF-A0A7V4AMQ2-F1-model_v4 ABC transporter permease 0.7594 1 191 GO:0005886
GO:0055085
AF-A0A2T6L397-F1-model_v4 ABC-type nitrate/sulfonate/bicarbonate transport system permease component 0.7504 1 191 GO:0005886
GO:0055085
AF-A0A2R7Y3J8-F1-model_v4 ABC transmembrane type-1 domain-containing protein 0.7495 1 242 GO:0005886
GO:0055085
AF-R0EDE2-F1-model_v4 ABC-type nitrate/sulfonate/bicarbonate transport system, permease component 0.7465 3 247 GO:0005886
GO:0055085
AF-R0EDE2-F1-model_v4 ABC-type nitrate/sulfonate/bicarbonate transport system, permease component 0.7386 3 247 GO:0005886
GO:0055085

Map