F495062
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1614 | 505 | 3228 | 68 |
Family's Representative Sequence
| Representative Sequence | 3300005329|Ga0070683_101207937|Ga0070683_1012079371 |
| Length | 73 |
| Sequence | MLGFVALVYASVKDTPVVHAGKAINIFGSMIQAVARQPELKGELTGIQWLGFALTEAVVFYGLIGGLLAYVLV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 2 | 3300000652 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA | Metagenome | Rhizosphere |
| 3 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 4 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 5 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 6 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 7 | 3300005277 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 11 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 14 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 16 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 18 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 31 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 45 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 46 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 52 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 55 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 57 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 62 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 63 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 65 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 66 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 67 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 69 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 70 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 71 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 72 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 73 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 74 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 75 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 76 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 77 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 78 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 79 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 80 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 81 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 82 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 84 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 85 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 86 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 87 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 88 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 89 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 90 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 91 | 3300006194 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Metagenome | Rhizosphere |
| 92 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 93 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 94 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 95 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 96 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 97 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 98 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 99 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 100 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 102 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300012480 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.yng.040610 | Metagenome | Rhizosphere |
| 118 | 3300012481 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.1.yng.040610 | Metagenome | Rhizosphere |
| 119 | 3300012483 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610 | Metagenome | Rhizosphere |
| 120 | 3300012508 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 | Metagenome | Rhizosphere |
| 121 | 3300012515 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 | Metagenome | Rhizosphere |
| 122 | 3300013062 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 123 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 135 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 139 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 140 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 142 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 143 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 144 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 145 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 146 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 147 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 148 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 208 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 209 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 213 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 214 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 215 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 216 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 217 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 218 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 219 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 220 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 221 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 222 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 223 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 224 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 225 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 226 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 227 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 228 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 229 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 230 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 231 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 232 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 233 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 234 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 235 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 236 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 237 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 238 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 239 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 240 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 241 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 242 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 243 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 244 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 245 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 246 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 247 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 248 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 249 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 250 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 251 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 252 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 253 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 254 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 255 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 256 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 257 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 258 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 259 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 260 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 261 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 262 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 263 | 3300042000 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 | Metagenome | Rhizosphere |
| 264 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 265 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 266 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 267 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 268 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 269 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 270 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 271 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 272 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 273 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 274 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 275 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 276 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 277 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 278 | 3300042118 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 | Metagenome | Rhizosphere |
| 279 | 3300042119 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218L_E14_082316_1902 | Metagenome | Rhizosphere |
| 280 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 281 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 282 | 3300042126 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 | Metagenome | Rhizosphere |
| 283 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 284 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 285 | 3300042136 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 | Metagenome | Rhizosphere |
| 286 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 287 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 288 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 289 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 290 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 291 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 292 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 293 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 294 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 295 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 296 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 297 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 298 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 299 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 300 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 301 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 302 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 303 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 304 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 305 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 306 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 307 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 308 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 309 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 310 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 311 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 312 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 313 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 314 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 315 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 316 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 317 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 398 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 399 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 400 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 401 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 402 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 403 