F495086

General Info

Members Datasets Scaffolds Average Seq Length
1622 605 1267 337

Family's Representative Sequence

Representative Sequence 3300046520|Ga0495637_0004206|Ga0495637_0004206_3207_4373
Length 379
Sequence VFTVLNSPLTRRSCRRLRSFDSALRNGEKIAACGSSYKTAFTSIKKELTMNLVALCVTNAFAAGSPGVEHNTQAFLEALAAGGGKPLEQLSPKDARGVLTGAQASVKVDLSGVEVSDKAIQVDGQTINLKVVRPAKVKGELPVFMFFHGGGWVLGDFPTHQRLIRDLVVGSGAVAVYVDYTPSPQAHYPTAINQAYAATRWVAEHGKEIKVDGKRLAVAGNSVGGNMAAVVALMAKEQKTPALRFQLLMWPVTNARFDSGSYQQFAEGHFLTQNMMKWFWDNYTTDAGERAQVHASPLNASTEQLKGLPAALVQTAEFDVLRDEGEGYARHLDAAGVPVTSVRYNGMIHDFGLLNPLSQIPEVKAAVRQAALELKTHLN

Samples

Sample ID Description Type Environment
1 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2506520007 Serratia plymuthica AS9 Isolate Rhizosphere
4 2506520008 Serratia plymuthica AS12 Isolate Unclassified
5 2508501071 Serratia proteamaculans S4 Isolate Rhizosphere
6 2510065053 Pseudomonas sp. MOIL14HWK12:I1 Isolate Rhizosphere
7 2510065055 Pseudomonas sp. MOIL14HWK12:I2 Isolate Rhizosphere
8 2510065058 Pseudomonas oleovorans MOIL14HWK12 Isolate Rhizosphere
9 2511231004 Pseudomonas sp. GM102 Isolate Nodule
10 2511231006 Pseudomonas sp. GM17 Isolate Nodule
11 2511231007 Pseudomonas sp. GM18 Isolate Nodule
12 2511231008 Pseudomonas sp. GM21 Isolate Nodule
13 2511231010 Pseudomonas sp. GM25 Isolate Nodule
14 2511231011 Pseudomonas sp. GM30 Isolate Nodule
15 2511231014 Pseudomonas sp. GM48 Isolate Nodule
16 2511231015 Pseudomonas sp. GM49 Isolate Nodule
17 2511231016 Pseudomonas sp. GM50 Isolate Nodule
18 2511231017 Pseudomonas sp. GM55 Isolate Nodule
19 2511231018 Pseudomonas sp. GM60 Isolate Nodule
20 2511231019 Pseudomonas sp. GM67 Isolate Nodule
21 2511231020 Pseudomonas sp. GM74 Isolate Nodule
22 2511231021 Pseudomonas sp. GM78 Isolate Nodule
23 2511231022 Pseudomonas sp. GM79 Isolate Nodule
24 2511231023 Pseudomonas sp. GM80 Isolate Nodule
25 2511231031 Pseudomonas sp. GM16 Isolate Nodule
26 2511231156 Pseudomonas ogarae F113 Isolate Rhizosphere
27 2519103095 Burkholderia sp. KJ006 Isolate Nodule
28 2521172590 Herbaspirillum sp. GW103 Isolate Rhizosphere
29 2551306416 Herbaspirillum seropedicae Os34 Isolate Unclassified
30 2554235231 Pseudomonas putida MTCC 5279 Isolate Unclassified
31 2582580891 Pseudomonas chlororaphis YL-1 Isolate Unclassified
32 2582581311 Burkholderia sp. WP42 Isolate Rhizosphere
33 2597489887 Pseudomonas chlororaphis aureofaciens 30-84 Isolate Rhizosphere
34 2597489888 Pseudomonas fluorescens SS101 Isolate Rhizosphere
35 2599185167 Pseudomonas sp. NFPP28 Isolate Rhizoplane
36 2599185179 Pseudomonas sp. NFR09 Isolate Rhizoplane
37 2599185185 Pseudomonas sp. NFPP07 Isolate Rhizoplane
38 2599185188 Pseudomonas sp. NFACC45 Isolate Rhizoplane
39 2599185190 Pseudomonas sp. NFPP04 Isolate Rhizoplane
40 2599185191 Pseudomonas sp. NFPP24 Isolate Rhizoplane
41 2599185212 Pseudomonas sp. NFACC15-1 Isolate Rhizoplane
42 2599185239 Burkholderia sp. NFACC38-1 Isolate Rhizoplane
43 2599185240 Burkholderia sp. NFPP32 Isolate Rhizoplane
44 2599185248 Pseudomonas sp. NFACC08-1 Isolate Rhizoplane
45 2599185257 Pseudomonas sp. NFACC41-3 Isolate Rhizoplane
46 2599185288 Pseudomonas sp. NFACC25 Isolate Rhizoplane
47 2599185289 Pseudomonas sp. NFACC51 Isolate Rhizoplane
48 2599185290 Pseudomonas sp. NFPP11 Isolate Rhizoplane
49 2599185291 Pseudomonas sp. NFACC48-1 Isolate Rhizoplane
50 2599185300 Pseudomonas sp. NFACC39-1 Isolate Rhizoplane
51 2599185302 Pseudomonas sp. NFACC43 Isolate Rhizoplane
52 2599185303 Pseudomonas sp. NFACC42-2 Isolate Rhizoplane
53 2599185304 Pseudomonas sp. NFACC47-1 Isolate Rhizoplane
54 2599185305 Pseudomonas sp. NFACC07-1 Isolate Rhizoplane
55 2599185306 Pseudomonas sp. NFACC16-2 Isolate Rhizoplane
56 2599185307 Pseudomonas sp. NFACC02 Isolate Rhizoplane
57 2599185308 Pseudomonas sp. NFACC17-2 Isolate Rhizoplane
58 2599185309 Pseudomonas sp. NFACC49-2 Isolate Rhizoplane
59 2599185310 Pseudomonas sp. NFACC09-4 Isolate Rhizoplane
60 2599185311 Pseudomonas sp. NFACC04-2 Isolate Rhizoplane
61 2599185312 Pseudomonas sp. NFACC32-1 Isolate Rhizoplane
62 2599185313 Pseudomonas sp. NFACC05-1 Isolate Rhizoplane
63 2599185314 Pseudomonas sp. NFACC23-1 Isolate Rhizoplane
64 2599185315 Pseudomonas sp. NFACC44-2 Isolate Rhizoplane
65 2599185316 Pseudomonas sp. NFACC52 Isolate Rhizoplane
66 2599185317 Pseudomonas sp. NFACC06-1 Isolate Rhizoplane
67 2599185318 Pseudomonas sp. NFACC13-1 Isolate Rhizoplane
68 2599185319 Pseudomonas sp. NFACC24-1 Isolate Rhizoplane
69 2599185320 Pseudomonas sp. NFACC36 Isolate Rhizoplane
70 2599185321 Pseudomonas sp. NFACC54 Isolate Rhizoplane
71 2599185322 Pseudomonas sp. NFACC14 Isolate Rhizoplane
72 2599185323 Pseudomonas sp. NFACC37-1 Isolate Rhizoplane
73 2599185324 Pseudomonas sp. NFACC46-3 Isolate Rhizoplane
74 2599185325 Pseudomonas sp. NFACC56-3 Isolate Rhizoplane
75 2599185355 Burkholderia sp. NFACC33-1 Isolate Rhizoplane
76 2600254930 Pseudomonas sp. NFIX10 Isolate Rhizoplane
77 2600254931 Pseudomonas sp. NFIX28 Isolate Rhizoplane
78 2600254954 Pseudomonas sp. NFACC19-2 Isolate Rhizoplane
79 2600255283 Pseudomonas sp. NFR16 Isolate Rhizoplane
80 2600255318 Pseudomonas putida NFIX47 Isolate Rhizoplane
81 2600255389 Pseudomonas sp. NFPP33 Isolate Rhizoplane
82 2603880185 Pseudomonas sp. NFIX46 Isolate Rhizoplane
83 2603880199 Pseudomonas sp. NFIX49 Isolate Rhizoplane
84 2623620443 Pseudomonas sp. DR 5-09 Isolate Unclassified
85 2623620446 Pseudomonas sp. GR 6-02 Isolate Unclassified
86 2639762793 Acinetobacter calcoaceticus GK1 Isolate Rhizosphere
87 2643221565 Pseudomonas sp. Root562 Isolate Unclassified
88 2643221589 Pseudomonas sp. Root68 Isolate Unclassified
89 2643221602 Pseudomonas sp. Root71 Isolate Unclassified
90 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
91 2643221633 Pseudomonas sp. Root329 Isolate Unclassified
92 2643221638 Duganella sp. Root336D2 Isolate Unclassified
93 2643221645 Massilia sp. Root351 Isolate Unclassified
94 2643221650 Pseudomonas sp. Root401 Isolate Unclassified
95 2651869719 Genome Sequence of Pseudomonas fluorescens UM270 Isolate Rhizosphere
96 2654587920 Serratia plymuthica HRO-C48 Isolate Rhizosphere
97 2667528170 Pseudomonas sp. NFACC50-1 Isolate Rhizoplane
98 2667528176 Pseudomonas sp. NFACC11-2 Isolate Rhizoplane
99 2671180172 Pseudomonas sp. NFIX51 Isolate Rhizoplane
100 2675903129 Burkholderia pyrrocinia NFIX32 Isolate Rhizoplane
101 2675903420 Pseudomonas fluorescens Ps006 Isolate Unclassified
102 2675903515 Pseudomonas thivervalensis DSM 13194 Isolate Unclassified
103 2684623219 Planctomyces sp. SH-PL14 Isolate Unclassified
104 2687453601 Serratia plymuthica 3Rp8 Isolate Unclassified
105 2690315857 Rheinheimera sp. EpRS3 Isolate Unclassified
106 2706794495 Dickeya zeae ZJU1202 Isolate Unclassified
107 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
108 2713897148 Pseudomonas fluorescens SF39a Isolate Rhizosphere
109 2713897149 Pseudomonas fluorescens SF4c Isolate Rhizosphere
110 2718217725 Pseudomonas fluorescens CREA-C16 Isolate Rhizosphere
111 2738541271 Pseudomonas sp. GV021 Isolate Unclassified
112 2738541294 Pseudomonas sp. GV087 Isolate Unclassified
113 2738541309 Pseudomonas sp. GV047 Isolate Unclassified
114 2738543004 Pseudomonas sp. GV085 Isolate Unclassified
115 2738543015 Pseudomonas sp. GV041 Isolate Unclassified
116 2738543016 Pseudomonas sp. GV012 Isolate Unclassified
117 2738543020 Pseudomonas sp. GV054 Isolate Unclassified
118 2738543021 Pseudomonas sp. GV071 Isolate Unclassified
119 2738543025 Pseudomonas sp. GV091 Isolate Unclassified
120 2740892503 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
121 2744054620 Pseudomonas thivervalensis LMG 21626 Isolate Unclassified
122 2765235841 Pseudomonas putida AA7 Isolate Unclassified
123 2773857670 Pseudomonas sp. 478 Isolate Unclassified
124 2773857672 Pseudomonas sp. 1766 Isolate Unclassified
125 2773857673 Pseudomonas sp. 443 Isolate Unclassified
126 2784132063 Pseudomonas sp. 424 Isolate Unclassified
127 2784132072 Pseudomonas sp. 460 Isolate Unclassified
128 2791355520 Pseudomonas sp. s211(2017) Isolate Unclassified
129 2806310673 Serratia quinivorans NCTC 13189 Isolate Rhizosphere
130 2806310737 Pseudomonas mosselii BS011 Isolate Unclassified
131 2806310745 Pseudomonas mosselii PtA1 Isolate Unclassified
132 2808606361 Pseudomonas sp. SJZ075 Isolate Rhizosphere
133 2808606373 Pseudomonas sp. SLBN-2 Isolate Unclassified
134 2808606376 Pseudomonas sp. SJZ074 Isolate Rhizosphere
135 2808606377 Pseudomonas sp. SJZ083 Isolate Rhizosphere
136 2808606378 Pseudomonas sp. SJZ078 Isolate Rhizosphere
137 2808606380 Pseudomonas sp. SJZ085 Isolate Rhizosphere
138 2808606381 Pseudomonas sp. SJZ077 Isolate Rhizosphere
139 2808606382 Pseudomonas sp. SJZ080 Isolate Rhizosphere
140 2808606383 Pseudomonas sp. SJZ124 Isolate Rhizosphere
141 2808606384 Burkholderia sp. SJZ089 Isolate Rhizosphere
142 2808606385 Pseudomonas sp. SJZ103 Isolate Rhizosphere
143 2808606388 Pseudomonas sp. SJZ094 Isolate Rhizosphere
144 2808606389 Pseudomonas sp. SJZ101 Isolate Rhizosphere
145 2808606390 Burkholderia sp. SJZ115 Isolate Rhizosphere
146 2808606391 Burkholderia sp. SJZ091 Isolate Rhizosphere
147 2808606445 Pseudomonas sp. SJZ131 Isolate Rhizosphere
148 2811994881 Pseudomonas sp. SLBN-26 Isolate Unclassified
149 2816332253 Burkholderia vietnamiensis HI2297 Isolate Unclassified
150 2816332256 Burkholderia vietnamiensis MSMB608WGS Isolate Unclassified
151 2816332286 Burkholderia vietnamiensis HI2221 Isolate Rhizosphere
152 2818991442 Chitinophaga pinensis 1204 Isolate Unclassified
153 2818991444 Filimonas endophytica 3197 Isolate Unclassified
154 2818991449 Herbaspirillum huttiense 1147 Isolate Unclassified
155 2818991452 Burkholderia cepacia 561 Isolate Unclassified
156 2818991456 Pseudomonas koreensis 3286 Isolate Rhizosphere
157 2821136567 Chitinophaga sancti 1232 Isolate Unclassified
158 2823421272 Pseudomonas mendocina S5.2 Isolate Rhizoplane
159 2825651385 Pseudomonas brassicacearum L13-6-12 Isolate Rhizosphere
160 2826581358 Pseudomonas viridiflava CDRTc14 Isolate Unclassified
161 2834028612 Pseudomonas fluorescens 513 Isolate Unclassified
162 2842805378 Pseudomonas sp. R-72599 Isolate Unclassified
163 2842815866 Pseudomonas sp. R-72210 Isolate Unclassified
164 2842832357 Pseudomonas sp. R-72164 Isolate Unclassified
165 2842843487 Pseudomonas sp. R-72074 Isolate Unclassified
166 2842849001 Pseudomonas sp. R-72008 Isolate Unclassified
167 2842854478 Pseudomonas sp. R-71998 Isolate Unclassified
168 2852103415 Edaphovirga cremea DSM 105170 Isolate Rhizosphere
169 2852612431 Pseudomonas sp. SJZ073 Isolate Rhizosphere
170 2852657418 Pseudomonas sp. JAI115 Isolate Rhizosphere
171 2852667396 Pseudomonas sp. JAI120 Isolate Rhizosphere
172 2860339153 Pseudomonas sp. JAI111 Isolate Rhizosphere
173 2860867994 Pseudomonas sp. R1-43-08 Isolate Rhizosphere
174 2863421361 Burkholderia cenocepacia CACua-24 Isolate Rhizosphere
175 2869551831 Serratia inhibens PRI-2C Isolate Rhizosphere
176 2870068957 Burkholderia sp. JP2-270 Isolate Unclassified
177 2878029506 Pseudomonas fluorescens DR397 Isolate Rhizosphere
178 2880230671 Pseudomonas fluorescens LBUM677 Isolate Unclassified
179 2889415604 Paludisphaera rhizosphaerae JC665 Isolate Rhizosphere
180 2904439833 Herbaspirillum sp. 1589 Isolate Rhizosphere
181 2904467357 Chitinophaga sancti 3198 Isolate Unclassified
182 2904518522 Pseudomonas fluorescens 4488 Isolate Rhizosphere
183 2904530477 Herbaspirillum huttiense 611 Isolate Unclassified
184 2904550169 Stutzerimonas stutzeri 1099 Isolate Rhizosphere
185 2904564687 Burkholderia sp. 571 Isolate Unclassified
186 2904571731 Burkholderia cenocepacia 574 Isolate Unclassified
187 2904584206 Herbaspirillum sp. 1050 Isolate Unclassified
188 2904589729 Herbaspirillum sp. 1130 Isolate Unclassified
189 2904601388 Herbaspirillum sp. 1273 Isolate Rhizosphere
190 2904615490 Paraburkholderia franconis CNPSo 3157 Isolate Unclassified
191 2913036834 Pseudomonas viciae 11K1 Isolate Rhizosphere
192 2919046199 Herbaspirillum frisingense 596 Isolate Unclassified
193 2919063839 Pseudomonas pharyngis 1098 Isolate Rhizosphere
194 2919079590 Herbaspirillum sp. 1173 Isolate Unclassified
195 2919385768 Pseudomonas sp. 2957 Isolate Unclassified
196 2919456309 Pseudomonas sp. 3296 Isolate Rhizosphere
197 2919481497 Pseudomonas brassicacearum 3432 Isolate Unclassified
198 2919487758 Pseudomonas koreensis 3441 Isolate Unclassified
199 2919501602 Pseudomonas alcaliphila 3512 Isolate Unclassified
200 2919534386 Rheinheimera pacifica 3879 Isolate Unclassified
201 2919688452 Pararheinheimera soli 4138 Isolate Unclassified
202 2919697872 Pseudomonas frederiksbergensis 4169 Isolate Unclassified
203 2920107658 Aquisphaera insulae JC669 Isolate Rhizosphere
204 2921643360 Paraburkholderia steynii HC1.1ba Isolate Nodule
205 2923153595 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
206 2923510766 Herbaspirillum rubrisubalbicans SLBN-127 Isolate Rhizosphere
207 2923519811 Pseudomonas otitidis SLBN-103 Isolate Rhizosphere
208 2923586266 Pseudomonas fluorescens 1550 Isolate Rhizosphere
209 2926063275 Pseudomonas sp. 3400 Isolate Unclassified
210 2928130867 Herbaspirillum seropedicae 1977 Isolate Unclassified
211 2928157003 Burkholderia ambifaria 566 Isolate Unclassified
212 2928163908 Burkholderia sp. 567 Isolate Unclassified
213 2928170801 Burkholderia sp. 572 Isolate Unclassified
214 2928536128 Burkholderia sola 565 Isolate Unclassified
215 2929144301 Pseudomonas sp. R-71838 Hybrid assembly Isolate Unclassified
216 2929189879 Pseudomonas sp. R-71842 Hybrid assembly Isolate Unclassified
217 2931369376 Pseudomonas fluorescens DR133 Isolate Rhizosphere
218 2931390751 Pseudomonas sp. DR208 Isolate Rhizosphere
219 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
220 2932406140 Serratia sp. 2723 Isolate Rhizosphere
221 2939577877 Serratia sp. 509 Isolate Rhizosphere
222 2939607340 Leclercia sp. 1548 Isolate Rhizosphere
223 2939636861 Pseudomonas sp. 2725 Isolate Rhizosphere
224 2945928738 Pseudomonas cedrina W1I11 Isolate Rhizosphere
225 2945961074 Pseudomonas sp. W2I6 Isolate Rhizosphere
226 2946006987 Pseudomonas sp. W3I7 Isolate Rhizosphere
227 2946027586 Pseudomonas sp. W4I3 Isolate Rhizosphere
228 2969304461 Pseudomonas sp. R84 Isolate Rhizosphere
229 2974289157 Pseudomonas fluorescens SORGH_AS 191 Isolate Unclassified
230 2974298342 Pseudomonas sp. SORGH_AS 211 Isolate Unclassified
231 2984286254 Pseudomonas chlororaphis aurantiaca JD37 Isolate Rhizosphere
232 2984499530 Pseudomonas sp. SORGH_AS199 Isolate Aerial Root
233 2988728565 Pseudomonas corrugata RM1-1-4 Isolate Rhizosphere
234 2998139840 Pseudomonas iranensis SWRI54 Isolate Rhizosphere
235 3007252601 Pseudomonas punonensis D1-6 Isolate Unclassified
236 3007395558 Pseudomonas chlororaphis PCL1601 Isolate Rhizosphere
237 3007419365 Pseudomonas vanderleydeniana RW8P3 Isolate Unclassified
238 3007511990 Pseudomonas fluorescens G20-18 Isolate Rhizosphere
239 3007614139 Pseudomonas sp. PB106 Isolate Unclassified
240 3007619802 Pseudomonas sp. PB120 Isolate Unclassified
241 3007718800 Pseudomonas fluorescens BW11P2 Isolate Rhizosphere
242 3007803356 Pseudomonas sp. CM27 Isolate Unclassified
243 3007855910 Pseudomonas khorasanensis SWRI153 Isolate Rhizosphere
244 3007861166 Pseudomonas hamedanensis SWRI65 Isolate Rhizosphere
245 3007866637 Pseudomonas marvdashtae SWRI102 Isolate Rhizosphere
246 3007872151 Pseudomonas sp. SWRI51 Isolate Rhizosphere
247 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
248 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
249 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
250 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
251 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
252 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
253 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
254 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
255 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
256 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
257 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
258 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
259 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
260 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
261 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
262 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
263 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
264 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
265 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
266 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
267 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
268 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
269 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
270 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
271 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
272 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
273 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
274 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
275 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
276 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
277 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
278 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
279 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
280 3300005272 Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v1 Metagenome Rhizosphere
281 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
282 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
283 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
284 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
285 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
286 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
287 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
288 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
289 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
290 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
291 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
292 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
293 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
294 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
295 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
296 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
297 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
298 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
299 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
300 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
301 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
302 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
303 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
304 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
305 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
306 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
307 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
308 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
309 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
310 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
311 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
312 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
313 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
314 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
315 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
316 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
317 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
318 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
319 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
320 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
321 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
322 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
323 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
324 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
325 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
326 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
327 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
328 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
329 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
330 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
331 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
332 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
333 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
334 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
335 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
336 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
337 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
338 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
339 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
340 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
341 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
342 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
343 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
344 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
345 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
346 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
347 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
348 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
349 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
350 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
351 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
352 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
353 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
354 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
355 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
356 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
357 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
358 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
359 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
360 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
361 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
362 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
363 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
364 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
365 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
366 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
367 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
368 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
369 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
370 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
371 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
372 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
373 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
374 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
375 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
376 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
377 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
378 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
379 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
380 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
381 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
382 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
383 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
384 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
385 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
386 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
387 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
388 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
389 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
390 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
391 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
392 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
393 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
394 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
395 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
396 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
397 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
398 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
399 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
400 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
401 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
402 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
403 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
404 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
405 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
406 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
407 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
408 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
409 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
410 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
411 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
412 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
413 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
414 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
415 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
416 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
417 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
418 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
419 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
420 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
421 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
422 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
423 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
424 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
425 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
426 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
427 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
428 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
429 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
430 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
431 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
432 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
433 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
434 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
435 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
436 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
437 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
438 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
439 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
440 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
441 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
442 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
443 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
444 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
445 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
446 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
447 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
448 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
449 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
450 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
451 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
452 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
453 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
454 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
455 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
456 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
457 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
458 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
459 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
460 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
461 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
462 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
463 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
464 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
465 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
466 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
467 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
468 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
469 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
470 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
471 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
472 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
473 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
474 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
475 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
476 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
477 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
478 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
479 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
480 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
481 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
482 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
483 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
484 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
485 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
486 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
487 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
488 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
489 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
490 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
491 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
492 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
493 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
494 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
495 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
496 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
497 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
498 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
499 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
500 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
501 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
502 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
503 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
504 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
505 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
506 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
507 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
508 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
509 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
510 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
511 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
512 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
513 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
514 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
515 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
516 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
517 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
518 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
519 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
520 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
521 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
522 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
523 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
524 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
525 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
526 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
527 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
528 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
529 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
530 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
531 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
532 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
533 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
534 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
535 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
536 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
537 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
538 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
539 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
540 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
541 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
542 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
543 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
544 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
545 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
546 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
547 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
548 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
549 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
550 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
551 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
552 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
553 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
554 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
555 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
556 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
557 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
558 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
559 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
560 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
561 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
562 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
563 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
564 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
565 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
566 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
567 3300053135 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere Metagenome Endosphere
568 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
569 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
570 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
571 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
572 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
573 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
574 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
575 640753048 Serratia proteamaculans 568 Isolate Endosphere
576 642555112 Paraburkholderia phymatum STM815 Isolate Nodule
577 8015687852 Pseudomonas chlororaphis aurantiaca RP4 Isolate Rhizosphere
578 8018845410 Burkholderia reimsis BE51 Isolate Rhizosphere
579 8019775933 Pseudomonas sp. PvR083 Isolate Rhizosphere
580 8020807995 Burkholderia sp. B10 Isolate Rhizosphere
581 8020945358 Burkholderia sp. BE17 Isolate Rhizosphere
582 8021120328 Burkholderia sp. LS-044 Isolate Rhizosphere
583 8029995093 Pseudomonas atacamensis SM1 Isolate Rhizosphere
584 8034962539 Pseudomonas sediminis PI11 Isolate Rhizosphere
585 8039098773 Burkholderia multivorans MSMB612WGS Isolate Unclassified
586 8040167225 Burkholderia vietnamiensis RS1 Isolate Unclassified
587 8040173305 Burkholderia vietnamiensis BE10 Isolate Rhizosphere
588 8052494512 Pseudomonas putida LD6 Isolate Unclassified
589 8054285046 Pseudomonas petroselini MAFF 311096 Isolate Nodule
590 8054503363 Pseudomonas sivasensis BsEB-1 Isolate Unclassified
591 8054929484 Pseudomonas vlassakiae RW4S1 Isolate Rhizosphere
592 8055770955 Pseudomonas chlororaphis qlu-1 Isolate Rhizosphere
593 8055817908 Pseudomonas pergaminensis 1008 Isolate Rhizosphere
594 8056115690 Pseudomonas muyukensis COW39 Isolate Rhizosphere
595 8056125926 Pseudomonas azerbaijanorientalis SWRI123 Isolate Rhizosphere
596 8056131705 Pseudomonas asgharzadehiana SWRI132 Isolate Rhizosphere
597 8056137416 Pseudomonas fakonensis COW40 Isolate Rhizosphere
598 8056143049 Pseudomonas alvandae SWRI17 Isolate Rhizosphere
599 8056155041 Pseudomonas farris SWRI79 Isolate Rhizosphere
600 8056161164 Pseudomonas azadiae SWRI103 Isolate Rhizosphere
601 8056166840 Pseudomonas triticicola SWRI88 Isolate Rhizosphere
602 8056172158 Pseudomonas ekonensis COR58 Isolate Rhizosphere
603 8056177738 Pseudomonas azerbaijanoccidentalis SWRI74 Isolate Rhizosphere
604 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
605 8056569372 Pseudomonas serboccidentalis IT-P374 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 78.55
Metatranscriptomes 0
Isolates 21.45

Biome Distribution

Category Percentage (%)
Aerial Root 0.06
Bulb 0
Endosphere 11.16
Nodule 2.77
Rhizoplane 5.61
Rhizosphere 66.15
Stem 0
Stem Tuber 0
Unclassified 14.24

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS2a_Contig_23 2124908027 Bacteria 55080
2 MRS2a_Contig_6176 2124908027 Bacteria 5712
3 SwRhRL2b_contig_1640999 2162886007 Bacteria 3995
4 SwRhRL2b_contig_180217 2162886007 Bacteria 1651
5 SwRhRL2b_contig_2300201 2162886007 Bacteria 1945
6 SwRhRL2b_contig_3802573 2162886007 Bacteria 9073
7 SwRhRL2b_contig_661307 2162886007 Bacteria 15307
8 JGI24739J22299_10009540 3300001989 Bacteria 3613
9 JGI25162J39368_1000013 3300002737 Bacteria 343384
10 JGI25162J39368_1000016 3300002737 Bacteria 288734
11 JGI25158J39367_1001698 3300002739 Bacteria 3771
12 JGI25163J39215_1000021 3300002771 Bacteria 74332
13 JGI25163J39215_1000581 3300002771 Bacteria 10305
14 JGI25164J39214_1000005 3300002772 Bacteria 343384
15 JGI25159J45721_1001534 3300002987 Bacteria 9466
16 JGI25159J45721_1003082 3300002987 Bacteria 6024
17 JGI25165J46597_1000099 3300003214 Bacteria 158550
18 JGI25165J46597_1000128 3300003214 Bacteria 130710
19 rootH1_10035892 3300003316 Bacteria 7472
20 rootH1_10175342 3300003316 Bacteria 1391
21 rootH2_10002539 3300003320 Bacteria 75433
22 rootH2_10015047 3300003320 Bacteria 20171
23 rootH2_10263596 3300003320 Bacteria 2735
24 JGI25160J50197_1002936 3300003354 Bacteria 7791
25 JGI25161J50226_1001799 3300003374 Bacteria 6024
26 Ga0055538_1000002 3300003751 Bacteria 999437
27 Ga0055539_1000002 3300003752 Bacteria 999437
28 Ga0055533_1000004 3300003756 Bacteria 999437
29 Ga0055532_1000230 3300003758 Bacteria 41833
30 Ga0055532_1001534 3300003758 Bacteria 6247
31 Ga0055525_1000002 3300003759 Bacteria 999437
32 Ga0055527_1000042 3300003760 Bacteria 115844
33 Ga0055527_1000270 3300003760 Bacteria 31387
34 Ga0055535_1000036 3300003761 Bacteria 162035
35 Ga0055535_1000066 3300003761 Bacteria 115844
36 Ga0055542_1000061 3300003762 Bacteria 162035
37 Ga0055542_1001559 3300003762 Bacteria 10785
38 Ga0055529_1000069 3300003763 Bacteria 162035
39 Ga0055529_1002440 3300003763 Bacteria 3607
40 Ga0055526_1002318 3300003771 Bacteria 12965
41 Ga0055526_1006094 3300003771 Bacteria 6660
42 Ga0055537_1000175 3300003773 Bacteria 47772
43 Ga0055524_1000015 3300003775 Bacteria 246493
44 Ga0055524_1001748 3300003775 Bacteria 11992
45 Ga0055524_1007104 3300003775 Bacteria 4797
46 Ga0055536_1000046 3300003781 Bacteria 118284
47 Ga0055536_1000119 3300003781 Bacteria 68235
48 Ga0055536_1001110 3300003781 Bacteria 16917
49 Ga0055536_1002293 3300003781 Bacteria 10860
50 Ga0055536_1002424 3300003781 Bacteria 10489
51 Ga0055534_1000452 3300003784 Bacteria 23968
52 Ga0055534_1000768 3300003784 Bacteria 15137
53 Ga0055528_1000537 3300003790 Bacteria 29135
54 Ga0055528_1001611 3300003790 Bacteria 13344
55 Ga0055528_1008578 3300003790 Bacteria 4355
56 Ga0055530_10000373 3300003791 Bacteria 40491
57 Ga0055530_10001052 3300003791 Bacteria 21886
58 Ga0055530_10002763 3300003791 Bacteria 10863
59 Ga0055530_10002821 3300003791 Bacteria 10670
60 Ga0055530_10003052 3300003791 Bacteria 9973
61 Ga0055540_1000070 3300003792 Bacteria 118483
62 Ga0055540_1000761 3300003792 Bacteria 21886
63 Ga0055540_1002116 3300003792 Bacteria 10855
64 Ga0055540_1002149 3300003792 Bacteria 10745
65 Ga0055531_10000151 3300003794 Bacteria 80302
66 Ga0055531_10000155 3300003794 Bacteria 79002
67 Ga0055531_10000742 3300003794 Bacteria 27477
68 Ga0055531_10001761 3300003794 Bacteria 15430
69 Ga0055531_10015489 3300003794 Bacteria 3354
70 Ga0055541_1000043 3300003841 Bacteria 161703
71 Ga0058692_1000051 3300003856 Bacteria 107880
72 Ga0058692_1006651 3300003856 Bacteria 3145
73 Ga0055543_1001587 3300004625 Bacteria 8765
74 Ga0055543_1009242 3300004625 Bacteria 2131
75 Ga0065165_1000119 3300005262 Bacteria 134464
76 Ga0065165_1000128 3300005262 Bacteria 129513
77 Ga0065165_1000726 3300005262 Bacteria 46055
78 Ga0065165_1019692 3300005262 Bacteria 2398
79 Ga0065703_1000218 3300005272 Bacteria 16012
80 Ga0065714_10004455 3300005288 Bacteria 5182
81 Ga0065714_10012982 3300005288 Bacteria 2245
82 Ga0065714_10024302 3300005288 Bacteria 3967
83 Ga0065714_10025315 3300005288 Bacteria 1335
84 Ga0065714_10065062 3300005288 Bacteria 13337
85 Ga0065714_10066322 3300005288 Bacteria 7110
86 Ga0065714_10066345 3300005288 Bacteria 7053
87 Ga0065714_10067351 3300005288 Bacteria 5614
88 Ga0065714_10096522 3300005288 Bacteria 1758
89 Ga0065714_10107453 3300005288 Bacteria 1531
90 Ga0065714_10113692 3300005288 Bacteria 1434
91 Ga0065714_10146719 3300005288 Bacteria 1119
92 Ga0065704_10000292 3300005289 Bacteria 38314
93 Ga0065704_10000681 3300005289 Bacteria 14725
94 Ga0065704_10001483 3300005289 Bacteria 14434
95 Ga0065704_10073102 3300005289 Bacteria 7584
96 Ga0065704_10073943 3300005289 Bacteria 6647
97 Ga0065704_10156139 3300005289 Bacteria 1389
98 Ga0065712_10006164 3300005290 Bacteria 2680
99 Ga0065712_10068223 3300005290 Bacteria 12740
100 Ga0065715_10011492 3300005293 Bacteria 2056
101 Ga0070658_10016240 3300005327 Bacteria 5957
102 Ga0070670_100001904 3300005331 Bacteria 17072
103 Ga0070670_100005785 3300005331 Bacteria 10448
104 Ga0070670_100008992 3300005331 Bacteria 8533
105 Ga0070670_100030122 3300005331 Bacteria 4673
106 Ga0070660_100000572 3300005339 Bacteria 24719
107 Ga0070661_100001382 3300005344 Bacteria 16961
108 Ga0070661_100025375 3300005344 Bacteria 4259
109 Ga0070669_100003585 3300005353 Bacteria 11204
110 Ga0070669_100121912 3300005353 Bacteria 1990
111 Ga0070671_100042390 3300005355 Bacteria 3783
112 Ga0070659_100000698 3300005366 Bacteria 24440
113 Ga0070714_100136545 3300005435 Bacteria 2197
114 Ga0070708_100039416 3300005445 Bacteria 4133
115 Ga0070663_100001986 3300005455 Bacteria 11426
116 Ga0068853_100033197 3300005539 Bacteria 4377
117 Ga0068853_100033739 3300005539 Bacteria 4342
118 Ga0068853_100410279 3300005539 Bacteria 1269
119 Ga0070665_100001721 3300005548 Bacteria 25063
120 Ga0070665_100044913 3300005548 Bacteria 4435
121 Ga0070704_100023296 3300005549 Bacteria 4041
122 Ga0068855_100000065 3300005563 Bacteria 129307
123 Ga0068855_100037194 3300005563 Bacteria 5790
124 Ga0070664_100005010 3300005564 Bacteria 10613
125 Ga0068854_100067072 3300005578 Bacteria 2613
126 Ga0068852_100007019 3300005616 Bacteria 8199
127 Ga0068852_100009594 3300005616 Bacteria 7194
128 Ga0068851_10000050 3300005834 Bacteria 72913
129 Ga0075364_10014866 3300006051 Bacteria 4816
130 Ga0075364_10048667 3300006051 Bacteria 2763
131 Ga0075364_10121184 3300006051 Bacteria 1751
132 Ga0075432_10015868 3300006058 Bacteria 2571
133 Ga0075432_10029606 3300006058 Bacteria 1891
134 Ga0075362_10057328 3300006177 Bacteria 1755
135 Ga0075362_10080798 3300006177 Bacteria 1498
136 Ga0075436_100041894 3300006914 Bacteria 3158
137 Ga0075436_100236977 3300006914 Bacteria 1297
138 Ga0099823_1000006 3300006944 Bacteria 135028
139 Ga0079104_1000124 3300006946 Bacteria 110752
140 Ga0079104_1002758 3300006946 Bacteria 8917
141 Ga0079104_1027136 3300006946 Bacteria 1472
142 Ga0099826_10000003 3300006948 Bacteria 1067817
143 Ga0099826_10023392 3300006948 Bacteria 4604
144 Ga0105251_10000013 3300009011 Bacteria 163226
145 Ga0105251_10000193 3300009011 Bacteria 61489
146 Ga0105251_10001039 3300009011 Bacteria 24331
147 Ga0105251_10001648 3300009011 Bacteria 18898
148 Ga0105251_10004102 3300009011 Bacteria 10190
149 Ga0105251_10005382 3300009011 Bacteria 8384
150 Ga0105251_10006201 3300009011 Bacteria 7674
151 Ga0105251_10006395 3300009011 Bacteria 7513
152 Ga0105251_10016228 3300009011 Bacteria 4034
153 Ga0105251_10041970 3300009011 Bacteria 2223
154 Ga0105251_10046707 3300009011 Bacteria 2083
155 Ga0105251_10091853 3300009011 Bacteria 1394
156 Ga0105251_10101744 3300009011 Bacteria 1313
157 Ga0105244_10000302 3300009036 Bacteria 47846
158 Ga0105244_10001906 3300009036 Bacteria 16204
159 Ga0105244_10002379 3300009036 Bacteria 14259
160 Ga0105244_10002557 3300009036 Bacteria 13651
161 Ga0105244_10003076 3300009036 Bacteria 12213
162 Ga0105244_10003260 3300009036 Bacteria 11709
163 Ga0105244_10003525 3300009036 Bacteria 11120
164 Ga0105244_10011091 3300009036 Bacteria 5428
165 Ga0105244_10014689 3300009036 Bacteria 4522
166 Ga0105244_10037969 3300009036 Bacteria 2514
167 Ga0105244_10040545 3300009036 Bacteria 2417
168 Ga0105244_10054451 3300009036 Bacteria 2029
169 Ga0105244_10074566 3300009036 Bacteria 1688
170 Ga0105250_10000092 3300009092 Bacteria 79976
171 Ga0105250_10000507 3300009092 Bacteria 27304
172 Ga0105250_10002084 3300009092 Bacteria 10258
173 Ga0105250_10003330 3300009092 Bacteria 7646
174 Ga0105250_10006245 3300009092 Bacteria 5228
175 Ga0105250_10006616 3300009092 Bacteria 5045
176 Ga0105250_10010591 3300009092 Bacteria 3841
177 Ga0105240_10000090 3300009093 Bacteria 184256
178 Ga0105240_10000232 3300009093 Bacteria 110394
179 Ga0105240_10045610 3300009093 Bacteria 5559
180 Ga0105247_10000012 3300009101 Bacteria 292188
181 Ga0105243_10000954 3300009148 Bacteria 27012
182 Ga0105243_10019002 3300009148 Bacteria 5210
183 Ga0105243_10096684 3300009148 Bacteria 2443
184 Ga0105242_10002363 3300009176 Bacteria 14891
185 Ga0105242_10194196 3300009176 Bacteria 1799
186 Ga0105248_10039288 3300009177 Bacteria 5299
187 Ga0105248_10071057 3300009177 Bacteria 3909
188 Ga0105237_10001117 3300009545 Bacteria 35949
189 Ga0105237_10001959 3300009545 Bacteria 26205
190 Ga0105237_10016014 3300009545 Bacteria 7796
191 Ga0105237_10024635 3300009545 Bacteria 6154
192 Ga0105237_10313861 3300009545 Bacteria 1571
193 Ga0105238_10021874 3300009551 Bacteria 6515
194 Ga0105238_10144987 3300009551 Bacteria 2351
195 Ga0105239_10001267 3300010375 Bacteria 34182
196 Ga0105239_10010093 3300010375 Bacteria 10586
197 Ga0105239_10089152 3300010375 Bacteria 3401
198 Ga0105239_10119585 3300010375 Bacteria 2924
199 Ga0105246_10000120 3300011119 Bacteria 35764
200 Ga0105246_10002300 3300011119 Bacteria 11528
201 Ga0157373_10001163 3300013100 Bacteria 20167
202 Ga0157373_10003018 3300013100 Bacteria 12714
203 Ga0157373_10003792 3300013100 Bacteria 11432
204 Ga0157373_10013168 3300013100 Bacteria 6070
205 Ga0157373_10013941 3300013100 Bacteria 5896
206 Ga0157373_10016336 3300013100 Bacteria 5415
207 Ga0157373_10090780 3300013100 Bacteria 2151
208 Ga0157373_10195495 3300013100 Bacteria 1426
209 Ga0157373_10228671 3300013100 Bacteria 1313
210 Ga0157371_10025284 3300013102 Bacteria 4329
211 Ga0157371_10197147 3300013102 Bacteria 1443
212 Ga0157370_10000199 3300013104 Bacteria 75511
213 Ga0157370_10011567 3300013104 Bacteria 9213
214 Ga0157370_10076057 3300013104 Bacteria 3164
215 Ga0157370_10307458 3300013104 Bacteria 1463
216 Ga0157369_10000670 3300013105 Bacteria 44076
217 Ga0157369_10014637 3300013105 Bacteria 8850
218 Ga0157369_10021174 3300013105 Bacteria 7269
219 Ga0157369_10027324 3300013105 Bacteria 6327
220 Ga0157369_10033958 3300013105 Bacteria 5602
221 Ga0157369_10058682 3300013105 Bacteria 4151
222 Ga0157369_10066320 3300013105 Bacteria 3883
223 Ga0157369_10127852 3300013105 Bacteria 2693
224 Ga0157369_10316365 3300013105 Bacteria 1623
225 Ga0163162_10000311 3300013306 Bacteria 45060
226 Ga0163162_10097341 3300013306 Bacteria 3031
227 Ga0163162_10218162 3300013306 Bacteria 2037
228 Ga0163162_10309555 3300013306 Bacteria 1712
229 Ga0163162_10392349 3300013306 Bacteria 1521
230 Ga0157372_10089144 3300013307 Bacteria 3504
231 Ga0157375_10010216 3300013308 Bacteria 8260
232 Ga0157375_10032111 3300013308 Bacteria 4977
233 Ga0157375_10382214 3300013308 Bacteria 1575
234 Ga0157375_10414409 3300013308 Bacteria 1513
235 Ga0182008_10003522 3300014497 Bacteria 9418
236 Ga0182008_10005394 3300014497 Bacteria 7294
237 Ga0182008_10014104 3300014497 Bacteria 4190
238 Ga0182008_10020567 3300014497 Bacteria 3397
239 Ga0182008_10021239 3300014497 Bacteria 3335
240 Ga0182008_10069799 3300014497 Bacteria 1729
241 Ga0182008_10075964 3300014497 Bacteria 1653
242 Ga0182008_10100712 3300014497 Bacteria 1428
243 Ga0182006_1000204 3300015261 Bacteria 59798
244 Ga0182006_1004201 3300015261 Bacteria 7145
245 Ga0182006_1005696 3300015261 Bacteria 5889
246 Ga0182006_1008554 3300015261 Bacteria 4638
247 Ga0182006_1014978 3300015261 Bacteria 3332
248 Ga0182006_1015239 3300015261 Bacteria 3298
249 Ga0182006_1017331 3300015261 Bacteria 3062
250 Ga0182006_1050867 3300015261 Bacteria 1596
251 Ga0182007_10000204 3300015262 Bacteria 40001
252 Ga0182007_10003378 3300015262 Bacteria 7537
253 Ga0182005_1000093 3300015265 Bacteria 67293
254 Ga0182005_1000114 3300015265 Bacteria 57889
255 Ga0182005_1003886 3300015265 Bacteria 4950
256 Ga0182005_1006309 3300015265 Bacteria 3638
257 Ga0182005_1010111 3300015265 Bacteria 2719
258 Ga0182005_1019514 3300015265 Bacteria 1868
259 Ga0182005_1020862 3300015265 Bacteria 1799
260 Ga0182005_1046521 3300015265 Bacteria 1179
261 Ga0163161_10000001 3300017792 Bacteria 2041488
262 Ga0163161_10003120 3300017792 Bacteria 11680
263 Ga0163161_10017734 3300017792 Bacteria 4988
264 Ga0163161_10018183 3300017792 Bacteria 4928
265 Ga0163161_10018429 3300017792 Bacteria 4893
266 Ga0163161_10025472 3300017792 Bacteria 4185
267 Ga0163161_10038252 3300017792 Bacteria 3441
268 Ga0163161_10047011 3300017792 Bacteria 3116
269 Ga0163161_10071791 3300017792 Bacteria 2534
270 Ga0163161_10119790 3300017792 Bacteria 1977
271 Ga0163161_10200027 3300017792 Bacteria 1539
272 Ga0163161_10218062 3300017792 Bacteria 1476
273 Ga0163161_10232146 3300017792 Bacteria 1432
274 Ga0213872_10000017 3300021361 Bacteria 178787
275 Ga0213872_10002525 3300021361 Bacteria 10669
276 Ga0213872_10006445 3300021361 Bacteria 5887
277 Ga0209760_100007 3300025207 Bacteria 211381
278 Ga0209760_100035 3300025207 Bacteria 132204
279 Ga0209436_100262 3300025208 Bacteria 24031
280 Ga0209436_102785 3300025208 Bacteria 4983
281 Ga0209784_100002 3300025224 Bacteria 1753105
282 Ga0209566_100003 3300025225 Bacteria 1753105
283 Ga0209674_100004 3300025226 Bacteria 1753105
284 Ga0209674_102494 3300025226 Bacteria 3920
285 Ga0209674_103750 3300025226 Bacteria 2689
286 Ga0209672_100035 3300025228 Bacteria 303111
287 Ga0209672_100090 3300025228 Bacteria 119861
288 Ga0209672_101840 3300025228 Bacteria 6387
289 Ga0209147_100041 3300025229 Bacteria 303111
290 Ga0209147_100132 3300025229 Bacteria 119628
291 Ga0209147_100156 3300025229 Bacteria 93105
292 Ga0209563_100006 3300025230 Bacteria 1753105
293 Ga0209563_100164 3300025230 Bacteria 54448
294 Ga0209563_100986 3300025230 Bacteria 8338
295 Ga0207427_100018 3300025231 Bacteria 530735
296 Ga0209437_100031 3300025233 Bacteria 530871
297 Ga0209437_100119 3300025233 Bacteria 206549
298 Ga0209258_100063 3300025242 Bacteria 303577
299 Ga0209258_100211 3300025242 Bacteria 116100
300 Ga0207425_1000060 3300025245 Bacteria 139031
301 Ga0207425_1001004 3300025245 Bacteria 13237
302 Ga0209026_1001487 3300025250 Bacteria 10293
303 Ga0209677_100003 3300025253 Bacteria 1753105
304 Ga0209148_1000088 3300025254 Bacteria 258188
305 Ga0209148_1000443 3300025254 Bacteria 45551
306 Ga0209759_1002784 3300025256 Bacteria 7398
307 Ga0209129_1001792 3300025258 Bacteria 11434
308 Ga0209233_1000012 3300025261 Bacteria 1019519
309 Ga0209565_1000006 3300025263 Bacteria 897294
310 Ga0209565_1001340 3300025263 Bacteria 11209
311 Ga0209565_1004373 3300025263 Bacteria 4311
312 Ga0209455_1000075 3300025272 Bacteria 285430
313 Ga0209455_1000631 3300025272 Bacteria 21732
314 Ga0209673_1000004 3300025273 Bacteria 896155
315 Ga0209673_1000061 3300025273 Bacteria 262274
316 Ga0209673_1001257 3300025273 Bacteria 26137
317 Ga0209673_1010719 3300025273 Bacteria 3840
318 Ga0209130_1001449 3300025284 Bacteria 15679
319 Ga0209130_1001994 3300025284 Bacteria 11168
320 Ga0209130_1002103 3300025284 Bacteria 10653
321 Ga0209130_1002367 3300025284 Bacteria 9560
322 Ga0209130_1012669 3300025284 Bacteria 2193
323 Ga0209675_1000006 3300025291 Bacteria 732267
324 Ga0209675_1001664 3300025291 Bacteria 12373
325 Ga0209675_1012344 3300025291 Bacteria 2760
326 Ga0209676_1000006 3300025292 Bacteria 1039588
327 Ga0209676_1000010 3300025292 Bacteria 954025
328 Ga0209676_1000055 3300025292 Bacteria 361565
329 Ga0209676_1000223 3300025292 Bacteria 124359
330 Ga0209676_1000407 3300025292 Bacteria 77466
331 Ga0209676_1000473 3300025292 Bacteria 66708
332 Ga0209676_1003099 3300025292 Bacteria 10692
333 Ga0209676_1006129 3300025292 Bacteria 6032
334 Ga0209564_1000064 3300025295 Bacteria 316431
335 Ga0209564_1004397 3300025295 Bacteria 8638
336 Ga0209564_1009105 3300025295 Bacteria 4779
337 Ga0209564_1012874 3300025295 Bacteria 3604
338 Ga0209758_1003146 3300025297 Bacteria 15515
339 Ga0209050_1000009 3300025298 Bacteria 1047265
340 Ga0209050_1000081 3300025298 Bacteria 267533
341 Ga0209050_1000085 3300025298 Bacteria 263219
342 Ga0209050_1000136 3300025298 Bacteria 179113
343 Ga0209050_1000214 3300025298 Bacteria 129270
344 Ga0209050_1000231 3300025298 Bacteria 122373
345 Ga0209050_1000465 3300025298 Bacteria 71894
346 Ga0209050_1000552 3300025298 Bacteria 61721
347 Ga0209050_1005130 3300025298 Bacteria 8407
348 Ga0209256_1000005 3300025299 Bacteria 1315082
349 Ga0209256_1000420 3300025299 Bacteria 66923
350 Ga0209256_1002112 3300025299 Bacteria 17284
351 Ga0209256_1002349 3300025299 Bacteria 15752
352 Ga0207426_1000215 3300025302 Bacteria 136757
353 Ga0207426_1000535 3300025302 Bacteria 54464
354 Ga0207426_1001212 3300025302 Bacteria 22818
355 Ga0207426_1001495 3300025302 Bacteria 19148
356 Ga0209051_1000008 3300025303 Bacteria 706935
357 Ga0209051_1000165 3300025303 Bacteria 122373
358 Ga0209051_1000171 3300025303 Bacteria 118013
359 Ga0209051_1000185 3300025303 Bacteria 110195
360 Ga0209051_1011125 3300025303 Bacteria 4471
361 Ga0209051_1021464 3300025303 Bacteria 2748
362 Ga0209257_1000010 3300025304 Bacteria 1158682
363 Ga0209257_1000013 3300025304 Bacteria 1047305
364 Ga0209257_1000040 3300025304 Bacteria 538759
365 Ga0209257_1000767 3300025304 Bacteria 47879
366 Ga0209257_1002483 3300025304 Bacteria 18241
367 Ga0209257_1006399 3300025304 Bacteria 7607
368 Ga0207656_10000683 3300025321 Bacteria 11116
369 Ga0207696_1000001 3300025711 Bacteria 2579611
370 Ga0207696_1000002 3300025711 Bacteria 1098043
371 Ga0207696_1000023 3300025711 Bacteria 422195
372 Ga0207696_1000171 3300025711 Bacteria 102599
373 Ga0207696_1000225 3300025711 Bacteria 79995
374 Ga0207696_1001259 3300025711 Bacteria 14233
375 Ga0207696_1002911 3300025711 Bacteria 8052
376 Ga0207696_1003628 3300025711 Bacteria 6953
377 Ga0207696_1005516 3300025711 Bacteria 5237
378 Ga0207696_1006566 3300025711 Bacteria 4672
379 Ga0207696_1041764 3300025711 Bacteria 1339
380 Ga0207655_1000006 3300025728 Bacteria 861092
381 Ga0207655_1000035 3300025728 Bacteria 359016
382 Ga0207655_1000051 3300025728 Bacteria 294176
383 Ga0207655_1000085 3300025728 Bacteria 206425
384 Ga0207655_1000217 3300025728 Bacteria 98999
385 Ga0207655_1000286 3300025728 Bacteria 77168
386 Ga0207655_1000340 3300025728 Bacteria 68045
387 Ga0207655_1000450 3300025728 Bacteria 54173
388 Ga0207655_1000451 3300025728 Bacteria 54097
389 Ga0207655_1000654 3300025728 Bacteria 41218
390 Ga0207655_1002485 3300025728 Bacteria 14924
391 Ga0207655_1005310 3300025728 Bacteria 8814
392 Ga0207655_1005373 3300025728 Bacteria 8724
393 Ga0207655_1009354 3300025728 Bacteria 6093
394 Ga0207655_1015128 3300025728 Bacteria 4311
395 Ga0207655_1034089 3300025728 Bacteria 2294
396 Ga0207655_1040787 3300025728 Bacteria 1998
397 Ga0207655_1041394 3300025728 Bacteria 1974
398 Ga0207655_1047738 3300025728 Bacteria 1764
399 Ga0207713_1000088 3300025735 Bacteria 155734
400 Ga0207713_1000113 3300025735 Bacteria 132424
401 Ga0207713_1000173 3300025735 Bacteria 92859
402 Ga0207713_1000220 3300025735 Bacteria 76897
403 Ga0207713_1000262 3300025735 Bacteria 64928
404 Ga0207713_1000298 3300025735 Bacteria 56915
405 Ga0207713_1000530 3300025735 Bacteria 38258
406 Ga0207713_1000816 3300025735 Bacteria 28818
407 Ga0207713_1001025 3300025735 Bacteria 24303
408 Ga0207713_1002411 3300025735 Bacteria 13651
409 Ga0207713_1003362 3300025735 Bacteria 10971
410 Ga0207713_1005863 3300025735 Bacteria 7591
411 Ga0207713_1006277 3300025735 Bacteria 7266
412 Ga0207713_1007173 3300025735 Bacteria 6644
413 Ga0207713_1017246 3300025735 Bacteria 3630
414 Ga0207713_1021244 3300025735 Bacteria 3117
415 Ga0207713_1022073 3300025735 Bacteria 3033
416 Ga0207713_1033185 3300025735 Bacteria 2257
417 Ga0207713_1034802 3300025735 Bacteria 2183
418 Ga0207713_1039788 3300025735 Bacteria 1979
419 Ga0207713_1049804 3300025735 Bacteria 1677
420 Ga0207713_1057730 3300025735 Bacteria 1499
421 Ga0207710_10000131 3300025900 Bacteria 87965
422 Ga0207647_10009950 3300025904 Bacteria 6735
423 Ga0207684_10123646 3300025910 Bacteria 2219
424 Ga0207695_10000169 3300025913 Bacteria 192566
425 Ga0207695_10000176 3300025913 Bacteria 187773
426 Ga0207695_10014003 3300025913 Bacteria 9525
427 Ga0207695_10030693 3300025913 Bacteria 5913
428 Ga0207671_10000989 3300025914 Bacteria 35031
429 Ga0207671_10009386 3300025914 Bacteria 8180
430 Ga0207671_10010188 3300025914 Bacteria 7781
431 Ga0207671_10018425 3300025914 Bacteria 5357
432 Ga0207671_10111343 3300025914 Bacteria 2083
433 Ga0207657_10001590 3300025919 Bacteria 24405
434 Ga0207649_10000041 3300025920 Bacteria 117781
435 Ga0207646_10009115 3300025922 Bacteria 9848
436 Ga0207681_10002768 3300025923 Bacteria 11087
437 Ga0207694_10008451 3300025924 Bacteria 7772
438 Ga0207694_10296154 3300025924 Bacteria 1331
439 Ga0207650_10000174 3300025925 Bacteria 75634
440 Ga0207650_10001409 3300025925 Bacteria 17327
441 Ga0207650_10014310 3300025925 Bacteria 5513
442 Ga0207700_10283560 3300025928 Bacteria 1426
443 Ga0207664_10122182 3300025929 Bacteria 2181
444 Ga0207644_10036161 3300025931 Bacteria 3465
445 Ga0207690_10000547 3300025932 Bacteria 24575
446 Ga0207706_10002445 3300025933 Bacteria 18134
447 Ga0207686_10035185 3300025934 Bacteria 3004
448 Ga0207686_10150838 3300025934 Bacteria 1618
449 Ga0207709_10000011 3300025935 Bacteria 552881
450 Ga0207709_10000035 3300025935 Bacteria 300968
451 Ga0207709_10010503 3300025935 Bacteria 5097
452 Ga0207665_10107405 3300025939 Bacteria 1957
453 Ga0207711_10091278 3300025941 Bacteria 2679
454 Ga0207679_10000018 3300025945 Bacteria 238375
455 Ga0207679_10045803 3300025945 Bacteria 3166
456 Ga0207667_10000025 3300025949 Bacteria 350159
457 Ga0207667_10001468 3300025949 Bacteria 29582
458 Ga0207667_10026840 3300025949 Bacteria 6284
459 Ga0207640_10072861 3300025981 Bacteria 2319
460 Ga0207658_10022132 3300025986 Bacteria 4422
461 Ga0207639_10024444 3300026041 Bacteria 4373
462 Ga0207639_10259040 3300026041 Bacteria 1520
463 Ga0207678_10008673 3300026067 Bacteria 8954
464 Ga0207698_10006688 3300026142 Bacteria 7204
465 Ga0207698_10009895 3300026142 Bacteria 6098
466 Ga0207698_10230259 3300026142 Bacteria 1682
467 Ga0209281_1000018 3300027111 Bacteria 579091
468 Ga0209281_1000077 3300027111 Bacteria 262887
469 Ga0209281_1003803 3300027111 Bacteria 4784
470 Ga0209281_1008896 3300027111 Bacteria 2399
471 Ga0209281_1009319 3300027111 Bacteria 2313
472 Ga0209389_1000030 3300027296 Bacteria 139329
473 Ga0209371_1000008 3300027312 Bacteria 1024606
474 Ga0209371_1000011 3300027312 Bacteria 848456
475 Ga0209371_1000179 3300027312 Bacteria 93861
476 Ga0209371_1000757 3300027312 Bacteria 26922
477 Ga0209282_1000002 3300027666 Bacteria 1067825
478 Ga0207428_10008748 3300027907 Bacteria 9132
479 Ga0207428_10010147 3300027907 Bacteria 8424
480 Ga0207428_10046998 3300027907 Bacteria 3468
481 Ga0207428_10071970 3300027907 Bacteria 2715
482 Ga0207428_10102784 3300027907 Bacteria 2207
483 Ga0268266_10001705 3300028379 Bacteria 25184
484 Ga0307517_10120901 3300028786 Bacteria 1937
485 Ga0307517_10159626 3300028786 Bacteria 1518
486 Ga0307517_10205693 3300028786 Bacteria 1222
487 Ga0307515_10003273 3300028794 Bacteria 34251
488 Ga0307515_10004165 3300028794 Bacteria 30102
489 Ga0307515_10004730 3300028794 Bacteria 27885
490 Ga0307515_10092079 3300028794 Bacteria 3778
491 Ga0307515_10232914 3300028794 Bacteria 1630
492 Ga0268256_1000009 3300030500 Bacteria 1022625
493 Ga0268256_1000011 3300030500 Bacteria 848625
494 Ga0268256_1000077 3300030500 Bacteria 177593
495 Ga0268256_1000149 3300030500 Bacteria 93861
496 Ga0316178_1126744 3300030735 Bacteria 26718
497 Ga0316181_1061592 3300030744 Bacteria 1969
498 Ga0316181_1087847 3300030744 Bacteria 1463
499 Ga0307513_10171675 3300031456 Bacteria 2045
500 Ga0307509_10028275 3300031507 Bacteria 6236
501 Ga0307408_100000077 3300031548 Bacteria 110022
502 Ga0307408_100000094 3300031548 Bacteria 97519
503 Ga0307408_100000174 3300031548 Bacteria 72297
504 Ga0307408_100005781 3300031548 Bacteria 8237
505 Ga0307408_100008134 3300031548 Bacteria 6929
506 Ga0307408_100023222 3300031548 Bacteria 4222
507 Ga0307408_100067274 3300031548 Bacteria 2634
508 Ga0307408_100098228 3300031548 Bacteria 2225
509 Ga0307408_100144896 3300031548 Bacteria 1868
510 Ga0307508_10001122 3300031616 Bacteria 30956
511 Ga0307516_10012577 3300031730 Bacteria 9108
512 Ga0307516_10014063 3300031730 Bacteria 8486
513 Ga0307405_10003762 3300031731 Bacteria 7046
514 Ga0307405_10017223 3300031731 Bacteria 3960
515 Ga0307405_10040009 3300031731 Bacteria 2837
516 Ga0307405_10103236 3300031731 Bacteria 1916
517 Ga0307406_10067727 3300031901 Bacteria 2328
518 Ga0307406_10103468 3300031901 Bacteria 1944
519 Ga0307407_10029880 3300031903 Bacteria 2932
520 Ga0307412_10004379 3300031911 Bacteria 7871
521 Ga0307412_10005057 3300031911 Bacteria 7370
522 Ga0307412_10034527 3300031911 Bacteria 3223
523 Ga0307412_10035887 3300031911 Bacteria 3171
524 Ga0307412_10101523 3300031911 Bacteria 2035
525 Ga0307412_10201375 3300031911 Bacteria 1512
526 Ga0307416_100072080 3300032002 Bacteria 2873
527 Ga0307414_10057788 3300032004 Bacteria 2729
528 Ga0307414_10087170 3300032004 Bacteria 2306
529 Ga0307411_10010652 3300032005 Bacteria 4914
530 Ga0307411_10414437 3300032005 Bacteria 1117
531 Ga0307510_10033836 3300033180 Bacteria 5733
532 Ga0307510_10133691 3300033180 Bacteria 2144
533 Ga0395905_0002046 3300037471 Bacteria 23048
534 Ga0395901_0000034 3300038443 Bacteria 230365
535 Ga0237819_01237 3300038705 Bacteria 7066
536 Ga0237819_01567 3300038705 Bacteria 5771
537 Ga0400483_077564 3300039062 Bacteria 1464
538 Ga0436361_0240489 3300039447 Bacteria 17218
539 Ga0436361_0425566 3300039447 Bacteria 6465
540 Ga0436361_0743687 3300039447 Bacteria 18104
541 Ga0436361_0833889 3300039447 Bacteria 30399
542 Ga0436361_1213913 3300039447 Bacteria 4164
543 Ga0439436_0012904 3300041404 Bacteria 2531
544 Ga0439438_000260 3300041405 Bacteria 23600
545 Ga0439438_001359 3300041405 Bacteria 10805
546 Ga0439438_002755 3300041405 Bacteria 7369
547 Ga0439438_009547 3300041405 Bacteria 3133
548 Ga0439438_013918 3300041405 Bacteria 2408
549 Ga0439438_017657 3300041405 Bacteria 2047
550 Ga0439438_029254 3300041405 Bacteria 1475
551 Ga0439447_000268 3300041407 Bacteria 18397
552 Ga0439447_002237 3300041407 Bacteria 7097
553 Ga0439447_003570 3300041407 Bacteria 5509
554 Ga0439447_033632 3300041407 Bacteria 1277
555 Ga0439466_0000448 3300041411 Bacteria 15706
556 Ga0439466_0002295 3300041411 Bacteria 7499
557 Ga0439466_0006090 3300041411 Bacteria 4593
558 Ga0439466_0008229 3300041411 Bacteria 3932
559 Ga0439466_0014319 3300041411 Bacteria 2889
560 Ga0439466_0033043 3300041411 Bacteria 1760
561 Ga0439466_0043490 3300041411 Bacteria 1491
562 Ga0439466_0059975 3300041411 Bacteria 1227
563 Ga0451798_1042570 3300041458 Bacteria 1046
564 Ga0439432_001794 3300042006 Bacteria 8046
565 Ga0439432_002089 3300042006 Bacteria 7544
566 Ga0439432_009692 3300042006 Bacteria 3351
567 Ga0439432_017432 3300042006 Bacteria 2410
568 Ga0439432_037860 3300042006 Bacteria 1537
569 Ga0439432_045198 3300042006 Bacteria 1385
570 Ga0439449_0035947 3300042007 Bacteria 1843
571 Ga0439451_032041 3300042009 Bacteria 1056
572 Ga0439452_000466 3300042010 Bacteria 22709
573 Ga0439452_001219 3300042010 Bacteria 10957
574 Ga0439452_001292 3300042010 Bacteria 10591
575 Ga0439452_001742 3300042010 Bacteria 8523
576 Ga0439452_010971 3300042010 Bacteria 2617
577 Ga0439452_013179 3300042010 Bacteria 2327
578 Ga0439452_026250 3300042010 Bacteria 1471
579 Ga0439455_0037678 3300042012 Bacteria 1227
580 Ga0439456_012706 3300042013 Bacteria 1746
581 Ga0439463_001095 3300042016 Bacteria 7312
582 Ga0439463_002529 3300042016 Bacteria 4645
583 Ga0439463_026766 3300042016 Bacteria 1449
584 Ga0450911_000968 3300042115 Bacteria 7498
585 Ga0450911_002773 3300042115 Bacteria 3311
586 Ga0450911_007479 3300042115 Bacteria 1583
587 Ga0450920_005726 3300042122 Bacteria 2216
588 Ga0450923_000518 3300042125 Bacteria 4299
589 Ga0450923_006834 3300042125 Bacteria 1907
590 Ga0450890_004468 3300042127 Bacteria 1826
591 Ga0450891_004443 3300042129 Bacteria 1312
592 Ga0450902_002992 3300042137 Bacteria 2436
593 Ga0450903_003382 3300042138 Bacteria 2763
594 Ga0450904_000022 3300042139 Bacteria 37057
595 Ga0450904_000292 3300042139 Bacteria 10835
596 Ga0450906_002200 3300042145 Bacteria 4259
597 Ga0450906_008551 3300042145 Bacteria 1975
598 Ga0450907_000474 3300042146 Bacteria 11356
599 Ga0450907_001315 3300042146 Bacteria 5520
600 Ga0450907_002672 3300042146 Bacteria 3324
601 Ga0450910_015605 3300042147 Bacteria 1118
602 Ga0439446_0000030 3300042156 Bacteria 23995
603 Ga0439446_0000589 3300042156 Bacteria 7421
604 Ga0439446_0005521 3300042156 Bacteria 3255
605 Ga0439446_0024239 3300042156 Bacteria 1730
606 Ga0450908_000420 3300042184 Bacteria 8187
607 Ga0450908_016190 3300042184 Bacteria 1331
608 Ga0450909_001625 3300042185 Bacteria 3139
609 Ga0450909_007499 3300042185 Bacteria 1579
610 Ga0439434_0000606 3300042435 Bacteria 10318
611 Ga0439434_0001138 3300042435 Bacteria 7689
612 Ga0439434_0006633 3300042435 Bacteria 3385
613 Ga0439464_0011253 3300042439 Bacteria 2368
614 Ga0439460_0004347 3300042461 Bacteria 3454
615 Ga0439460_0007043 3300042461 Bacteria 2804
616 Ga0439460_0008688 3300042461 Bacteria 2566
617 Ga0451577_0427009 3300042876 Bacteria 1203
618 Ga0439440_0001079 3300042993 Bacteria 4861
619 Ga0439440_0037497 3300042993 Bacteria 1170
620 Ga0466968_0000202 3300044735 Bacteria 18323
621 Ga0466970_0038444 3300044765 Bacteria 2538
622 Ga0495617_003920 3300046452 Bacteria 5482
623 Ga0495617_017261 3300046452 Bacteria 2437
624 Ga0495617_019579 3300046452 Bacteria 2289
625 Ga0495617_029489 3300046452 Bacteria 1844
626 Ga0495627_000027 3300046453 Bacteria 236960
627 Ga0495627_000160 3300046453 Bacteria 76554
628 Ga0495627_000205 3300046453 Bacteria 63989
629 Ga0495627_001078 3300046453 Bacteria 17940
630 Ga0495627_001605 3300046453 Bacteria 12643
631 Ga0495627_005084 3300046453 Bacteria 5373
632 Ga0495627_006733 3300046453 Bacteria 4472