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 404 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 405 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 406 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 407 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 408 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 409 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 410 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 411 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 412 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 413 | 3300049129 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 414 | 3300049162 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 415 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 416 | 3300049527 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 417 | 3300049529 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 418 | 3300049532 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 419 | 3300049533 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 420 | 3300049537 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 421 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 422 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 423 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 424 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 425 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 426 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 427 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 428 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 429 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 430 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 431 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 432 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 433 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 434 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 435 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 436 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 437 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 438 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 439 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 440 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 441 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 442 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 443 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 444 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 445 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 446 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 447 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 448 | 3300049656 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought | Metagenome | Rhizosphere |
| 449 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 450 | 3300049680 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought | Metagenome | Rhizosphere |
| 451 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 452 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 453 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 454 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 455 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 456 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 457 | 3300049757 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control | Metagenome | Rhizosphere |
| 458 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 459 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 460 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 461 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 462 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 463 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 464 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 465 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 466 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 467 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 468 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 469 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 470 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 471 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 472 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 473 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 474 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 475 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 476 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 477 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 478 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 479 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 480 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 481 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 482 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 483 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 484 | 3300059423 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 485 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 486 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 487 | 3300059477 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 488 | 3300059490 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 489 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 490 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 491 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 492 | 3300059503 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 493 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 494 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 495 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 496 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 497 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 498 | 3300059640 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 499 | 3300059641 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 500 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 501 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 502 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 503 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 504 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 505 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.52 |
| Metatranscriptomes | 2.48 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.12 |
| Nodule | 0 |
| Rhizoplane | 3.84 |
| Rhizosphere | 94.67 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.04 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070683_101207937 | 3300005329 | Bacteria | 727 |
| 2 | ARCol0yngRDRAFT_1001060 | 3300000652 | Bacteria | 2387 |
| 3 | JGI24738J21930_10030244 | 3300002075 | Bacteria | 1106 |
| 4 | JGI25406J46586_10011774 | 3300003203 | Unclassified | 3819 |
| 5 | JGI25407J50210_10000553 | 3300003373 | Bacteria | 7544 |
| 6 | JGI25407J50210_10003527 | 3300003373 | Bacteria | 3756 |
| 7 | JGI25407J50210_10005891 | 3300003373 | Bacteria | 3031 |
| 8 | JGI25407J50210_10019566 | 3300003373 | Bacteria | 1760 |
| 9 | JGI25407J50210_10028789 | 3300003373 | Bacteria | 1441 |
| 10 | Ga0058860_11993703 | 3300004801 | Bacteria | 641 |
| 11 | Ga0065716_1005683 | 3300005277 | Bacteria | 860 |
| 12 | Ga0070658_10837135 | 3300005327 | Bacteria | 800 |
| 13 | Ga0070658_11102006 | 3300005327 | Bacteria | 691 |
| 14 | Ga0070658_11281839 | 3300005327 | Bacteria | 636 |
| 15 | Ga0070658_11692384 | 3300005327 | Bacteria | 548 |
| 16 | Ga0070676_10097544 | 3300005328 | Bacteria | 1810 |
| 17 | Ga0070676_10608933 | 3300005328 | Bacteria | 788 |
| 18 | Ga0070683_100005414 | 3300005329 | Bacteria | 10657 |
| 19 | Ga0070683_100100898 | 3300005329 | Bacteria | 2717 |
| 20 | Ga0070683_100106748 | 3300005329 | Bacteria | 2640 |
| 21 | Ga0070683_100188623 | 3300005329 | Bacteria | 1957 |
| 22 | Ga0070683_100511463 | 3300005329 | Bacteria | 1147 |
| 23 | Ga0070683_100807252 | 3300005329 | Bacteria | 899 |
| 24 | Ga0070683_101981896 | 3300005329 | Bacteria | 560 |
| 25 | Ga0070690_100285495 | 3300005330 | Bacteria | 1179 |
| 26 | Ga0070670_100046088 | 3300005331 | Bacteria | 3748 |
| 27 | Ga0070670_100508715 | 3300005331 | Bacteria | 1072 |
| 28 | Ga0070677_10543811 | 3300005333 | Bacteria | 636 |
| 29 | Ga0068869_100060514 | 3300005334 | Bacteria | 2775 |
| 30 | Ga0068869_100851264 | 3300005334 | Bacteria | 787 |
| 31 | Ga0068869_100907922 | 3300005334 | Bacteria | 762 |
| 32 | Ga0070666_10486505 | 3300005335 | Bacteria | 894 |
| 33 | Ga0070680_100015754 | 3300005336 | Bacteria | 5936 |
| 34 | Ga0070680_100034133 | 3300005336 | Bacteria | 4102 |
| 35 | Ga0070680_100054321 | 3300005336 | Bacteria | 3270 |
| 36 | Ga0070680_100097987 | 3300005336 | Bacteria | 2431 |
| 37 | Ga0070680_100145337 | 3300005336 | Bacteria | 1989 |
| 38 | Ga0070682_100022269 | 3300005337 | Bacteria | 3751 |
| 39 | Ga0070682_100027027 | 3300005337 | Unclassified | 3440 |
| 40 | Ga0070682_100041884 | 3300005337 | Bacteria | 2824 |
| 41 | Ga0070682_100244232 | 3300005337 | Bacteria | 1291 |
| 42 | Ga0068868_100178731 | 3300005338 | Bacteria | 1759 |
| 43 | Ga0068868_100618124 | 3300005338 | Bacteria | 962 |
| 44 | Ga0070660_100031833 | 3300005339 | Bacteria | 3965 |
| 45 | Ga0070660_100098992 | 3300005339 | Bacteria | 2309 |
| 46 | Ga0070660_100193179 | 3300005339 | Bacteria | 1649 |
| 47 | Ga0070660_100633915 | 3300005339 | Bacteria | 895 |
| 48 | Ga0070660_100862620 | 3300005339 | Bacteria | 763 |
| 49 | Ga0070660_101054173 | 3300005339 | Bacteria | 688 |
| 50 | Ga0070660_101588444 | 3300005339 | Bacteria | 556 |
| 51 | Ga0070689_101616428 | 3300005340 | Bacteria | 589 |
| 52 | Ga0070691_10006550 | 3300005341 | Bacteria | 5326 |
| 53 | Ga0070691_10126178 | 3300005341 | Bacteria | 1293 |
| 54 | Ga0070687_100438755 | 3300005343 | Bacteria | 866 |
| 55 | Ga0070661_100045876 | 3300005344 | Bacteria | 3195 |
| 56 | Ga0070661_100385297 | 3300005344 | Bacteria | 1106 |
| 57 | Ga0070661_100597897 | 3300005344 | Bacteria | 892 |
| 58 | Ga0070692_10032201 | 3300005345 | Bacteria | 2634 |
| 59 | Ga0070692_10077485 | 3300005345 | Bacteria | 1783 |
| 60 | Ga0070692_10100609 | 3300005345 | Bacteria | 1584 |
| 61 | Ga0070692_10607410 | 3300005345 | Bacteria | 724 |
| 62 | Ga0070668_100677812 | 3300005347 | Bacteria | 908 |
| 63 | Ga0070668_101585021 | 3300005347 | Bacteria | 600 |
| 64 | Ga0070669_100297287 | 3300005353 | Bacteria | 1298 |
| 65 | Ga0070669_100696287 | 3300005353 | Bacteria | 858 |
| 66 | Ga0070669_100890765 | 3300005353 | Bacteria | 760 |
| 67 | Ga0070675_100128487 | 3300005354 | Bacteria | 2158 |
| 68 | Ga0070675_100286654 | 3300005354 | Bacteria | 1448 |
| 69 | Ga0070675_100567293 | 3300005354 | Bacteria | 1027 |
| 70 | Ga0070675_101443228 | 3300005354 | Bacteria | 635 |
| 71 | Ga0070675_101633280 | 3300005354 | Bacteria | 595 |
| 72 | Ga0070671_100132215 | 3300005355 | Bacteria | 2102 |
| 73 | Ga0070674_100097268 | 3300005356 | Bacteria | 2138 |
| 74 | Ga0070674_100117126 | 3300005356 | Bacteria | 1966 |
| 75 | Ga0070674_100287540 | 3300005356 | Bacteria | 1306 |
| 76 | Ga0070674_101286340 | 3300005356 | Bacteria | 652 |
| 77 | Ga0070673_100501683 | 3300005364 | Bacteria | 1098 |
| 78 | Ga0070673_101336151 | 3300005364 | Bacteria | 674 |
| 79 | Ga0070688_101191534 | 3300005365 | Bacteria | 612 |
| 80 | Ga0070659_100034611 | 3300005366 | Bacteria | 3930 |
| 81 | Ga0070659_100436033 | 3300005366 | Bacteria | 1109 |
| 82 | Ga0070659_100559489 | 3300005366 | Bacteria | 980 |
| 83 | Ga0070709_10320854 | 3300005434 | Unclassified | 1137 |