633 Ga0495627_008072 3300046453 Bacteria 3970
634 Ga0495627_035988 3300046453 Bacteria 1540
635 Ga0495603_0031651 3300046455 Bacteria 3184
636 Ga0495603_0046225 3300046455 Bacteria 2594
637 Ga0495603_0084614 3300046455 Bacteria 1857
638 Ga0495590_0000048 3300046457 Bacteria 116368
639 Ga0495590_0012315 3300046457 Bacteria 3175
640 Ga0495591_000154 3300046458 Bacteria 72915
641 Ga0495591_000355 3300046458 Bacteria 40398
642 Ga0495591_001776 3300046458 Bacteria 12780
643 Ga0495591_002457 3300046458 Bacteria 10302
644 Ga0495591_002570 3300046458 Bacteria 9986
645 Ga0495591_002795 3300046458 Bacteria 9399
646 Ga0495591_002951 3300046458 Bacteria 9080
647 Ga0495591_003607 3300046458 Bacteria 7888
648 Ga0495591_004738 3300046458 Bacteria 6521
649 Ga0495591_024506 3300046458 Bacteria 1911
650 Ga0495638_0009362 3300046460 Bacteria 6886
651 Ga0495638_0028897 3300046460 Bacteria 3577
652 Ga0495638_0029787 3300046460 Bacteria 3519
653 Ga0495638_0061452 3300046460 Bacteria 2321
654 Ga0495653_0000817 3300046463 Bacteria 23901
655 Ga0495653_0027365 3300046463 Bacteria 4562
656 Ga0495653_0101995 3300046463 Bacteria 2077
657 Ga0495650_0000095 3300046471 Bacteria 218020
658 Ga0495650_0001005 3300046471 Bacteria 31820
659 Ga0495650_0004869 3300046471 Bacteria 8981
660 Ga0495650_0023333 3300046471 Bacteria 2947
661 Ga0495650_0043332 3300046471 Bacteria 1910
662 Ga0495650_0043644 3300046471 Bacteria 1900
663 Ga0495605_0000002 3300046474 Bacteria 522417
664 Ga0495605_0000006 3300046474 Bacteria 361304
665 Ga0495605_0000020 3300046474 Bacteria 254765
666 Ga0495605_0000075 3300046474 Bacteria 128702
667 Ga0495605_0000088 3300046474 Bacteria 119191
668 Ga0495605_0001180 3300046474 Bacteria 17364
669 Ga0495605_0001383 3300046474 Bacteria 15971
670 Ga0495605_0001394 3300046474 Bacteria 15900
671 Ga0495605_0001431 3300046474 Bacteria 15649
672 Ga0495605_0002327 3300046474 Bacteria 11837
673 Ga0495605_0003071 3300046474 Bacteria 10078
674 Ga0495605_0003260 3300046474 Bacteria 9741
675 Ga0495605_0015531 3300046474 Bacteria 4138
676 Ga0495605_0022111 3300046474 Bacteria 3362
677 Ga0495584_0000087 3300046491 Bacteria 64103
678 Ga0495584_0002347 3300046491 Bacteria 10791
679 Ga0495584_0004571 3300046491 Bacteria 7421
680 Ga0495584_0008609 3300046491 Bacteria 5282
681 Ga0495584_0010169 3300046491 Bacteria 4831
682 Ga0495584_0013889 3300046491 Bacteria 4102
683 Ga0495584_0021971 3300046491 Bacteria 3239
684 Ga0495584_0025611 3300046491 Bacteria 2990
685 Ga0495584_0027402 3300046491 Bacteria 2887
686 Ga0495584_0033457 3300046491 Bacteria 2600
687 Ga0495584_0081150 3300046491 Bacteria 1632
688 Ga0495585_0000073 3300046492 Bacteria 102662
689 Ga0495585_0000541 3300046492 Bacteria 35747
690 Ga0495585_0000614 3300046492 Bacteria 33211
691 Ga0495585_0003530 3300046492 Bacteria 10522
692 Ga0495585_0006640 3300046492 Bacteria 7150
693 Ga0495585_0038490 3300046492 Bacteria 2691
694 Ga0495585_0113537 3300046492 Bacteria 1438
695 Ga0495585_0117620 3300046492 Bacteria 1408
696 Ga0495594_0024423 3300046499 Bacteria 3246
697 Ga0495594_0141754 3300046499 Bacteria 1363
698 Ga0495596_0000375 3300046500 Bacteria 28559
699 Ga0495596_0005757 3300046500 Bacteria 5812
700 Ga0495596_0031520 3300046500 Bacteria 2117
701 Ga0495607_0000028 3300046501 Bacteria 155637
702 Ga0495607_0000051 3300046501 Bacteria 119303
703 Ga0495607_0000053 3300046501 Bacteria 118035
704 Ga0495607_0000106 3300046501 Bacteria 88081
705 Ga0495607_0000246 3300046501 Bacteria 58017
706 Ga0495607_0000629 3300046501 Bacteria 34218
707 Ga0495607_0002670 3300046501 Bacteria 14262
708 Ga0495607_0003041 3300046501 Bacteria 13070
709 Ga0495607_0003589 3300046501 Bacteria 11797
710 Ga0495607_0008839 3300046501 Bacteria 6859
711 Ga0495607_0018555 3300046501 Bacteria 4433
712 Ga0495607_0023229 3300046501 Bacteria 3882
713 Ga0495607_0050248 3300046501 Bacteria 2428
714 Ga0495607_0077173 3300046501 Bacteria 1840
715 Ga0495583_0000012 3300046506 Bacteria 324839
716 Ga0495583_0000135 3300046506 Bacteria 123916
717 Ga0495583_0000540 3300046506 Bacteria 53188
718 Ga0495583_0000759 3300046506 Bacteria 40966
719 Ga0495583_0001201 3300046506 Bacteria 27777
720 Ga0495583_0002193 3300046506 Bacteria 17359
721 Ga0495583_0004169 3300046506 Bacteria 10534
722 Ga0495583_0004571 3300046506 Bacteria 9833
723 Ga0495583_0006387 3300046506 Bacteria 7719
724 Ga0495606_0000022 3300046507 Bacteria 265567
725 Ga0495606_0000281 3300046507 Bacteria 88474
726 Ga0495606_0000293 3300046507 Bacteria 86455
727 Ga0495606_0000548 3300046507 Bacteria 60206
728 Ga0495606_0000873 3300046507 Bacteria 45086
729 Ga0495606_0001864 3300046507 Bacteria 26462
730 Ga0495606_0002271 3300046507 Bacteria 22755
731 Ga0495606_0003482 3300046507 Bacteria 16676
732 Ga0495606_0003987 3300046507 Bacteria 15091
733 Ga0495606_0006300 3300046507 Bacteria 10995
734 Ga0495606_0008357 3300046507 Bacteria 9013
735 Ga0495606_0011184 3300046507 Bacteria 7347
736 Ga0495606_0012381 3300046507 Bacteria 6845
737 Ga0495606_0013257 3300046507 Bacteria 6532
738 Ga0495606_0021090 3300046507 Bacteria 4780
739 Ga0495606_0031458 3300046507 Bacteria 3689
740 Ga0495610_0004502 3300046512 Bacteria 10267
741 Ga0495610_0007156 3300046512 Bacteria 7513
742 Ga0495610_0007673 3300046512 Bacteria 7125
743 Ga0495610_0009781 3300046512 Bacteria 6023
744 Ga0495610_0010705 3300046512 Bacteria 5676
745 Ga0495610_0011886 3300046512 Bacteria 5285
746 Ga0495610_0019236 3300046512 Bacteria 3829
747 Ga0495610_0023050 3300046512 Bacteria 3391
748 Ga0495610_0032047 3300046512 Bacteria 2735
749 Ga0495610_0040278 3300046512 Bacteria 2356
750 Ga0495610_0040498 3300046512 Bacteria 2347
751 Ga0495610_0057114 3300046512 Bacteria 1873
752 Ga0495616_0000393 3300046513 Bacteria 33844
753 Ga0495616_0001062 3300046513 Bacteria 19627
754 Ga0495616_0002238 3300046513 Bacteria 12945
755 Ga0495616_0003291 3300046513 Bacteria 10388
756 Ga0495616_0005371 3300046513 Bacteria 7904
757 Ga0495616_0006035 3300046513 Bacteria 7381
758 Ga0495616_0014011 3300046513 Bacteria 4505
759 Ga0495616_0040458 3300046513 Bacteria 2381
760 Ga0495616_0049374 3300046513 Bacteria 2109
761 Ga0495620_0000026 3300046515 Bacteria 124427
762 Ga0495620_0000034 3300046515 Bacteria 117942
763 Ga0495620_0000069 3300046515 Bacteria 86730
764 Ga0495620_0000103 3300046515 Bacteria 67830
765 Ga0495620_0000684 3300046515 Bacteria 20999
766 Ga0495620_0002772 3300046515 Bacteria 10090
767 Ga0495620_0003741 3300046515 Bacteria 8684
768 Ga0495620_0004441 3300046515 Bacteria 7907
769 Ga0495620_0005400 3300046515 Bacteria 7133
770 Ga0495620_0007169 3300046515 Bacteria 6075
771 Ga0495620_0010484 3300046515 Bacteria 4889
772 Ga0495620_0048118 3300046515 Bacteria 1832
773 Ga0495620_0056185 3300046515 Bacteria 1656
774 Ga0495620_0081334 3300046515 Bacteria 1310
775 Ga0495628_0085087 3300046516 Bacteria 2453
776 Ga0495630_0111659 3300046517 Bacteria 2070
777 Ga0495630_0118548 3300046517 Bacteria 2007
778 Ga0495631_0002264 3300046518 Bacteria 11031
779 Ga0495631_0002378 3300046518 Bacteria 10680
780 Ga0495631_0002648 3300046518 Bacteria 9983
781 Ga0495631_0040624 3300046518 Bacteria 2060
782 Ga0495631_0051005 3300046518 Bacteria 1808
783 Ga0495631_0051529 3300046518 Bacteria 1799
784 Ga0495631_0076882 3300046518 Bacteria 1440
785 Ga0495632_0000063 3300046519 Bacteria 117984
786 Ga0495632_0000117 3300046519 Bacteria 81479
787 Ga0495632_0002433 3300046519 Bacteria 14163
788 Ga0495632_0003021 3300046519 Bacteria 12268
789 Ga0495632_0003236 3300046519 Bacteria 11686
790 Ga0495632_0003477 3300046519 Bacteria 11140
791 Ga0495632_0006787 3300046519 Bacteria 7309
792 Ga0495632_0010108 3300046519 Bacteria 5618
793 Ga0495632_0014471 3300046519 Bacteria 4461
794 Ga0495632_0063775 3300046519 Bacteria 1783
795 Ga0495632_0065336 3300046519 Bacteria 1757
796 Ga0495632_0066135 3300046519 Bacteria 1744
797 Ga0495632_0081369 3300046519 Bacteria 1544
798 Ga0495632_0135167 3300046519 Bacteria 1146
799 Ga0495637_0000259 3300046520 Bacteria 41761
800 Ga0495637_0000597 3300046520 Bacteria 25843
801 Ga0495637_0001758 3300046520 Bacteria 12414
802 Ga0495637_0004206 3300046520 Bacteria 7477
803 Ga0495637_0006521 3300046520 Bacteria 5848
804 Ga0495637_0016676 3300046520 Bacteria 3432
805 Ga0495637_0020546 3300046520 Bacteria 3038
806 Ga0495637_0021054 3300046520 Bacteria 2992
807 Ga0495637_0022919 3300046520 Bacteria 2842
808 Ga0495637_0033438 3300046520 Bacteria 2258
809 Ga0495637_0042085 3300046520 Bacteria 1956
810 Ga0495637_0062444 3300046520 Bacteria 1524
811 Ga0495637_0065733 3300046520 Bacteria 1475
812 Ga0495637_0068607 3300046520 Bacteria 1436
813 Ga0495643_0000087 3300046522 Bacteria 156505
814 Ga0495643_0000148 3300046522 Bacteria 113969
815 Ga0495643_0004536 3300046522 Bacteria 9675
816 Ga0495643_0006613 3300046522 Bacteria 7613
817 Ga0495643_0009802 3300046522 Bacteria 5925
818 Ga0495643_0011200 3300046522 Bacteria 5479
819 Ga0495643_0019548 3300046522 Bacteria 3916
820 Ga0495643_0024143 3300046522 Bacteria 3451
821 Ga0495643_0099967 3300046522 Bacteria 1487
822 Ga0495644_0000104 3300046523 Bacteria 40103
823 Ga0495644_0000883 3300046523 Bacteria 12418
824 Ga0495644_0001121 3300046523 Bacteria 11009
825 Ga0495644_0004321 3300046523 Bacteria 5581
826 Ga0495648_0001459 3300046524 Bacteria 23132
827 Ga0495648_0002635 3300046524 Bacteria 16301
828 Ga0495648_0007489 3300046524 Bacteria 8732
829 Ga0495648_0010081 3300046524 Bacteria 7237
830 Ga0495648_0010465 3300046524 Bacteria 7063
831 Ga0495648_0013241 3300046524 Bacteria 6110
832 Ga0495648_0014957 3300046524 Bacteria 5652
833 Ga0495648_0015054 3300046524 Bacteria 5632
834 Ga0495648_0017206 3300046524 Bacteria 5177
835 Ga0495648_0021905 3300046524 Bacteria 4413
836 Ga0495648_0032365 3300046524 Bacteria 3432
837 Ga0495648_0042579 3300046524 Bacteria 2855
838 Ga0495648_0065726 3300046524 Bacteria 2130
839 Ga0495648_0067595 3300046524 Bacteria 2089
840 Ga0495666_0002048 3300046526 Bacteria 9975
841 Ga0495666_0059677 3300046526 Bacteria 1824
842 Ga0495666_0073390 3300046526 Bacteria 1623
843 Ga0495642_0000419 3300046528 Bacteria 22623
844 Ga0495642_0000932 3300046528 Bacteria 13693
845 Ga0495642_0002389 3300046528 Bacteria 7647
846 Ga0495642_0073275 3300046528 Bacteria 1435
847 Ga0495652_0015575 3300046529 Bacteria 6806
848 Ga0495654_0000150 3300046530 Bacteria 71986
849 Ga0495654_0000617 3300046530 Bacteria 28316
850 Ga0495654_0001112 3300046530 Bacteria 19430
851 Ga0495654_0002074 3300046530 Bacteria 13152
852 Ga0495654_0002316 3300046530 Bacteria 12304
853 Ga0495654_0004756 3300046530 Bacteria 7986
854 Ga0495654_0008623 3300046530 Bacteria 5621
855 Ga0495654_0011517 3300046530 Bacteria 4781
856 Ga0495654_0011629 3300046530 Bacteria 4756
857 Ga0495654_0013917 3300046530 Bacteria 4293
858 Ga0495654_0014404 3300046530 Bacteria 4208
859 Ga0495654_0019760 3300046530 Bacteria 3518
860 Ga0495654_0023502 3300046530 Bacteria 3191
861 Ga0495654_0023534 3300046530 Bacteria 3189
862 Ga0495654_0034241 3300046530 Bacteria 2564
863 Ga0495654_0063705 3300046530 Bacteria 1764
864 Ga0495587_0004365 3300046536 Bacteria 9331
865 Ga0495609_0000008 3300046538 Bacteria 383025
866 Ga0495609_0000181 3300046538 Bacteria 63857
867 Ga0495609_0000243 3300046538 Bacteria 51423
868 Ga0495609_0000247 3300046538 Bacteria 51172
869 Ga0495609_0000297 3300046538 Bacteria 46055
870 Ga0495609_0000659 3300046538 Bacteria 26849
871 Ga0495609_0000887 3300046538 Bacteria 21846
872 Ga0495609_0001015 3300046538 Bacteria 19951
873 Ga0495609_0004142 3300046538 Bacteria 8059
874 Ga0495609_0007406 3300046538 Bacteria 5484
875 Ga0495609_0021844 3300046538 Bacteria 2951
876 Ga0495597_0000088 3300046542 Bacteria 80794
877 Ga0495597_0000792 3300046542 Bacteria 24970
878 Ga0495597_0002677 3300046542 Bacteria 11021
879 Ga0495597_0002842 3300046542 Bacteria 10597
880 Ga0495597_0003282 3300046542 Bacteria 9580
881 Ga0495597_0004749 3300046542 Bacteria 7355
882 Ga0495597_0006680 3300046542 Bacteria 5939
883 Ga0495597_0024191 3300046542 Bacteria 2804
884 Ga0495597_0030206 3300046542 Bacteria 2470
885 Ga0495597_0097689 3300046542 Bacteria 1240
886 Ga0495645_0107535 3300046543 Bacteria 1977
887 Ga0495645_0150247 3300046543 Bacteria 1619
888 Ga0495622_0004281 3300046557 Bacteria 6642
889 Ga0495622_0011035 3300046557 Bacteria 4169
890 Ga0495622_0112900 3300046557 Bacteria 1243
891 Ga0495633_0000216 3300046558 Bacteria 72025
892 Ga0495633_0000468 3300046558 Bacteria 41323
893 Ga0495633_0000799 3300046558 Bacteria 28124
894 Ga0495633_0002520 3300046558 Bacteria 12876
895 Ga0495633_0009148 3300046558 Bacteria 5497
896 Ga0495633_0009930 3300046558 Bacteria 5226
897 Ga0495633_0048503 3300046558 Bacteria 2005
898 Ga0495633_0062288 3300046558 Bacteria 1746
899 Ga0495656_0002550 3300046615 Bacteria 6073
900 Ga0495656_0022666 3300046615 Bacteria 2462
901 Ga0495668_0000656 3300046616 Bacteria 41513
902 Ga0495668_0003877 3300046616 Bacteria 10918
903 Ga0495668_0005450 3300046616 Bacteria 8618
904 Ga0495668_0030465 3300046616 Bacteria 3046
905 Ga0495668_0081713 3300046616 Bacteria 1772
906 Ga0495668_0118499 3300046616 Bacteria 1448
907 Ga0495668_0175909 3300046616 Bacteria 1172
908 Ga0495634_0007022 3300046642 Bacteria 8492
909 Ga0495611_0000232 3300046648 Bacteria 38330
910 Ga0495611_0000242 3300046648 Bacteria 37831
911 Ga0495611_0000301 3300046648 Bacteria 33531
912 Ga0495611_0001319 3300046648 Bacteria 12612
913 Ga0495611_0007712 3300046648 Bacteria 4571
914 Ga0495625_0000004 3300046660 Bacteria 611314
915 Ga0495625_0000007 3300046660 Bacteria 565749
916 Ga0495625_0000163 3300046660 Bacteria 103308
917 Ga0495625_0007573 3300046660 Bacteria 9426
918 Ga0495625_0010023 3300046660 Bacteria 7878
919 Ga0495625_0075878 3300046660 Bacteria 2351
920 Ga0495625_0076982 3300046660 Bacteria 2331
921 Ga0495625_0088399 3300046660 Bacteria 2147
922 Ga0495625_0099574 3300046660 Bacteria 1998
923 Ga0495625_0119190 3300046660 Bacteria 1797
924 Ga0495625_0157298 3300046660 Bacteria 1524
925 Ga0495659_0004218 3300046664 Bacteria 4537
926 Ga0495659_0020199 3300046664 Bacteria 2235
927 Ga0495661_0000001 3300046665 Bacteria 898372
928 Ga0495661_0000006 3300046665 Bacteria 427288
929 Ga0495661_0000010 3300046665 Bacteria 284261
930 Ga0495661_0000078 3300046665 Bacteria 119097
931 Ga0495661_0000096 3300046665 Bacteria 109096
932 Ga0495661_0000455 3300046665 Bacteria 43336
933 Ga0495661_0000675 3300046665 Bacteria 34076
934 Ga0495661_0003086 3300046665 Bacteria 12505
935 Ga0495661_0003225 3300046665 Bacteria 12168
936 Ga0495661_0003454 3300046665 Bacteria 11664
937 Ga0495661_0004673 3300046665 Bacteria 9834
938 Ga0495661_0005353 3300046665 Bacteria 9124
939 Ga0495661_0008986 3300046665 Bacteria 6877
940 Ga0495661_0020284 3300046665 Bacteria 4341
941 Ga0495661_0021104 3300046665 Bacteria 4249
942 Ga0495661_0021158 3300046665 Bacteria 4243
943 Ga0495661_0031240 3300046665 Bacteria 3382
944 Ga0495588_0013809 3300046674 Bacteria 3853
945 Ga0495588_0056669 3300046674 Bacteria 2023
946 Ga0495623_0008990 3300046679 Bacteria 6486
947 Ga0495623_0041757 3300046679 Bacteria 2923
948 Ga0495646_0017165 3300046680 Bacteria 4595
949 Ga0495646_0027189 3300046680 Bacteria 3589
950 Ga0495646_0038675 3300046680 Bacteria 2944
951 Ga0495646_0117616 3300046680 Bacteria 1507
952 Ga0495669_0000311 3300046684 Bacteria 26905
953 Ga0495669_0004788 3300046684 Bacteria 5615
954 Ga0495669_0005074 3300046684 Bacteria 5475
955 Ga0495624_0001413 3300046690 Bacteria 18717
956 Ga0495624_0014500 3300046690 Bacteria 5348
957 Ga0495670_0001854 3300046691 Bacteria 10396
958 Ga0495670_0003557 3300046691 Bacteria 7653
959 Ga0495670_0006909 3300046691 Bacteria 5588
960 Ga0495670_0022774 3300046691 Bacteria 3093
961 Ga0495670_0062033 3300046691 Bacteria 1880
962 Ga0495670_0093917 3300046691 Bacteria 1537
963 Ga0495670_0100720 3300046691 Bacteria 1487
964 Ga0495670_0135055 3300046691 Bacteria 1288
965 Ga0495671_0001048 3300046692 Bacteria 19214
966 Ga0495671_0002683 3300046692 Bacteria 11152
967 Ga0495671_0003049 3300046692 Bacteria 10406
968 Ga0495671_0006370 3300046692 Bacteria 6820
969 Ga0495671_0008535 3300046692 Bacteria 5758
970 Ga0495671_0014722 3300046692 Bacteria 4203
971 Ga0495671_0025385 3300046692 Bacteria 3080
972 Ga0495671_0027654 3300046692 Bacteria 2926
973 Ga0495671_0054582 3300046692 Bacteria 1980
974 Ga0495671_0114334 3300046692 Bacteria 1318
975 Ga0495671_0151847 3300046692 Bacteria 1127
976 Ga0495649_0000007 3300046694 Bacteria 518037
977 Ga0495649_0000241 3300046694 Bacteria 48093
978 Ga0495649_0000607 3300046694 Bacteria 29847
979 Ga0495649_0005299 3300046694 Bacteria 8237
980 Ga0495649_0010572 3300046694 Bacteria 5439
981 Ga0495649_0018251 3300046694 Bacteria 3950
982 Ga0495649_0029184 3300046694 Bacteria 3052
983 Ga0495649_0064230 3300046694 Bacteria 1971
984 Ga0495649_0104959 3300046694 Bacteria 1500
985 Ga0495589_0000001 3300046794 Bacteria 888100
986 Ga0495589_0000492 3300046794 Bacteria 28250
987 Ga0495589_0000534 3300046794 Bacteria 26598
988 Ga0495589_0002808 3300046794 Bacteria 9627
989 Ga0495589_0003770 3300046794 Bacteria 8154
990 Ga0495589_0004256 3300046794 Bacteria 7657
991 Ga0495589_0006938 3300046794 Bacteria 5945
992 Ga0495589_0013584 3300046794 Bacteria 4199
993 Ga0495589_0028030 3300046794 Bacteria 2844
994 Ga0495589_0035203 3300046794 Bacteria 2511
995 Ga0495589_0040670 3300046794 Bacteria 2320
996 Ga0495589_0057106 3300046794 Bacteria 1920
997 Ga0495660_0000204 3300046810 Bacteria 62239
998 Ga0495660_0001619 3300046810 Bacteria 15130
999 Ga0495660_0007409 3300046810 Bacteria 6441
1000 Ga0495660_0007647 3300046810 Bacteria 6347
1001 Ga0495660_0009772 3300046810 Bacteria 5590
1002 Ga0495660_0012585 3300046810 Bacteria 4909
1003 Ga0495660_0016334 3300046810 Bacteria 4280
1004 Ga0495660_0018440 3300046810 Bacteria 4012
1005 Ga0495660_0024163 3300046810 Bacteria 3462
1006 Ga0495660_0034229 3300046810 Bacteria 2844
1007 Ga0495660_0074913 3300046810 Bacteria 1786
1008 Ga0495604_0008714 3300047317 Bacteria 8019
1009 Ga0495604_0071714 3300047317 Bacteria 2619
1010 Ga0495636_0036542 3300047318 Bacteria 2026
1011 Ga0495674_0005397 3300047319 Bacteria 12273
1012 Ga0495672_0000432 3300047320 Bacteria 50120
1013 Ga0495672_0000710 3300047320 Bacteria 36643
1014 Ga0495672_0001068 3300047320 Bacteria 27899
1015 Ga0495672_0001105 3300047320 Bacteria 27356
1016 Ga0495672_0003042 3300047320 Bacteria 14718
1017 Ga0495672_0003088 3300047320 Bacteria 14569
1018 Ga0495672_0004293 3300047320 Bacteria 11753
1019 Ga0495672_0007742 3300047320 Bacteria 8038
1020 Ga0495672_0009467 3300047320 Bacteria 7054
1021 Ga0495672_0018634 3300047320 Bacteria 4600
1022 Ga0495672_0024315 3300047320 Bacteria 3905
1023 Ga0495672_0029214 3300047320 Bacteria 3475
1024 Ga0495672_0059321 3300047320 Bacteria 2214
1025 Ga0495672_0077389 3300047320 Bacteria 1865
1026 Ga0495672_0080224 3300047320 Bacteria 1820
1027 Ga0495676_0000074 3300047321 Bacteria 73520
1028 Ga0495676_0000078 3300047321 Bacteria 72357
1029 Ga0495676_0043106 3300047321 Bacteria 3696
1030 Ga0495680_0013873 3300047322 Bacteria 7010
1031 Ga0495680_0014820 3300047322 Bacteria 6740
1032 Ga0495680_0041316 3300047322 Bacteria 3668
1033 Ga0495680_0104890 3300047322 Bacteria 2102
1034 Ga0495683_0000114 3300047323 Bacteria 82525
1035 Ga0495683_0000169 3300047323 Bacteria 63606
1036 Ga0495683_0000409 3300047323 Bacteria 34478
1037 Ga0495683_0000710 3300047323 Bacteria 24349
1038 Ga0495683_0001939 3300047323 Bacteria 12917
1039 Ga0495683_0002388 3300047323 Bacteria 11374
1040 Ga0495683_0015807 3300047323 Bacteria 3918
1041 Ga0495683_0018387 3300047323 Bacteria 3615
1042 Ga0495683_0043316 3300047323 Bacteria 2267
1043 Ga0495683_0061918 3300047323 Bacteria 1852
1044 Ga0495687_002888 3300047443 Bacteria 13121
1045 Ga0495687_003868 3300047443 Bacteria 10517
1046 Ga0495687_006108 3300047443 Bacteria 7479
1047 Ga0495687_010750 3300047443 Bacteria 4989
1048 Ga0495687_022994 3300047443 Bacteria 2984
1049 Ga0495675_0044568 3300047444 Bacteria 2825
1050 Ga0495675_0112078 3300047444 Bacteria 1702
1051 Ga0495677_0000389 3300047445 Bacteria 18832
1052 Ga0495677_0000801 3300047445 Bacteria 12709
1053 Ga0495679_000015 3300047446 Bacteria 287256
1054 Ga0495679_000185 3300047446 Bacteria 55225
1055 Ga0495679_000200 3300047446 Bacteria 52539
1056 Ga0495679_000417 3300047446 Bacteria 31474
1057 Ga0495679_002083 3300047446 Bacteria 10555
1058 Ga0495679_002144 3300047446 Bacteria 10362
1059 Ga0495679_002364 3300047446 Bacteria 9665
1060 Ga0495679_018095 3300047446 Bacteria 2509
1061 Ga0495673_0000292 3300047469 Bacteria 67107
1062 Ga0495673_0000480 3300047469 Bacteria 42694
1063 Ga0495673_0001215 3300047469 Bacteria 21433
1064 Ga0495673_0001334 3300047469 Bacteria 20025
1065 Ga0495673_0003329 3300047469 Bacteria 10643
1066 Ga0495673_0005502 3300047469 Bacteria 7645
1067 Ga0495673_0005927 3300047469 Bacteria 7284
1068 Ga0495673_0006408 3300047469 Bacteria 6920
1069 Ga0495673_0016376 3300047469 Bacteria 3790
1070 Ga0495673_0016459 3300047469 Bacteria 3779
1071 Ga0495673_0016704 3300047469 Bacteria 3745
1072 Ga0495673_0019142 3300047469 Bacteria 3434
1073 Ga0495673_0027689 3300047469 Bacteria 2693
1074 Ga0495673_0035272 3300047469 Bacteria 2306
1075 Ga0495673_0056811 3300047469 Bacteria 1691
1076 Ga0495673_0057113 3300047469 Bacteria 1685
1077 Ga0495673_0077363 3300047469 Bacteria 1386
1078 Ga0495673_0079904 3300047469 Bacteria 1356
1079 Ga0495673_0081472 3300047469 Bacteria 1340
1080 Ga0495681_0000547 3300047470 Bacteria 28724
1081 Ga0495681_0003413 3300047470 Bacteria 11058
1082 Ga0495681_0004559 3300047470 Bacteria 9441
1083 Ga0495681_0005565 3300047470 Bacteria 8411
1084 Ga0495681_0005919 3300047470 Bacteria 8111
1085 Ga0495681_0006331 3300047470 Bacteria 7793
1086 Ga0495681_0007911 3300047470 Bacteria 6720
1087 Ga0495681_0008152 3300047470 Bacteria 6594
1088 Ga0495681_0019486 3300047470 Bacteria 3703
1089 Ga0495681_0020340 3300047470 Bacteria 3604
1090 Ga0495681_0022880 3300047470 Bacteria 3333
1091 Ga0495681_0024886 3300047470 Bacteria 3140
1092 Ga0495681_0055558 3300047470 Bacteria 1846
1093 Ga0495681_0059734 3300047470 Bacteria 1761
1094 Ga0495686_0000034 3300047472 Bacteria 325038
1095 Ga0495686_0000066 3300047472 Bacteria 225023
1096 Ga0495686_0000196 3300047472 Bacteria 112875
1097 Ga0495686_0000270 3300047472 Bacteria 92321
1098 Ga0495686_0000492 3300047472 Bacteria 57976
1099 Ga0495686_0000899 3300047472 Bacteria 37472
1100 Ga0495686_0001290 3300047472 Bacteria 28257
1101 Ga0495686_0008036 3300047472 Bacteria 7819
1102 Ga0495686_0008547 3300047472 Bacteria 7502
1103 Ga0495686_0020099 3300047472 Bacteria 4455
1104 Ga0495686_0045034 3300047472 Bacteria 2792
1105 Ga0495686_0112412 3300047472 Bacteria 1632
1106 Ga0495593_0002427 3300047673 Bacteria 11199
1107 Ga0495593_0014842 3300047673 Bacteria 4425
1108 Ga0495593_0019564 3300047673 Bacteria 3795
1109 Ga0495602_0170228 3300048088 Bacteria 1691
1110 Ga0495602_0279874 3300048088 Bacteria 1229
1111 Ga0495626_0000117 3300048091 Bacteria 104166
1112 Ga0495626_0000201 3300048091 Bacteria 72576
1113 Ga0495626_0003201 3300048091 Bacteria 10634
1114 Ga0495626_0003517 3300048091 Bacteria 10025
1115 Ga0495626_0005760 3300048091 Bacteria 7149
1116 Ga0495626_0005789 3300048091 Bacteria 7134
1117 Ga0495626_0009432 3300048091 Bacteria 5275
1118 Ga0495626_0011857 3300048091 Bacteria 4589
1119 Ga0496100_0000078 3300048903 Bacteria 54410
1120 Ga0496100_0088252 3300048903 Bacteria 2110
1121 Ga0496100_0114207 3300048903 Bacteria 1881
1122 Ga0496100_0219079 3300048903 Bacteria 1396
1123 Ga0496101_0000205 3300048904 Bacteria 45101
1124 Ga0496101_0070614 3300048904 Bacteria 2558
1125 Ga0496101_0109128 3300048904 Bacteria 2081
1126 Ga0496102_0000165 3300048905 Bacteria 89141
1127 Ga0496102_0040080 3300048905 Bacteria 4235
1128 Ga0496102_0077073 3300048905 Bacteria 3068
1129 Ga0496103_0001056 3300048906 Bacteria 19218
1130 Ga0496103_0004271 3300048906 Bacteria 8681
1131 Ga0496104_0037290 3300048907 Bacteria 4546
1132 Ga0496104_0050180 3300048907 Bacteria 3937
1133 Ga0496104_0414855 3300048907 Bacteria 1259
1134 Ga0496105_0178061 3300048908 Bacteria 1741
1135 Ga0496107_0105747 3300048910 Bacteria 2066
1136 Ga0496110_0182584 3300048913 Bacteria 1905
1137 Ga0496112_0026367 3300048915 Bacteria 5590
1138 Ga0496112_0327574 3300048915 Bacteria 1476
1139 Ga0496114_0004381 3300048917 Bacteria 10938
1140 Ga0496115_0007157 3300048918 Bacteria 8194
1141 Ga0496115_0008182 3300048918 Bacteria 7726
1142 Ga0496116_0000001 3300048919 Bacteria 1501681
1143 Ga0496116_0000448 3300048919 Bacteria 57466
1144 Ga0496116_0008919 3300048919 Bacteria 8624
1145 Ga0496116_0011116 3300048919 Bacteria 7486
1146 Ga0496117_0000707 3300048920 Bacteria 52889
1147 Ga0496117_0001107 3300048920 Bacteria 40628
1148 Ga0496117_0004614 3300048920 Bacteria 15023
1149 Ga0496117_0006891 3300048920 Bacteria 11273
1150 Ga0496117_0008803 3300048920 Bacteria 9523
1151 Ga0496117_0010449 3300048920 Bacteria 8459
1152 Ga0496117_0016570 3300048920 Bacteria 6209
1153 Ga0496117_0028523 3300048920 Bacteria 4322
1154 Ga0496117_0070960 3300048920 Bacteria 2336
1155 Ga0496117_0076696 3300048920 Bacteria 2214
1156 Ga0496117_0125621 3300048920 Bacteria 1566
1157 Ga0496117_0145946 3300048920 Bacteria 1408
1158 Ga0496117_0175623 3300048920 Bacteria 1238
1159 Ga0496118_0000283 3300048921 Bacteria 89206
1160 Ga0496118_0001819 3300048921 Bacteria 30671
1161 Ga0496118_0005166 3300048921 Bacteria 14954
1162 Ga0496118_0007467 3300048921 Bacteria 11571
1163 Ga0496118_0009431 3300048921 Bacteria 9855
1164 Ga0496118_0046154 3300048921 Bacteria 3393
1165 Ga0496118_0067486 3300048921 Bacteria 2603
1166 Ga0496118_0102858 3300048921 Bacteria 1924
1167 Ga0496118_0183295 3300048921 Bacteria 1262
1168 Ga0496119_0000068 3300048922 Bacteria 158748
1169 Ga0496119_0001652 3300048922 Bacteria 26251
1170 Ga0496119_0127532 3300048922 Bacteria 1390
1171 Ga0496120_0000194 3300048923 Bacteria 104142
1172 Ga0496120_0001598 3300048923 Bacteria 26334
1173 Ga0496120_0063670 3300048923 Bacteria 2050
1174 Ga0496121_0000028 3300048924 Bacteria 439193
1175 Ga0496121_0000705 3300048924 Bacteria 62174
1176 Ga0496121_0001382 3300048924 Bacteria 41101
1177 Ga0496121_0001505 3300048924 Bacteria 39145
1178 Ga0496121_0001776 3300048924 Bacteria 34991
1179 Ga0496121_0002437 3300048924 Bacteria 28448
1180 Ga0496121_0017252 3300048924 Bacteria 7388
1181 Ga0496121_0034838 3300048924 Bacteria 4522
1182 Ga0496121_0068402 3300048924 Bacteria 2873
1183 Ga0496121_0101561 3300048924 Bacteria 2217
1184 Ga0496121_0170084 3300048924 Bacteria 1584
1185 Ga0496122_0000175 3300048925 Bacteria 153295
1186 Ga0496122_0000566 3300048925 Bacteria 75845
1187 Ga0496122_0005202 3300048925 Bacteria 15626
1188 Ga0496122_0010688 3300048925 Bacteria 9424
1189 Ga0496122_0019513 3300048925 Bacteria 6188
1190 Ga0496122_0029267 3300048925 Bacteria 4649
1191 Ga0496122_0049102 3300048925 Bacteria 3236
1192 Ga0496122_0067777 3300048925 Bacteria 2567
1193 Ga0496122_0070648 3300048925 Bacteria 2492
1194 Ga0496122_0089428 3300048925 Bacteria 2105
1195 Ga0496123_0000079 3300048926 Bacteria 191201
1196 Ga0496123_0000324 3300048926 Bacteria 91012
1197 Ga0496123_0004048 3300048926 Bacteria 15803
1198 Ga0496123_0010272 3300048926 Bacteria 8304
1199 Ga0496123_0011568 3300048926 Bacteria 7632
1200 Ga0496123_0024878 3300048926 Bacteria 4532
1201 Ga0496123_0026255 3300048926 Bacteria 4368
1202 Ga0496123_0037243 3300048926 Bacteria 3437
1203 Ga0496123_0087312 3300048926 Bacteria 1866
1204 Ga0496123_0096928 3300048926 Bacteria 1729
1205 Ga0496124_0000658 3300048927 Bacteria 56989
1206 Ga0496124_0000669 3300048927 Bacteria 56349
1207 Ga0496124_0001943 3300048927 Bacteria 28267
1208 Ga0496124_0005226 3300048927 Bacteria 14729
1209 Ga0496124_0010394 3300048927 Bacteria 9430
1210 Ga0496124_0012763 3300048927 Bacteria 8259
1211 Ga0496124_0016504 3300048927 Bacteria 7014
1212 Ga0496124_0017105 3300048927 Bacteria 6855
1213 Ga0496124_0027395 3300048927 Bacteria 5115
1214 Ga0496124_0112036 3300048927 Bacteria 2194
1215 Ga0496124_0153819 3300048927 Bacteria 1801
1216 Ga0496124_0166944 3300048927 Bacteria 1710
1217 Ga0496124_0221271 3300048927 Bacteria 1423
1218 Ga0496124_0254153 3300048927 Bacteria 1297
1219 Ga0496125_0000006 3300048928 Bacteria 759385
1220 Ga0496125_0000893 3300048928 Bacteria 47285
1221 Ga0496125_0009254 3300048928 Bacteria 10173
1222 Ga0496125_0009526 3300048928 Bacteria 9968
1223 Ga0496125_0010719 3300048928 Bacteria 9235
1224 Ga0496125_0061912 3300048928 Bacteria 2997
1225 Ga0496126_0011237 3300048929 Bacteria 9289
1226 Ga0496126_0063498 3300048929 Bacteria 3310
1227 Ga0496126_0068309 3300048929 Bacteria 3173
1228 Ga0496126_0131384 3300048929 Bacteria 2163
1229 Ga0495678_000081 3300049459 Bacteria 118700
1230 Ga0495678_000213 3300049459 Bacteria 67444
1231 Ga0495678_000242 3300049459 Bacteria 61395
1232 Ga0495678_001125 3300049459 Bacteria 22215
1233 Ga0495678_004528 3300049459 Bacteria 8010
1234 Ga0495678_004551 3300049459 Bacteria 7976
1235 Ga0495678_004874 3300049459 Bacteria 7591
1236 Ga0495678_005054 3300049459 Bacteria 7416
1237 Ga0495678_011160 3300049459 Bacteria 4317
1238 Ga0495678_027010 3300049459 Bacteria 2440
1239 Ga0495678_081497 3300049459 Bacteria 1160
1240 Ga0495682_0000014 3300049460 Bacteria 249706
1241 Ga0495682_0000954 3300049460 Bacteria 17497
1242 Ga0495682_0000982 3300049460 Bacteria 17072
1243 Ga0501034_0000158 3300049571 Bacteria 128537
1244 Ga0501038_0167089 3300049574 Bacteria 1784
1245 Ga0501046_0000046 3300049580 Bacteria 144066
1246 Ga0501238_000184 3300049671 Bacteria 9287
1247 Ga0501241_000108 3300049758 Bacteria 17925
1248 Ga0501226_000019 3300049853 Bacteria 143773
1249 Ga0501226_000079 3300049853 Bacteria 29272
1250 nmdc:mga08x19_30555_c1 3300050514 Bacteria 3385
1251 Ga0500644_0000682 3300053088 Bacteria 12338
1252 Ga0500646_0003915 3300053090 Bacteria 3788
1253 Ga0500583_0043898 3300053092 Bacteria 2044
1254 Ga0500556_0004996 3300053104 Bacteria 3753
1255 Ga0500618_000376 3300053125 Bacteria 30780
1256 Ga0500618_005261 3300053125 Bacteria 3967
1257 Ga0500618_010474 3300053125 Bacteria 2488
1258 Ga0500658_0007635 3300053134 Bacteria 3996
1259 Ga0500659_0008883 3300053135 Bacteria 5518
1260 Ga0500577_0002952 3300053142 Bacteria 4379
1261 Ga0500577_0070454 3300053142 Bacteria 1370
1262 Ga0500588_0008060 3300053146 Unclassified 2447
1263 Ga0500616_0016488 3300053153 Bacteria 4206
1264 Ga0500622_0000384 3300053156 Bacteria 42700
1265 Ga0500633_0002830 3300053160 Bacteria 3660
1266 Ga0500634_0001458 3300053161 Bacteria 9212
1267 Ga0500636_0000279 3300053177 Bacteria 28352