| 84 | Ga0070709_11179855 | 3300005434 | Bacteria | 615 |
| 85 | Ga0070714_100015334 | 3300005435 | Bacteria | 6166 |
| 86 | Ga0070714_100430135 | 3300005435 | Bacteria | 1251 |
| 87 | Ga0070713_101177697 | 3300005436 | Bacteria | 742 |
| 88 | Ga0070701_10231684 | 3300005438 | Bacteria | 1106 |
| 89 | Ga0070711_101432366 | 3300005439 | Bacteria | 602 |
| 90 | Ga0070705_100107071 | 3300005440 | Bacteria | 1778 |
| 91 | Ga0070705_100336368 | 3300005440 | Bacteria | 1096 |
| 92 | Ga0070700_100072761 | 3300005441 | Bacteria | 2198 |
| 93 | Ga0070700_100135725 | 3300005441 | Bacteria | 1666 |
| 94 | Ga0070700_101340993 | 3300005441 | Bacteria | 603 |
| 95 | Ga0070694_100109330 | 3300005444 | Bacteria | 1967 |
| 96 | Ga0070694_100127724 | 3300005444 | Unclassified | 1832 |
| 97 | Ga0070694_100297529 | 3300005444 | Bacteria | 1235 |
| 98 | Ga0070708_100160220 | 3300005445 | Bacteria | 2097 |
| 99 | Ga0070708_101519709 | 3300005445 | Bacteria | 624 |
| 100 | Ga0070663_100989674 | 3300005455 | Bacteria | 731 |
| 101 | Ga0070663_101012701 | 3300005455 | Bacteria | 723 |
| 102 | Ga0070663_101185120 | 3300005455 | Bacteria | 671 |
| 103 | Ga0070663_101211323 | 3300005455 | Bacteria | 664 |
| 104 | Ga0070663_101908135 | 3300005455 | Bacteria | 534 |
| 105 | Ga0070678_100020088 | 3300005456 | Bacteria | 4375 |
| 106 | Ga0070678_100500555 | 3300005456 | Bacteria | 1072 |
| 107 | Ga0070678_100640532 | 3300005456 | Bacteria | 952 |
| 108 | Ga0070678_101924475 | 3300005456 | Bacteria | 559 |
| 109 | Ga0070662_100098582 | 3300005457 | Bacteria | 2208 |
| 110 | Ga0070662_100166324 | 3300005457 | Bacteria | 1729 |
| 111 | Ga0070662_101094012 | 3300005457 | Bacteria | 684 |
| 112 | Ga0070681_10018574 | 3300005458 | Bacteria | 6951 |
| 113 | Ga0070681_10042262 | 3300005458 | Bacteria | 4568 |
| 114 | Ga0070681_10089000 | 3300005458 | Bacteria | 3038 |
| 115 | Ga0070681_10337067 | 3300005458 | Bacteria | 1417 |
| 116 | Ga0070681_10641834 | 3300005458 | Bacteria | 977 |
| 117 | Ga0070681_11235032 | 3300005458 | Bacteria | 669 |
| 118 | Ga0068867_100230565 | 3300005459 | Bacteria | 1497 |
| 119 | Ga0068867_100248089 | 3300005459 | Bacteria | 1447 |
| 120 | Ga0068867_100333484 | 3300005459 | Bacteria | 1260 |
| 121 | Ga0068867_100641431 | 3300005459 | Bacteria | 931 |
| 122 | Ga0068867_100806240 | 3300005459 | Bacteria | 838 |
| 123 | Ga0068867_102232437 | 3300005459 | Bacteria | 520 |
| 124 | Ga0070685_10053763 | 3300005466 | Bacteria | 2334 |
| 125 | Ga0070706_100023684 | 3300005467 | Bacteria | 5651 |
| 126 | Ga0070706_100352826 | 3300005467 | Bacteria | 1371 |
| 127 | Ga0070707_100081792 | 3300005468 | Bacteria | 3119 |
| 128 | Ga0070707_100085098 | 3300005468 | Bacteria | 3056 |
| 129 | Ga0070698_100002914 | 3300005471 | Bacteria | 18836 |
| 130 | Ga0070698_100069760 | 3300005471 | Bacteria | 3528 |
| 131 | Ga0070698_100110270 | 3300005471 | Bacteria | 2717 |
| 132 | Ga0070698_100537509 | 3300005471 | Unclassified | 1108 |
| 133 | Ga0070698_100661958 | 3300005471 | Bacteria | 985 |
| 134 | Ga0070698_100800146 | 3300005471 | Bacteria | 887 |
| 135 | Ga0070699_100024816 | 3300005518 | Bacteria | 5168 |
| 136 | Ga0070699_100034974 | 3300005518 | Bacteria | 4342 |
| 137 | Ga0070699_100466199 | 3300005518 | Bacteria | 1146 |
| 138 | Ga0070699_100699969 | 3300005518 | Bacteria | 926 |
| 139 | Ga0070699_101033444 | 3300005518 | Bacteria | 754 |
| 140 | Ga0070699_101952198 | 3300005518 | Bacteria | 537 |
| 141 | Ga0070679_100120426 | 3300005530 | Bacteria | 2609 |
| 142 | Ga0070679_100129492 | 3300005530 | Bacteria | 2505 |
| 143 | Ga0070679_100178762 | 3300005530 | Bacteria | 2095 |
| 144 | Ga0070679_100217718 | 3300005530 | Bacteria | 1871 |
| 145 | Ga0070679_100219122 | 3300005530 | Bacteria | 1864 |
| 146 | Ga0070679_100597959 | 3300005530 | Bacteria | 1046 |
| 147 | Ga0070684_100067464 | 3300005535 | Bacteria | 3142 |
| 148 | Ga0070684_100099228 | 3300005535 | Bacteria | 2599 |
| 149 | Ga0070684_100140117 | 3300005535 | Bacteria | 2187 |
| 150 | Ga0070684_100190171 | 3300005535 | Bacteria | 1868 |
| 151 | Ga0070684_100414131 | 3300005535 | Bacteria | 1243 |
| 152 | Ga0070684_100432859 | 3300005535 | Bacteria | 1215 |
| 153 | Ga0070684_100844865 | 3300005535 | Bacteria | 857 |
| 154 | Ga0070684_101000308 | 3300005535 | Bacteria | 785 |
| 155 | Ga0070684_101075730 | 3300005535 | Bacteria | 755 |
| 156 | Ga0070697_100253597 | 3300005536 | Bacteria | 1505 |
| 157 | Ga0068853_100148213 | 3300005539 | Bacteria | 2111 |
| 158 | Ga0068853_100154850 | 3300005539 | Bacteria | 2065 |
| 159 | Ga0068853_100160754 | 3300005539 | Bacteria | 2027 |
| 160 | Ga0070672_100377211 | 3300005543 | Bacteria | 1212 |
| 161 | Ga0070672_100713141 | 3300005543 | Bacteria | 879 |
| 162 | Ga0070672_101095601 | 3300005543 | Bacteria | 708 |
| 163 | Ga0070686_100088621 | 3300005544 | Bacteria | 2065 |
| 164 | Ga0070686_101585869 | 3300005544 | Bacteria | 553 |
| 165 | Ga0070695_100102433 | 3300005545 | Bacteria | 1931 |
| 166 | Ga0070696_100103996 | 3300005546 | Bacteria | 2038 |
| 167 | Ga0070693_100382881 | 3300005547 | Bacteria | 971 |
| 168 | Ga0070693_101138823 | 3300005547 | Bacteria | 596 |
| 169 | Ga0070665_100731096 | 3300005548 | Bacteria | 1003 |
| 170 | Ga0070704_100205791 | 3300005549 | Bacteria | 1591 |
| 171 | Ga0068855_101735335 | 3300005563 | Bacteria | 636 |
| 172 | Ga0070664_100036994 | 3300005564 | Bacteria | 4102 |
| 173 | Ga0070664_100151920 | 3300005564 | Bacteria | 2044 |
| 174 | Ga0070664_100304127 | 3300005564 | Bacteria | 1441 |
| 175 | Ga0070664_100639068 | 3300005564 | Bacteria | 989 |
| 176 | Ga0068857_100003001 | 3300005577 | Bacteria | 13924 |
| 177 | Ga0068857_100116161 | 3300005577 | Bacteria | 2407 |
| 178 | Ga0068857_100298940 | 3300005577 | Bacteria | 1484 |
| 179 | Ga0068857_100316532 | 3300005577 | Bacteria | 1440 |
| 180 | Ga0068857_102005162 | 3300005577 | Bacteria | 568 |
| 181 | Ga0068854_100220685 | 3300005578 | Bacteria | 1500 |
| 182 | Ga0068854_100318935 | 3300005578 | Bacteria | 1262 |
| 183 | Ga0068854_100510511 | 3300005578 | Bacteria | 1014 |
| 184 | Ga0068856_100153210 | 3300005614 | Bacteria | 2314 |
| 185 | Ga0068856_100214217 | 3300005614 | Bacteria | 1941 |
| 186 | Ga0070702_100139069 | 3300005615 | Bacteria | 1544 |
| 187 | Ga0070702_100366717 | 3300005615 | Bacteria | 1019 |
| 188 | Ga0070702_101289676 | 3300005615 | Bacteria | 593 |
| 189 | Ga0068852_100272341 | 3300005616 | Bacteria | 1630 |
| 190 | Ga0068852_100736259 | 3300005616 | Bacteria | 997 |
| 191 | Ga0068852_101911305 | 3300005616 | Bacteria | 616 |
| 192 | Ga0068859_100182455 | 3300005617 | Bacteria | 2182 |
| 193 | Ga0068859_100896263 | 3300005617 | Bacteria | 972 |
| 194 | Ga0068864_100072800 | 3300005618 | Bacteria | 2996 |
| 195 | Ga0068864_100720384 | 3300005618 | Bacteria | 976 |
| 196 | Ga0068864_101575851 | 3300005618 | Bacteria | 660 |
| 197 | Ga0068864_102297957 | 3300005618 | Bacteria | 546 |
| 198 | Ga0068866_10591778 | 3300005718 | Bacteria | 748 |
| 199 | Ga0068866_10925786 | 3300005718 | Bacteria | 615 |
| 200 | Ga0068866_11048836 | 3300005718 | Bacteria | 582 |
| 201 | Ga0068861_100094678 | 3300005719 | Bacteria | 2364 |
| 202 | Ga0068861_101262469 | 3300005719 | Bacteria | 717 |
| 203 | Ga0068851_10390861 | 3300005834 | Bacteria | 817 |
| 204 | Ga0068870_10083098 | 3300005840 | Bacteria | 1775 |
| 205 | Ga0068870_10145766 | 3300005840 | Bacteria | 1390 |
| 206 | Ga0068870_10343491 | 3300005840 | Bacteria | 955 |
| 207 | Ga0068870_10438401 | 3300005840 | Bacteria | 859 |
| 208 | Ga0068863_100395589 | 3300005841 | Bacteria | 1351 |
| 209 | Ga0068863_101791611 | 3300005841 | Bacteria | 624 |
| 210 | Ga0068858_100166781 | 3300005842 | Bacteria | 2075 |
| 211 | Ga0068860_100570754 | 3300005843 | Bacteria | 1135 |
| 212 | Ga0068862_100305469 | 3300005844 | Bacteria | 1465 |
| 213 | Ga0081455_10002616 | 3300005937 | Bacteria | 21335 |
| 214 | Ga0081455_10003194 | 3300005937 | Bacteria | 18994 |
| 215 | Ga0081455_10020838 | 3300005937 | Bacteria | 6162 |
| 216 | Ga0081455_10028494 | 3300005937 | Bacteria | 5102 |
| 217 | Ga0081455_10034787 | 3300005937 | Bacteria | 4510 |
| 218 | Ga0081455_10052915 | 3300005937 | Bacteria | 3472 |
| 219 | Ga0081455_10054190 | 3300005937 | Bacteria | 3420 |
| 220 | Ga0081455_10057833 | 3300005937 | Bacteria | 3284 |
| 221 | Ga0081455_10073359 | 3300005937 | Bacteria | 2830 |
| 222 | Ga0081455_10254080 | 3300005937 | Bacteria | 1284 |
| 223 | Ga0081455_10262367 | 3300005937 | Bacteria | 1257 |
| 224 | Ga0081455_10359743 | 3300005937 | Bacteria | 1024 |
| 225 | Ga0081455_10757821 | 3300005937 | Bacteria | 613 |
| 226 | Ga0081538_10000012 | 3300005981 | Bacteria | 153046 |
| 227 | Ga0081538_10000043 | 3300005981 | Bacteria | 115532 |
| 228 | Ga0081538_10000078 | 3300005981 | Bacteria | 92826 |
| 229 | Ga0081538_10001739 | 3300005981 | Bacteria | 22122 |
| 230 | Ga0081538_10003796 | 3300005981 | Bacteria | 14123 |
| 231 | Ga0081538_10006203 | 3300005981 | Bacteria | 10584 |
| 232 | Ga0081538_10012471 | 3300005981 | Bacteria | 6811 |
| 233 | Ga0081538_10018260 | 3300005981 | Bacteria | 5279 |
| 234 | Ga0081538_10024585 | 3300005981 | Bacteria | 4286 |
| 235 | Ga0081538_10028759 | 3300005981 | Bacteria | 3813 |
| 236 | Ga0081538_10040171 | 3300005981 | Bacteria | 2988 |
| 237 | Ga0081538_10040841 | 3300005981 | Bacteria | 2953 |
| 238 | Ga0081538_10052475 | 3300005981 | Bacteria | 2436 |
| 239 | Ga0081538_10069084 | 3300005981 | Bacteria | 1959 |
| 240 | Ga0081538_10171304 | 3300005981 | Bacteria | 947 |
| 241 | Ga0081538_10208422 | 3300005981 | Bacteria | 792 |
| 242 | Ga0081538_10259260 | 3300005981 | Bacteria | 657 |
| 243 | Ga0081539_10001017 | 3300005985 | Bacteria | 51648 |
| 244 | Ga0081539_10001655 | 3300005985 | Bacteria | 36118 |
| 245 | Ga0081539_10008759 | 3300005985 | Bacteria | 8685 |
| 246 | Ga0081539_10091234 | 3300005985 | Bacteria | 1574 |
| 247 | Ga0070717_11680835 | 3300006028 | Bacteria | 575 |
| 248 | Ga0075365_10095091 | 3300006038 | Bacteria | 2034 |
| 249 | Ga0075365_10124097 | 3300006038 | Bacteria | 1783 |
| 250 | Ga0075368_10052943 | 3300006042 | Bacteria | 1615 |
| 251 | Ga0075363_100023210 | 3300006048 | Bacteria | 3142 |
| 252 | Ga0075364_10003002 | 3300006051 | Bacteria | 9535 |
| 253 | Ga0075364_10524287 | 3300006051 | Bacteria | 810 |
| 254 | Ga0075432_10001315 | 3300006058 | Bacteria | 8030 |
| 255 | Ga0075432_10156135 | 3300006058 | Bacteria | 880 |
| 256 | Ga0075432_10269755 | 3300006058 | Bacteria | 697 |
| 257 | Ga0070712_100045012 | 3300006175 | Unclassified | 3045 |
| 258 | Ga0070712_101596957 | 3300006175 | Bacteria | 570 |
| 259 | Ga0075362_10079884 | 3300006177 | Bacteria | 1506 |
| 260 | Ga0075362_10685463 | 3300006177 | Bacteria | 534 |
| 261 | Ga0075367_10009020 | 3300006178 | Bacteria | 5195 |
| 262 | Ga0075427_10013143 | 3300006194 | Bacteria | 1264 |
| 263 | Ga0075427_10057743 | 3300006194 | Bacteria | 676 |
| 264 | Ga0068871_100222874 | 3300006358 | Bacteria | 1634 |
| 265 | Ga0068871_100531919 | 3300006358 | Bacteria | 1063 |
| 266 | Ga0068871_101565789 | 3300006358 | Bacteria | 623 |
| 267 | Ga0068871_101881734 | 3300006358 | Bacteria | 569 |
| 268 | Ga0068871_101915281 | 3300006358 | Bacteria | 564 |
| 269 | Ga0068871_102036583 | 3300006358 | Bacteria | 546 |
| 270 | Ga0075428_100012121 | 3300006844 | Bacteria | 9591 |
| 271 | Ga0075428_100014262 | 3300006844 | Bacteria | 8839 |
| 272 | Ga0075428_100056043 | 3300006844 | Bacteria | 4318 |
| 273 | Ga0075428_100152138 | 3300006844 | Bacteria | 2513 |