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046507 Ga0495606_0021090 Ga0495606_0021090_1163_2212 304
2 3300005262 Ga0065165_1019692 Ga0065165_10196922 306
3 3300025284 Ga0209130_1012669 Ga0209130_10126693 306
4 3300025302 Ga0207426_1001212 Ga0207426_100121217 306
5 3300047472 Ga0495686_0000492 Ga0495686_0000492_35779_36828 307
6 3300009093 Ga0105240_10000232 Ga0105240_1000023289 309
7 3300009545 Ga0105237_10024635 Ga0105237_100246353 309
8 3300025735 Ga0207713_1007173 Ga0207713_10071733 309
9 3300025913 Ga0207695_10000169 Ga0207695_1000016990 309
10 3300046665 Ga0495661_0008986 Ga0495661_0008986_638_1678 312
11 iso_pu_bacteria 2818991452 2819637577 312
12 iso_pu_bacteria 2870068957 2870076369 312
13 iso_pu_bacteria 2928170801 2928177928 312
14 iso_pu_bacteria 8020945358 8020952843 312
15 iso_pu_bacteria 8021120328 8021127157 312
16 3300046648 Ga0495611_0000242 Ga0495611_0000242_33297_34244 314
17 3300005355 Ga0070671_100042390 Ga0070671_1000423904 315
18 3300025931 Ga0207644_10036161 Ga0207644_100361614 315
19 3300025226 Ga0209674_103750 Ga0209674_1037503 316
20 3300046692 Ga0495671_0114334 Ga0495671_0114334_273_1247 316
21 3300041458 Ga0451798_1042570 Ga0451798_1042570_12_971 317
22 3300050514 nmdc:mga08x19_30555_c1 nmdc:mga08x19_30555_c1_1691_2659 317
23 3300002987 JGI25159J45721_1001534 JGI25159J45721_10015347 318
24 3300005262 Ga0065165_1000726 Ga0065165_10007265 318
25 3300005616 Ga0068852_100009594 Ga0068852_1000095944 318
26 3300025284 Ga0209130_1002367 Ga0209130_10023676 318
27 3300026142 Ga0207698_10009895 Ga0207698_100098953 318
28 3300046519 Ga0495632_0000063 Ga0495632_0000063_94504_95526 318
29 3300046665 Ga0495661_0021104 Ga0495661_0021104_1586_2608 318
30 3300046810 Ga0495660_0034229 Ga0495660_0034229_1102_2145 318
31 iso_pu_bacteria 2600254954 2600445692 319
32 iso_pu_bacteria 2600255389 2602012607 319
33 iso_pu_bacteria 2684623219 2687239387 319
34 iso_pu_bacteria 2889415604 2889420709 319
35 iso_pu_bacteria 2919501602 2919503769 319
36 iso_pu_bacteria 2920107658 2920111501 319
37 iso_pu_bacteria 2926063275 2926065659 319
38 iso_pu_bacteria 8034962539 8034965941 319
39 3300048920 Ga0496117_0001107 Ga0496117_0001107_28419_29435 320
40 3300048921 Ga0496118_0005166 Ga0496118_0005166_8233_9249 320
41 iso_pu_bacteria 2506520007 2506579014 320
42 iso_pu_bacteria 2506520008 2506584153 320
43 iso_pu_bacteria 2508501071 2508852894 320
44 iso_pu_bacteria 2654587920 2656279888 320
45 iso_pu_bacteria 2687453601 2689445470 320
46 iso_pu_bacteria 2806310673 2807180756 320
47 iso_pu_bacteria 2852103415 2852106789 320
48 iso_pu_bacteria 2869551831 2869554926 320
49 iso_pu_bacteria 2932406140 2932408681 320
50 iso_pu_bacteria 2939577877 2939580377 320
51 iso_pu_bacteria 640753048 640938393 320
52 3300009011 Ga0105251_10016228 Ga0105251_100162284 321
53 3300028794 Ga0307515_10004730 Ga0307515_1000473012 321
54 3300047320 Ga0495672_0000432 Ga0495672_0000432_15597_16622 321
55 3300048928 Ga0496125_0000006 Ga0496125_0000006_749108_750082 321
56 3300053104 Ga0500556_0004996 Ga0500556_0004996_892_1866 321
57 2162886007 SwRhRL2b_contig_661307 SwRhRL2b_0620.00000120 322
58 3300003320 rootH2_10002539 rootH2_1000253926 322
59 3300003320 rootH2_10015047 rootH2_1001504717 322
60 3300003856 Ga0058692_1000051 Ga0058692_100005147 322
61 3300005289 Ga0065704_10000292 Ga0065704_1000029228 322
62 3300013306 Ga0163162_10392349 Ga0163162_103923491 322
63 3300027312 Ga0209371_1000008 Ga0209371_100000845 322
64 3300030500 Ga0268256_1000009 Ga0268256_100000945 322
65 3300046538 Ga0495609_0004142 Ga0495609_0004142_4864_5904 322
66 3300047472 Ga0495686_0000066 Ga0495686_0000066_126160_127152 322
67 3300005548 Ga0070665_100001721 Ga0070665_10000172125 323
68 3300028379 Ga0268266_10001705 Ga0268266_1000170524 323
69 3300031616 Ga0307508_10001122 Ga0307508_1000112212 323
70 3300046519 Ga0495632_0000117 Ga0495632_0000117_55241_56266 323
71 3300046524 Ga0495648_0042579 Ga0495648_0042579_1824_2843 323
72 3300048903 Ga0496100_0088252 Ga0496100_0088252_237_1265 323
73 3300048904 Ga0496101_0109128 Ga0496101_0109128_726_1754 323
74 3300048915 Ga0496112_0026367 Ga0496112_0026367_2799_3827 323
75 3300048924 Ga0496121_0001776 Ga0496121_0001776_22156_23184 323
76 3300048927 Ga0496124_0166944 Ga0496124_0166944_402_1430 323
77 3300003771 Ga0055526_1002318 Ga0055526_10023181 324
78 3300003773 Ga0055537_1000175 Ga0055537_100017531 324
79 3300003775 Ga0055524_1007104 Ga0055524_10071045 324
80 3300003784 Ga0055534_1000452 Ga0055534_100045215 324
81 3300003790 Ga0055528_1000537 Ga0055528_100053714 324
82 3300009011 Ga0105251_10001039 Ga0105251_1000103922 324
83 3300017792 Ga0163161_10000001 Ga0163161_100000011687 324
84 3300025263 Ga0209565_1000006 Ga0209565_100000661 324
85 3300025273 Ga0209673_1000004 Ga0209673_1000004768 324
86 3300025291 Ga0209675_1000006 Ga0209675_100000660 324
87 3300025295 Ga0209564_1000064 Ga0209564_1000064217 324
88 3300025299 Ga0209256_1000420 Ga0209256_100042012 324
89 3300025711 Ga0207696_1000001 Ga0207696_10000011769 324
90 3300025728 Ga0207655_1000217 Ga0207655_100021746 324
91 3300025735 Ga0207713_1000088 Ga0207713_100008865 324
92 3300025735 Ga0207713_1001025 Ga0207713_100102528 324
93 3300025900 Ga0207710_10000131 Ga0207710_1000013168 324
94 3300025922 Ga0207646_10009115 Ga0207646_100091152 324
95 3300025939 Ga0207665_10107405 Ga0207665_101074052 324
96 3300042876 Ga0451577_0427009 Ga0451577_0427009_191_1165 324
97 3300048920 Ga0496117_0028523 Ga0496117_0028523_305_1279 324
98 3300003856 Ga0058692_1006651 Ga0058692_10066513 325
99 3300009101 Ga0105247_10000012 Ga0105247_10000012215 325
100 3300009551 Ga0105238_10144987 Ga0105238_101449873 325
101 3300025273 Ga0209673_1000061 Ga0209673_100006194 325
102 3300025295 Ga0209564_1004397 Ga0209564_10043972 325
103 3300027312 Ga0209371_1000179 Ga0209371_100017918 325
104 3300030500 Ga0268256_1000149 Ga0268256_100014969 325
105 3300046453 Ga0495627_000027 Ga0495627_000027_141986_142963 325
106 3300046526 Ga0495666_0002048 Ga0495666_0002048_5810_6829 325
107 3300046530 Ga0495654_0000150 Ga0495654_0000150_53882_54859 325
108 3300046679 Ga0495623_0008990 Ga0495623_0008990_3130_4149 325
109 3300046794 Ga0495589_0000001 Ga0495589_0000001_195587_196564 325
110 3300047320 Ga0495672_0001068 Ga0495672_0001068_18852_19877 325
111 3300047444 Ga0495675_0044568 Ga0495675_0044568_1045_2064 325
112 3300047673 Ga0495593_0002427 Ga0495593_0002427_1624_2643 325
113 3300048919 Ga0496116_0000001 Ga0496116_0000001_1199072_1200049 325
114 3300048920 Ga0496117_0004614 Ga0496117_0004614_8317_9294 325
115 3300048921 Ga0496118_0007467 Ga0496118_0007467_7404_8381 325
116 3300048924 Ga0496121_0000028 Ga0496121_0000028_292453_293517 325
117 3300046474 Ga0495605_0002327 Ga0495605_0002327_4490_5503 326
118 3300046474 Ga0495605_0015531 Ga0495605_0015531_1472_2500 326
119 iso_pu_bacteria 2643221638 2644213575 326
120 3300003758 Ga0055532_1000230 Ga0055532_100023044 327
121 3300003760 Ga0055527_1000042 Ga0055527_100004244 327
122 3300003761 Ga0055535_1000066 Ga0055535_100006644 327
123 3300003762 Ga0055542_1001559 Ga0055542_100155910 327
124 3300003763 Ga0055529_1002440 Ga0055529_10024403 327
125 3300005539 Ga0068853_100033197 Ga0068853_1000331971 327
126 3300009093 Ga0105240_10000090 Ga0105240_1000009075 327
127 3300009545 Ga0105237_10313861 Ga0105237_103138612 327
128 3300013100 Ga0157373_10013168 Ga0157373_100131685 327
129 3300025228 Ga0209672_100090 Ga0209672_10009067 327
130 3300025229 Ga0209147_100132 Ga0209147_10013266 327
131 3300025230 Ga0209563_100164 Ga0209563_10016429 327
132 3300025242 Ga0209258_100211 Ga0209258_10021167 327
133 3300025254 Ga0209148_1000443 Ga0209148_100044345 327
134 3300025272 Ga0209455_1000631 Ga0209455_100063118 327
135 3300025913 Ga0207695_10000176 Ga0207695_10000176103 327
136 3300025924 Ga0207694_10296154 Ga0207694_102961541 327
137 3300026142 Ga0207698_10230259 Ga0207698_102302592 327
138 3300046794 Ga0495589_0028030 Ga0495589_0028030_1809_2825 327
139 3300047443 Ga0495687_010750 Ga0495687_010750_1431_2459 327
140 3300003320 rootH2_10263596 rootH2_102635962 328
141 3300046455 Ga0495603_0084614 Ga0495603_0084614_324_1352 328
142 3300046528 Ga0495642_0073275 Ga0495642_0073275_261_1289 328
143 3300047319 Ga0495674_0005397 Ga0495674_0005397_7535_8563 328
144 3300047472 Ga0495686_0000270 Ga0495686_0000270_66205_67200 328
145 iso_pu_bacteria 2706794495 2707098437 328
146 3300046501 Ga0495607_0000629 Ga0495607_0000629_30021_31037 329
147 3300047470 Ga0495681_0008152 Ga0495681_0008152_2447_3463 329
148 3300048924 Ga0496121_0000705 Ga0496121_0000705_46485_47504 329
149 iso_pu_bacteria 2643221645 2644249214 329
150 iso_pu_bacteria 2818991442 2819572993 329
151 iso_pu_bacteria 2818991444 2819587999 329
152 3300002739 JGI25158J39367_1001698 JGI25158J39367_10016982 330
153 3300002987 JGI25159J45721_1003082 JGI25159J45721_10030822 330
154 3300003354 JGI25160J50197_1002936 JGI25160J50197_10029364 330
155 3300003374 JGI25161J50226_1001799 JGI25161J50226_10017992 330
156 3300003758 Ga0055532_1001534 Ga0055532_10015347 330
157 3300003775 Ga0055524_1001748 Ga0055524_10017486 330
158 3300003784 Ga0055534_1000768 Ga0055534_100076810 330
159 3300003790 Ga0055528_1008578 Ga0055528_10085784 330
160 3300003794 Ga0055531_10001761 Ga0055531_1000176116 330
161 3300003794 Ga0055531_10015489 Ga0055531_100154894 330
162 3300025208 Ga0209436_100262 Ga0209436_10026215 330
163 3300025229 Ga0209147_100156 Ga0209147_1001567 330
164 3300025245 Ga0207425_1000060 Ga0207425_100006054 330
165 3300025245 Ga0207425_1001004 Ga0207425_10010044 330
166 3300025258 Ga0209129_1001792 Ga0209129_10017928 330
167 3300025263 Ga0209565_1001340 Ga0209565_10013404 330
168 3300025263 Ga0209565_1004373 Ga0209565_10043734 330
169 3300025273 Ga0209673_1010719 Ga0209673_10107192 330
170 3300025284 Ga0209130_1001449 Ga0209130_10014494 330
171 3300025284 Ga0209130_1001994 Ga0209130_10019944 330
172 3300025291 Ga0209675_1001664 Ga0209675_10016649 330
173 3300025295 Ga0209564_1012874 Ga0209564_10128743 330
174 3300025298 Ga0209050_1000085 Ga0209050_1000085145 330
175 3300025298 Ga0209050_1000465 Ga0209050_100046523 330
176 3300025298 Ga0209050_1000552 Ga0209050_100055214 330
177 3300025299 Ga0209256_1002112 Ga0209256_10021129 330
178 3300025299 Ga0209256_1002349 Ga0209256_10023498 330
179 3300025302 Ga0207426_1001495 Ga0207426_100149511 330
180 3300025304 Ga0209257_1000010 Ga0209257_1000010868 330
181 3300031548 Ga0307408_100000094 Ga0307408_10000009438 330
182 3300031548 Ga0307408_100000174 Ga0307408_1000001743 330
183 3300031548 Ga0307408_100008134 Ga0307408_1000081345 330
184 3300039062 Ga0400483_077564 Ga0400483_077564_293_1303 330
185 3300046492 Ga0495585_0117620 Ga0495585_0117620_17_1009 330
186 iso_pu_bacteria 2639762793 2640734365 330
187 iso_pu_bacteria 2643221628 2644159737 330
188 iso_pu_bacteria 2711768613 2713481887 330
189 iso_pu_bacteria 2811994881 2812367039 330
190 iso_pu_bacteria 2826581358 2826585357 330
191 iso_pu_bacteria 2842815866 2842820431 330
192 iso_pu_bacteria 2842849001 2842849064 330
193 iso_pu_bacteria 2869551831 2869554590 330
194 iso_pu_bacteria 2904615490 2904618686 330
195 iso_pu_bacteria 2921643360 2921645393 330
196 iso_pu_bacteria 2923519811 2923521077 330
197 iso_pu_bacteria 2946006987 2946010727 330
198 iso_pu_bacteria 642555112 642597320 330
199 iso_pu_bacteria 8054503363 8054505560 330
200 iso_pu_bacteria 8056375014 8056378905 330
201 3300009177 Ga0105248_10039288 Ga0105248_100392882 331
202 3300046507 Ga0495606_0001864 Ga0495606_0001864_17385_18398 331
203 iso_pu_bacteria 2690315857 2691329283 331
204 iso_pu_bacteria 2808606373 2808904280 331
205 iso_pu_bacteria 2919534386 2919537473 331
206 iso_pu_bacteria 2919688452 2919689033 331
207 3300003316 rootH1_10035892 rootH1_100358923 332
208 3300003775 Ga0055524_1000015 Ga0055524_100001562 332
209 3300003794 Ga0055531_10000151 Ga0055531_1000015141 332
210 3300006948 Ga0099826_10000003 Ga0099826_10000003354 332
211 3300025250 Ga0209026_1001487 Ga0209026_10014878 332
212 3300025299 Ga0209256_1000005 Ga0209256_100000563 332
213 3300025304 Ga0209257_1000013 Ga0209257_1000013881 332
214 3300027666 Ga0209282_1000002 Ga0209282_1000002644 332
215 3300042007 Ga0439449_0035947 Ga0439449_0035947_605_1633 332
216 3300046684 Ga0495669_0005074 Ga0495669_0005074_4424_5431 332
217 3300048904 Ga0496101_0070614 Ga0496101_0070614_937_1989 332
218 3300048929 Ga0496126_0011237 Ga0496126_0011237_8003_9055 332
219 3300049580 Ga0501046_0000046 Ga0501046_0000046_18887_19891 332
220 3300049671 Ga0501238_000184 Ga0501238_000184_4818_5822 332
221 3300053156 Ga0500622_0000384 Ga0500622_0000384_6947_7975 332
222 iso_pu_bacteria 2511231007 2511271260 332
223 iso_pu_bacteria 2511231010 2511290572 332
224 iso_pu_bacteria 2511231010 2511290800 332
225 iso_pu_bacteria 2511231011 2511293599 332
226 iso_pu_bacteria 2511231014 2511312285 332
227 iso_pu_bacteria 2511231015 2511321011 332
228 iso_pu_bacteria 2511231021 2511355262 332
229 iso_pu_bacteria 2511231022 2511364174 332
230 iso_pu_bacteria 2511231023 2511368012 332
231 iso_pu_bacteria 2519103095 2519463298 332
232 iso_pu_bacteria 2554235231 2555248554 332
233 iso_pu_bacteria 2582581311 2585295105 332
234 iso_pu_bacteria 2597489888 2597863000 332
235 iso_pu_bacteria 2599185167 2599401580 332
236 iso_pu_bacteria 2599185179 2599451879 332
237 iso_pu_bacteria 2599185190 2599514824 332
238 iso_pu_bacteria 2599185191 2599520922 332
239 iso_pu_bacteria 2599185212 2599611627 332
240 iso_pu_bacteria 2599185212 2599611779 332
241 iso_pu_bacteria 2599185239 2599738899 332
242 iso_pu_bacteria 2599185240 2599746393 332
243 iso_pu_bacteria 2599185288 2599882169 332
244 iso_pu_bacteria 2599185290 2599894379 332
245 iso_pu_bacteria 2599185303 2599951587 332
246 iso_pu_bacteria 2599185316 2600023078 332
247 iso_pu_bacteria 2599185318 2600034007 332
248 iso_pu_bacteria 2599185318 2600034402 332
249 iso_pu_bacteria 2599185322 2600057575 332
250 iso_pu_bacteria 2599185322 2600058631 332
251 iso_pu_bacteria 2599185325 2600076826 332
252 iso_pu_bacteria 2599185355 2600208212 332
253 iso_pu_bacteria 2600254954 2600445721 332
254 iso_pu_bacteria 2600255318 2601795899 332
255 iso_pu_bacteria 2600255318 2601796258 332
256 iso_pu_bacteria 2600255389 2602012563 332
257 iso_pu_bacteria 2603880185 2606073407 332
258 iso_pu_bacteria 2603880185 2606075253 332
259 iso_pu_bacteria 2603880199 2606126947 332
260 iso_pu_bacteria 2603880199 2606128116 332
261 iso_pu_bacteria 2623620443 2624479942 332
262 iso_pu_bacteria 2623620443 2624481907 332
263 iso_pu_bacteria 2623620446 2624492991 332
264 iso_pu_bacteria 2643221565 2643845609 332
265 iso_pu_bacteria 2667528176 2671124925 332
266 iso_pu_bacteria 2675903129 2676743894 332
267 iso_pu_bacteria 2675903420 2677900284 332
268 iso_pu_bacteria 2713897148 2715751210 332
269 iso_pu_bacteria 2713897149 2715758210 332
270 iso_pu_bacteria 2713897149 2715760160 332
271 iso_pu_bacteria 2718217725 2718635158 332
272 iso_pu_bacteria 2738541294 2738810822 332
273 iso_pu_bacteria 2738541309 2738898182 332
274 iso_pu_bacteria 2738543020 2739289085 332
275 iso_pu_bacteria 2738543021 2739294397 332
276 iso_pu_bacteria 2738543025 2739316503 332
277 iso_pu_bacteria 2773857673 2774132817 332
278 iso_pu_bacteria 2773857673 2774137418 332
279 iso_pu_bacteria 2784132063 2784263371 332
280 iso_pu_bacteria 2784132063 2784263748 332
281 iso_pu_bacteria 2806310737 2807405916 332
282 iso_pu_bacteria 2806310745 2807454251 332
283 iso_pu_bacteria 2808606384 2808968806 332
284 iso_pu_bacteria 2808606385 2808979464 332
285 iso_pu_bacteria 2808606388 2808995388 332
286 iso_pu_bacteria 2808606390 2809003637 332
287 iso_pu_bacteria 2808606391 2809010914 332
288 iso_pu_bacteria 2816332253 2817263325 332
289 iso_pu_bacteria 2816332256 2817276706 332
290 iso_pu_bacteria 2816332286 2817452782 332
291 iso_pu_bacteria 2818991452 2819631472 332
292 iso_pu_bacteria 2818991456 2819655651 332
293 iso_pu_bacteria 2818991456 2819656541 332
294 iso_pu_bacteria 2823421272 2823424047 332
295 iso_pu_bacteria 2834028612 2834029648 332
296 iso_pu_bacteria 2842805378 2842808339 332
297 iso_pu_bacteria 2842832357 2842836502 332
298 iso_pu_bacteria 2842843487 2842844615 332
299 iso_pu_bacteria 2842854478 2842854671 332
300 iso_pu_bacteria 2852612431 2852618471 332
301 iso_pu_bacteria 2852657418 2852658197 332
302 iso_pu_bacteria 2852667396 2852673393 332
303 iso_pu_bacteria 2860867994 2860869642 332
304 iso_pu_bacteria 2863421361 2863426666 332
305 iso_pu_bacteria 2870068957 2870075891 332
306 iso_pu_bacteria 2878029506 2878031851 332
307 iso_pu_bacteria 2878029506 2878033891 332
308 iso_pu_bacteria 2880230671 2880234195 332
309 iso_pu_bacteria 2904518522 2904521343 332
310 iso_pu_bacteria 2904518522 2904523682 332
311 iso_pu_bacteria 2904550169 2904555703 332
312 iso_pu_bacteria 2904564687 2904566749 332
313 iso_pu_bacteria 2904571731 2904573794 332
314 iso_pu_bacteria 2919063839 2919068324 332
315 iso_pu_bacteria 2919063839 2919068877 332
316 iso_pu_bacteria 2919385768 2919386824 332
317 iso_pu_bacteria 2919385768 2919387984 332
318 iso_pu_bacteria 2919481497 2919483244 332
319 iso_pu_bacteria 2919487758 2919489834 332
320 iso_pu_bacteria 2919501602 2919503700 332
321 iso_pu_bacteria 2919697872 2919699733 332
322 iso_pu_bacteria 2926063275 2926065728 332
323 iso_pu_bacteria 2928157003 2928163390 332
324 iso_pu_bacteria 2928163908 2928167095 332
325 iso_pu_bacteria 2928170801 2928176058 332
326 iso_pu_bacteria 2928536128 2928542974 332
327 iso_pu_bacteria 2929189879 2929191618 332
328 iso_pu_bacteria 2931390751 2931392715 332
329 iso_pu_bacteria 2939607340 2939608006 332
330 iso_pu_bacteria 2945928738 2945928950 332
331 iso_pu_bacteria 2945961074 2945962253 332
332 iso_pu_bacteria 2946027586 2946029900 332
333 iso_pu_bacteria 2946027586 2946031791 332
334 iso_pu_bacteria 2969304461 2969306661 332
335 iso_pu_bacteria 2969304461 2969308666 332
336 iso_pu_bacteria 2974289157 2974289960 332
337 iso_pu_bacteria 2998139840 2998143971 332
338 iso_pu_bacteria 3007252601 3007256169 332
339 iso_pu_bacteria 3007614139 3007617165 332
340 iso_pu_bacteria 3007718800 3007723708 332
341 iso_pu_bacteria 3007855910 3007857877 332
342 iso_pu_bacteria 3007855910 3007860589 332
343 iso_pu_bacteria 3007861166 3007865401 332
344 iso_pu_bacteria 3007872151 3007876229 332
345 iso_pu_bacteria 8018845410 8018847205 332
346 iso_pu_bacteria 8019775933 8019775996 332
347 iso_pu_bacteria 8020807995 8020812319 332
348 iso_pu_bacteria 8020945358 8020950972 332
349 iso_pu_bacteria 8021120328 8021126074 332
350 iso_pu_bacteria 8029995093 8029996906 332
351 iso_pu_bacteria 8034962539 8034964527 332
352 iso_pu_bacteria 8039098773 8039099952 332
353 iso_pu_bacteria 8040167225 8040172026 332
354 iso_pu_bacteria 8040173305 8040177989 332
355 iso_pu_bacteria 8054285046 8054288272 332
356 iso_pu_bacteria 8055817908 8055819759 332
357 iso_pu_bacteria 8056115690 8056116201 332
358 iso_pu_bacteria 8056131705 8056133545 332
359 iso_pu_bacteria 8056143049 8056147243 332
360 iso_pu_bacteria 8056161164 8056164968 332
361 iso_pu_bacteria 8056166840 8056167304 332
362 iso_pu_bacteria 8056166840 8056168970 332
363 iso_pu_bacteria 8056172158 8056173289 332
364 iso_pu_bacteria 8056172158 8056175070 332
365 iso_pu_bacteria 8056177738 8056179482 332
366 iso_pu_bacteria 8056569372 8056572918 332
367 3300002737 JGI25162J39368_1000016 JGI25162J39368_100001681 333
368 3300004625 Ga0055543_1001587 Ga0055543_10015876 333
369 3300005262 Ga0065165_1000726 Ga0065165_10007266 333
370 3300009545 Ga0105237_10016014 Ga0105237_100160145 333
371 3300010375 Ga0105239_10001267 Ga0105239_100012671 333
372 3300021361 Ga0213872_10000017 Ga0213872_100000178 333
373 3300025233 Ga0209437_100119 Ga0209437_1001191 333
374 3300025284 Ga0209130_1002367 Ga0209130_10023677 333
375 3300025914 Ga0207671_10010188 Ga0207671_100101884 333
376 3300025981 Ga0207640_10072861 Ga0207640_100728613 333
377 3300039447 Ga0436361_0743687 Ga0436361_0743687_5320_6327 333
378 3300044735 Ga0466968_0000202 Ga0466968_0000202_1524_2564 333
379 3300046516 Ga0495628_0085087 Ga0495628_0085087_66_1088 333
380 3300046517 Ga0495630_0118548 Ga0495630_0118548_571_1593 333
381 3300046526 Ga0495666_0059677 Ga0495666_0059677_244_1266 333
382 3300046680 Ga0495646_0017165 Ga0495646_0017165_2682_3704 333
383 3300046690 Ga0495624_0001413 Ga0495624_0001413_15771_16793 333
384 3300047317 Ga0495604_0071714 Ga0495604_0071714_723_1745 333
385 3300047322 Ga0495680_0013873 Ga0495680_0013873_2471_3493 333
386 3300047472 Ga0495686_0000899 Ga0495686_0000899_8561_9583 333
387 3300047472 Ga0495686_0001290 Ga0495686_0001290_25572_26579 333
388 3300048088 Ga0495602_0170228 Ga0495602_0170228_416_1438 333
389 3300048929 Ga0496126_0131384 Ga0496126_0131384_19_1041 333
390 3300053088 Ga0500644_0000682 Ga0500644_0000682_2566_3588 333
391 3300053160 Ga0500633_0002830 Ga0500633_0002830_2070_3092 333
392 iso_pu_bacteria 2510065053 2510282914 333
393 iso_pu_bacteria 2510065055 2510293588 333
394 iso_pu_bacteria 2510065058 2510310806 333
395 iso_pu_bacteria 2511231004 2511255044 333
396 iso_pu_bacteria 2511231006 2511268423 333
397 iso_pu_bacteria 2511231007 2511273069 333
398 iso_pu_bacteria 2511231008 2511276052 333
399 iso_pu_bacteria 2511231014 2511316119 333
400 iso_pu_bacteria 2511231015 2511321965 333
401 iso_pu_bacteria 2511231016 2511326188 333
402 iso_pu_bacteria 2511231017 2511331162 333
403 iso_pu_bacteria 2511231017 2511333777 333
404 iso_pu_bacteria 2511231018 2511339589 333
405 iso_pu_bacteria 2511231018 2511340218 333
406 iso_pu_bacteria 2511231019 2511343015 333
407 iso_pu_bacteria 2511231019 2511344662 333
408 iso_pu_bacteria 2511231019 2511346655 333
409 iso_pu_bacteria 2511231020 2511349824 333
410 iso_pu_bacteria 2511231020 2511352446 333
411 iso_pu_bacteria 2511231022 2511365751 333
412 iso_pu_bacteria 2511231031 2511413328 333
413 iso_pu_bacteria 2511231156 2511823685 333
414 iso_pu_bacteria 2521172590 2521557810 333
415 iso_pu_bacteria 2551306416 2553002930 333
416 iso_pu_bacteria 2582580891 2583793682 333
417 iso_pu_bacteria 2597489887 2597859341 333
418 iso_pu_bacteria 2599185185 2599482172 333
419 iso_pu_bacteria 2599185188 2599504478 333
420 iso_pu_bacteria 2599185248 2599770278 333
421 iso_pu_bacteria 2599185257 2599804110 333
422 iso_pu_bacteria 2599185289 2599887513 333
423 iso_pu_bacteria 2599185291 2599900008 333
424 iso_pu_bacteria 2599185300 2599932140 333
425 iso_pu_bacteria 2599185302 2599941787 333
426 iso_pu_bacteria 2599185304 2599952693 333
427 iso_pu_bacteria 2599185305 2599960584 333
428 iso_pu_bacteria 2599185306 2599964878 333
429 iso_pu_bacteria 2599185307 2599970967 333
430 iso_pu_bacteria 2599185307 2599972188 333
431 iso_pu_bacteria 2599185308 2599976009 333
432 iso_pu_bacteria 2599185309 2599981956 333
433 iso_pu_bacteria 2599185310 2599987865 333
434 iso_pu_bacteria 2599185311 2599995568 333
435 iso_pu_bacteria 2599185312 2599998243 333
436 iso_pu_bacteria 2599185313 2600005407 333
437 iso_pu_bacteria 2599185314 2600010110 333
438 iso_pu_bacteria 2599185315 2600017375 333
439 iso_pu_bacteria 2599185316 2600022598 333
440 iso_pu_bacteria 2599185317 2600027618 333
441 iso_pu_bacteria 2599185319 2600039898 333
442 iso_pu_bacteria 2599185320 2600046195 333
443 iso_pu_bacteria 2599185321 2600052198 333
444 iso_pu_bacteria 2599185323 2600064736 333
445 iso_pu_bacteria 2599185324 2600072313 333
446 iso_pu_bacteria 2599185325 2600075873 333
447 iso_pu_bacteria 2600254930 2600356673 333
448 iso_pu_bacteria 2600254931 2600364248 333
449 iso_pu_bacteria 2600255283 2601625046 333
450 iso_pu_bacteria 2600255283 2601625395 333
451 iso_pu_bacteria 2643221589 2643956486 333
452 iso_pu_bacteria 2643221602 2644025472 333
453 iso_pu_bacteria 2643221633 2644185493 333
454 iso_pu_bacteria 2643221633 2644190251 333
455 iso_pu_bacteria 2643221650 2644284863 333
456 iso_pu_bacteria 2651869719 2652543836 333
457 iso_pu_bacteria 2667528170 2671090172 333
458 iso_pu_bacteria 2667528176 2671126012 333
459 iso_pu_bacteria 2671180172 2671770322 333
460 iso_pu_bacteria 2675903515 2678262617 333
461 iso_pu_bacteria 2713897148 2715753125 333
462 iso_pu_bacteria 2718217725 2718633506 333
463 iso_pu_bacteria 2738541271 2738689059 333
464 iso_pu_bacteria 2738543004 2739201945 333
465 iso_pu_bacteria 2738543015 2739259251 333
466 iso_pu_bacteria 2738543015 2739260685 333
467 iso_pu_bacteria 2738543016 2739264446 333
468 iso_pu_bacteria 2740892503 2743738874 333
469 iso_pu_bacteria 2744054620 2745008957 333
470 iso_pu_bacteria 2765235841 2765584625 333
471 iso_pu_bacteria 2773857670 2774119182 333
472 iso_pu_bacteria 2773857672 2774129029 333
473 iso_pu_bacteria 2784132072 2784314832 333
474 iso_pu_bacteria 2791355520 2794596421 333
475 iso_pu_bacteria 2806310737 2807410173 333
476 iso_pu_bacteria 2806310745 2807458520 333
477 iso_pu_bacteria 2808606361 2808855086 333
478 iso_pu_bacteria 2808606373 2808906904 333
479 iso_pu_bacteria 2808606376 2808924363 333
480 iso_pu_bacteria 2808606377 2808928003 333
481 iso_pu_bacteria 2808606377 2808930602 333
482 iso_pu_bacteria 2808606378 2808935742 333
483 iso_pu_bacteria 2808606380 2808946539 333
484 iso_pu_bacteria 2808606381 2808949457 333
485 iso_pu_bacteria 2808606381 2808952724 333
486 iso_pu_bacteria 2808606382 2808958991 333
487 iso_pu_bacteria 2808606382 2808960581 333
488 iso_pu_bacteria 2808606383 2808963563 333
489 iso_pu_bacteria 2808606389 2808998479 333
490 iso_pu_bacteria 2808606445 2809216818 333
491 iso_pu_bacteria 2818991449 2819615048 333
492 iso_pu_bacteria 2825651385 2825653018 333
493 iso_pu_bacteria 2826581358 2826585901 333
494 iso_pu_bacteria 2842815866 2842818934 333
495 iso_pu_bacteria 2842832357 2842835412 333
496 iso_pu_bacteria 2842843487 2842847183 333
497 iso_pu_bacteria 2842849001 2842853909 333
498 iso_pu_bacteria 2860339153 2860345658 333
499 iso_pu_bacteria 2904439833 2904441429 333
500 iso_pu_bacteria 2904530477 2904531633 333
501 iso_pu_bacteria 2904550169 2904554782 333
502 iso_pu_bacteria 2904584206 2904586727 333
503 iso_pu_bacteria 2904589729 2904593240 333
504 iso_pu_bacteria 2904601388 2904602916 333
505 iso_pu_bacteria 2913036834 2913038596 333
506 iso_pu_bacteria 2919046199 2919046273 333
507 iso_pu_bacteria 2919079590 2919084063 333
508 iso_pu_bacteria 2919456309 2919456551 333
509 iso_pu_bacteria 2919456309 2919461081 333
510 iso_pu_bacteria 2919481497 2919481871 333
511 iso_pu_bacteria 2919487758 2919492344 333
512 iso_pu_bacteria 2923153595 2923157947 333
513 iso_pu_bacteria 2923510766 2923511028 333
514 iso_pu_bacteria 2923586266 2923587292 333
515 iso_pu_bacteria 2928130867 2928130980 333
516 iso_pu_bacteria 2929144301 2929146048 333
517 iso_pu_bacteria 2931369376 2931370614 333
518 iso_pu_bacteria 2931396565 2931400911 333
519 iso_pu_bacteria 2939636861 2939637636 333
520 iso_pu_bacteria 2939636861 2939641477 333
521 iso_pu_bacteria 2974289157 2974291676 333
522 iso_pu_bacteria 2974298342 2974302549 333
523 iso_pu_bacteria 2984286254 2984288233 333
524 iso_pu_bacteria 2984499530 2984499867 333
525 iso_pu_bacteria 2988728565 2988733580 333
526 iso_pu_bacteria 2998139840 2998142104 333
527 iso_pu_bacteria 3007395558 3007397256 333
528 iso_pu_bacteria 3007419365 3007423205 333
529 iso_pu_bacteria 3007419365 3007424283 333
530 iso_pu_bacteria 3007511990 3007513558 333
531 iso_pu_bacteria 3007511990 3007515275 333
532 iso_pu_bacteria 3007619802 3007620075 333
533 iso_pu_bacteria 3007619802 3007622821 333
534 iso_pu_bacteria 3007803356 3007803458 333
535 iso_pu_bacteria 3007866637 3007870253 333
536 iso_pu_bacteria 8015687852 8015692045 333
537 iso_pu_bacteria 8029995093 8029998586 333
538 iso_pu_bacteria 8052494512 8052498003 333
539 iso_pu_bacteria 8054929484 8054931812 333
540 iso_pu_bacteria 8055770955 8055775254 333
541 iso_pu_bacteria 8056115690 8056117129 333
542 iso_pu_bacteria 8056125926 8056127587 333
543 iso_pu_bacteria 8056137416 8056140765 333
544 iso_pu_bacteria 8056155041 8056157351 333
545 2162886007 SwRhRL2b_contig_1640999 SwRhRL2b_0558.00006650 334
546 3300002771 JGI25163J39215_1000021 JGI25163J39215_100002134 334
547 3300002772 JGI25164J39214_1000005 JGI25164J39214_1000005208 334
548 3300003214 JGI25165J46597_1000128 JGI25165J46597_1000128156 334
549 3300005262 Ga0065165_1000119 Ga0065165_100011997 334
550 3300005272 Ga0065703_1000218 Ga0065703_10002184 334
551 3300005288 Ga0065714_10065062 Ga0065714_1006506214 334
552 3300005289 Ga0065704_10001483 Ga0065704_100014836 334
553 3300005331 Ga0070670_100005785 Ga0070670_10000578512 334
554 3300009036 Ga0105244_10000302 Ga0105244_1000030249 334
555 3300010375 Ga0105239_10010093 Ga0105239_100100938 334
556 3300017792 Ga0163161_10038252 Ga0163161_100382523 334
557 3300025207 Ga0209760_100007 Ga0209760_100007196 334
558 3300025231 Ga0207427_100018 Ga0207427_100018373 334
559 3300025233 Ga0209437_100031 Ga0209437_100031373 334
560 3300025256 Ga0209759_1002784 Ga0209759_10027849 334
561 3300025261 Ga0209233_1000012 Ga0209233_1000012370 334
562 3300025284 Ga0209130_1002103 Ga0209130_10021039 334
563 3300025302 Ga0207426_1000215 Ga0207426_100021597 334
564 3300025711 Ga0207696_1003628 Ga0207696_10036283 334
565 3300025728 Ga0207655_1000450 Ga0207655_100045052 334
566 3300025914 Ga0207671_10018425 Ga0207671_100184254 334
567 3300028794 Ga0307515_10003273 Ga0307515_1000327327 334
568 3300028794 Ga0307515_10092079 Ga0307515_100920794 334
569 3300031548 Ga0307408_100098228 Ga0307408_1000982282 334
570 3300031730 Ga0307516_10014063 Ga0307516_100140635 334
571 3300032004 Ga0307414_10087170 Ga0307414_100871702 334
572 3300038443 Ga0395901_0000034 Ga0395901_0000034_224096_225124 334
573 3300046457 Ga0495590_0000048 Ga0495590_0000048_87309_88328 334
574 3300046471 Ga0495650_0023333 Ga0495650_0023333_1391_2467 334
575 3300046491 Ga0495584_0000087 Ga0495584_0000087_6885_7961 334
576 3300046501 Ga0495607_0008839 Ga0495607_0008839_4404_5480 334
577 3300046507 Ga0495606_0003482 Ga0495606_0003482_14088_15164 334
578 3300046512 Ga0495610_0019236 Ga0495610_0019236_184_1203 334
579 3300046513 Ga0495616_0002238 Ga0495616_0002238_1664_2740 334
580 3300046522 Ga0495643_0024143 Ga0495643_0024143_997_2073 334
581 3300046538 Ga0495609_0000887 Ga0495609_0000887_16404_17519 334
582 3300046558 Ga0495633_0048503 Ga0495633_0048503_631_1650 334
583 3300046558 Ga0495633_0062288 Ga0495633_0062288_214_1233 334
584 3300046616 Ga0495668_0000656 Ga0495668_0000656_3095_4114 334
585 3300046665 Ga0495661_0000001 Ga0495661_0000001_782383_783459 334
586 3300046680 Ga0495646_0117616 Ga0495646_0117616_274_1302 334
587 3300046694 Ga0495649_0018251 Ga0495649_0018251_611_1630 334
588 3300046810 Ga0495660_0000204 Ga0495660_0000204_58851_59927 334
589 3300047469 Ga0495673_0001215 Ga0495673_0001215_15844_16923 334
590 3300048088 Ga0495602_0279874 Ga0495602_0279874_95_1123 334
591 3300048903 Ga0496100_0000078 Ga0496100_0000078_51179_52207 334
592 3300048904 Ga0496101_0000205 Ga0496101_0000205_28141_29169 334
593 3300048905 Ga0496102_0000165 Ga0496102_0000165_51097_52125 334
594 3300048906 Ga0496103_0001056 Ga0496103_0001056_10_1038 334
595 3300048907 Ga0496104_0050180 Ga0496104_0050180_704_1732 334
596 3300048910 Ga0496107_0105747 Ga0496107_0105747_967_1995 334
597 3300048919 Ga0496116_0000448 Ga0496116_0000448_3675_4694 334
598 3300048920 Ga0496117_0000707 Ga0496117_0000707_51084_52112 334
599 3300048921 Ga0496118_0000283 Ga0496118_0000283_37095_38123 334
600 3300048924 Ga0496121_0001382 Ga0496121_0001382_3056_4084 334
601 3300053177 Ga0500636_0000279 Ga0500636_0000279_15817_16836 334
602 3300003316 rootH1_10175342 rootH1_101753422 335
603 3300005289 Ga0065704_10073102 Ga0065704_100731024 335
604 3300005331 Ga0070670_100030122 Ga0070670_1000301222 335
605 3300006051 Ga0075364_10048667 Ga0075364_100486673 335
606 3300009011 Ga0105251_10000013 Ga0105251_10000013148 335
607 3300009011 Ga0105251_10001648 Ga0105251_100016485 335
608 3300009092 Ga0105250_10000092 Ga0105250_1000009262 335
609 3300025711 Ga0207696_1000225 Ga0207696_100022563 335
610 3300025735 Ga0207713_1000113 Ga0207713_10001136 335
611 3300025735 Ga0207713_1000262 Ga0207713_100026264 335
612 3300025925 Ga0207650_10014310 Ga0207650_100143102 335
613 3300025986 Ga0207658_10022132 Ga0207658_100221325 335
614 3300027312 Ga0209371_1000011 Ga0209371_1000011635 335
615 3300028794 Ga0307515_10004165 Ga0307515_1000416531 335
616 3300028794 Ga0307515_10232914 Ga0307515_102329141 335
617 3300030500 Ga0268256_1000011 Ga0268256_1000011635 335
618 3300031456 Ga0307513_10171675 Ga0307513_101716752 335
619 3300042129 Ga0450891_004443 Ga0450891_004443_53_1069 335
620 3300042139 Ga0450904_000022 Ga0450904_000022_237_1250 335
621 3300042156 Ga0439446_0005521 Ga0439446_0005521_360_1373 335
622 3300046471 Ga0495650_0001005 Ga0495650_0001005_21704_22717 335
623 3300046520 Ga0495637_0068607 Ga0495637_0068607_263_1273 335
624 3300046524 Ga0495648_0010465 Ga0495648_0010465_3640_4653 335
625 3300046538 Ga0495609_0000659 Ga0495609_0000659_523_1536 335
626 3300046538 Ga0495609_0004142 Ga0495609_0004142_294_1331 335
627 3300046794 Ga0495589_0006938 Ga0495589_0006938_3715_4728 335
628 3300047320 Ga0495672_0000710 Ga0495672_0000710_8134_9147 335
629 3300047469 Ga0495673_0003329 Ga0495673_0003329_428_1441 335
630 3300047472 Ga0495686_0008036 Ga0495686_0008036_6423_7472 335
631 3300048920 Ga0496117_0016570 Ga0496117_0016570_1329_2354 335
632 3300048922 Ga0496119_0001652 Ga0496119_0001652_18302_19327 335
633 3300048923 Ga0496120_0001598 Ga0496120_0001598_18385_19410 335
634 3300048925 Ga0496122_0000566 Ga0496122_0000566_18627_19652 335
635 3300048926 Ga0496123_0000324 Ga0496123_0000324_85936_86961 335
636 3300048927 Ga0496124_0001943 Ga0496124_0001943_16132_17157 335
637 3300049853 Ga0501226_000019 Ga0501226_000019_120926_121939 335
638 iso_pu_bacteria 2821136567 2821139588 335
639 iso_pu_bacteria 2904467357 2904471776 335
640 2162886007 SwRhRL2b_contig_180217 SwRhRL2b_0806.00002800 336
641 3300001989 JGI24739J22299_10009540 JGI24739J22299_100095405 336
642 3300002737 JGI25162J39368_1000013 JGI25162J39368_1000013274 336
643 3300002771 JGI25163J39215_1000581 JGI25163J39215_10005817 336
644 3300002772 JGI25164J39214_1000005 JGI25164J39214_1000005274 336
645 3300003214 JGI25165J46597_1000099 JGI25165J46597_100009956 336
646 3300003760 Ga0055527_1000270 Ga0055527_100027018 336
647 3300003761 Ga0055535_1000036 Ga0055535_100003614 336
648 3300003762 Ga0055542_1000061 Ga0055542_1000061148 336
649 3300003763 Ga0055529_1000069 Ga0055529_100006914 336
650 3300003781 Ga0055536_1000046 Ga0055536_100004671 336
651 3300003781 Ga0055536_1001110 Ga0055536_100111017 336
652 3300003781 Ga0055536_1002424 Ga0055536_10024242 336
653 3300003791 Ga0055530_10000373 Ga0055530_100003734 336
654 3300003791 Ga0055530_10002821 Ga0055530_1000282111 336
655 3300003792 Ga0055540_1000070 Ga0055540_100007071 336
656 3300003792 Ga0055540_1002149 Ga0055540_10021492 336
657 3300003794 Ga0055531_10000155 Ga0055531_1000015570 336
658 3300003794 Ga0055531_10000742 Ga0055531_1000074224 336
659 3300005288 Ga0065714_10024302 Ga0065714_100243023 336
660 3300005288 Ga0065714_10066345 Ga0065714_100663458 336
661 3300005288 Ga0065714_10107453 Ga0065714_101074531 336
662 3300005289 Ga0065704_10156139 Ga0065704_101561391 336
663 3300005327 Ga0070658_10016240 Ga0070658_100162405 336
664 3300005331 Ga0070670_100001904 Ga0070670_10000190411 336
665 3300005331 Ga0070670_100008992 Ga0070670_1000089929 336
666 3300005339 Ga0070660_100000572 Ga0070660_10000057220 336
667 3300005344 Ga0070661_100001382 Ga0070661_10000138215 336
668 3300005344 Ga0070661_100025375 Ga0070661_1000253756 336
669 3300005353 Ga0070669_100003585 Ga0070669_1000035856 336
670 3300005353 Ga0070669_100121912 Ga0070669_1001219122 336
671 3300005366 Ga0070659_100000698 Ga0070659_10000069820 336
672 3300005445 Ga0070708_100039416 Ga0070708_1000394164 336
673 3300005455 Ga0070663_100001986 Ga0070663_1000019866 336
674 3300005539 Ga0068853_100033739 Ga0068853_1000337393 336
675 3300005539 Ga0068853_100410279 Ga0068853_1004102791 336
676 3300005548 Ga0070665_100044913 Ga0070665_1000449134 336
677 3300005549 Ga0070704_100023296 Ga0070704_1000232964 336
678 3300005563 Ga0068855_100037194 Ga0068855_1000371946 336
679 3300005564 Ga0070664_100005010 Ga0070664_1000050109 336
680 3300005616 Ga0068852_100007019 Ga0068852_1000070195 336
681 3300005834 Ga0068851_10000050 Ga0068851_100000503 336
682 3300006051 Ga0075364_10014866 Ga0075364_100148664 336
683 3300006177 Ga0075362_10080798 Ga0075362_100807982 336
684 3300006946 Ga0079104_1027136 Ga0079104_10271361 336
685 3300009011 Ga0105251_10004102 Ga0105251_100041022 336
686 3300009011 Ga0105251_10005382 Ga0105251_100053822 336
687 3300009011 Ga0105251_10006201 Ga0105251_100062012 336
688 3300009011 Ga0105251_10101744 Ga0105251_101017441 336
689 3300009036 Ga0105244_10001906 Ga0105244_100019069 336
690 3300009036 Ga0105244_10002557 Ga0105244_1000255711 336
691 3300009036 Ga0105244_10003260 Ga0105244_100032609 336
692 3300009036 Ga0105244_10037969 Ga0105244_100379692 336
693 3300009036 Ga0105244_10040545 Ga0105244_100405452 336
694 3300009036 Ga0105244_10054451 Ga0105244_100544511 336
695 3300009092 Ga0105250_10000507 Ga0105250_1000050726 336
696 3300009092 Ga0105250_10002084 Ga0105250_100020842 336
697 3300009092 Ga0105250_10003330 Ga0105250_100033302 336
698 3300009092 Ga0105250_10006245 Ga0105250_100062456 336
699 3300009092 Ga0105250_10006616 Ga0105250_100066165 336
700 3300009092 Ga0105250_10010591 Ga0105250_100105911 336
701 3300009093 Ga0105240_10045610 Ga0105240_100456106 336
702 3300009148 Ga0105243_10000954 Ga0105243_1000095423 336
703 3300009176 Ga0105242_10002363 Ga0105242_1000236312 336
704 3300009177 Ga0105248_10071057 Ga0105248_100710575 336
705 3300009545 Ga0105237_10001117 Ga0105237_1000111726 336
706 3300009551 Ga0105238_10021874 Ga0105238_100218744 336
707 3300010375 Ga0105239_10119585 Ga0105239_101195851 336
708 3300011119 Ga0105246_10000120 Ga0105246_100001206 336
709 3300011119 Ga0105246_10002300 Ga0105246_100023003 336
710 3300013100 Ga0157373_10013941 Ga0157373_100139418 336
711 3300013100 Ga0157373_10090780 Ga0157373_100907803 336
712 3300013100 Ga0157373_10195495 Ga0157373_101954952 336
713 3300013100 Ga0157373_10228671 Ga0157373_102286711 336
714 3300013102 Ga0157371_10197147 Ga0157371_101971471 336
715 3300013104 Ga0157370_10000199 Ga0157370_1000019948 336
716 3300013104 Ga0157370_10011567 Ga0157370_1001156712 336
717 3300013104 Ga0157370_10307458 Ga0157370_103074582 336
718 3300013105 Ga0157369_10000670 Ga0157369_1000067019 336
719 3300013105 Ga0157369_10021174 Ga0157369_100211749 336
720 3300013105 Ga0157369_10027324 Ga0157369_100273246 336
721 3300013105 Ga0157369_10033958 Ga0157369_100339586 336
722 3300013105 Ga0157369_10058682 Ga0157369_100586822 336
723 3300013105 Ga0157369_10066320 Ga0157369_100663202 336
724 3300013105 Ga0157369_10316365 Ga0157369_103163652 336
725 3300013308 Ga0157375_10010216 Ga0157375_100102169 336
726 3300013308 Ga0157375_10032111 Ga0157375_100321111 336
727 3300013308 Ga0157375_10414409 Ga0157375_104144092 336
728 3300014497 Ga0182008_10003522 Ga0182008_100035222 336
729 3300014497 Ga0182008_10014104 Ga0182008_100141045 336
730 3300014497 Ga0182008_10021239 Ga0182008_100212392 336
731 3300015261 Ga0182006_1000204 Ga0182006_100020430 336
732 3300015261 Ga0182006_1004201 Ga0182006_10042019 336
733 3300015261 Ga0182006_1008554 Ga0182006_10085545 336
734 3300015261 Ga0182006_1015239 Ga0182006_10152392 336
735 3300015261 Ga0182006_1050867 Ga0182006_10508672 336
736 3300015262 Ga0182007_10000204 Ga0182007_1000020434 336
737 3300015262 Ga0182007_10003378 Ga0182007_100033789 336
738 3300015265 Ga0182005_1000114 Ga0182005_100011434 336
739 3300015265 Ga0182005_1019514 Ga0182005_10195141 336
740 3300015265 Ga0182005_1020862 Ga0182005_10208622 336
741 3300017792 Ga0163161_10018183 Ga0163161_100181836 336
742 3300017792 Ga0163161_10047011 Ga0163161_100470113 336
743 3300017792 Ga0163161_10200027 Ga0163161_102000272 336
744 3300017792 Ga0163161_10232146 Ga0163161_102321462 336
745 3300025207 Ga0209760_100035 Ga0209760_10003527 336
746 3300025226 Ga0209674_102494 Ga0209674_1024943 336
747 3300025228 Ga0209672_100035 Ga0209672_10003594 336
748 3300025229 Ga0209147_100041 Ga0209147_10004194 336
749 3300025230 Ga0209563_100986 Ga0209563_1009861 336
750 3300025231 Ga0207427_100018 Ga0207427_100018431 336
751 3300025233 Ga0209437_100031 Ga0209437_100031431 336
752 3300025242 Ga0209258_100063 Ga0209258_10006396 336
753 3300025254 Ga0209148_1000088 Ga0209148_100008894 336
754 3300025261 Ga0209233_1000012 Ga0209233_1000012428 336
755 3300025272 Ga0209455_1000075 Ga0209455_1000075172 336
756 3300025291 Ga0209675_1012344 Ga0209675_10123443 336
757 3300025292 Ga0209676_1000010 Ga0209676_100001099 336
758 3300025292 Ga0209676_1000055 Ga0209676_1000055234 336
759 3300025292 Ga0209676_1000223 Ga0209676_100022353 336
760 3300025298 Ga0209050_1000081 Ga0209050_1000081151 336
761 3300025298 Ga0209050_1000231 Ga0209050_100023142 336
762 3300025303 Ga0209051_1000165 Ga0209051_100016542 336
763 3300025303 Ga0209051_1000185 Ga0209051_10001852 336
764 3300025304 Ga0209257_1000040 Ga0209257_1000040426 336
765 3300025304 Ga0209257_1000767 Ga0209257_100076742 336
766 3300025321 Ga0207656_10000683 Ga0207656_100006834 336
767 3300025711 Ga0207696_1000002 Ga0207696_100000274 336
768 3300025711 Ga0207696_1000171 Ga0207696_100017180 336
769 3300025711 Ga0207696_1001259 Ga0207696_10012592 336
770 3300025711 Ga0207696_1002911 Ga0207696_10029119 336
771 3300025711 Ga0207696_1006566 Ga0207696_10065661 336
772 3300025728 Ga0207655_1000085 Ga0207655_100008586 336
773 3300025728 Ga0207655_1000286 Ga0207655_100028668 336
774 3300025728 Ga0207655_1000451 Ga0207655_100045143 336
775 3300025728 Ga0207655_1000654 Ga0207655_100065430 336
776 3300025728 Ga0207655_1002485 Ga0207655_100248510 336
777 3300025728 Ga0207655_1015128 Ga0207655_10151285 336
778 3300025728 Ga0207655_1034089 Ga0207655_10340892 336
779 3300025728 Ga0207655_1040787 Ga0207655_10407872 336
780 3300025735 Ga0207713_1000298 Ga0207713_100029834 336
781 3300025735 Ga0207713_1000816 Ga0207713_100081626 336
782 3300025735 Ga0207713_1002411 Ga0207713_100241111 336
783 3300025735 Ga0207713_1003362 Ga0207713_10033626 336
784 3300025735 Ga0207713_1005863 Ga0207713_10058632 336
785 3300025735 Ga0207713_1017246 Ga0207713_10172464 336
786 3300025735 Ga0207713_1033185 Ga0207713_10331852 336
787 3300025735 Ga0207713_1049804 Ga0207713_10498042 336
788 3300025735 Ga0207713_1057730 Ga0207713_10577302 336
789 3300025904 Ga0207647_10009950 Ga0207647_100099505 336
790 3300025910 Ga0207684_10123646 Ga0207684_101236462 336
791 3300025913 Ga0207695_10030693 Ga0207695_100306934 336
792 3300025914 Ga0207671_10000989 Ga0207671_1000098930 336
793 3300025914 Ga0207671_10009386 Ga0207671_100093866 336
794 3300025919 Ga0207657_10001590 Ga0207657_1000159020 336
795 3300025920 Ga0207649_10000041 Ga0207649_100000419 336
796 3300025923 Ga0207681_10002768 Ga0207681_100027686 336
797 3300025924 Ga0207694_10008451 Ga0207694_100084514 336
798 3300025925 Ga0207650_10000174 Ga0207650_1000017474 336
799 3300025925 Ga0207650_10001409 Ga0207650_1000140911 336
800 3300025932 Ga0207690_10000547 Ga0207690_100005476 336
801 3300025933 Ga0207706_10002445 Ga0207706_1000244515 336
802 3300025934 Ga0207686_10035185 Ga0207686_100351852 336
803 3300025934 Ga0207686_10150838 Ga0207686_101508382 336
804 3300025935 Ga0207709_10000011 Ga0207709_10000011311 336
805 3300025935 Ga0207709_10000035 Ga0207709_1000003597 336
806 3300025941 Ga0207711_10091278 Ga0207711_100912783 336
807 3300025945 Ga0207679_10000018 Ga0207679_1000001830 336
808 3300025945 Ga0207679_10045803 Ga0207679_100458032 336
809 3300025949 Ga0207667_10001468 Ga0207667_100014683 336
810 3300026041 Ga0207639_10024444 Ga0207639_100244443 336
811 3300026041 Ga0207639_10259040 Ga0207639_102590401 336
812 3300026067 Ga0207678_10008673 Ga0207678_100086737 336
813 3300026142 Ga0207698_10006688 Ga0207698_100066885 336
814 3300027111 Ga0209281_1008896 Ga0209281_10088963 336
815 3300027111 Ga0209281_1009319 Ga0209281_10093192 336
816 3300027312 Ga0209371_1000757 Ga0209371_100075724 336
817 3300027907 Ga0207428_10046998 Ga0207428_100469983 336
818 3300030500 Ga0268256_1000077 Ga0268256_1000077161 336
819 3300030735 Ga0316178_1126744 Ga0316178_112674431 336
820 3300031548 Ga0307408_100000077 Ga0307408_100000077100 336
821 3300031548 Ga0307408_100005781 Ga0307408_1000057818 336
822 3300031548 Ga0307408_100023222 Ga0307408_1000232222 336
823 3300031731 Ga0307405_10003762 Ga0307405_100037622 336
824 3300031731 Ga0307405_10017223 Ga0307405_100172235 336
825 3300031901 Ga0307406_10067727 Ga0307406_100677272 336
826 3300031911 Ga0307412_10004379 Ga0307412_100043792 336
827 3300031911 Ga0307412_10034527 Ga0307412_100345274 336
828 3300031911 Ga0307412_10101523 Ga0307412_101015232 336
829 3300031911 Ga0307412_10201375 Ga0307412_102013752 336
830 3300032002 Ga0307416_100072080 Ga0307416_1000720802 336
831 3300032004 Ga0307414_10057788 Ga0307414_100577884 336
832 3300032005 Ga0307411_10010652 Ga0307411_100106522 336
833 3300032005 Ga0307411_10414437 Ga0307411_104144371 336
834 3300038705 Ga0237819_01237 Ga0237819_01237_3892_4911 336
835 3300038705 Ga0237819_01567 Ga0237819_01567_3590_4606 336
836 3300041405 Ga0439438_001359 Ga0439438_001359_7354_8370 336
837 3300041405 Ga0439438_029254 Ga0439438_029254_160_1176 336
838 3300041407 Ga0439447_000268 Ga0439447_000268_15038_16054 336
839 3300041411 Ga0439466_0000448 Ga0439466_0000448_12107_13123 336
840 3300041411 Ga0439466_0008229 Ga0439466_0008229_226_1242 336
841 3300041411 Ga0439466_0033043 Ga0439466_0033043_622_1641 336
842 3300042006 Ga0439432_001794 Ga0439432_001794_388_1404 336
843 3300042006 Ga0439432_002089 Ga0439432_002089_6235_7251 336
844 3300042006 Ga0439432_045198 Ga0439432_045198_245_1261 336
845 3300042010 Ga0439452_001292 Ga0439452_001292_9285_10304 336
846 3300042010 Ga0439452_001742 Ga0439452_001742_2236_3252 336
847 3300042010 Ga0439452_010971 Ga0439452_010971_264_1280 336
848 3300042115 Ga0450911_000968 Ga0450911_000968_272_1288 336
849 3300042115 Ga0450911_007479 Ga0450911_007479_407_1426 336
850 3300042125 Ga0450923_006834 Ga0450923_006834_99_1115 336
851 3300042156 Ga0439446_0000030 Ga0439446_0000030_17123_18139 336
852 3300042156 Ga0439446_0000589 Ga0439446_0000589_3937_4953 336
853 3300042435 Ga0439434_0000606 Ga0439434_0000606_2964_3980 336
854 3300042439 Ga0439464_0011253 Ga0439464_0011253_170_1186 336
855 3300044765 Ga0466970_0038444 Ga0466970_0038444_721_1737 336
856 3300046452 Ga0495617_029489 Ga0495617_029489_602_1621 336
857 3300046458 Ga0495591_002951 Ga0495591_002951_281_1309 336
858 3300046458 Ga0495591_003607 Ga0495591_003607_6386_7402 336
859 3300046458 Ga0495591_024506 Ga0495591_024506_429_1448 336
860 3300046460 Ga0495638_0009362 Ga0495638_0009362_277_1293 336
861 3300046460 Ga0495638_0028897 Ga0495638_0028897_1207_2286 336
862 3300046463 Ga0495653_0027365 Ga0495653_0027365_2519_3535 336
863 3300046463 Ga0495653_0101995 Ga0495653_0101995_842_1858 336
864 3300046471 Ga0495650_0043644 Ga0495650_0043644_856_1866 336
865 3300046491 Ga0495584_0021971 Ga0495584_0021971_2095_3111 336
866 3300046492 Ga0495585_0003530 Ga0495585_0003530_301_1317 336
867 3300046500 Ga0495596_0000375 Ga0495596_0000375_26925_27935 336
868 3300046501 Ga0495607_0000028 Ga0495607_0000028_154534_155550 336
869 3300046507 Ga0495606_0000293 Ga0495606_0000293_37544_38560 336
870 3300046507 Ga0495606_0006300 Ga0495606_0006300_298_1317 336
871 3300046507 Ga0495606_0008357 Ga0495606_0008357_7817_8845 336
872 3300046507 Ga0495606_0012381 Ga0495606_0012381_2694_3812 336
873 3300046512 Ga0495610_0004502 Ga0495610_0004502_8867_9883 336
874 3300046512 Ga0495610_0010705 Ga0495610_0010705_3393_4421 336
875 3300046512 Ga0495610_0011886 Ga0495610_0011886_250_1269 336