| 274 | Ga0075428_100507800 | 3300006844 | Bacteria | 1290 |
| 275 | Ga0075428_101023531 | 3300006844 | Bacteria | 874 |
| 276 | Ga0075428_101074017 | 3300006844 | Bacteria | 851 |
| 277 | Ga0075430_100078687 | 3300006846 | Bacteria | 2763 |
| 278 | Ga0075430_100189359 | 3300006846 | Bacteria | 1710 |
| 279 | Ga0075431_100056374 | 3300006847 | Bacteria | 4053 |
| 280 | Ga0075431_100155187 | 3300006847 | Bacteria | 2355 |
| 281 | Ga0075431_100634509 | 3300006847 | Bacteria | 1050 |
| 282 | Ga0075431_100698963 | 3300006847 | Bacteria | 992 |
| 283 | Ga0075431_100722545 | 3300006847 | Bacteria | 973 |
| 284 | Ga0075431_100727840 | 3300006847 | Bacteria | 969 |
| 285 | Ga0075431_101058972 | 3300006847 | Unclassified | 777 |
| 286 | Ga0075431_101122080 | 3300006847 | Bacteria | 751 |
| 287 | Ga0075431_101272603 | 3300006847 | Bacteria | 697 |
| 288 | Ga0075431_101468346 | 3300006847 | Bacteria | 641 |
| 289 | Ga0075434_100684907 | 3300006871 | Bacteria | 1043 |
| 290 | Ga0075434_100973403 | 3300006871 | Bacteria | 863 |
| 291 | Ga0075429_100023663 | 3300006880 | Bacteria | 5331 |
| 292 | Ga0075429_100173070 | 3300006880 | Bacteria | 1891 |
| 293 | Ga0075429_100185368 | 3300006880 | Bacteria | 1823 |
| 294 | Ga0075429_101116107 | 3300006880 | Bacteria | 689 |
| 295 | Ga0075429_101287011 | 3300006880 | Bacteria | 638 |
| 296 | Ga0068865_100090588 | 3300006881 | Bacteria | 2218 |
| 297 | Ga0068865_100959281 | 3300006881 | Bacteria | 747 |
| 298 | Ga0068865_101155825 | 3300006881 | Bacteria | 684 |
| 299 | Ga0075436_100291063 | 3300006914 | Bacteria | 1169 |
| 300 | Ga0097620_100182458 | 3300006931 | Bacteria | 2182 |
| 301 | Ga0097620_100896166 | 3300006931 | Bacteria | 972 |
| 302 | Ga0075435_101418323 | 3300007076 | Bacteria | 609 |
| 303 | Ga0105250_10323257 | 3300009092 | Bacteria | 671 |
| 304 | Ga0105240_12458240 | 3300009093 | Bacteria | 539 |
| 305 | Ga0111539_10004858 | 3300009094 | Bacteria | 17509 |
| 306 | Ga0111539_10009775 | 3300009094 | Bacteria | 12107 |
| 307 | Ga0111539_10027100 | 3300009094 | Bacteria | 6999 |
| 308 | Ga0111539_10029591 | 3300009094 | Bacteria | 6667 |
| 309 | Ga0111539_10281997 | 3300009094 | Bacteria | 1933 |
| 310 | Ga0111539_10286454 | 3300009094 | Bacteria | 1917 |
| 311 | Ga0111539_10590586 | 3300009094 | Bacteria | 1293 |
| 312 | Ga0111539_10783105 | 3300009094 | Bacteria | 1110 |
| 313 | Ga0111539_11211441 | 3300009094 | Bacteria | 877 |
| 314 | Ga0111539_12252066 | 3300009094 | Bacteria | 632 |
| 315 | Ga0105245_10061841 | 3300009098 | Bacteria | 3377 |
| 316 | Ga0105245_10073114 | 3300009098 | Bacteria | 3116 |
| 317 | Ga0105245_10091194 | 3300009098 | Bacteria | 2804 |
| 318 | Ga0105245_10207111 | 3300009098 | Bacteria | 1886 |
| 319 | Ga0105245_10709359 | 3300009098 | Bacteria | 1040 |
| 320 | Ga0105245_11182387 | 3300009098 | Bacteria | 812 |
| 321 | Ga0105247_10310257 | 3300009101 | Bacteria | 1097 |
| 322 | Ga0114129_10019838 | 3300009147 | Bacteria | 9567 |
| 323 | Ga0114129_10034585 | 3300009147 | Bacteria | 7139 |
| 324 | Ga0114129_10042952 | 3300009147 | Bacteria | 6362 |
| 325 | Ga0114129_10194478 | 3300009147 | Bacteria | 2752 |
| 326 | Ga0114129_10271452 | 3300009147 | Bacteria | 2269 |
| 327 | Ga0114129_10532079 | 3300009147 | Bacteria | 1531 |
| 328 | Ga0114129_11802972 | 3300009147 | Bacteria | 744 |
| 329 | Ga0114129_12206860 | 3300009147 | Bacteria | 662 |
| 330 | Ga0105243_10152295 | 3300009148 | Bacteria | 1985 |
| 331 | Ga0105243_10716425 | 3300009148 | Bacteria | 977 |
| 332 | Ga0105243_11038973 | 3300009148 | Bacteria | 824 |
| 333 | Ga0105241_10426534 | 3300009174 | Bacteria | 1168 |
| 334 | Ga0105242_10140847 | 3300009176 | Bacteria | 2092 |
| 335 | Ga0105242_10228089 | 3300009176 | Bacteria | 1668 |
| 336 | Ga0105242_10465910 | 3300009176 | Bacteria | 1194 |
| 337 | Ga0105242_11156178 | 3300009176 | Bacteria | 791 |
| 338 | Ga0105248_10177812 | 3300009177 | Bacteria | 2398 |
| 339 | Ga0105237_10153292 | 3300009545 | Bacteria | 2301 |
| 340 | Ga0105237_11848547 | 3300009545 | Bacteria | 612 |
| 341 | Ga0105238_10496393 | 3300009551 | Bacteria | 1221 |
| 342 | Ga0105249_10030507 | 3300009553 | Bacteria | 4874 |
| 343 | Ga0105249_10272330 | 3300009553 | Bacteria | 1687 |
| 344 | Ga0105249_10498255 | 3300009553 | Bacteria | 1263 |
| 345 | Ga0105249_11296920 | 3300009553 | Bacteria | 800 |
| 346 | Ga0105239_10158905 | 3300010375 | Bacteria | 2525 |
| 347 | Ga0105239_10279218 | 3300010375 | Bacteria | 1880 |
| 348 | Ga0105239_11377959 | 3300010375 | Bacteria | 814 |
| 349 | Ga0105246_10257522 | 3300011119 | Bacteria | 1388 |
| 350 | Ga0105246_10327644 | 3300011119 | Bacteria | 1247 |
| 351 | Ga0105246_10563148 | 3300011119 | Bacteria | 979 |
| 352 | Ga0105246_10639528 | 3300011119 | Bacteria | 924 |
| 353 | Ga0105246_10893983 | 3300011119 | Bacteria | 796 |
| 354 | Ga0105246_12443260 | 3300011119 | Bacteria | 513 |
| 355 | Ga0157346_1013493 | 3300012480 | Bacteria | 632 |
| 356 | Ga0157320_1013023 | 3300012481 | Bacteria | 676 |
| 357 | Ga0157337_1025459 | 3300012483 | Bacteria | 575 |
| 358 | Ga0157315_1032099 | 3300012508 | Bacteria | 622 |
| 359 | Ga0157338_1046318 | 3300012515 | Bacteria | 609 |
| 360 | Ga0154010_164487 | 3300013062 | Bacteria | 519 |
| 361 | Ga0157373_10694481 | 3300013100 | Bacteria | 745 |
| 362 | Ga0157373_10766196 | 3300013100 | Bacteria | 710 |
| 363 | Ga0157371_10193809 | 3300013102 | Bacteria | 1455 |
| 364 | Ga0157371_10241696 | 3300013102 | Bacteria | 1299 |
| 365 | Ga0157370_10154684 | 3300013104 | Bacteria | 2134 |
| 366 | Ga0157370_11604569 | 3300013104 | Bacteria | 584 |
| 367 | Ga0157369_10144031 | 3300013105 | Bacteria | 2520 |
| 368 | Ga0157374_10058527 | 3300013296 | Bacteria | 3601 |
| 369 | Ga0157374_10392480 | 3300013296 | Bacteria | 1383 |
| 370 | Ga0157374_11449660 | 3300013296 | Bacteria | 710 |
| 371 | Ga0157378_10471694 | 3300013297 | Bacteria | 1249 |
| 372 | Ga0157378_11242545 | 3300013297 | Bacteria | 785 |
| 373 | Ga0157378_12063731 | 3300013297 | Bacteria | 620 |
| 374 | Ga0163162_10105023 | 3300013306 | Bacteria | 2919 |
| 375 | Ga0163162_10572753 | 3300013306 | Bacteria | 1256 |
| 376 | Ga0163162_11345383 | 3300013306 | Bacteria | 812 |
| 377 | Ga0157372_10832749 | 3300013307 | Bacteria | 1071 |
| 378 | Ga0157372_10867950 | 3300013307 | Bacteria | 1047 |
| 379 | Ga0157372_11259598 | 3300013307 | Bacteria | 854 |
| 380 | Ga0157375_10243699 | 3300013308 | Bacteria | 1957 |
| 381 | Ga0157375_10810502 | 3300013308 | Bacteria | 1084 |
| 382 | Ga0157375_13176261 | 3300013308 | Bacteria | 548 |
| 383 | Ga0163163_10299612 | 3300014325 | Bacteria | 1660 |
| 384 | Ga0163163_10597244 | 3300014325 | Bacteria | 1167 |
| 385 | Ga0163163_11544366 | 3300014325 | Bacteria | 725 |
| 386 | Ga0157380_10377392 | 3300014326 | Bacteria | 1337 |
| 387 | Ga0157380_10538822 | 3300014326 | Bacteria | 1142 |
| 388 | Ga0157380_11239550 | 3300014326 | Bacteria | 791 |
| 389 | Ga0157380_11437455 | 3300014326 | Bacteria | 741 |
| 390 | Ga0182008_10002863 | 3300014497 | Bacteria | 10684 |
| 391 | Ga0182008_10778774 | 3300014497 | Bacteria | 553 |
| 392 | Ga0157377_10101653 | 3300014745 | Bacteria | 1714 |
| 393 | Ga0157377_10278226 | 3300014745 | Bacteria | 1096 |
| 394 | Ga0157379_10279969 | 3300014968 | Bacteria | 1518 |
| 395 | Ga0157379_11235946 | 3300014968 | Bacteria | 719 |
| 396 | Ga0157379_11246767 | 3300014968 | Bacteria | 716 |
| 397 | Ga0157376_10214746 | 3300014969 | Bacteria | 1778 |
| 398 | Ga0157376_10289074 | 3300014969 | Bacteria | 1547 |
| 399 | Ga0157376_10483767 | 3300014969 | Bacteria | 1213 |
| 400 | Ga0157376_10754898 | 3300014969 | Bacteria | 982 |
| 401 | Ga0182007_10018713 | 3300015262 | Bacteria | 2504 |
| 402 | Ga0182005_1056312 | 3300015265 | Unclassified | 1071 |
| 403 | Ga0163161_10396685 | 3300017792 | Bacteria | 1106 |
| 404 | Ga0197907_10123201 | 3300020069 | Bacteria | 565 |
| 405 | Ga0197907_10392146 | 3300020069 | Bacteria | 733 |
| 406 | Ga0206355_1580130 | 3300020076 | Bacteria | 658 |
| 407 | Ga0206351_10697763 | 3300020077 | Bacteria | 2331 |
| 408 | Ga0206354_10836039 | 3300020081 | Bacteria | 786 |
| 409 | Ga0206354_11226363 | 3300020081 | Bacteria | 736 |
| 410 | Ga0206353_10089638 | 3300020082 | Bacteria | 538 |
| 411 | Ga0206353_10335316 | 3300020082 | Bacteria | 2203 |
| 412 | Ga0206353_10442328 | 3300020082 | Bacteria | 1306 |
| 413 | Ga0206353_10959623 | 3300020082 | Bacteria | 633 |
| 414 | Ga0154015_1677257 | 3300020610 | Bacteria | 898 |
| 415 | Ga0224712_10187199 | 3300022467 | Bacteria | 935 |
| 416 | Ga0207655_1053832 | 3300025728 | Bacteria | 1605 |
| 417 | Ga0207682_10455960 | 3300025893 | Bacteria | 605 |
| 418 | Ga0207642_10169498 | 3300025899 | Bacteria | 1180 |
| 419 | Ga0207642_10293511 | 3300025899 | Bacteria | 940 |
| 420 | Ga0207688_10011358 | 3300025901 | Bacteria | 4850 |
| 421 | Ga0207688_10030354 | 3300025901 | Bacteria | 2980 |
| 422 | Ga0207647_10222784 | 3300025904 | Bacteria | 1087 |
| 423 | Ga0207685_10227462 | 3300025905 | Bacteria | 890 |
| 424 | Ga0207645_10093656 | 3300025907 | Bacteria | 1933 |
| 425 | Ga0207645_10114835 | 3300025907 | Bacteria | 1745 |
| 426 | Ga0207645_10180877 | 3300025907 | Bacteria | 1383 |
| 427 | Ga0207645_10329572 | 3300025907 | Bacteria | 1019 |
| 428 | Ga0207643_10016941 | 3300025908 | Bacteria | 3977 |
| 429 | Ga0207643_10045405 | 3300025908 | Bacteria | 2481 |
| 430 | Ga0207643_10680655 | 3300025908 | Bacteria | 664 |
| 431 | Ga0207705_10029629 | 3300025909 | Bacteria | 3902 |
| 432 | Ga0207705_10665598 | 3300025909 | Bacteria | 810 |
| 433 | Ga0207705_11419235 | 3300025909 | Bacteria | 527 |
| 434 | Ga0207705_11542694 | 3300025909 | Bacteria | 502 |
| 435 | Ga0207684_10454540 | 3300025910 | Bacteria | 1099 |
| 436 | Ga0207684_10878479 | 3300025910 | Bacteria | 755 |
| 437 | Ga0207684_10942191 | 3300025910 | Bacteria | 724 |
| 438 | Ga0207707_10026096 | 3300025912 | Bacteria | 5108 |
| 439 | Ga0207707_10109194 | 3300025912 | Bacteria | 2418 |
| 440 | Ga0207707_10138023 | 3300025912 | Bacteria | 2132 |
| 441 | Ga0207707_10329499 | 3300025912 | Bacteria | 1317 |
| 442 | Ga0207707_10519161 | 3300025912 | Bacteria | 1014 |
| 443 | Ga0207707_11461571 | 3300025912 | Bacteria | 543 |
| 444 | Ga0207671_10645058 | 3300025914 | Bacteria | 843 |
| 445 | Ga0207693_10170033 | 3300025915 | Bacteria | 1716 |
| 446 | Ga0207693_10991540 | 3300025915 | Bacteria | 642 |
| 447 | Ga0207660_10017811 | 3300025917 | Bacteria | 4726 |
| 448 | Ga0207660_10026727 | 3300025917 | Bacteria | 3932 |
| 449 | Ga0207660_10127350 | 3300025917 | Bacteria | 1935 |
| 450 | Ga0207660_10173935 | 3300025917 | Bacteria | 1668 |
| 451 | Ga0207660_10313371 | 3300025917 | Bacteria | 1252 |
| 452 | Ga0207660_10402713 | 3300025917 | Bacteria | 1102 |
| 453 | Ga0207662_10105715 | 3300025918 | Bacteria | 1750 |
| 454 | Ga0207662_10298434 | 3300025918 | Bacteria | 1070 |
| 455 | Ga0207657_10032675 | 3300025919 | Bacteria | 4699 |
| 456 | Ga0207657_10078394 | 3300025919 | Bacteria | 2782 |
| 457 | Ga0207657_10194906 | 3300025919 | Bacteria | 1632 |
| 458 | Ga0207657_10218387 | 3300025919 | Bacteria | 1528 |
| 459 | Ga0207657_10537251 | 3300025919 | Bacteria | 914 |
| 460 | Ga0207657_11344692 | 3300025919 | Bacteria | 538 |
| 461 | Ga0207649_10006584 | 3300025920 | Bacteria | 6310 |
| 462 | Ga0207649_10906933 | 3300025920 | Bacteria | 691 |
| 463 | Ga0207652_10056627 | 3300025921 | Bacteria | 3375 |
| 464 | Ga0207652_10222124 | 3300025921 | Bacteria | 1702 |
| 465 | Ga0207652_10285733 | 3300025921 | Bacteria | 1488 |
| 466 | Ga0207652_10333662 | 3300025921 | Bacteria | 1369 |
| 467 | Ga0207652_10769610 | 3300025921 | Bacteria | 856 |
| 468 | Ga0207652_11113788 | 3300025921 | Bacteria | 690 |
| 469 | Ga0207646_10073193 | 3300025922 | Bacteria | 3061 |
| 470 | Ga0207646_10504248 | 3300025922 | Bacteria | 1090 |
| 471 | Ga0207646_10601954 | 3300025922 | Bacteria | 986 |
| 472 | Ga0207681_10246541 | 3300025923 | Bacteria | 1393 |
| 473 | Ga0207694_10627374 | 3300025924 | Bacteria | 905 |
| 474 | Ga0207694_10685448 | 3300025924 | Bacteria | 864 |
| 475 | Ga0207650_10203293 | 3300025925 | Bacteria | 1588 |
| 476 | Ga0207650_11912781 | 3300025925 | Bacteria | 501 |
| 477 | Ga0207659_10030117 | 3300025926 | Bacteria | 3705 |
| 478 | Ga0207659_10054344 | 3300025926 | Bacteria | 2860 |
| 479 | Ga0207659_11908055 | 3300025926 | Bacteria | 503 |
| 480 | Ga0207687_10049558 | 3300025927 | Bacteria | 2921 |
| 481 | Ga0207687_10082716 | 3300025927 | Bacteria | 2323 |
| 482 | Ga0207687_10282006 | 3300025927 | Bacteria | 1332 |
| 483 | Ga0207687_10337689 | 3300025927 | Bacteria | 1224 |
| 484 | Ga0207687_10404579 | 3300025927 | Bacteria | 1123 |
| 485 | Ga0207687_10467295 | 3300025927 | Bacteria | 1048 |
| 486 | Ga0207687_11222853 | 3300025927 | Bacteria | 646 |
| 487 | Ga0207687_11546652 | 3300025927 | Bacteria | 570 |
| 488 | Ga0207664_10128515 | 3300025929 | Bacteria | 2130 |
| 489 | Ga0207664_10157072 | 3300025929 | Unclassified | 1937 |
| 490 | Ga0207664_11240979 | 3300025929 | Bacteria | 664 |
| 491 | Ga0207690_10115023 | 3300025932 | Bacteria | 1944 |
| 492 | Ga0207690_10129614 | 3300025932 | Bacteria | 1844 |
| 493 | Ga0207690_11230683 | 3300025932 | Bacteria | 625 |
| 494 | Ga0207690_11793153 | 3300025932 | Bacteria | 512 |
| 495 | Ga0207706_10085744 | 3300025933 | Bacteria | 2769 |
| 496 | Ga0207706_10416761 | 3300025933 | Bacteria | 1163 |
| 497 | Ga0207706_11030380 | 3300025933 | Archaea | 690 |
| 498 | Ga0207686_10045133 | 3300025934 | Bacteria | 2710 |
| 499 | Ga0207686_10350076 | 3300025934 | Bacteria | 1112 |
| 500 | Ga0207709_10175971 | 3300025935 | Bacteria | 1507 |
| 501 | Ga0207709_10343731 | 3300025935 | Bacteria | 1124 |
| 502 | Ga0207709_10656432 | 3300025935 | Bacteria | 836 |
| 503 | Ga0207709_10885908 | 3300025935 | Bacteria | 725 |
| 504 | Ga0207709_11846071 | 3300025935 | Bacteria | 503 |
| 505 | Ga0207670_10040829 | 3300025936 | Bacteria | 3047 |
| 506 | Ga0207669_10568405 | 3300025937 | Bacteria | 917 |
| 507 | Ga0207669_10731804 | 3300025937 | Bacteria | 815 |
| 508 | Ga0207669_11000376 | 3300025937 | Bacteria | 702 |
| 509 | Ga0207669_11003924 | 3300025937 | Bacteria | 701 |
| 510 | Ga0207704_10068690 | 3300025938 | Bacteria | 2235 |
| 511 | Ga0207704_10671958 | 3300025938 | Bacteria | 855 |
| 512 | Ga0207704_10976900 | 3300025938 | Bacteria | 715 |
| 513 | Ga0207704_11919578 | 3300025938 | Bacteria | 509 |
| 514 | Ga0207665_10608374 | 3300025939 | Bacteria | 854 |
| 515 | Ga0207691_10113414 | 3300025940 | Bacteria | 2409 |
| 516 | Ga0207691_10173183 | 3300025940 | Bacteria | 1889 |
| 517 | Ga0207691_10827928 | 3300025940 | Bacteria | 777 |
| 518 | Ga0207691_11154287 | 3300025940 | Bacteria | 643 |
| 519 | Ga0207711_10062058 | 3300025941 | Bacteria | 3224 |
| 520 | Ga0207711_11059163 | 3300025941 | Bacteria | 751 |
| 521 | Ga0207711_11460134 | 3300025941 | Bacteria | 627 |
| 522 | Ga0207689_10108289 | 3300025942 | Bacteria | 2283 |
| 523 | Ga0207689_10183159 | 3300025942 | Bacteria | 1727 |
| 524 | Ga0207689_11428205 | 3300025942 | Bacteria | 579 |
| 525 | Ga0207661_10000297 | 3300025944 | Bacteria | 31532 |
| 526 | Ga0207661_10111178 | 3300025944 | Bacteria | 2317 |
| 527 | Ga0207661_10134616 | 3300025944 | Bacteria | 2121 |
| 528 | Ga0207661_10151127 | 3300025944 | Bacteria | 2007 |
| 529 | Ga0207661_10414770 | 3300025944 | Bacteria | 1222 |
| 530 | Ga0207661_11047459 | 3300025944 | Bacteria | 751 |
| 531 | Ga0207661_11741760 | 3300025944 | Bacteria | 568 |
| 532 | Ga0207679_10137123 | 3300025945 | Bacteria | 1972 |
| 533 | Ga0207679_10423302 | 3300025945 | Bacteria | 1176 |
| 534 | Ga0207679_10497385 | 3300025945 | Bacteria | 1087 |
| 535 | Ga0207667_10486862 | 3300025949 | Bacteria | 1252 |
| 536 | Ga0207667_12138103 | 3300025949 | Bacteria | 518 |
| 537 | Ga0207651_10250545 | 3300025960 | Bacteria | 1449 |
| 538 | Ga0207651_11353330 | 3300025960 | Bacteria | 640 |
| 539 | Ga0207712_10077189 | 3300025961 | Bacteria | 2413 |
| 540 | Ga0207712_10208411 | 3300025961 | Bacteria | 1555 |
| 541 | Ga0207668_11134409 | 3300025972 | Bacteria | 701 |
| 542 | Ga0207640_10194056 | 3300025981 | Bacteria | 1533 |
| 543 | Ga0207640_10215126 | 3300025981 | Bacteria | 1467 |
| 544 | Ga0207640_10551475 | 3300025981 | Bacteria | 968 |
| 545 | Ga0207640_11427667 | 3300025981 | Bacteria | 620 |
| 546 | Ga0207658_10418135 | 3300025986 | Bacteria | 1182 |
| 547 | Ga0207677_10127492 | 3300026023 | Bacteria | 1926 |
| 548 | Ga0207677_11202843 | 3300026023 | Bacteria | 694 |
| 549 | Ga0207677_11473392 | 3300026023 | Bacteria | 628 |
| 550 | Ga0207703_10147744 | 3300026035 | Bacteria | 2046 |
| 551 | Ga0207703_12226423 | 3300026035 | Bacteria | 524 |
| 552 | Ga0207639_10074514 | 3300026041 | Bacteria | 2665 |
| 553 | Ga0207639_10152500 | 3300026041 | Bacteria | 1937 |
| 554 | Ga0207639_10355232 | 3300026041 | Bacteria | 1310 |
| 555 | Ga0207678_10115328 | 3300026067 | Bacteria | 2292 |
| 556 | Ga0207678_10211598 | 3300026067 | Bacteria | 1659 |
| 557 | Ga0207678_11909723 | 3300026067 | Bacteria | 518 |
| 558 | Ga0207708_10010855 | 3300026075 | Bacteria | 6776 |
| 559 | Ga0207708_10037820 | 3300026075 | Bacteria | 3676 |
| 560 | Ga0207708_10147104 | 3300026075 | Bacteria | 1852 |
| 561 | Ga0207708_10322502 | 3300026075 | Bacteria | 1261 |
| 562 | Ga0207708_10646720 | 3300026075 | Bacteria | 900 |
| 563 | Ga0207702_10045112 | 3300026078 | Bacteria | 3709 |
| 564 | Ga0207702_12373241 | 3300026078 | Bacteria | 518 |
| 565 | Ga0207641_10515974 | 3300026088 | Bacteria | 1162 |
| 566 | Ga0207648_10029997 | 3300026089 | Bacteria | 4822 |
| 567 | Ga0207648_10122453 | 3300026089 | Bacteria | 2287 |
| 568 | Ga0207648_10308320 | 3300026089 | Bacteria | 1421 |
| 569 | Ga0207648_10866927 | 3300026089 | Bacteria | 842 |
| 570 | Ga0207648_10960126 | 3300026089 | Bacteria | 800 |
| 571 | Ga0207648_11170023 | 3300026089 | Bacteria | 722 |
| 572 | Ga0207648_12296287 | 3300026089 | Unclassified | 500 |
| 573 | Ga0207676_10279581 | 3300026095 | Bacteria | 1515 |
| 574 | Ga0207676_10637188 | 3300026095 | Bacteria | 1027 |
| 575 | Ga0207676_10866072 | 3300026095 | Bacteria | 884 |
| 576 | Ga0207676_11255334 | 3300026095 | Bacteria | 735 |
| 577 | Ga0207674_10003542 | 3300026116 | Bacteria | 19059 |
| 578 | Ga0207674_10021743 | 3300026116 | Bacteria | 6903 |
| 579 | Ga0207674_10027993 | 3300026116 | Bacteria | 5955 |
| 580 | Ga0207674_10546103 | 3300026116 | Bacteria | 1119 |
| 581 | Ga0207674_11102424 | 3300026116 | Bacteria | 763 |
| 582 | Ga0207675_100032371 | 3300026118 | Bacteria | 4870 |
| 583 | Ga0207675_101836748 | 3300026118 | Bacteria | 625 |
| 584 | Ga0207675_102413653 | 3300026118 | Bacteria | 538 |
| 585 | Ga0207683_10161641 | 3300026121 | Bacteria | 2025 |
| 586 | Ga0207683_10288215 | 3300026121 | Bacteria | 1501 |
| 587 | Ga0207683_10967292 | 3300026121 | Bacteria | 790 |
| 588 | Ga0207698_10067992 | 3300026142 | Bacteria | 2812 |
| 589 | Ga0207698_10239871 | 3300026142 | Bacteria | 1651 |
| 590 | Ga0207698_11688456 | 3300026142 | Bacteria | 649 |
| 591 | Ga0209968_1040220 | 3300027526 | Bacteria | 798 |
| 592 | Ga0209998_10007307 | 3300027717 | Bacteria | 2292 |
| 593 | Ga0209998_10188806 | 3300027717 | Bacteria | 537 |
| 594 | Ga0209813_10014831 | 3300027866 | Bacteria | 2103 |
| 595 | Ga0207428_10000383 | 3300027907 | Bacteria | 55634 |
| 596 | Ga0207428_10006260 | 3300027907 | Bacteria | 10996 |
| 597 | Ga0207428_10008443 | 3300027907 | Bacteria | 9297 |
| 598 | Ga0207428_10020204 | 3300027907 | Bacteria | 5663 |
| 599 | Ga0207428_10042121 | 3300027907 | Bacteria | 3693 |
| 600 | Ga0207428_10100929 | 3300027907 | Bacteria | 2230 |
| 601 | Ga0207428_11132955 | 3300027907 | Bacteria | 546 |
| 602 | Ga0268266_11544650 | 3300028379 | Bacteria | 639 |
| 603 | Ga0268265_10970772 | 3300028380 | Bacteria | 838 |
| 604 | Ga0268265_12678342 | 3300028380 | Bacteria | 504 |
| 605 | Ga0268264_10729446 | 3300028381 | Bacteria | 986 |
| 606 | Ga0265318_10071394 | 3300028577 | Bacteria | 1287 |
| 607 | Ga0265318_10189202 | 3300028577 | Bacteria | 753 |
| 608 | Ga0265320_10407494 | 3300031240 | Unclassified | 600 |
| 609 | Ga0265340_10059264 | 3300031247 | Bacteria | 1837 |
| 610 | Ga0265327_10075516 | 3300031251 | Bacteria | 1676 |
| 611 | Ga0307408_100076490 | 3300031548 | Bacteria | 2490 |
| 612 | Ga0307408_100265431 | 3300031548 | Bacteria | 1423 |
| 613 | Ga0307408_100631735 | 3300031548 | Bacteria | 955 |
| 614 | Ga0307408_100899569 | 3300031548 | Bacteria | 810 |
| 615 | Ga0307408_101255351 | 3300031548 | Bacteria | 693 |
| 616 | Ga0307408_101521112 | 3300031548 | Unclassified | 633 |
| 617 | Ga0307408_101869845 | 3300031548 | Bacteria | 575 |
| 618 | Ga0307408_102393452 | 3300031548 | Bacteria | 512 |
| 619 | Ga0265313_10075834 | 3300031595 | Bacteria | 1538 |
| 620 | Ga0307405_10051501 | 3300031731 | Bacteria | 2555 |
| 621 | Ga0307405_10357736 | 3300031731 | Bacteria | 1128 |
| 622 | Ga0307405_10718129 | 3300031731 | Bacteria | 829 |
| 623 | Ga0307405_10972912 | 3300031731 | Bacteria | 722 |
| 624 | Ga0307413_10005458 | 3300031824 | Bacteria | 5682 |
| 625 | Ga0307413_10103776 | 3300031824 | Bacteria | 1886 |
| 626 | Ga0307413_10486934 | 3300031824 | Bacteria | 987 |
| 627 | Ga0307413_10919490 | 3300031824 | Bacteria | 744 |
| 628 | Ga0307413_11689474 | 3300031824 | Bacteria | 564 |
| 629 | Ga0307410_10030671 | 3300031852 | Bacteria | 3439 |
| 630 | Ga0307410_10642688 | 3300031852 | Bacteria | 889 |
| 631 | Ga0307410_11881654 | 3300031852 | Bacteria | 532 |
| 632 | Ga0307406_10016045 | 3300031901 | Bacteria | 4346 |
| 633 | Ga0307406_10105772 | 3300031901 | Bacteria | 1926 |
| 634 | Ga0307406_10165556 | 3300031901 | Bacteria | 1594 |
| 635 | Ga0307406_10378626 | 3300031901 | Bacteria | 1115 |
| 636 | Ga0307407_10012114 | 3300031903 | Bacteria | 4134 |
| 637 | Ga0307407_10300042 | 3300031903 | Bacteria | 1120 |
| 638 | Ga0307407_11528664 | 3300031903 | Bacteria | 528 |
| 639 | Ga0307412_10028974 | 3300031911 | Bacteria | 3471 |
| 640 | Ga0307412_10029849 | 3300031911 | Bacteria | 3426 |
| 641 | Ga0307409_100036492 | 3300031995 | Bacteria | 3614 |
| 642 | Ga0307409_100086421 | 3300031995 | Bacteria | 2553 |
| 643 | Ga0307409_100096436 | 3300031995 | Bacteria | 2440 |
| 644 | Ga0307409_100366724 | 3300031995 | Bacteria | 1364 |
| 645 | Ga0307409_100589136 | 3300031995 | Bacteria | 1097 |
| 646 | Ga0307409_100630486 | 3300031995 | Bacteria | 1063 |
| 647 | Ga0307409_101699430 | 3300031995 | Bacteria | 660 |
| 648 | Ga0307409_102060963 | 3300031995 | Bacteria | 600 |
| 649 | Ga0307409_102285266 | 3300031995 | Bacteria | 570 |
| 650 | Ga0307416_100003117 | 3300032002 | Bacteria | 9706 |
| 651 | Ga0307416_100045042 | 3300032002 | Bacteria | 3470 |
| 652 | Ga0307416_100068677 | 3300032002 | Bacteria | 2929 |
| 653 | Ga0307416_100112163 | 3300032002 | Bacteria | 2406 |
| 654 | Ga0307416_100197351 | 3300032002 | Bacteria | 1905 |
| 655 | Ga0307416_100417306 | 3300032002 | Bacteria | 1385 |
| 656 | Ga0307416_100631219 | 3300032002 | Bacteria | 1154 |
| 657 | Ga0307416_100673454 | 3300032002 | Bacteria | 1121 |