876 3300046512 Ga0495610_0040278 Ga0495610_0040278_1090_2106 336
877 3300046512 Ga0495610_0057114 Ga0495610_0057114_258_1268 336
878 3300046513 Ga0495616_0000393 Ga0495616_0000393_25989_27011 336
879 3300046513 Ga0495616_0005371 Ga0495616_0005371_6322_7338 336
880 3300046513 Ga0495616_0049374 Ga0495616_0049374_647_1663 336
881 3300046515 Ga0495620_0002772 Ga0495620_0002772_298_1317 336
882 3300046515 Ga0495620_0004441 Ga0495620_0004441_6454_7482 336
883 3300046515 Ga0495620_0048118 Ga0495620_0048118_488_1504 336
884 3300046515 Ga0495620_0056185 Ga0495620_0056185_41_1051 336
885 3300046518 Ga0495631_0040624 Ga0495631_0040624_272_1282 336
886 3300046519 Ga0495632_0003236 Ga0495632_0003236_2118_3140 336
887 3300046519 Ga0495632_0014471 Ga0495632_0014471_260_1279 336
888 3300046519 Ga0495632_0063775 Ga0495632_0063775_289_1305 336
889 3300046519 Ga0495632_0065336 Ga0495632_0065336_365_1393 336
890 3300046519 Ga0495632_0066135 Ga0495632_0066135_654_1664 336
891 3300046520 Ga0495637_0042085 Ga0495637_0042085_900_1919 336
892 3300046522 Ga0495643_0000148 Ga0495643_0000148_34488_35504 336
893 3300046522 Ga0495643_0006613 Ga0495643_0006613_6370_7380 336
894 3300046522 Ga0495643_0011200 Ga0495643_0011200_1437_2453 336
895 3300046523 Ga0495644_0001121 Ga0495644_0001121_9563_10579 336
896 3300046524 Ga0495648_0032365 Ga0495648_0032365_465_1481 336
897 3300046530 Ga0495654_0004756 Ga0495654_0004756_487_1503 336
898 3300046530 Ga0495654_0011517 Ga0495654_0011517_551_1570 336
899 3300046530 Ga0495654_0011629 Ga0495654_0011629_73_1089 336
900 3300046530 Ga0495654_0014404 Ga0495654_0014404_2860_3876 336
901 3300046542 Ga0495597_0030206 Ga0495597_0030206_254_1264 336
902 3300046542 Ga0495597_0097689 Ga0495597_0097689_78_1094 336
903 3300046616 Ga0495668_0003877 Ga0495668_0003877_252_1262 336
904 3300046660 Ga0495625_0010023 Ga0495625_0010023_493_1509 336
905 3300046660 Ga0495625_0119190 Ga0495625_0119190_271_1290 336
906 3300046660 Ga0495625_0157298 Ga0495625_0157298_179_1189 336
907 3300046665 Ga0495661_0000455 Ga0495661_0000455_33404_34426 336
908 3300046665 Ga0495661_0005353 Ga0495661_0005353_378_1406 336
909 3300046665 Ga0495661_0031240 Ga0495661_0031240_183_1202 336
910 3300046679 Ga0495623_0041757 Ga0495623_0041757_1694_2710 336
911 3300046690 Ga0495624_0014500 Ga0495624_0014500_3113_4129 336
912 3300046692 Ga0495671_0001048 Ga0495671_0001048_9085_10101 336
913 3300046692 Ga0495671_0025385 Ga0495671_0025385_1904_2920 336
914 3300046692 Ga0495671_0054582 Ga0495671_0054582_437_1456 336
915 3300046694 Ga0495649_0000241 Ga0495649_0000241_28193_29209 336
916 3300046694 Ga0495649_0000607 Ga0495649_0000607_26665_27681 336
917 3300046694 Ga0495649_0005299 Ga0495649_0005299_174_1190 336
918 3300046794 Ga0495589_0013584 Ga0495589_0013584_131_1147 336
919 3300046810 Ga0495660_0009772 Ga0495660_0009772_554_1570 336
920 3300047318 Ga0495636_0036542 Ga0495636_0036542_158_1174 336
921 3300047320 Ga0495672_0018634 Ga0495672_0018634_1066_2082 336
922 3300047320 Ga0495672_0077389 Ga0495672_0077389_773_1786 336
923 3300047322 Ga0495680_0041316 Ga0495680_0041316_757_1773 336
924 3300047322 Ga0495680_0104890 Ga0495680_0104890_220_1236 336
925 3300047323 Ga0495683_0061918 Ga0495683_0061918_157_1173 336
926 3300047443 Ga0495687_002888 Ga0495687_002888_11310_12326 336
927 3300047444 Ga0495675_0112078 Ga0495675_0112078_209_1225 336
928 3300047445 Ga0495677_0000801 Ga0495677_0000801_6045_7067 336
929 3300047446 Ga0495679_002144 Ga0495679_002144_418_1434 336
930 3300047469 Ga0495673_0005927 Ga0495673_0005927_591_1607 336
931 3300047469 Ga0495673_0035272 Ga0495673_0035272_1067_2086 336
932 3300047470 Ga0495681_0020340 Ga0495681_0020340_2092_3108 336
933 3300047470 Ga0495681_0022880 Ga0495681_0022880_2261_3271 336
934 3300047470 Ga0495681_0055558 Ga0495681_0055558_602_1621 336
935 3300047472 Ga0495686_0020099 Ga0495686_0020099_451_1500 336
936 3300047673 Ga0495593_0014842 Ga0495593_0014842_3211_4227 336
937 3300047673 Ga0495593_0019564 Ga0495593_0019564_2023_3039 336
938 3300048091 Ga0495626_0003201 Ga0495626_0003201_289_1308 336
939 3300048091 Ga0495626_0011857 Ga0495626_0011857_442_1458 336
940 3300048907 Ga0496104_0414855 Ga0496104_0414855_64_1098 336
941 3300048919 Ga0496116_0011116 Ga0496116_0011116_269_1285 336
942 3300048920 Ga0496117_0008803 Ga0496117_0008803_8110_9138 336
943 3300048920 Ga0496117_0076696 Ga0496117_0076696_927_1943 336
944 3300048920 Ga0496117_0125621 Ga0496117_0125621_256_1272 336
945 3300048920 Ga0496117_0145946 Ga0496117_0145946_311_1345 336
946 3300048921 Ga0496118_0046154 Ga0496118_0046154_264_1280 336
947 3300048921 Ga0496118_0067486 Ga0496118_0067486_1448_2476 336
948 3300048922 Ga0496119_0127532 Ga0496119_0127532_84_1100 336
949 3300048923 Ga0496120_0063670 Ga0496120_0063670_649_1677 336
950 3300048924 Ga0496121_0034838 Ga0496121_0034838_1332_2366 336
951 3300048924 Ga0496121_0170084 Ga0496121_0170084_242_1258 336
952 3300048925 Ga0496122_0067777 Ga0496122_0067777_747_1775 336
953 3300048925 Ga0496122_0070648 Ga0496122_0070648_1192_2226 336
954 3300048925 Ga0496122_0089428 Ga0496122_0089428_181_1197 336
955 3300048926 Ga0496123_0024878 Ga0496123_0024878_183_1199 336
956 3300048926 Ga0496123_0087312 Ga0496123_0087312_337_1365 336
957 3300048927 Ga0496124_0010394 Ga0496124_0010394_8025_9053 336
958 3300048927 Ga0496124_0012763 Ga0496124_0012763_6914_7930 336
959 3300048927 Ga0496124_0112036 Ga0496124_0112036_252_1268 336
960 3300048927 Ga0496124_0221271 Ga0496124_0221271_11_1027 336
961 3300048927 Ga0496124_0254153 Ga0496124_0254153_171_1187 336
962 3300048928 Ga0496125_0010719 Ga0496125_0010719_7820_8848 336
963 3300048929 Ga0496126_0068309 Ga0496126_0068309_181_1197 336
964 3300049459 Ga0495678_000213 Ga0495678_000213_4603_5685 336
965 3300049459 Ga0495678_005054 Ga0495678_005054_253_1263 336
966 3300049459 Ga0495678_081497 Ga0495678_081497_96_1106 336
967 3300049758 Ga0501241_000108 Ga0501241_000108_7485_8501 336
968 3300053146 Ga0500588_0008060 Ga0500588_0008060_1239_2288 336
969 2124908027 MRS2a_Contig_23 MRS2a_00132490 337
970 2124908027 MRS2a_Contig_6176 MRS2a_00075400 337
971 2162886007 SwRhRL2b_contig_2300201 SwRhRL2b_0935.00002510 337
972 2162886007 SwRhRL2b_contig_3802573 SwRhRL2b_0125.00004870 337
973 3300003751 Ga0055538_1000002 Ga0055538_1000002852 337
974 3300003752 Ga0055539_1000002 Ga0055539_1000002852 337
975 3300003756 Ga0055533_1000004 Ga0055533_1000004852 337
976 3300003759 Ga0055525_1000002 Ga0055525_1000002852 337
977 3300003771 Ga0055526_1006094 Ga0055526_10060946 337
978 3300003781 Ga0055536_1000119 Ga0055536_100011935 337
979 3300003781 Ga0055536_1002293 Ga0055536_100229311 337
980 3300003790 Ga0055528_1001611 Ga0055528_100161114 337
981 3300003791 Ga0055530_10001052 Ga0055530_1000105214 337
982 3300003791 Ga0055530_10002763 Ga0055530_100027632 337
983 3300003791 Ga0055530_10003052 Ga0055530_100030523 337
984 3300003792 Ga0055540_1000761 Ga0055540_100076114 337
985 3300003792 Ga0055540_1002116 Ga0055540_10021162 337
986 3300003841 Ga0055541_1000043 Ga0055541_100004365 337
987 3300004625 Ga0055543_1009242 Ga0055543_10092422 337
988 3300005262 Ga0065165_1000128 Ga0065165_1000128100 337
989 3300005288 Ga0065714_10004455 Ga0065714_100044553 337
990 3300005288 Ga0065714_10012982 Ga0065714_100129822 337
991 3300005288 Ga0065714_10025315 Ga0065714_100253151 337
992 3300005288 Ga0065714_10066322 Ga0065714_100663224 337
993 3300005288 Ga0065714_10067351 Ga0065714_100673517 337
994 3300005288 Ga0065714_10096522 Ga0065714_100965222 337
995 3300005288 Ga0065714_10113692 Ga0065714_101136921 337
996 3300005288 Ga0065714_10146719 Ga0065714_101467191 337
997 3300005289 Ga0065704_10000681 Ga0065704_1000068111 337
998 3300005289 Ga0065704_10073943 Ga0065704_100739432 337
999 3300005290 Ga0065712_10006164 Ga0065712_100061641 337
1000 3300005290 Ga0065712_10068223 Ga0065712_100682233 337
1001 3300005293 Ga0065715_10011492 Ga0065715_100114922 337
1002 3300005435 Ga0070714_100136545 Ga0070714_1001365452 337
1003 3300005563 Ga0068855_100000065 Ga0068855_10000006528 337
1004 3300005578 Ga0068854_100067072 Ga0068854_1000670722 337
1005 3300006051 Ga0075364_10121184 Ga0075364_101211841 337
1006 3300006058 Ga0075432_10015868 Ga0075432_100158682 337
1007 3300006058 Ga0075432_10029606 Ga0075432_100296062 337
1008 3300006177 Ga0075362_10057328 Ga0075362_100573282 337
1009 3300006914 Ga0075436_100041894 Ga0075436_1000418942 337
1010 3300006914 Ga0075436_100236977 Ga0075436_1002369772 337
1011 3300006944 Ga0099823_1000006 Ga0099823_100000662 337
1012 3300006946 Ga0079104_1000124 Ga0079104_100012490 337
1013 3300006946 Ga0079104_1002758 Ga0079104_10027589 337
1014 3300006948 Ga0099826_10023392 Ga0099826_100233925 337
1015 3300009011 Ga0105251_10000193 Ga0105251_1000019341 337
1016 3300009011 Ga0105251_10006395 Ga0105251_100063958 337
1017 3300009011 Ga0105251_10041970 Ga0105251_100419702 337
1018 3300009011 Ga0105251_10046707 Ga0105251_100467072 337
1019 3300009011 Ga0105251_10091853 Ga0105251_100918532 337
1020 3300009036 Ga0105244_10002379 Ga0105244_1000237914 337
1021 3300009036 Ga0105244_10003076 Ga0105244_100030763 337
1022 3300009036 Ga0105244_10003525 Ga0105244_100035253 337
1023 3300009036 Ga0105244_10011091 Ga0105244_100110916 337
1024 3300009036 Ga0105244_10014689 Ga0105244_100146894 337
1025 3300009036 Ga0105244_10074566 Ga0105244_100745661 337
1026 3300009148 Ga0105243_10019002 Ga0105243_100190023 337
1027 3300009148 Ga0105243_10096684 Ga0105243_100966842 337
1028 3300009176 Ga0105242_10194196 Ga0105242_101941961 337
1029 3300009545 Ga0105237_10001959 Ga0105237_1000195920 337
1030 3300010375 Ga0105239_10089152 Ga0105239_100891523 337
1031 3300013100 Ga0157373_10001163 Ga0157373_100011634 337
1032 3300013100 Ga0157373_10003018 Ga0157373_100030184 337
1033 3300013100 Ga0157373_10003792 Ga0157373_100037926 337
1034 3300013100 Ga0157373_10016336 Ga0157373_100163363 337
1035 3300013102 Ga0157371_10025284 Ga0157371_100252842 337
1036 3300013104 Ga0157370_10076057 Ga0157370_100760572 337
1037 3300013105 Ga0157369_10014637 Ga0157369_100146376 337
1038 3300013105 Ga0157369_10127852 Ga0157369_101278521 337
1039 3300013306 Ga0163162_10000311 Ga0163162_1000031143 337
1040 3300013306 Ga0163162_10097341 Ga0163162_100973413 337
1041 3300013306 Ga0163162_10218162 Ga0163162_102181622 337
1042 3300013306 Ga0163162_10309555 Ga0163162_103095552 337
1043 3300013307 Ga0157372_10089144 Ga0157372_100891442 337
1044 3300013308 Ga0157375_10382214 Ga0157375_103822142 337
1045 3300014497 Ga0182008_10005394 Ga0182008_1000539410 337
1046 3300014497 Ga0182008_10020567 Ga0182008_100205674 337
1047 3300014497 Ga0182008_10069799 Ga0182008_100697992 337
1048 3300014497 Ga0182008_10075964 Ga0182008_100759642 337
1049 3300014497 Ga0182008_10100712 Ga0182008_101007121 337
1050 3300015261 Ga0182006_1005696 Ga0182006_10056961 337
1051 3300015261 Ga0182006_1014978 Ga0182006_10149782 337
1052 3300015261 Ga0182006_1017331 Ga0182006_10173312 337
1053 3300015265 Ga0182005_1000093 Ga0182005_100009322 337
1054 3300015265 Ga0182005_1003886 Ga0182005_10038862 337
1055 3300015265 Ga0182005_1006309 Ga0182005_10063092 337
1056 3300015265 Ga0182005_1010111 Ga0182005_10101112 337
1057 3300015265 Ga0182005_1046521 Ga0182005_10465211 337
1058 3300017792 Ga0163161_10003120 Ga0163161_100031204 337
1059 3300017792 Ga0163161_10017734 Ga0163161_100177343 337
1060 3300017792 Ga0163161_10018429 Ga0163161_100184296 337
1061 3300017792 Ga0163161_10025472 Ga0163161_100254723 337
1062 3300017792 Ga0163161_10071791 Ga0163161_100717912 337
1063 3300017792 Ga0163161_10119790 Ga0163161_101197902 337
1064 3300017792 Ga0163161_10218062 Ga0163161_102180622 337
1065 3300021361 Ga0213872_10002525 Ga0213872_100025258 337
1066 3300021361 Ga0213872_10006445 Ga0213872_100064457 337
1067 3300025208 Ga0209436_102785 Ga0209436_1027854 337
1068 3300025224 Ga0209784_100002 Ga0209784_1000021071 337
1069 3300025225 Ga0209566_100003 Ga0209566_1000031071 337
1070 3300025226 Ga0209674_100004 Ga0209674_1000041071 337
1071 3300025228 Ga0209672_101840 Ga0209672_1018406 337
1072 3300025230 Ga0209563_100006 Ga0209563_1000061071 337
1073 3300025253 Ga0209677_100003 Ga0209677_1000031071 337
1074 3300025273 Ga0209673_1001257 Ga0209673_10012576 337
1075 3300025292 Ga0209676_1000006 Ga0209676_100000698 337
1076 3300025292 Ga0209676_1000407 Ga0209676_100040730 337
1077 3300025292 Ga0209676_1000473 Ga0209676_100047319 337
1078 3300025292 Ga0209676_1003099 Ga0209676_100309912 337
1079 3300025292 Ga0209676_1006129 Ga0209676_10061295 337
1080 3300025295 Ga0209564_1009105 Ga0209564_10091056 337
1081 3300025297 Ga0209758_1003146 Ga0209758_10031467 337
1082 3300025298 Ga0209050_1000009 Ga0209050_1000009362 337
1083 3300025298 Ga0209050_1000136 Ga0209050_1000136136 337
1084 3300025298 Ga0209050_1000214 Ga0209050_100021498 337
1085 3300025298 Ga0209050_1005130 Ga0209050_10051309 337
1086 3300025302 Ga0207426_1000535 Ga0207426_100053539 337
1087 3300025303 Ga0209051_1000008 Ga0209051_1000008119 337
1088 3300025303 Ga0209051_1000171 Ga0209051_10001712 337
1089 3300025303 Ga0209051_1011125 Ga0209051_10111254 337
1090 3300025303 Ga0209051_1021464 Ga0209051_10214642 337
1091 3300025304 Ga0209257_1002483 Ga0209257_100248315 337
1092 3300025304 Ga0209257_1006399 Ga0209257_10063995 337
1093 3300025711 Ga0207696_1000023 Ga0207696_1000023156 337
1094 3300025711 Ga0207696_1005516 Ga0207696_10055163 337
1095 3300025711 Ga0207696_1041764 Ga0207696_10417642 337
1096 3300025728 Ga0207655_1000006 Ga0207655_1000006556 337
1097 3300025728 Ga0207655_1000035 Ga0207655_100003528 337
1098 3300025728 Ga0207655_1000051 Ga0207655_1000051175 337
1099 3300025728 Ga0207655_1000340 Ga0207655_100034055 337
1100 3300025728 Ga0207655_1005310 Ga0207655_10053103 337
1101 3300025728 Ga0207655_1005373 Ga0207655_10053733 337
1102 3300025728 Ga0207655_1009354 Ga0207655_10093545 337
1103 3300025728 Ga0207655_1041394 Ga0207655_10413942 337
1104 3300025728 Ga0207655_1047738 Ga0207655_10477381 337
1105 3300025735 Ga0207713_1000173 Ga0207713_100017323 337
1106 3300025735 Ga0207713_1000220 Ga0207713_100022018 337
1107 3300025735 Ga0207713_1000530 Ga0207713_100053030 337
1108 3300025735 Ga0207713_1006277 Ga0207713_10062778 337
1109 3300025735 Ga0207713_1021244 Ga0207713_10212444 337
1110 3300025735 Ga0207713_1022073 Ga0207713_10220733 337
1111 3300025735 Ga0207713_1034802 Ga0207713_10348023 337
1112 3300025735 Ga0207713_1039788 Ga0207713_10397882 337
1113 3300025913 Ga0207695_10014003 Ga0207695_100140038 337
1114 3300025914 Ga0207671_10111343 Ga0207671_101113431 337
1115 3300025928 Ga0207700_10283560 Ga0207700_102835601 337
1116 3300025929 Ga0207664_10122182 Ga0207664_101221822 337
1117 3300025935 Ga0207709_10010503 Ga0207709_100105033 337
1118 3300025949 Ga0207667_10000025 Ga0207667_1000002569 337
1119 3300025949 Ga0207667_10026840 Ga0207667_100268404 337
1120 3300027111 Ga0209281_1000018 Ga0209281_1000018337 337
1121 3300027111 Ga0209281_1000077 Ga0209281_100007790 337
1122 3300027111 Ga0209281_1003803 Ga0209281_10038036 337
1123 3300027296 Ga0209389_1000030 Ga0209389_100003061 337
1124 3300027907 Ga0207428_10008748 Ga0207428_1000874810 337
1125 3300027907 Ga0207428_10010147 Ga0207428_1001014711 337
1126 3300027907 Ga0207428_10071970 Ga0207428_100719701 337
1127 3300027907 Ga0207428_10102784 Ga0207428_101027841 337
1128 3300028786 Ga0307517_10120901 Ga0307517_101209011 337
1129 3300028786 Ga0307517_10159626 Ga0307517_101596261 337
1130 3300028786 Ga0307517_10205693 Ga0307517_102056931 337
1131 3300030744 Ga0316181_1061592 Ga0316181_10615922 337
1132 3300030744 Ga0316181_1087847 Ga0316181_10878472 337
1133 3300031507 Ga0307509_10028275 Ga0307509_100282752 337
1134 3300031548 Ga0307408_100067274 Ga0307408_1000672741 337
1135 3300031548 Ga0307408_100144896 Ga0307408_1001448962 337
1136 3300031730 Ga0307516_10012577 Ga0307516_100125774 337
1137 3300031731 Ga0307405_10040009 Ga0307405_100400091 337
1138 3300031731 Ga0307405_10103236 Ga0307405_101032362 337
1139 3300031901 Ga0307406_10103468 Ga0307406_101034682 337
1140 3300031903 Ga0307407_10029880 Ga0307407_100298804 337
1141 3300031911 Ga0307412_10005057 Ga0307412_100050571 337
1142 3300031911 Ga0307412_10035887 Ga0307412_100358872 337
1143 3300033180 Ga0307510_10033836 Ga0307510_100338364 337
1144 3300033180 Ga0307510_10133691 Ga0307510_101336911 337
1145 3300037471 Ga0395905_0002046 Ga0395905_0002046_11723_12742 337
1146 3300039447 Ga0436361_0240489 Ga0436361_0240489_9925_10944 337
1147 3300039447 Ga0436361_0425566 Ga0436361_0425566_589_1608 337
1148 3300039447 Ga0436361_0833889 Ga0436361_0833889_29304_30323 337
1149 3300039447 Ga0436361_1213913 Ga0436361_1213913_3121_4140 337
1150 3300041404 Ga0439436_0012904 Ga0439436_0012904_393_1412 337
1151 3300041405 Ga0439438_000260 Ga0439438_000260_4585_5598 337
1152 3300041405 Ga0439438_002755 Ga0439438_002755_259_1272 337
1153 3300041405 Ga0439438_009547 Ga0439438_009547_641_1660 337
1154 3300041405 Ga0439438_013918 Ga0439438_013918_403_1416 337
1155 3300041405 Ga0439438_017657 Ga0439438_017657_641_1660 337
1156 3300041407 Ga0439447_002237 Ga0439447_002237_63_1079 337
1157 3300041407 Ga0439447_003570 Ga0439447_003570_506_1525 337
1158 3300041407 Ga0439447_033632 Ga0439447_033632_240_1259 337
1159 3300041411 Ga0439466_0002295 Ga0439466_0002295_323_1342 337
1160 3300041411 Ga0439466_0006090 Ga0439466_0006090_2855_3874 337
1161 3300041411 Ga0439466_0014319 Ga0439466_0014319_1793_2809 337
1162 3300041411 Ga0439466_0043490 Ga0439466_0043490_25_1044 337
1163 3300041411 Ga0439466_0059975 Ga0439466_0059975_123_1142 337
1164 3300042006 Ga0439432_009692 Ga0439432_009692_279_1298 337
1165 3300042006 Ga0439432_017432 Ga0439432_017432_1220_2239 337
1166 3300042006 Ga0439432_037860 Ga0439432_037860_123_1142 337
1167 3300042009 Ga0439451_032041 Ga0439451_032041_13_1032 337
1168 3300042010 Ga0439452_000466 Ga0439452_000466_3220_4242 337
1169 3300042010 Ga0439452_001219 Ga0439452_001219_494_1507 337
1170 3300042010 Ga0439452_013179 Ga0439452_013179_260_1273 337
1171 3300042010 Ga0439452_026250 Ga0439452_026250_192_1205 337
1172 3300042012 Ga0439455_0037678 Ga0439455_0037678_158_1177 337
1173 3300042013 Ga0439456_012706 Ga0439456_012706_384_1403 337
1174 3300042016 Ga0439463_001095 Ga0439463_001095_428_1441 337
1175 3300042016 Ga0439463_002529 Ga0439463_002529_867_1886 337
1176 3300042016 Ga0439463_026766 Ga0439463_026766_406_1425 337
1177 3300042115 Ga0450911_002773 Ga0450911_002773_159_1178 337
1178 3300042122 Ga0450920_005726 Ga0450920_005726_953_1969 337
1179 3300042125 Ga0450923_000518 Ga0450923_000518_3230_4246 337
1180 3300042127 Ga0450890_004468 Ga0450890_004468_59_1078 337
1181 3300042137 Ga0450902_002992 Ga0450902_002992_1123_2142 337
1182 3300042138 Ga0450903_003382 Ga0450903_003382_283_1302 337
1183 3300042139 Ga0450904_000292 Ga0450904_000292_8344_9363 337
1184 3300042145 Ga0450906_002200 Ga0450906_002200_154_1173 337
1185 3300042145 Ga0450906_008551 Ga0450906_008551_704_1717 337
1186 3300042146 Ga0450907_000474 Ga0450907_000474_9932_10945 337
1187 3300042146 Ga0450907_001315 Ga0450907_001315_2070_3083 337
1188 3300042146 Ga0450907_002672 Ga0450907_002672_181_1200 337
1189 3300042147 Ga0450910_015605 Ga0450910_015605_38_1057 337
1190 3300042156 Ga0439446_0024239 Ga0439446_0024239_441_1460 337
1191 3300042184 Ga0450908_000420 Ga0450908_000420_4683_5696 337
1192 3300042184 Ga0450908_016190 Ga0450908_016190_198_1211 337
1193 3300042185 Ga0450909_001625 Ga0450909_001625_1929_2948 337
1194 3300042185 Ga0450909_007499 Ga0450909_007499_99_1112 337
1195 3300042435 Ga0439434_0001138 Ga0439434_0001138_6166_7179 337
1196 3300042435 Ga0439434_0006633 Ga0439434_0006633_326_1345 337
1197 3300042461 Ga0439460_0004347 Ga0439460_0004347_464_1483 337
1198 3300042461 Ga0439460_0007043 Ga0439460_0007043_296_1309 337
1199 3300042461 Ga0439460_0008688 Ga0439460_0008688_228_1244 337
1200 3300042993 Ga0439440_0001079 Ga0439440_0001079_147_1163 337
1201 3300042993 Ga0439440_0037497 Ga0439440_0037497_48_1067 337
1202 3300046452 Ga0495617_003920 Ga0495617_003920_81_1097 337
1203 3300046452 Ga0495617_017261 Ga0495617_017261_149_1162 337
1204 3300046452 Ga0495617_019579 Ga0495617_019579_862_1881 337
1205 3300046453 Ga0495627_000160 Ga0495627_000160_58920_59942 337
1206 3300046453 Ga0495627_000205 Ga0495627_000205_30965_31984 337
1207 3300046453 Ga0495627_001078 Ga0495627_001078_6890_7909 337
1208 3300046453 Ga0495627_001605 Ga0495627_001605_10617_11636 337
1209 3300046453 Ga0495627_005084 Ga0495627_005084_1091_2113 337
1210 3300046453 Ga0495627_006733 Ga0495627_006733_1918_2937 337
1211 3300046453 Ga0495627_008072 Ga0495627_008072_504_1523 337
1212 3300046453 Ga0495627_035988 Ga0495627_035988_472_1485 337
1213 3300046455 Ga0495603_0031651 Ga0495603_0031651_257_1270 337
1214 3300046455 Ga0495603_0046225 Ga0495603_0046225_1006_2025 337
1215 3300046457 Ga0495590_0012315 Ga0495590_0012315_1717_2730 337
1216 3300046458 Ga0495591_000154 Ga0495591_000154_54428_55447 337
1217 3300046458 Ga0495591_000355 Ga0495591_000355_34841_35860 337
1218 3300046458 Ga0495591_001776 Ga0495591_001776_10266_11285 337
1219 3300046458 Ga0495591_002457 Ga0495591_002457_738_1757 337
1220 3300046458 Ga0495591_002570 Ga0495591_002570_7750_8865 337
1221 3300046458 Ga0495591_002795 Ga0495591_002795_8285_9310 337
1222 3300046458 Ga0495591_004738 Ga0495591_004738_3409_4428 337
1223 3300046460 Ga0495638_0029787 Ga0495638_0029787_2106_3128 337
1224 3300046460 Ga0495638_0061452 Ga0495638_0061452_465_1484 337
1225 3300046463 Ga0495653_0000817 Ga0495653_0000817_3222_4241 337
1226 3300046471 Ga0495650_0000095 Ga0495650_0000095_47626_48681 337
1227 3300046471 Ga0495650_0004869 Ga0495650_0004869_299_1318 337
1228 3300046471 Ga0495650_0043332 Ga0495650_0043332_724_1737 337
1229 3300046474 Ga0495605_0000002 Ga0495605_0000002_383741_384763 337
1230 3300046474 Ga0495605_0000006 Ga0495605_0000006_58558_59577 337
1231 3300046474 Ga0495605_0000020 Ga0495605_0000020_250854_251873 337
1232 3300046474 Ga0495605_0000075 Ga0495605_0000075_44210_45229 337
1233 3300046474 Ga0495605_0000088 Ga0495605_0000088_28136_29155 337
1234 3300046474 Ga0495605_0001180 Ga0495605_0001180_5929_6948 337
1235 3300046474 Ga0495605_0001383 Ga0495605_0001383_13697_14722 337
1236 3300046474 Ga0495605_0001394 Ga0495605_0001394_9680_10693 337
1237 3300046474 Ga0495605_0001431 Ga0495605_0001431_6370_7389 337
1238 3300046474 Ga0495605_0003071 Ga0495605_0003071_2276_3310 337
1239 3300046474 Ga0495605_0003260 Ga0495605_0003260_2905_3924 337
1240 3300046474 Ga0495605_0022111 Ga0495605_0022111_1899_2912 337
1241 3300046491 Ga0495584_0002347 Ga0495584_0002347_9364_10386 337
1242 3300046491 Ga0495584_0004571 Ga0495584_0004571_6104_7120 337
1243 3300046491 Ga0495584_0008609 Ga0495584_0008609_850_1869 337
1244 3300046491 Ga0495584_0010169 Ga0495584_0010169_2341_3360 337
1245 3300046491 Ga0495584_0013889 Ga0495584_0013889_2437_3456 337
1246 3300046491 Ga0495584_0025611 Ga0495584_0025611_1565_2584 337
1247 3300046491 Ga0495584_0027402 Ga0495584_0027402_1782_2807 337
1248 3300046491 Ga0495584_0033457 Ga0495584_0033457_1339_2355 337
1249 3300046491 Ga0495584_0081150 Ga0495584_0081150_172_1185 337
1250 3300046492 Ga0495585_0000073 Ga0495585_0000073_26931_27950 337
1251 3300046492 Ga0495585_0000541 Ga0495585_0000541_17766_18785 337
1252 3300046492 Ga0495585_0000614 Ga0495585_0000614_6096_7115 337
1253 3300046492 Ga0495585_0006640 Ga0495585_0006640_4188_5213 337
1254 3300046492 Ga0495585_0038490 Ga0495585_0038490_151_1164 337
1255 3300046492 Ga0495585_0113537 Ga0495585_0113537_218_1237 337
1256 3300046499 Ga0495594_0024423 Ga0495594_0024423_533_1552 337
1257 3300046499 Ga0495594_0141754 Ga0495594_0141754_231_1244 337
1258 3300046500 Ga0495596_0005757 Ga0495596_0005757_550_1575 337
1259 3300046500 Ga0495596_0031520 Ga0495596_0031520_866_1885 337
1260 3300046501 Ga0495607_0000051 Ga0495607_0000051_47701_48720 337
1261 3300046501 Ga0495607_0000053 Ga0495607_0000053_27470_28546 337
1262 3300046501 Ga0495607_0000106 Ga0495607_0000106_1437_2456 337
1263 3300046501 Ga0495607_0000246 Ga0495607_0000246_20523_21542 337
1264 3300046501 Ga0495607_0002670 Ga0495607_0002670_3197_4216 337
1265 3300046501 Ga0495607_0003041 Ga0495607_0003041_1386_2405 337
1266 3300046501 Ga0495607_0003589 Ga0495607_0003589_8490_9509 337
1267 3300046501 Ga0495607_0018555 Ga0495607_0018555_1345_2370 337
1268 3300046501 Ga0495607_0023229 Ga0495607_0023229_285_1304 337
1269 3300046501 Ga0495607_0050248 Ga0495607_0050248_945_1958 337
1270 3300046501 Ga0495607_0077173 Ga0495607_0077173_445_1464 337
1271 3300046506 Ga0495583_0000012 Ga0495583_0000012_37376_38398 337
1272 3300046506 Ga0495583_0000135 Ga0495583_0000135_28103_29122 337
1273 3300046506 Ga0495583_0000540 Ga0495583_0000540_25065_26084 337
1274 3300046506 Ga0495583_0000759 Ga0495583_0000759_33458_34477 337
1275 3300046506 Ga0495583_0001201 Ga0495583_0001201_6213_7232 337
1276 3300046506 Ga0495583_0002193 Ga0495583_0002193_7044_8066 337
1277 3300046506 Ga0495583_0004169 Ga0495583_0004169_1128_2147 337
1278 3300046506 Ga0495583_0004571 Ga0495583_0004571_8444_9469 337
1279 3300046506 Ga0495583_0006387 Ga0495583_0006387_6412_7428 337
1280 3300046507 Ga0495606_0000022 Ga0495606_0000022_44173_45192 337
1281 3300046507 Ga0495606_0000281 Ga0495606_0000281_77443_78462 337
1282 3300046507 Ga0495606_0000548 Ga0495606_0000548_51294_52319 337
1283 3300046507 Ga0495606_0000873 Ga0495606_0000873_19732_20751 337
1284 3300046507 Ga0495606_0002271 Ga0495606_0002271_21058_22077 337
1285 3300046507 Ga0495606_0003987 Ga0495606_0003987_9416_10450 337
1286 3300046507 Ga0495606_0011184 Ga0495606_0011184_515_1531 337
1287 3300046507 Ga0495606_0013257 Ga0495606_0013257_2242_3264 337
1288 3300046507 Ga0495606_0031458 Ga0495606_0031458_134_1153 337
1289 3300046512 Ga0495610_0007156 Ga0495610_0007156_487_1503 337
1290 3300046512 Ga0495610_0007673 Ga0495610_0007673_379_1392 337
1291 3300046512 Ga0495610_0009781 Ga0495610_0009781_3439_4458 337
1292 3300046512 Ga0495610_0023050 Ga0495610_0023050_918_1940 337
1293 3300046512 Ga0495610_0032047 Ga0495610_0032047_1310_2329 337
1294 3300046512 Ga0495610_0040498 Ga0495610_0040498_470_1495 337
1295 3300046513 Ga0495616_0001062 Ga0495616_0001062_3007_4026 337
1296 3300046513 Ga0495616_0003291 Ga0495616_0003291_5767_6789 337
1297 3300046513 Ga0495616_0006035 Ga0495616_0006035_6125_7144 337
1298 3300046513 Ga0495616_0014011 Ga0495616_0014011_1263_2318 337
1299 3300046513 Ga0495616_0040458 Ga0495616_0040458_165_1178 337
1300 3300046515 Ga0495620_0000026 Ga0495620_0000026_37617_38639 337
1301 3300046515 Ga0495620_0000034 Ga0495620_0000034_88901_89920 337
1302 3300046515 Ga0495620_0000069 Ga0495620_0000069_69090_70166 337
1303 3300046515 Ga0495620_0000103 Ga0495620_0000103_50960_51979 337
1304 3300046515 Ga0495620_0000684 Ga0495620_0000684_16458_17480 337
1305 3300046515 Ga0495620_0003741 Ga0495620_0003741_1601_2620 337
1306 3300046515 Ga0495620_0005400 Ga0495620_0005400_6063_7079 337
1307 3300046515 Ga0495620_0007169 Ga0495620_0007169_3313_4332 337
1308 3300046515 Ga0495620_0010484 Ga0495620_0010484_2569_3594 337
1309 3300046515 Ga0495620_0081334 Ga0495620_0081334_106_1125 337
1310 3300046517 Ga0495630_0111659 Ga0495630_0111659_188_1207 337
1311 3300046518 Ga0495631_0002264 Ga0495631_0002264_7501_8523 337
1312 3300046518 Ga0495631_0002378 Ga0495631_0002378_499_1518 337
1313 3300046518 Ga0495631_0002648 Ga0495631_0002648_1019_2059 337
1314 3300046518 Ga0495631_0051005 Ga0495631_0051005_554_1573 337
1315 3300046518 Ga0495631_0051529 Ga0495631_0051529_532_1566 337
1316 3300046518 Ga0495631_0076882 Ga0495631_0076882_377_1390 337
1317 3300046519 Ga0495632_0002433 Ga0495632_0002433_4530_5549 337
1318 3300046519 Ga0495632_0003021 Ga0495632_0003021_8204_9226 337
1319 3300046519 Ga0495632_0003477 Ga0495632_0003477_3405_4424 337
1320 3300046519 Ga0495632_0006787 Ga0495632_0006787_196_1209 337
1321 3300046519 Ga0495632_0010108 Ga0495632_0010108_1262_2281 337
1322 3300046519 Ga0495632_0081369 Ga0495632_0081369_292_1335 337
1323 3300046519 Ga0495632_0135167 Ga0495632_0135167_17_1033 337
1324 3300046520 Ga0495637_0000259 Ga0495637_0000259_2000_3019 337
1325 3300046520 Ga0495637_0000597 Ga0495637_0000597_9546_10568 337
1326 3300046520 Ga0495637_0001758 Ga0495637_0001758_8218_9240 337
1327 3300046520 Ga0495637_0004206 Ga0495637_0004206_3207_4373 337
1328 3300046520 Ga0495637_0006521 Ga0495637_0006521_2164_3183 337
1329 3300046520 Ga0495637_0016676 Ga0495637_0016676_1743_2762 337
1330 3300046520 Ga0495637_0020546 Ga0495637_0020546_531_1553 337
1331 3300046520 Ga0495637_0021054 Ga0495637_0021054_489_1508 337
1332 3300046520 Ga0495637_0022919 Ga0495637_0022919_1604_2620 337
1333 3300046520 Ga0495637_0033438 Ga0495637_0033438_432_1457 337
1334 3300046520 Ga0495637_0062444 Ga0495637_0062444_94_1119 337
1335 3300046520 Ga0495637_0065733 Ga0495637_0065733_408_1427 337
1336 3300046522 Ga0495643_0000087 Ga0495643_0000087_3322_4359 337
1337 3300046522 Ga0495643_0004536 Ga0495643_0004536_1319_2341 337
1338 3300046522 Ga0495643_0009802 Ga0495643_0009802_3067_4086 337
1339 3300046522 Ga0495643_0019548 Ga0495643_0019548_415_1434 337
1340 3300046522 Ga0495643_0099967 Ga0495643_0099967_399_1424 337
1341 3300046523 Ga0495644_0000104 Ga0495644_0000104_32180_33199 337
1342 3300046523 Ga0495644_0000883 Ga0495644_0000883_6476_7495 337
1343 3300046523 Ga0495644_0004321 Ga0495644_0004321_3483_4508 337
1344 3300046524 Ga0495648_0001459 Ga0495648_0001459_8092_9114 337
1345 3300046524 Ga0495648_0002635 Ga0495648_0002635_141_1163 337
1346 3300046524 Ga0495648_0007489 Ga0495648_0007489_451_1470 337
1347 3300046524 Ga0495648_0010081 Ga0495648_0010081_345_1370 337
1348 3300046524 Ga0495648_0013241 Ga0495648_0013241_4285_5304 337
1349 3300046524 Ga0495648_0014957 Ga0495648_0014957_1900_2919 337
1350 3300046524 Ga0495648_0015054 Ga0495648_0015054_4049_5065 337
1351 3300046524 Ga0495648_0017206 Ga0495648_0017206_620_1639 337
1352 3300046524 Ga0495648_0021905 Ga0495648_0021905_2907_3932 337
1353 3300046524 Ga0495648_0065726 Ga0495648_0065726_752_1771 337
1354 3300046524 Ga0495648_0067595 Ga0495648_0067595_805_1839 337
1355 3300046526 Ga0495666_0073390 Ga0495666_0073390_45_1064 337
1356 3300046528 Ga0495642_0000419 Ga0495642_0000419_18210_19229 337
1357 3300046528 Ga0495642_0000932 Ga0495642_0000932_3317_4330 337
1358 3300046528 Ga0495642_0002389 Ga0495642_0002389_6132_7145 337
1359 3300046529 Ga0495652_0015575 Ga0495652_0015575_5141_6160 337
1360 3300046530 Ga0495654_0000617 Ga0495654_0000617_22761_23783 337
1361 3300046530 Ga0495654_0001112 Ga0495654_0001112_15515_16534 337
1362 3300046530 Ga0495654_0002074 Ga0495654_0002074_8331_9353 337
1363 3300046530 Ga0495654_0002316 Ga0495654_0002316_917_1936 337
1364 3300046530 Ga0495654_0008623 Ga0495654_0008623_284_1306 337
1365 3300046530 Ga0495654_0013917 Ga0495654_0013917_1114_2133 337
1366 3300046530 Ga0495654_0019760 Ga0495654_0019760_1913_2935 337
1367 3300046530 Ga0495654_0023502 Ga0495654_0023502_182_1207 337
1368 3300046530 Ga0495654_0023534 Ga0495654_0023534_958_1977 337
1369 3300046530 Ga0495654_0034241 Ga0495654_0034241_427_1443 337
1370 3300046530 Ga0495654_0063705 Ga0495654_0063705_293_1306 337
1371 3300046536 Ga0495587_0004365 Ga0495587_0004365_2820_3839 337
1372 3300046538 Ga0495609_0000008 Ga0495609_0000008_344478_345500 337
1373 3300046538 Ga0495609_0000181 Ga0495609_0000181_13409_14434 337
1374 3300046538 Ga0495609_0000243 Ga0495609_0000243_9958_10977 337
1375 3300046538 Ga0495609_0000247 Ga0495609_0000247_22043_23062 337
1376 3300046538 Ga0495609_0000297 Ga0495609_0000297_3040_4059 337
1377 3300046538 Ga0495609_0001015 Ga0495609_0001015_6079_7098 337
1378 3300046538 Ga0495609_0007406 Ga0495609_0007406_3008_4123 337
1379 3300046538 Ga0495609_0021844 Ga0495609_0021844_1354_2367 337
1380 3300046542 Ga0495597_0000088 Ga0495597_0000088_69473_70492 337
1381 3300046542 Ga0495597_0000792 Ga0495597_0000792_12509_13522 337
1382 3300046542 Ga0495597_0002677 Ga0495597_0002677_852_1871 337
1383 3300046542 Ga0495597_0002842 Ga0495597_0002842_4728_5750 337
1384 3300046542 Ga0495597_0003282 Ga0495597_0003282_7152_8171 337
1385 3300046542 Ga0495597_0004749 Ga0495597_0004749_2331_3350 337
1386 3300046542 Ga0495597_0006680 Ga0495597_0006680_3141_4160 337
1387 3300046542 Ga0495597_0024191 Ga0495597_0024191_1365_2378 337
1388 3300046543 Ga0495645_0107535 Ga0495645_0107535_647_1666 337
1389 3300046543 Ga0495645_0150247 Ga0495645_0150247_506_1525 337
1390 3300046557 Ga0495622_0004281 Ga0495622_0004281_302_1315 337
1391 3300046557 Ga0495622_0011035 Ga0495622_0011035_774_1793 337
1392 3300046557 Ga0495622_0112900 Ga0495622_0112900_22_1035 337
1393 3300046558 Ga0495633_0000216 Ga0495633_0000216_22971_23993 337
1394 3300046558 Ga0495633_0000468 Ga0495633_0000468_27980_28999 337
1395 3300046558 Ga0495633_0000799 Ga0495633_0000799_4619_5662 337
1396 3300046558 Ga0495633_0002520 Ga0495633_0002520_8389_9444 337
1397 3300046558 Ga0495633_0009148 Ga0495633_0009148_1214_2233 337
1398 3300046558 Ga0495633_0009930 Ga0495633_0009930_500_1519 337
1399 3300046615 Ga0495656_0002550 Ga0495656_0002550_2893_3912 337
1400 3300046615 Ga0495656_0022666 Ga0495656_0022666_1376_2395 337
1401 3300046616 Ga0495668_0005450 Ga0495668_0005450_5732_6751 337
1402 3300046616 Ga0495668_0030465 Ga0495668_0030465_1467_2486 337
1403 3300046616 Ga0495668_0081713 Ga0495668_0081713_267_1292 337
1404 3300046616 Ga0495668_0118499 Ga0495668_0118499_113_1168 337
1405 3300046616 Ga0495668_0175909 Ga0495668_0175909_104_1117 337
1406 3300046642 Ga0495634_0007022 Ga0495634_0007022_1799_2818 337
1407 3300046648 Ga0495611_0000232 Ga0495611_0000232_18673_19692 337
1408 3300046648 Ga0495611_0000301 Ga0495611_0000301_4454_5479 337
1409 3300046648 Ga0495611_0001319 Ga0495611_0001319_3260_4282 337
1410 3300046648 Ga0495611_0007712 Ga0495611_0007712_493_1512 337
1411 3300046660 Ga0495625_0000004 Ga0495625_0000004_589820_590839 337
1412 3300046660 Ga0495625_0000007 Ga0495625_0000007_130489_131544 337
1413 3300046660 Ga0495625_0000163 Ga0495625_0000163_53222_54247 337
1414 3300046660 Ga0495625_0007573 Ga0495625_0007573_1485_2507 337
1415 3300046660 Ga0495625_0075878 Ga0495625_0075878_151_1164 337
1416 3300046660 Ga0495625_0076982 Ga0495625_0076982_1227_2249 337
1417 3300046660 Ga0495625_0088399 Ga0495625_0088399_776_1795 337
1418 3300046660 Ga0495625_0099574 Ga0495625_0099574_950_1966 337
1419 3300046664 Ga0495659_0004218 Ga0495659_0004218_2062_3081 337
1420 3300046664 Ga0495659_0020199 Ga0495659_0020199_688_1707 337
1421 3300046665 Ga0495661_0000006 Ga0495661_0000006_341069_342088 337
1422 3300046665 Ga0495661_0000010 Ga0495661_0000010_73701_74720 337
1423 3300046665 Ga0495661_0000078 Ga0495661_0000078_28033_29052 337
1424 3300046665 Ga0495661_0000096 Ga0495661_0000096_35162_36184 337
1425 3300046665 Ga0495661_0000675 Ga0495661_0000675_12517_13542 337
1426 3300046665 Ga0495661_0003086 Ga0495661_0003086_6285_7304 337
1427 3300046665 Ga0495661_0003225 Ga0495661_0003225_1778_2893 337
1428 3300046665 Ga0495661_0003454 Ga0495661_0003454_1291_2346 337
1429 3300046665 Ga0495661_0004673 Ga0495661_0004673_5350_6384 337
1430 3300046665 Ga0495661_0020284 Ga0495661_0020284_350_1369 337
1431 3300046665 Ga0495661_0021158 Ga0495661_0021158_2829_3848 337
1432 3300046674 Ga0495588_0013809 Ga0495588_0013809_524_1537 337
1433 3300046674 Ga0495588_0056669 Ga0495588_0056669_125_1141 337
1434 3300046680 Ga0495646_0027189 Ga0495646_0027189_765_1784 337
1435 3300046680 Ga0495646_0038675 Ga0495646_0038675_1881_2900 337
1436 3300046684 Ga0495669_0000311 Ga0495669_0000311_20138_21157 337
1437 3300046684 Ga0495669_0004788 Ga0495669_0004788_4080_5093 337
1438 3300046691 Ga0495670_0001854 Ga0495670_0001854_9286_10305 337
1439 3300046691 Ga0495670_0003557 Ga0495670_0003557_6453_7469 337
1440 3300046691 Ga0495670_0006909 Ga0495670_0006909_2876_3898 337
1441 3300046691 Ga0495670_0022774 Ga0495670_0022774_606_1625 337
1442 3300046691 Ga0495670_0062033 Ga0495670_0062033_711_1730 337
1443 3300046691 Ga0495670_0093917 Ga0495670_0093917_356_1372 337
1444 3300046691 Ga0495670_0100720 Ga0495670_0100720_63_1082 337
1445 3300046691 Ga0495670_0135055 Ga0495670_0135055_29_1042 337
1446 3300046692 Ga0495671_0002683 Ga0495671_0002683_469_1491 337
1447 3300046692 Ga0495671_0003049 Ga0495671_0003049_503_1528 337
1448 3300046692 Ga0495671_0006370 Ga0495671_0006370_590_1609 337
1449 3300046692 Ga0495671_0008535 Ga0495671_0008535_886_1905 337
1450 3300046692 Ga0495671_0014722 Ga0495671_0014722_2222_3244 337
1451 3300046692 Ga0495671_0027654 Ga0495671_0027654_1319_2341 337
1452 3300046692 Ga0495671_0151847 Ga0495671_0151847_22_1035 337
1453 3300046694 Ga0495649_0000007 Ga0495649_0000007_303872_304927 337
1454 3300046694 Ga0495649_0010572 Ga0495649_0010572_1624_2643 337
1455 3300046694 Ga0495649_0029184 Ga0495649_0029184_238_1254 337
1456 3300046694 Ga0495649_0064230 Ga0495649_0064230_297_1313 337
1457 3300046694 Ga0495649_0104959 Ga0495649_0104959_454_1467 337
1458 3300046794 Ga0495589_0000492 Ga0495589_0000492_14622_15644 337
1459 3300046794 Ga0495589_0000534 Ga0495589_0000534_20241_21260 337
1460 3300046794 Ga0495589_0002808 Ga0495589_0002808_3618_4733 337
1461 3300046794 Ga0495589_0003770 Ga0495589_0003770_373_1389 337
1462 3300046794 Ga0495589_0004256 Ga0495589_0004256_830_1849 337
1463 3300046794 Ga0495589_0035203 Ga0495589_0035203_162_1175 337
1464 3300046794 Ga0495589_0040670 Ga0495589_0040670_197_1210 337
1465 3300046794 Ga0495589_0057106 Ga0495589_0057106_358_1377 337
1466 3300046810 Ga0495660_0001619 Ga0495660_0001619_13692_14711 337
1467 3300046810 Ga0495660_0007409 Ga0495660_0007409_2827_3846 337
1468 3300046810 Ga0495660_0007647 Ga0495660_0007647_3321_4343 337
1469 3300046810 Ga0495660_0012585 Ga0495660_0012585_428_1447 337
1470 3300046810 Ga0495660_0016334 Ga0495660_0016334_356_1378 337
1471 3300046810 Ga0495660_0018440 Ga0495660_0018440_2360_3379 337
1472 3300046810 Ga0495660_0024163 Ga0495660_0024163_842_1861 337
1473 3300046810 Ga0495660_0074913 Ga0495660_0074913_247_1272 337
1474 3300047317 Ga0495604_0008714 Ga0495604_0008714_5786_6805 337
1475 3300047320 Ga0495672_0001105 Ga0495672_0001105_24406_25425 337
1476 3300047320 Ga0495672_0003042 Ga0495672_0003042_12699_13739 337
1477 3300047320 Ga0495672_0003088 Ga0495672_0003088_3860_4873 337
1478 3300047320 Ga0495672_0004293 Ga0495672_0004293_3426_4445 337
1479 3300047320 Ga0495672_0007742 Ga0495672_0007742_6619_7632 337
1480 3300047320 Ga0495672_0009467 Ga0495672_0009467_54_1070 337
1481 3300047320 Ga0495672_0024315 Ga0495672_0024315_1136_2155 337
1482 3300047320 Ga0495672_0029214 Ga0495672_0029214_808_1833 337
1483 3300047320 Ga0495672_0059321 Ga0495672_0059321_1051_2064 337
1484 3300047320 Ga0495672_0080224 Ga0495672_0080224_558_1574 337
1485 3300047321 Ga0495676_0000074 Ga0495676_0000074_51927_52952 337
1486 3300047321 Ga0495676_0000078 Ga0495676_0000078_60818_61837 337
1487 3300047321 Ga0495676_0043106 Ga0495676_0043106_2154_3173 337
1488 3300047322 Ga0495680_0014820 Ga0495680_0014820_5678_6697 337
1489 3300047323 Ga0495683_0000114 Ga0495683_0000114_43664_44683 337
1490 3300047323 Ga0495683_0000169 Ga0495683_0000169_24967_25989 337
1491 3300047323 Ga0495683_0000409 Ga0495683_0000409_5394_6413 337
1492 3300047323 Ga0495683_0000710 Ga0495683_0000710_19769_20788 337
1493 3300047323 Ga0495683_0001939 Ga0495683_0001939_11356_12372 337
1494 3300047323 Ga0495683_0002388 Ga0495683_0002388_9947_10966 337
1495 3300047323 Ga0495683_0015807 Ga0495683_0015807_236_1255 337
1496 3300047323 Ga0495683_0018387 Ga0495683_0018387_2441_3460 337
1497 3300047323 Ga0495683_0043316 Ga0495683_0043316_165_1184 337
1498 3300047443 Ga0495687_003868 Ga0495687_003868_9321_10337 337
1499 3300047443 Ga0495687_006108 Ga0495687_006108_5889_6905 337
1500 3300047443 Ga0495687_022994 Ga0495687_022994_1543_2565 337
1501 3300047445 Ga0495677_0000389 Ga0495677_0000389_5649_6668 337
1502 3300047446 Ga0495679_000015 Ga0495679_000015_10766_11785 337
1503 3300047446 Ga0495679_000185 Ga0495679_000185_33685_34710 337
1504 3300047446 Ga0495679_000200 Ga0495679_000200_16298_17320 337
1505 3300047446 Ga0495679_000417 Ga0495679_000417_27977_28996 337
1506 3300047446 Ga0495679_002083 Ga0495679_002083_4075_5094 337
1507 3300047446 Ga0495679_002364 Ga0495679_002364_5433_6467 337
1508 3300047446 Ga0495679_018095 Ga0495679_018095_602_1621 337
1509 3300047469 Ga0495673_0000292 Ga0495673_0000292_16700_17719 337
1510 3300047469 Ga0495673_0000480 Ga0495673_0000480_30125_31144 337
1511 3300047469 Ga0495673_0001334 Ga0495673_0001334_266_1285 337
1512 3300047469 Ga0495673_0005502 Ga0495673_0005502_6288_7304 337
1513 3300047469 Ga0495673_0006408 Ga0495673_0006408_157_1179 337
1514 3300047469 Ga0495673_0016376 Ga0495673_0016376_2104_3123 337
1515 3300047469 Ga0495673_0016459 Ga0495673_0016459_1350_2465 337
1516 3300047469 Ga0495673_0016704 Ga0495673_0016704_976_1995 337
1517 3300047469 Ga0495673_0019142 Ga0495673_0019142_1478_2500 337
1518 3300047469 Ga0495673_0027689 Ga0495673_0027689_1585_2604 337
1519 3300047469 Ga0495673_0056811 Ga0495673_0056811_625_1644 337
1520 3300047469 Ga0495673_0057113 Ga0495673_0057113_76_1095 337
1521 3300047469 Ga0495673_0077363 Ga0495673_0077363_255_1268 337
1522 3300047469 Ga0495673_0079904 Ga0495673_0079904_182_1207 337
1523 3300047469 Ga0495673_0081472 Ga0495673_0081472_233_1288 337
1524 3300047470 Ga0495681_0000547 Ga0495681_0000547_7968_8987 337
1525 3300047470 Ga0495681_0003413 Ga0495681_0003413_9759_10778 337
1526 3300047470 Ga0495681_0004559 Ga0495681_0004559_8125_9141 337
1527 3300047470 Ga0495681_0005565 Ga0495681_0005565_961_1980 337
1528 3300047470 Ga0495681_0005919 Ga0495681_0005919_6264_7280 337
1529 3300047470 Ga0495681_0006331 Ga0495681_0006331_5207_6232 337
1530 3300047470 Ga0495681_0007911 Ga0495681_0007911_314_1330 337
1531 3300047470 Ga0495681_0019486 Ga0495681_0019486_392_1414 337
1532 3300047470 Ga0495681_0024886 Ga0495681_0024886_492_1508 337
1533 3300047470 Ga0495681_0059734 Ga0495681_0059734_257_1276 337
1534 3300047472 Ga0495686_0000034 Ga0495686_0000034_292373_293416 337
1535 3300047472 Ga0495686_0000196 Ga0495686_0000196_94165_95265 337
1536 3300047472 Ga0495686_0008547 Ga0495686_0008547_6090_7106 337
1537 3300047472 Ga0495686_0045034 Ga0495686_0045034_759_1784 337
1538 3300047472 Ga0495686_0112412 Ga0495686_0112412_462_1517 337
1539 3300048091 Ga0495626_0000117 Ga0495626_0000117_49904_50929 337
1540 3300048091 Ga0495626_0000201 Ga0495626_0000201_4612_5631 337
1541 3300048091 Ga0495626_0003517 Ga0495626_0003517_8516_9532 337
1542 3300048091 Ga0495626_0005760 Ga0495626_0005760_65_1081 337
1543 3300048091 Ga0495626_0005789 Ga0495626_0005789_2325_3347 337
1544 3300048091 Ga0495626_0009432 Ga0495626_0009432_1286_2305 337
1545 3300048903 Ga0496100_0114207 Ga0496100_0114207_309_1328 337
1546 3300048903 Ga0496100_0219079 Ga0496100_0219079_351_1370 337
1547 3300048905 Ga0496102_0040080 Ga0496102_0040080_1856_2875 337
1548 3300048905 Ga0496102_0077073 Ga0496102_0077073_534_1553 337
1549 3300048906 Ga0496103_0004271 Ga0496103_0004271_5908_6927 337
1550 3300048907 Ga0496104_0037290 Ga0496104_0037290_324_1343 337
1551 3300048908 Ga0496105_0178061 Ga0496105_0178061_690_1709 337
1552 3300048913 Ga0496110_0182584 Ga0496110_0182584_601_1620 337
1553 3300048915 Ga0496112_0327574 Ga0496112_0327574_259_1278 337
1554 3300048917 Ga0496114_0004381 Ga0496114_0004381_9439_10458 337
1555 3300048918 Ga0496115_0007157 Ga0496115_0007157_4775_5794 337
1556 3300048918 Ga0496115_0008182 Ga0496115_0008182_5368_6387 337
1557 3300048919 Ga0496116_0008919 Ga0496116_0008919_3575_4597 337
1558 3300048920 Ga0496117_0006891 Ga0496117_0006891_7339_8358 337
1559 3300048920 Ga0496117_0010449 Ga0496117_0010449_1842_2861 337
1560 3300048920 Ga0496117_0070960 Ga0496117_0070960_685_1722 337
1561 3300048920 Ga0496117_0175623 Ga0496117_0175623_144_1163 337
1562 3300048921 Ga0496118_0001819 Ga0496118_0001819_22888_23907 337
1563 3300048921 Ga0496118_0009431 Ga0496118_0009431_115_1152 337
1564 3300048921 Ga0496118_0102858 Ga0496118_0102858_173_1192 337
1565 3300048921 Ga0496118_0183295 Ga0496118_0183295_142_1167 337
1566 3300048922 Ga0496119_0000068 Ga0496119_0000068_90014_91036 337
1567 3300048923 Ga0496120_0000194 Ga0496120_0000194_67713_68735 337
1568 3300048924 Ga0496121_0001505 Ga0496121_0001505_11659_12678 337
1569 3300048924 Ga0496121_0002437 Ga0496121_0002437_8848_9867 337
1570 3300048924 Ga0496121_0017252 Ga0496121_0017252_5517_6536 337
1571 3300048924 Ga0496121_0068402 Ga0496121_0068402_809_1828 337
1572 3300048924 Ga0496121_0101561 Ga0496121_0101561_501_1526 337
1573 3300048925 Ga0496122_0000175 Ga0496122_0000175_105347_106366 337
1574 3300048925 Ga0496122_0005202 Ga0496122_0005202_502_1527 337
1575 3300048925 Ga0496122_0010688 Ga0496122_0010688_5966_7003 337
1576 3300048925 Ga0496122_0019513 Ga0496122_0019513_3288_4307 337
1577 3300048925 Ga0496122_0029267 Ga0496122_0029267_936_1955 337
1578 3300048925 Ga0496122_0049102 Ga0496122_0049102_107_1129 337
1579 3300048926 Ga0496123_0000079 Ga0496123_0000079_46944_47963 337
1580 3300048926 Ga0496123_0004048 Ga0496123_0004048_533_1558 337
1581 3300048926 Ga0496123_0010272 Ga0496123_0010272_5960_6997 337
1582 3300048926 Ga0496123_0011568 Ga0496123_0011568_3351_4370 337
1583 3300048926 Ga0496123_0026255 Ga0496123_0026255_1391_2410 337
1584 3300048926 Ga0496123_0037243 Ga0496123_0037243_107_1129 337
1585 3300048926 Ga0496123_0096928 Ga0496123_0096928_488_1507 337
1586 3300048927 Ga0496124_0000658 Ga0496124_0000658_40789_41808 337
1587 3300048927 Ga0496124_0000669 Ga0496124_0000669_1753_2772 337
1588 3300048927 Ga0496124_0005226 Ga0496124_0005226_5028_6047 337
1589 3300048927 Ga0496124_0016504 Ga0496124_0016504_1699_2736 337
1590 3300048927 Ga0496124_0017105 Ga0496124_0017105_4172_5197 337
1591 3300048927 Ga0496124_0027395 Ga0496124_0027395_3638_4660 337
1592 3300048927 Ga0496124_0153819 Ga0496124_0153819_561_1580 337
1593 3300048928 Ga0496125_0000893 Ga0496125_0000893_22817_23836 337
1594 3300048928 Ga0496125_0009254 Ga0496125_0009254_3966_4985 337
1595 3300048928 Ga0496125_0009526 Ga0496125_0009526_5635_6654 337
1596 3300048928 Ga0496125_0061912 Ga0496125_0061912_1726_2763 337
1597 3300048929 Ga0496126_0063498 Ga0496126_0063498_1487_2506 337
1598 3300049459 Ga0495678_000081 Ga0495678_000081_27854_28873 337
1599 3300049459 Ga0495678_000242 Ga0495678_000242_22871_23893 337
1600 3300049459 Ga0495678_001125 Ga0495678_001125_2398_3417 337
1601 3300049459 Ga0495678_004528 Ga0495678_004528_2889_3911 337
1602 3300049459 Ga0495678_004551 Ga0495678_004551_928_1953 337
1603 3300049459 Ga0495678_004874 Ga0495678_004874_6312_7334 337
1604 3300049459 Ga0495678_011160 Ga0495678_011160_2322_3341 337
1605 3300049459 Ga0495678_027010 Ga0495678_027010_1204_2217 337
1606 3300049460 Ga0495682_0000014 Ga0495682_0000014_98824_99843 337
1607 3300049460 Ga0495682_0000954 Ga0495682_0000954_64_1083 337
1608 3300049460 Ga0495682_0000982 Ga0495682_0000982_401_1420 337
1609 3300049571 Ga0501034_0000158 Ga0501034_0000158_118631_119650 337
1610 3300049574 Ga0501038_0167089 Ga0501038_0167089_240_1259 337
1611 3300049853 Ga0501226_000079 Ga0501226_000079_17083_18102 337
1612 3300053090 Ga0500646_0003915 Ga0500646_0003915_863_1906 337
1613 3300053092 Ga0500583_0043898 Ga0500583_0043898_730_1773 337
1614 3300053125 Ga0500618_000376 Ga0500618_000376_23445_24464 337
1615 3300053125 Ga0500618_005261 Ga0500618_005261_2716_3735 337
1616 3300053125 Ga0500618_010474 Ga0500618_010474_1160_2182 337
1617 3300053134 Ga0500658_0007635 Ga0500658_0007635_2642_3685 337
1618 3300053135 Ga0500659_0008883 Ga0500659_0008883_130_1149 337
1619 3300053142 Ga0500577_0002952 Ga0500577_0002952_742_1785 337
1620 3300053142 Ga0500577_0070454 Ga0500577_0070454_316_1335 337
1621 3300053153 Ga0500616_0016488 Ga0500616_0016488_2564_3607 337
1622 3300053161 Ga0500634_0001458 Ga0500634_0001458_4845_5879 337