| 658 | Ga0307416_100755099 | 3300032002 | Bacteria | 1065 |
| 659 | Ga0307416_101366230 | 3300032002 | Bacteria | 814 |
| 660 | Ga0307411_10020345 | 3300032005 | Bacteria | 3857 |
| 661 | Ga0307415_100002861 | 3300032126 | Bacteria | 8640 |
| 662 | Ga0307415_100029740 | 3300032126 | Bacteria | 3495 |
| 663 | Ga0307415_100118554 | 3300032126 | Bacteria | 1979 |
| 664 | Ga0307415_100168897 | 3300032126 | Bacteria | 1704 |
| 665 | Ga0307415_100655885 | 3300032126 | Bacteria | 941 |
| 666 | Ga0373950_0084939 | 3300034818 | Bacteria | 666 |
| 667 | Ga0373959_0066549 | 3300034820 | Bacteria | 807 |
| 668 | Ga0373928_0041237 | 3300035084 | Bacteria | 1061 |
| 669 | Ga0373949_0143321 | 3300035090 | Bacteria | 686 |
| 670 | Ga0373941_0058241 | 3300035115 | Bacteria | 1250 |
| 671 | Ga0373953_0108946 | 3300035117 | Bacteria | 1170 |
| 672 | Ga0373960_0017129 | 3300035121 | Bacteria | 1874 |
| 673 | Ga0373955_0906984 | 3300035172 | Bacteria | 542 |
| 674 | Ga0373942_0260720 | 3300035207 | Bacteria | 592 |
| 675 | Ga0373962_0365427 | 3300035242 | Bacteria | 524 |
| 676 | Ga0373931_0107781 | 3300035691 | Bacteria | 1576 |
| 677 | Ga0373933_0057580 | 3300035724 | Bacteria | 2336 |
| 678 | Ga0373937_0010090 | 3300036401 | Bacteria | 8234 |
| 679 | Ga0395899_0002627 | 3300037312 | Bacteria | 14485 |
| 680 | Ga0395899_0007615 | 3300037312 | Bacteria | 8352 |
| 681 | Ga0395899_0009566 | 3300037312 | Bacteria | 7440 |
| 682 | Ga0395899_0022065 | 3300037312 | Bacteria | 4828 |
| 683 | Ga0395899_0038109 | 3300037312 | Bacteria | 3602 |
| 684 | Ga0395899_0047261 | 3300037312 | Bacteria | 3205 |
| 685 | Ga0395899_0051194 | 3300037312 | Bacteria | 3065 |
| 686 | Ga0395899_0052759 | 3300037312 | Bacteria | 3013 |
| 687 | Ga0395899_0077455 | 3300037312 | Bacteria | 2425 |
| 688 | Ga0395899_0081383 | 3300037312 | Bacteria | 2356 |
| 689 | Ga0395900_0001846 | 3300037418 | Bacteria | 24148 |
| 690 | Ga0395900_0009429 | 3300037418 | Bacteria | 10005 |
| 691 | Ga0395900_0013373 | 3300037418 | Bacteria | 8387 |
| 692 | Ga0395900_0018988 | 3300037418 | Bacteria | 7012 |
| 693 | Ga0395900_0029483 | 3300037418 | Bacteria | 5628 |
| 694 | Ga0395900_0036371 | 3300037418 | Bacteria | 5076 |
| 695 | Ga0395900_0044072 | 3300037418 | Bacteria | 4598 |
| 696 | Ga0395900_0070500 | 3300037418 | Bacteria | 3593 |
| 697 | Ga0395900_0091363 | 3300037418 | Bacteria | 3129 |
| 698 | Ga0395900_0092038 | 3300037418 | Unclassified | 3115 |
| 699 | Ga0395900_0177306 | 3300037418 | Bacteria | 2167 |
| 700 | Ga0395900_0213443 | 3300037418 | Bacteria | 1948 |
| 701 | Ga0395900_0231275 | 3300037418 | Bacteria | 1859 |
| 702 | Ga0395900_0278004 | 3300037418 | Bacteria | 1667 |
| 703 | Ga0395900_0532104 | 3300037418 | Bacteria | 1122 |
| 704 | Ga0395900_0637198 | 3300037418 | Bacteria | 1003 |
| 705 | Ga0395900_0706805 | 3300037418 | Bacteria | 941 |
| 706 | Ga0395900_0840105 | 3300037418 | Bacteria | 844 |
| 707 | Ga0395900_0926663 | 3300037418 | Bacteria | 794 |
| 708 | Ga0395900_1084601 | 3300037418 | Bacteria | 718 |
| 709 | Ga0395900_1427707 | 3300037418 | Bacteria | 605 |
| 710 | Ga0395898_0005570 | 3300037466 | Bacteria | 13576 |
| 711 | Ga0395898_0026680 | 3300037466 | Bacteria | 5807 |
| 712 | Ga0395898_0033109 | 3300037466 | Bacteria | 5159 |
| 713 | Ga0395898_0035313 | 3300037466 | Bacteria | 4973 |
| 714 | Ga0395898_0035595 | 3300037466 | Bacteria | 4948 |
| 715 | Ga0395898_0040518 | 3300037466 | Bacteria | 4606 |
| 716 | Ga0395898_0069894 | 3300037466 | Unclassified | 3396 |
| 717 | Ga0395898_0112977 | 3300037466 | Bacteria | 2603 |
| 718 | Ga0395898_0145358 | 3300037466 | Bacteria | 2269 |
| 719 | Ga0395898_0178520 | 3300037466 | Bacteria | 2029 |
| 720 | Ga0395898_0208555 | 3300037466 | Bacteria | 1864 |
| 721 | Ga0395898_0210759 | 3300037466 | Bacteria | 1853 |
| 722 | Ga0395898_0223818 | 3300037466 | Unclassified | 1795 |
| 723 | Ga0395898_0291811 | 3300037466 | Bacteria | 1556 |
| 724 | Ga0395898_0295351 | 3300037466 | Bacteria | 1546 |
| 725 | Ga0395898_0304188 | 3300037466 | Archaea | 1521 |
| 726 | Ga0395898_0634839 | 3300037466 | Bacteria | 1010 |
| 727 | Ga0395898_0685312 | 3300037466 | Bacteria | 967 |
| 728 | Ga0395898_0991720 | 3300037466 | Bacteria | 776 |
| 729 | Ga0395898_1229414 | 3300037466 | Bacteria | 680 |
| 730 | Ga0395898_1367412 | 3300037466 | Unclassified | 636 |
| 731 | Ga0395898_1588481 | 3300037466 | Bacteria | 578 |
| 732 | Ga0395905_0004008 | 3300037471 | Bacteria | 15477 |
| 733 | Ga0395905_0010346 | 3300037471 | Bacteria | 9079 |
| 734 | Ga0395905_0011656 | 3300037471 | Bacteria | 8489 |
| 735 | Ga0395905_0025570 | 3300037471 | Bacteria | 5567 |
| 736 | Ga0395905_0031491 | 3300037471 | Bacteria | 4994 |
| 737 | Ga0395905_0037383 | 3300037471 | Bacteria | 4558 |
| 738 | Ga0395905_0053318 | 3300037471 | Bacteria | 3785 |
| 739 | Ga0395905_0096239 | 3300037471 | Unclassified | 2779 |
| 740 | Ga0395905_0177897 | 3300037471 | Bacteria | 1997 |
| 741 | Ga0395905_0310604 | 3300037471 | Bacteria | 1465 |
| 742 | Ga0395905_0528232 | 3300037471 | Bacteria | 1080 |
| 743 | Ga0395905_0567972 | 3300037471 | Bacteria | 1036 |
| 744 | Ga0395901_0009445 | 3300038443 | Bacteria | 9895 |
| 745 | Ga0395901_0015959 | 3300038443 | Bacteria | 7651 |
| 746 | Ga0395901_0018845 | 3300038443 | Bacteria | 7054 |
| 747 | Ga0395901_0033635 | 3300038443 | Bacteria | 5293 |
| 748 | Ga0395901_0038276 | 3300038443 | Bacteria | 4961 |
| 749 | Ga0395901_0059703 | 3300038443 | Bacteria | 3968 |
| 750 | Ga0395901_0063865 | 3300038443 | Bacteria | 3832 |
| 751 | Ga0395901_0083377 | 3300038443 | Bacteria | 3341 |
| 752 | Ga0395901_0094138 | 3300038443 | Bacteria | 3138 |
| 753 | Ga0395901_0162709 | 3300038443 | Bacteria | 2343 |
| 754 | Ga0395901_0224018 | 3300038443 | Bacteria | 1965 |
| 755 | Ga0395901_0316432 | 3300038443 | Unclassified | 1616 |
| 756 | Ga0395901_0344580 | 3300038443 | Bacteria | 1539 |
| 757 | Ga0395901_0402782 | 3300038443 | Bacteria | 1405 |
| 758 | Ga0395901_0968412 | 3300038443 | Bacteria | 828 |
| 759 | Ga0395901_1220753 | 3300038443 | Bacteria | 717 |
| 760 | Ga0395901_1258385 | 3300038443 | Bacteria | 703 |
| 761 | Ga0395901_1510270 | 3300038443 | Bacteria | 627 |
| 762 | Ga0395901_1776392 | 3300038443 | Bacteria | 566 |
| 763 | Ga0395901_1995259 | 3300038443 | Bacteria | 526 |
| 764 | Ga0436360_0951681 | 3300039438 | Bacteria | 7280 |
| 765 | Ga0436360_1157905 | 3300039438 | Bacteria | 935 |
| 766 | Ga0436363_0888617 | 3300039450 | Bacteria | 635 |
| 767 | Ga0436363_1488566 | 3300039450 | Bacteria | 1063 |
| 768 | Ga0436362_0754288 | 3300039453 | Bacteria | 502 |
| 769 | Ga0439438_095989 | 3300041405 | Bacteria | 720 |
| 770 | Ga0439438_096486 | 3300041405 | Bacteria | 718 |
| 771 | Ga0439439_0010319 | 3300041406 | Bacteria | 2231 |
| 772 | Ga0439439_0160852 | 3300041406 | Bacteria | 641 |
| 773 | Ga0439439_0178182 | 3300041406 | Bacteria | 611 |
| 774 | Ga0439461_0000619 | 3300041410 | Bacteria | 5124 |
| 775 | Ga0439461_0037683 | 3300041410 | Bacteria | 1034 |
| 776 | Ga0439466_0020576 | 3300041411 | Bacteria | 2350 |
| 777 | Ga0439466_0034957 | 3300041411 | Bacteria | 1701 |
| 778 | Ga0439465_0079624 | 3300041413 | Bacteria | 1109 |
| 779 | Ga0439465_0252795 | 3300041413 | Bacteria | 652 |
| 780 | Ga0451787_498795 | 3300041441 | Bacteria | 938 |
| 781 | Ga0451800_1006391 | 3300041459 | Bacteria | 1005 |
| 782 | Ga0451802_1694304 | 3300041460 | Bacteria | 747 |
| 783 | Ga0451807_0378497 | 3300041486 | Bacteria | 616 |
| 784 | Ga0451833_0670140 | 3300041491 | Bacteria | 719 |
| 785 | Ga0451843_1366079 | 3300041509 | Bacteria | 1320 |
| 786 | Ga0451853_0882388 | 3300041512 | Bacteria | 1081 |
| 787 | Ga0439431_0014907 | 3300041997 | Bacteria | 1806 |
| 788 | Ga0439431_0260470 | 3300041997 | Bacteria | 516 |
| 789 | Ga0439433_0095913 | 3300041999 | Bacteria | 733 |
| 790 | Ga0439433_0106392 | 3300041999 | Bacteria | 699 |
| 791 | Ga0439437_004317 | 3300042000 | Bacteria | 1549 |
| 792 | Ga0439441_029176 | 3300042001 | Bacteria | 1061 |
| 793 | Ga0439442_025999 | 3300042002 | Bacteria | 1218 |
| 794 | Ga0439445_0012137 | 3300042004 | Bacteria | 2066 |
| 795 | Ga0439445_0025725 | 3300042004 | Bacteria | 1503 |
| 796 | Ga0439445_0179855 | 3300042004 | Bacteria | 621 |
| 797 | Ga0439448_0030851 | 3300042005 | Bacteria | 1702 |
| 798 | Ga0439448_0085420 | 3300042005 | Bacteria | 1063 |
| 799 | Ga0439448_0235799 | 3300042005 | Bacteria | 644 |
| 800 | Ga0439432_052677 | 3300042006 | Unclassified | 1267 |
| 801 | Ga0439432_133780 | 3300042006 | Bacteria | 731 |
| 802 | Ga0439449_0031177 | 3300042007 | Bacteria | 1987 |
| 803 | Ga0439450_123045 | 3300042008 | Bacteria | 669 |
| 804 | Ga0439451_005011 | 3300042009 | Bacteria | 2694 |
| 805 | Ga0439451_122909 | 3300042009 | Bacteria | 529 |
| 806 | Ga0439452_081638 | 3300042010 | Unclassified | 704 |
| 807 | Ga0439454_010851 | 3300042011 | Bacteria | 1207 |
| 808 | Ga0439454_011510 | 3300042011 | Bacteria | 1183 |
| 809 | Ga0439454_062647 | 3300042011 | Bacteria | 648 |
| 810 | Ga0439456_054646 | 3300042013 | Bacteria | 874 |
| 811 | Ga0439457_052188 | 3300042014 | Bacteria | 919 |
| 812 | Ga0439457_076226 | 3300042014 | Bacteria | 768 |
| 813 | Ga0439462_0001216 | 3300042015 | Bacteria | 5635 |
| 814 | Ga0439462_0023904 | 3300042015 | Bacteria | 1603 |
| 815 | Ga0439462_0146042 | 3300042015 | Bacteria | 664 |
| 816 | Ga0439463_064454 | 3300042016 | Bacteria | 937 |
| 817 | Ga0439463_210321 | 3300042016 | Bacteria | 505 |
| 818 | Ga0450914_010151 | 3300042118 | Bacteria | 905 |
| 819 | Ga0450915_002864 | 3300042119 | Bacteria | 936 |
| 820 | Ga0450915_003205 | 3300042119 | Bacteria | 907 |
| 821 | Ga0450920_007020 | 3300042122 | Bacteria | 2035 |
| 822 | Ga0450923_004638 | 3300042125 | Bacteria | 2166 |
| 823 | Ga0450888_008357 | 3300042126 | Bacteria | 1164 |
| 824 | Ga0450890_017802 | 3300042127 | Bacteria | 947 |
| 825 | Ga0450898_025234 | 3300042134 | Bacteria | 1066 |
| 826 | Ga0450898_061645 | 3300042134 | Bacteria | 739 |
| 827 | Ga0450898_133927 | 3300042134 | Bacteria | 535 |
| 828 | Ga0450900_023403 | 3300042136 | Bacteria | 872 |
| 829 | Ga0450902_060043 | 3300042137 | Bacteria | 657 |
| 830 | Ga0450904_019231 | 3300042139 | Bacteria | 690 |
| 831 | Ga0450907_013427 | 3300042146 | Bacteria | 1365 |
| 832 | Ga0450907_016232 | 3300042146 | Bacteria | 1242 |
| 833 | Ga0450907_018107 | 3300042146 | Bacteria | 1177 |
| 834 | Ga0450910_015813 | 3300042147 | Bacteria | 1112 |
| 835 | Ga0450910_084384 | 3300042147 | Bacteria | 558 |
| 836 | Ga0439446_0001871 | 3300042156 | Bacteria | 4942 |
| 837 | Ga0439446_0002997 | 3300042156 | Bacteria | 4133 |
| 838 | Ga0439446_0067040 | 3300042156 | Bacteria | 1093 |
| 839 | Ga0439446_0074421 | 3300042156 | Bacteria | 1043 |
| 840 | Ga0439458_0128823 | 3300042157 | Bacteria | 670 |
| 841 | Ga0450908_026382 | 3300042184 | Bacteria | 1014 |
| 842 | Ga0450908_109462 | 3300042184 | Bacteria | 510 |
| 843 | Ga0450909_037546 | 3300042185 | Bacteria | 742 |
| 844 | Ga0439434_0003699 | 3300042435 | Bacteria | 4475 |
| 845 | Ga0439434_0013912 | 3300042435 | Bacteria | 2391 |
| 846 | Ga0439434_0015819 | 3300042435 | Bacteria | 2250 |
| 847 | Ga0439434_0033142 | 3300042435 | Bacteria | 1573 |
| 848 | Ga0439435_0010298 | 3300042436 | Bacteria | 2215 |
| 849 | Ga0439435_0211134 | 3300042436 | Bacteria | 643 |
| 850 | Ga0439435_0236384 | 3300042436 | Bacteria | 612 |
| 851 | Ga0439459_0063100 | 3300042438 | Bacteria | 841 |
| 852 | Ga0439464_0234559 | 3300042439 | Bacteria | 591 |
| 853 | Ga0439460_0105236 | 3300042461 | Bacteria | 911 |
| 854 | Ga0439460_0122681 | 3300042461 | Bacteria | 851 |
| 855 | Ga0439460_0255701 | 3300042461 | Bacteria | 606 |
| 856 | Ga0450918_041960 | 3300042531 | Bacteria | 822 |
| 857 | Ga0450918_042988 | 3300042531 | Bacteria | 813 |
| 858 | Ga0450918_065991 | 3300042531 | Bacteria | 674 |
| 859 | Ga0450893_0044938 | 3300042532 | Bacteria | 817 |
| 860 | Ga0466969_0187795 | 3300044656 | Unclassified | 945 |
| 861 | Ga0466969_0372773 | 3300044656 | Unclassified | 647 |
| 862 | Ga0466972_0087994 | 3300044658 | Bacteria | 1475 |
| 863 | Ga0466965_0677716 | 3300044683 | Unclassified | 590 |
| 864 | Ga0466966_0007359 | 3300044684 | Bacteria | 7302 |
| 865 | Ga0466966_0020640 | 3300044684 | Bacteria | 4329 |
| 866 | Ga0466966_0090441 | 3300044684 | Bacteria | 1901 |
| 867 | Ga0466966_0096023 | 3300044684 | Bacteria | 1836 |
| 868 | Ga0466961_0025304 | 3300044693 | Bacteria | 3817 |
| 869 | Ga0466961_0088882 | 3300044693 | Bacteria | 1951 |
| 870 | Ga0466961_0104429 | 3300044693 | Bacteria | 1784 |
| 871 | Ga0466961_0631236 | 3300044693 | Unclassified | 643 |
| 872 | Ga0466961_0846082 | 3300044693 | Bacteria | 545 |
| 873 | Ga0466963_0002360 | 3300044694 | Bacteria | 10539 |
| 874 | Ga0466963_0004483 | 3300044694 | Bacteria | 8125 |
| 875 | Ga0466963_0138988 | 3300044694 | Bacteria | 1682 |
| 876 | Ga0466963_0175164 | 3300044694 | Unclassified | 1496 |
| 877 | Ga0466963_0196714 | 3300044694 | Bacteria | 1409 |
| 878 | Ga0466963_0211471 | 3300044694 | Bacteria | 1357 |
| 879 | Ga0466963_0367608 | 3300044694 | Bacteria | 1013 |
| 880 | Ga0466963_0371625 | 3300044694 | Bacteria | 1007 |
| 881 | Ga0466964_0049424 | 3300044706 | Bacteria | 1722 |
| 882 | Ga0466964_0061381 | 3300044706 | Bacteria | 1565 |
| 883 | Ga0466971_0201931 | 3300044719 | Bacteria | 938 |
| 884 | Ga0466968_0202019 | 3300044735 | Bacteria | 931 |
| 885 | Ga0466970_0433797 | 3300044765 | Unclassified | 752 |
| 886 | Ga0466957_0016927 | 3300044842 | Bacteria | 4266 |
| 887 | Ga0466957_0135131 | 3300044842 | Bacteria | 1584 |
| 888 | Ga0466957_0147570 | 3300044842 | Bacteria | 1519 |
| 889 | Ga0466957_0249409 | 3300044842 | Bacteria | 1180 |
| 890 | Ga0466957_1104981 | 3300044842 | Bacteria | 572 |
| 891 | Ga0466960_0045272 | 3300044901 | Bacteria | 2101 |
| 892 | Ga0466960_0084219 | 3300044901 | Bacteria | 1609 |
| 893 | Ga0466960_0178347 | 3300044901 | Bacteria | 1150 |
| 894 | Ga0466960_0591429 | 3300044901 | Bacteria | 658 |
| 895 | Ga0466960_0625060 | 3300044901 | Bacteria | 641 |
| 896 | Ga0466960_0767288 | 3300044901 | Archaea | 582 |
| 897 | Ga0466960_1051913 | 3300044901 | Bacteria | 502 |
| 898 | Ga0466959_0008749 | 3300045049 | Bacteria | 7167 |
| 899 | Ga0451576_0115815 | 3300045051 | Bacteria | 2790 |
| 900 | Ga0451576_1587058 | 3300045051 | Bacteria | 679 |
| 901 | Ga0466958_0004955 | 3300045836 | Bacteria | 7106 |
| 902 | Ga0466958_0015048 | 3300045836 | Bacteria | 4426 |
| 903 | Ga0466958_0036322 | 3300045836 | Bacteria | 2949 |
| 904 | Ga0466958_0136163 | 3300045836 | Bacteria | 1544 |
| 905 | Ga0466958_0138350 | 3300045836 | Bacteria | 1532 |
| 906 | Ga0466967_0006350 | 3300045976 | Bacteria | 8348 |
| 907 | Ga0466967_0016066 | 3300045976 | Bacteria | 5890 |
| 908 | Ga0466967_0067733 | 3300045976 | Bacteria | 3185 |
| 909 | Ga0466967_0180731 | 3300045976 | Bacteria | 1990 |
| 910 | Ga0466967_0263236 | 3300045976 | Unclassified | 1650 |
| 911 | Ga0466967_0326778 | 3300045976 | Bacteria | 1480 |
| 912 | Ga0466967_0413182 | 3300045976 | Bacteria | 1314 |
| 913 | Ga0466967_0445980 | 3300045976 | Unclassified | 1264 |
| 914 | Ga0466967_1311720 | 3300045976 | Bacteria | 721 |
| 915 | Ga0495617_073853 | 3300046452 | Bacteria | 1120 |
| 916 | Ga0495592_0000888 | 3300046454 | Bacteria | 20740 |
| 917 | Ga0495592_0124100 | 3300046454 | Bacteria | 1813 |
| 918 | Ga0495603_0165183 | 3300046455 | Bacteria | 1283 |
| 919 | Ga0495603_0873762 | 3300046455 | Bacteria | 511 |
| 920 | Ga0495590_0254741 | 3300046457 | Bacteria | 654 |
| 921 | Ga0495591_047010 | 3300046458 | Bacteria | 1197 |
| 922 | Ga0495629_0252696 | 3300046459 | Bacteria | 1213 |
| 923 | Ga0495629_0852333 | 3300046459 | Bacteria | 599 |
| 924 | Ga0495629_0900201 | 3300046459 | Bacteria | 580 |
| 925 | Ga0495641_0503644 | 3300046461 | Unclassified | 552 |
| 926 | Ga0495651_0000180 | 3300046462 | Bacteria | 46908 |
| 927 | Ga0495651_0600715 | 3300046462 | Bacteria | 694 |
| 928 | Ga0495653_0002924 | 3300046463 | Bacteria | 13667 |
| 929 | Ga0495653_0635130 | 3300046463 | Bacteria | 653 |
| 930 | Ga0495650_0189396 | 3300046471 | Bacteria | 720 |
| 931 | Ga0495582_0568845 | 3300046473 | Bacteria | 656 |
| 932 | Ga0495605_0032750 | 3300046474 | Bacteria | 2644 |
| 933 | Ga0495605_0288096 | 3300046474 | Bacteria | 697 |
| 934 | Ga0495605_0308889 | 3300046474 | Bacteria | 668 |
| 935 | Ga0495605_0437250 | 3300046474 | Bacteria | 540 |
| 936 | Ga0495639_0295760 | 3300046475 | Bacteria | 807 |
| 937 | Ga0495664_0263796 | 3300046477 | Bacteria | 1041 |
| 938 | Ga0495584_0178201 | 3300046491 | Bacteria | 1080 |
| 939 | Ga0495584_0582548 | 3300046491 | Bacteria | 570 |
| 940 | Ga0495585_0056503 | 3300046492 | Bacteria | 2167 |
| 941 | Ga0495585_0461342 | 3300046492 | Bacteria | 607 |
| 942 | Ga0495585_0600092 | 3300046492 | Bacteria | 518 |
| 943 | Ga0495596_0058005 | 3300046500 | Bacteria | 1510 |
| 944 | Ga0495596_0075595 | 3300046500 | Unclassified | 1308 |
| 945 | Ga0495596_0121458 | 3300046500 | Bacteria | 1014 |
| 946 | Ga0495596_0240682 | 3300046500 | Bacteria | 702 |
| 947 | Ga0495607_0107078 | 3300046501 | Bacteria | 1487 |
| 948 | Ga0495583_0243839 | 3300046506 | Bacteria | 722 |
| 949 | Ga0495583_0292738 | 3300046506 | Bacteria | 648 |
| 950 | Ga0495608_0001686 | 3300046511 | Bacteria | 15858 |
| 951 | Ga0495608_0336179 | 3300046511 | Bacteria | 931 |
| 952 | Ga0495610_0316075 | 3300046512 | Bacteria | 598 |
| 953 | Ga0495616_0054636 | 3300046513 | Bacteria | 1980 |
| 954 | Ga0495616_0210481 | 3300046513 | Bacteria | 851 |
| 955 | Ga0495616_0316762 | 3300046513 | Bacteria | 656 |
| 956 | Ga0495618_0012480 | 3300046514 | Bacteria | 5160 |
| 957 | Ga0495620_0022332 | 3300046515 | Bacteria | 3049 |
| 958 | Ga0495620_0345407 | 3300046515 | Bacteria | 564 |
| 959 | Ga0495628_0000067 | 3300046516 | Bacteria | 85377 |
| 960 | Ga0495628_0788631 | 3300046516 | Bacteria | 665 |
| 961 | Ga0495630_0081846 | 3300046517 | Bacteria | 2436 |
| 962 | Ga0495630_0404854 | 3300046517 | Bacteria | 1045 |
| 963 | Ga0495631_0054944 | 3300046518 | Bacteria | 1735 |
| 964 | Ga0495631_0084610 | 3300046518 | Bacteria | 1367 |
| 965 | Ga0495631_0269111 | 3300046518 | Bacteria | 726 |
| 966 | Ga0495631_0444668 | 3300046518 | Bacteria | 552 |
| 967 | Ga0495632_0142562 | 3300046519 | Bacteria | 1111 |
| 968 | Ga0495632_0520542 | 3300046519 | Bacteria | 512 |
| 969 | Ga0495637_0092707 | 3300046520 | Bacteria | 1189 |
| 970 | Ga0495637_0170921 | 3300046520 | Bacteria | 811 |
| 971 | Ga0495644_0305800 | 3300046523 | Bacteria | 622 |
| 972 | Ga0495642_0009720 | 3300046528 | Bacteria | 3682 |
| 973 | Ga0495652_0000315 | 3300046529 | Bacteria | 57240 |
| 974 | Ga0495640_0946791 | 3300046533 | Bacteria | 509 |
| 975 | Ga0495587_0000287 | 3300046536 | Bacteria | 35735 |
| 976 | Ga0495587_0216058 | 3300046536 | Bacteria | 1082 |
| 977 | Ga0495587_0324175 | 3300046536 | Bacteria | 860 |
| 978 | Ga0495598_0032233 | 3300046537 | Unclassified | 1480 |
| 979 | Ga0495598_0081236 | 3300046537 | Bacteria | 1040 |
| 980 | Ga0495609_0214884 | 3300046538 | Bacteria | 800 |
| 981 | Ga0495609_0356633 | 3300046538 | Bacteria | 589 |
| 982 | Ga0495621_0031654 | 3300046539 | Bacteria | 1816 |
| 983 | Ga0495597_0046898 | 3300046542 | Bacteria | 1914 |
| 984 | Ga0495645_0000234 | 3300046543 | Bacteria | 40275 |
| 985 | Ga0495645_0115844 | 3300046543 | Bacteria | 1892 |
| 986 | Ga0495633_0036714 | 3300046558 | Bacteria | 2347 |
| 987 | Ga0495633_0372087 | 3300046558 | Bacteria | 647 |
| 988 | Ga0495633_0417170 | 3300046558 | Bacteria | 607 |
| 989 | Ga0495667_0051835 | 3300046559 | Bacteria | 2706 |
| 990 | Ga0495667_0060341 | 3300046559 | Bacteria | 2488 |
| 991 | Ga0495656_0144301 | 3300046615 | Bacteria | 1144 |
| 992 | Ga0495656_0240034 | 3300046615 | Bacteria | 912 |
| 993 | Ga0495656_0312135 | 3300046615 | Bacteria | 808 |
| 994 | Ga0495656_0707014 | 3300046615 | Bacteria | 542 |
| 995 | Ga0495668_0126987 | 3300046616 | Bacteria | 1396 |
| 996 | Ga0495668_0333762 | 3300046616 | Bacteria | 832 |
| 997 | Ga0495634_0146005 | 3300046642 | Bacteria | 1499 |
| 998 | Ga0495611_0379181 | 3300046648 | Bacteria | 647 |
| 999 | Ga0495635_0298037 | 3300046663 | Bacteria | 1081 |
| 1000 | Ga0495659_0005392 | 3300046664 | Bacteria | 4023 |
| 1001 | Ga0495659_0177241 | 3300046664 | Bacteria | 867 |
| 1002 | Ga0495661_0073887 | 3300046665 | Bacteria | 1985 |
| 1003 | Ga0495661_0306742 | 3300046665 | Bacteria | 793 |
| 1004 | Ga0495588_0191157 | 3300046674 | Bacteria | 1081 |
| 1005 | Ga0495657_0030413 | 3300046675 | Bacteria | 3782 |
| 1006 | Ga0495657_0034883 | 3300046675 | Bacteria | 3491 |
| 1007 | Ga0495657_0414421 | 3300046675 | Bacteria | 791 |
| 1008 | Ga0495599_0000249 | 3300046678 | Bacteria | 34129 |
| 1009 | Ga0495599_0875064 | 3300046678 | Bacteria | 510 |
| 1010 | Ga0495623_0000144 | 3300046679 | Bacteria | 43790 |
| 1011 | Ga0495623_0257898 | 3300046679 | Bacteria | 978 |
| 1012 | Ga0495646_0000614 | 3300046680 | Bacteria | 19439 |
| 1013 | Ga0495647_0331979 | 3300046681 | Bacteria | 690 |
| 1014 | Ga0495669_0051344 | 3300046684 | Bacteria | 1851 |
| 1015 | Ga0495669_0292207 | 3300046684 | Bacteria | 785 |
| 1016 | Ga0495613_1014977 | 3300046689 | Bacteria | 532 |
| 1017 | Ga0495624_0954229 | 3300046690 | Bacteria | 504 |
| 1018 | Ga0495670_0094543 | 3300046691 | Bacteria | 1533 |
| 1019 | Ga0495670_0443928 | 3300046691 | Bacteria | 703 |
| 1020 | Ga0495670_0445784 | 3300046691 | Bacteria | 701 |
| 1021 | Ga0495670_0790016 | 3300046691 | Bacteria | 518 |
| 1022 | Ga0495671_0141049 | 3300046692 | Bacteria | 1174 |
| 1023 | Ga0495671_0434642 | 3300046692 | Bacteria | 628 |
| 1024 | Ga0495649_0198625 | 3300046694 | Bacteria | 1042 |
| 1025 | Ga0495589_0040099 | 3300046794 | Bacteria | 2339 |
| 1026 | Ga0495589_0091039 | 3300046794 | Bacteria | 1481 |
| 1027 | Ga0495589_0129373 | 3300046794 | Bacteria | 1213 |
| 1028 | Ga0495589_0377739 | 3300046794 | Bacteria | 651 |
| 1029 | Ga0495600_0190425 | 3300046809 | Unclassified | 1319 |
| 1030 | Ga0495600_0195398 | 3300046809 | Bacteria | 1300 |
| 1031 | Ga0495600_0584456 | 3300046809 | Bacteria | 680 |
| 1032 | Ga0495660_0077023 | 3300046810 | Bacteria | 1756 |
| 1033 | Ga0495660_0255491 | 3300046810 | Bacteria | 811 |
| 1034 | Ga0495660_0336195 | 3300046810 | Bacteria | 675 |
| 1035 | Ga0495660_0382387 | 3300046810 | Bacteria | 620 |
| 1036 | Ga0495581_0186089 | 3300047315 | Bacteria | 1215 |
| 1037 | Ga0495604_0000076 | 3300047317 | Bacteria | 85332 |
| 1038 | Ga0495604_0224250 | 3300047317 | Bacteria | 1292 |
| 1039 | Ga0495604_0666779 | 3300047317 | Bacteria | 662 |
| 1040 | Ga0495636_0043642 | 3300047318 | Bacteria | 1866 |
| 1041 | Ga0495636_0426777 | 3300047318 | Bacteria | 634 |
| 1042 | Ga0495674_0323066 | 3300047319 | Bacteria | 1257 |
| 1043 | Ga0495674_0677644 | 3300047319 | Bacteria | 811 |
| 1044 | Ga0495680_0056788 | 3300047322 | Bacteria | 3030 |
| 1045 | Ga0495680_0151804 | 3300047322 | Unclassified | 1688 |
| 1046 | Ga0495683_0021829 | 3300047323 | Bacteria | 3298 |