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07859

Abhydrolase_3

alpha/beta hydrolase fold

144

353

0.97

PF20434

BD-FAE

BD-FAE

129

279

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ou4-assembly1.cif.gz_A-2 crystal structure of esterase rppe mutant s159a complexed with (s)-ac-cpa 0.9949 24 337
4ob8-assembly1.cif.gz_A-2 crystal structure of a novel thermostable esterase from pseudomonas putida ecu1011 0.994 24 337
4ob7-assembly1.cif.gz_A-2 crystal structure of esterase rppe mutant w187h 0.9936 24 337
4ou5-assembly1.cif.gz_A crystal structure of esterase rppe mutant s159a/w187h 0.9931 24 337
4v2i-assembly1.cif.gz_B biochemical characterization and structural analysis of a new cold- active and salt tolerant esterase from the marine bacterium thalassospira sp 0.9792 26 336
ID Description Score Start End Superfamily
4ob8A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.994 24 337 3.40.50.1820
4v2iB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9792 26 336 3.40.50.1820
4ob8A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9754 24 337 3.40.50.1820
4v2iB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9639 26 336 3.40.50.1820
af_Q54L36_11_325_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.959 30 337 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A136QGY0-F1-model_v4 deleted 1.002 156 337
AF-A0A2V6RND3-F1-model_v4 Alpha/beta hydrolase fold-3 domain-containing protein 0.9992 246 336 GO:0016787
AF-A0A0D5BJU0-F1-model_v4 deleted 0.9989 103 336
AF-A0A0E4HBS2-F1-model_v4 Alpha/beta hydrolase 0.9988 187 334 GO:0016787
AF-A0A4U9HKL8-F1-model_v4 Lipase 2 (EC 3.1.1.3) 0.9983 198 337 GO:0004806

Feature Viewer

pLDDT pTM Quality
92.72 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map