| 1047 | Ga0495683_0424280 | 3300047323 | Bacteria | 549 |
| 1048 | Ga0495675_0015013 | 3300047444 | Bacteria | 4896 |
| 1049 | Ga0495675_0175608 | 3300047444 | Bacteria | 1314 |
| 1050 | Ga0495677_0014856 | 3300047445 | Bacteria | 2832 |
| 1051 | Ga0495679_065970 | 3300047446 | Bacteria | 1052 |
| 1052 | Ga0495679_134141 | 3300047446 | Bacteria | 671 |
| 1053 | Ga0495679_137826 | 3300047446 | Bacteria | 660 |
| 1054 | Ga0495685_034722 | 3300047447 | Bacteria | 1733 |
| 1055 | Ga0495681_0028720 | 3300047470 | Bacteria | 2857 |
| 1056 | Ga0495681_0226384 | 3300047470 | Bacteria | 748 |
| 1057 | Ga0495684_0020664 | 3300047471 | Bacteria | 5073 |
| 1058 | Ga0495684_0897722 | 3300047471 | Bacteria | 571 |
| 1059 | Ga0495593_0601021 | 3300047673 | Bacteria | 552 |
| 1060 | Ga0495602_0000247 | 3300048088 | Bacteria | 50489 |
| 1061 | Ga0495614_0329403 | 3300048089 | Bacteria | 709 |
| 1062 | Ga0495615_0013300 | 3300048090 | Bacteria | 1717 |
| 1063 | Ga0495626_0241050 | 3300048091 | Bacteria | 728 |
| 1064 | Ga0496100_0175107 | 3300048903 | Bacteria | 1548 |
| 1065 | Ga0496100_0303868 | 3300048903 | Bacteria | 1195 |
| 1066 | Ga0496100_1538221 | 3300048903 | Bacteria | 526 |
| 1067 | Ga0496101_0078025 | 3300048904 | Bacteria | 2442 |
| 1068 | Ga0496101_0841511 | 3300048904 | Bacteria | 723 |
| 1069 | Ga0496101_1169584 | 3300048904 | Bacteria | 603 |
| 1070 | Ga0496101_1326021 | 3300048904 | Bacteria | 562 |
| 1071 | Ga0496102_0615589 | 3300048905 | Bacteria | 1009 |
| 1072 | Ga0496102_0759579 | 3300048905 | Bacteria | 892 |
| 1073 | Ga0496102_1213080 | 3300048905 | Bacteria | 674 |
| 1074 | Ga0496102_1418269 | 3300048905 | Bacteria | 613 |
| 1075 | Ga0496103_0192928 | 3300048906 | Bacteria | 1310 |
| 1076 | Ga0496103_0384997 | 3300048906 | Bacteria | 901 |
| 1077 | Ga0496104_0003234 | 3300048907 | Bacteria | 14027 |
| 1078 | Ga0496104_0158074 | 3300048907 | Bacteria | 2175 |
| 1079 | Ga0496105_0083225 | 3300048908 | Bacteria | 2643 |
| 1080 | Ga0496106_0212251 | 3300048909 | Bacteria | 1542 |
| 1081 | Ga0496106_0374663 | 3300048909 | Bacteria | 1144 |
| 1082 | Ga0496106_0847823 | 3300048909 | Bacteria | 723 |
| 1083 | Ga0496107_0096029 | 3300048910 | Bacteria | 2169 |
| 1084 | Ga0496107_0098643 | 3300048910 | Bacteria | 2140 |
| 1085 | Ga0496107_0445779 | 3300048910 | Bacteria | 962 |
| 1086 | Ga0496107_0791404 | 3300048910 | Bacteria | 695 |
| 1087 | Ga0496108_0004178 | 3300048911 | Bacteria | 11627 |
| 1088 | Ga0496108_0018043 | 3300048911 | Bacteria | 5773 |
| 1089 | Ga0496108_0044721 | 3300048911 | Bacteria | 3696 |
| 1090 | Ga0496108_0123552 | 3300048911 | Bacteria | 2221 |
| 1091 | Ga0496108_0173491 | 3300048911 | Bacteria | 1866 |
| 1092 | Ga0496108_0185332 | 3300048911 | Bacteria | 1803 |
| 1093 | Ga0496108_1161403 | 3300048911 | Bacteria | 654 |
| 1094 | Ga0496108_1794579 | 3300048911 | Bacteria | 502 |
| 1095 | Ga0496109_0005943 | 3300048912 | Bacteria | 10242 |
| 1096 | Ga0496109_0011028 | 3300048912 | Bacteria | 7746 |
| 1097 | Ga0496109_0030731 | 3300048912 | Bacteria | 4814 |
| 1098 | Ga0496109_0102452 | 3300048912 | Bacteria | 2656 |
| 1099 | Ga0496109_0198403 | 3300048912 | Bacteria | 1887 |
| 1100 | Ga0496109_0420874 | 3300048912 | Bacteria | 1262 |
| 1101 | Ga0496110_0004216 | 3300048913 | Bacteria | 11120 |
| 1102 | Ga0496110_0027118 | 3300048913 | Bacteria | 4908 |
| 1103 | Ga0496110_0350691 | 3300048913 | Bacteria | 1344 |
| 1104 | Ga0496110_1385745 | 3300048913 | Bacteria | 612 |
| 1105 | Ga0496110_1520834 | 3300048913 | Bacteria | 579 |
| 1106 | Ga0496111_0000393 | 3300048914 | Bacteria | 21943 |
| 1107 | Ga0496111_0007348 | 3300048914 | Bacteria | 7211 |
| 1108 | Ga0496111_0090525 | 3300048914 | Bacteria | 2241 |
| 1109 | Ga0496111_0236133 | 3300048914 | Bacteria | 1358 |
| 1110 | Ga0496111_0451377 | 3300048914 | Bacteria | 948 |
| 1111 | Ga0496112_0124184 | 3300048915 | Bacteria | 2552 |
| 1112 | Ga0496113_0014014 | 3300048916 | Bacteria | 5455 |
| 1113 | Ga0496113_0133419 | 3300048916 | Bacteria | 1950 |
| 1114 | Ga0496113_0345003 | 3300048916 | Bacteria | 1194 |
| 1115 | Ga0496114_0049879 | 3300048917 | Bacteria | 3483 |
| 1116 | Ga0496114_0190020 | 3300048917 | Bacteria | 1797 |
| 1117 | Ga0496114_0271639 | 3300048917 | Bacteria | 1494 |
| 1118 | Ga0496114_0556989 | 3300048917 | Unclassified | 1013 |
| 1119 | Ga0496114_0792951 | 3300048917 | Bacteria | 826 |
| 1120 | Ga0496114_1029061 | 3300048917 | Bacteria | 707 |
| 1121 | Ga0496115_0255332 | 3300048918 | Bacteria | 1442 |
| 1122 | Ga0501309_089122 | 3300049129 | Bacteria | 524 |
| 1123 | Ga0501307_038129 | 3300049162 | Bacteria | 690 |
| 1124 | Ga0501299_209127 | 3300049522 | Bacteria | 522 |
| 1125 | Ga0501311_036429 | 3300049527 | Bacteria | 731 |
| 1126 | Ga0501313_044581 | 3300049529 | Bacteria | 603 |
| 1127 | Ga0501316_071380 | 3300049532 | Bacteria | 526 |
| 1128 | Ga0501317_085189 | 3300049533 | Bacteria | 552 |
| 1129 | Ga0501321_039901 | 3300049537 | Bacteria | 657 |
| 1130 | Ga0501031_0000706 | 3300049568 | Bacteria | 19927 |
| 1131 | Ga0501031_0005850 | 3300049568 | Bacteria | 8015 |
| 1132 | Ga0501031_0043735 | 3300049568 | Bacteria | 2922 |
| 1133 | Ga0501031_0050750 | 3300049568 | Bacteria | 2702 |
| 1134 | Ga0501031_0110681 | 3300049568 | Bacteria | 1793 |
| 1135 | Ga0501031_0130436 | 3300049568 | Bacteria | 1642 |
| 1136 | Ga0501031_0130858 | 3300049568 | Bacteria | 1639 |
| 1137 | Ga0501031_0187617 | 3300049568 | Bacteria | 1350 |
| 1138 | Ga0501031_0198994 | 3300049568 | Bacteria | 1307 |
| 1139 | Ga0501031_0200654 | 3300049568 | Bacteria | 1301 |
| 1140 | Ga0501031_0530971 | 3300049568 | Unclassified | 758 |
| 1141 | Ga0501031_0701890 | 3300049568 | Bacteria | 649 |
| 1142 | Ga0501031_0794061 | 3300049568 | Bacteria | 607 |
| 1143 | Ga0501031_0921361 | 3300049568 | Bacteria | 559 |
| 1144 | Ga0501032_0016227 | 3300049569 | Bacteria | 5239 |
| 1145 | Ga0501032_0018329 | 3300049569 | Bacteria | 4905 |
| 1146 | Ga0501032_0047603 | 3300049569 | Bacteria | 2895 |
| 1147 | Ga0501032_0114899 | 3300049569 | Bacteria | 1780 |
| 1148 | Ga0501032_0152060 | 3300049569 | Bacteria | 1521 |
| 1149 | Ga0501032_0717000 | 3300049569 | Bacteria | 633 |
| 1150 | Ga0501033_0010945 | 3300049570 | Bacteria | 6953 |
| 1151 | Ga0501033_0170851 | 3300049570 | Bacteria | 1561 |
| 1152 | Ga0501033_0260823 | 3300049570 | Bacteria | 1226 |
| 1153 | Ga0501033_0312085 | 3300049570 | Unclassified | 1105 |
| 1154 | Ga0501033_0331947 | 3300049570 | Bacteria | 1067 |
| 1155 | Ga0501033_0353750 | 3300049570 | Bacteria | 1028 |
| 1156 | Ga0501033_1188061 | 3300049570 | Bacteria | 505 |
| 1157 | Ga0501034_0005653 | 3300049571 | Bacteria | 13605 |
| 1158 | Ga0501034_0195508 | 3300049571 | Bacteria | 1983 |
| 1159 | Ga0501034_0283514 | 3300049571 | Bacteria | 1596 |
| 1160 | Ga0501034_0755012 | 3300049571 | Bacteria | 868 |
| 1161 | Ga0501034_1028107 | 3300049571 | Unclassified | 707 |
| 1162 | Ga0501034_1444928 | 3300049571 | Bacteria | 562 |
| 1163 | Ga0501036_0003757 | 3300049572 | Bacteria | 12167 |
| 1164 | Ga0501036_0007382 | 3300049572 | Bacteria | 8956 |
| 1165 | Ga0501036_0035879 | 3300049572 | Bacteria | 4195 |
| 1166 | Ga0501036_0062512 | 3300049572 | Bacteria | 3153 |
| 1167 | Ga0501036_0113188 | 3300049572 | Bacteria | 2293 |
| 1168 | Ga0501036_0121770 | 3300049572 | Bacteria | 2203 |
| 1169 | Ga0501036_0124465 | 3300049572 | Bacteria | 2177 |
| 1170 | Ga0501036_0150408 | 3300049572 | Bacteria | 1963 |
| 1171 | Ga0501036_0337166 | 3300049572 | Bacteria | 1259 |
| 1172 | Ga0501036_0631634 | 3300049572 | Bacteria | 887 |
| 1173 | Ga0501036_0780228 | 3300049572 | Bacteria | 787 |
| 1174 | Ga0501037_0006885 | 3300049573 | Bacteria | 8304 |
| 1175 | Ga0501037_0023639 | 3300049573 | Bacteria | 4544 |
| 1176 | Ga0501037_0119963 | 3300049573 | Bacteria | 1891 |
| 1177 | Ga0501037_0144876 | 3300049573 | Bacteria | 1699 |
| 1178 | Ga0501037_0257106 | 3300049573 | Bacteria | 1221 |
| 1179 | Ga0501037_0327762 | 3300049573 | Bacteria | 1059 |
| 1180 | Ga0501037_0735831 | 3300049573 | Bacteria | 654 |
| 1181 | Ga0501037_1075436 | 3300049573 | Bacteria | 522 |
| 1182 | Ga0501038_0001115 | 3300049574 | Bacteria | 24376 |
| 1183 | Ga0501038_0009144 | 3300049574 | Bacteria | 9091 |
| 1184 | Ga0501038_0013764 | 3300049574 | Bacteria | 7372 |
| 1185 | Ga0501038_0018951 | 3300049574 | Bacteria | 6210 |
| 1186 | Ga0501038_0028196 | 3300049574 | Bacteria | 4989 |
| 1187 | Ga0501038_0157363 | 3300049574 | Bacteria | 1849 |
| 1188 | Ga0501038_0234398 | 3300049574 | Bacteria | 1459 |
| 1189 | Ga0501039_0000660 | 3300049575 | Bacteria | 24915 |
| 1190 | Ga0501039_0007924 | 3300049575 | Bacteria | 8094 |
| 1191 | Ga0501039_0008099 | 3300049575 | Bacteria | 8006 |
| 1192 | Ga0501039_0033291 | 3300049575 | Bacteria | 3975 |
| 1193 | Ga0501039_0041562 | 3300049575 | Bacteria | 3551 |
| 1194 | Ga0501039_0049372 | 3300049575 | Bacteria | 3252 |
| 1195 | Ga0501039_0053511 | 3300049575 | Bacteria | 3124 |
| 1196 | Ga0501039_0074546 | 3300049575 | Bacteria | 2637 |
| 1197 | Ga0501039_0086913 | 3300049575 | Bacteria | 2435 |
| 1198 | Ga0501039_0266870 | 3300049575 | Bacteria | 1345 |
| 1199 | Ga0501039_0511975 | 3300049575 | Bacteria | 942 |
| 1200 | Ga0501039_1227992 | 3300049575 | Bacteria | 579 |
| 1201 | Ga0501039_1266092 | 3300049575 | Bacteria | 569 |
| 1202 | Ga0501040_0000728 | 3300049576 | Bacteria | 20356 |
| 1203 | Ga0501040_0006365 | 3300049576 | Bacteria | 7667 |
| 1204 | Ga0501040_0010406 | 3300049576 | Bacteria | 6081 |
| 1205 | Ga0501040_0017443 | 3300049576 | Bacteria | 4766 |
| 1206 | Ga0501040_0040218 | 3300049576 | Bacteria | 3181 |
| 1207 | Ga0501040_0054331 | 3300049576 | Bacteria | 2745 |
| 1208 | Ga0501040_0106290 | 3300049576 | Bacteria | 1961 |
| 1209 | Ga0501040_0208933 | 3300049576 | Bacteria | 1387 |
| 1210 | Ga0501040_0244845 | 3300049576 | Bacteria | 1278 |
| 1211 | Ga0501040_0315473 | 3300049576 | Bacteria | 1118 |
| 1212 | Ga0501041_0003781 | 3300049577 | Bacteria | 8710 |
| 1213 | Ga0501041_0003881 | 3300049577 | Bacteria | 8608 |
| 1214 | Ga0501041_0008611 | 3300049577 | Bacteria | 6009 |
| 1215 | Ga0501041_0013072 | 3300049577 | Bacteria | 4920 |
| 1216 | Ga0501041_0014750 | 3300049577 | Bacteria | 4640 |
| 1217 | Ga0501041_0051949 | 3300049577 | Bacteria | 2498 |
| 1218 | Ga0501041_0064403 | 3300049577 | Bacteria | 2245 |
| 1219 | Ga0501041_0107124 | 3300049577 | Bacteria | 1732 |
| 1220 | Ga0501041_0620415 | 3300049577 | Bacteria | 690 |
| 1221 | Ga0501041_0903048 | 3300049577 | Bacteria | 567 |
| 1222 | Ga0501042_0002963 | 3300049578 | Bacteria | 10555 |
| 1223 | Ga0501042_0007578 | 3300049578 | Bacteria | 7120 |
| 1224 | Ga0501042_0011188 | 3300049578 | Bacteria | 6045 |
| 1225 | Ga0501042_0031230 | 3300049578 | Bacteria | 3768 |
| 1226 | Ga0501042_0047422 | 3300049578 | Bacteria | 3064 |
| 1227 | Ga0501042_0061732 | 3300049578 | Bacteria | 2677 |
| 1228 | Ga0501042_0084864 | 3300049578 | Bacteria | 2271 |
| 1229 | Ga0501042_0092038 | 3300049578 | Bacteria | 2177 |
| 1230 | Ga0501042_0106568 | 3300049578 | Bacteria | 2017 |
| 1231 | Ga0501042_0126877 | 3300049578 | Bacteria | 1837 |
| 1232 | Ga0501042_0159818 | 3300049578 | Bacteria | 1625 |
| 1233 | Ga0501042_0586818 | 3300049578 | Bacteria | 810 |
| 1234 | Ga0501042_0755061 | 3300049578 | Bacteria | 707 |
| 1235 | Ga0501043_0007842 | 3300049579 | Bacteria | 8440 |
| 1236 | Ga0501043_0008472 | 3300049579 | Bacteria | 8093 |
| 1237 | Ga0501043_0128791 | 3300049579 | Bacteria | 1984 |
| 1238 | Ga0501043_0196146 | 3300049579 | Bacteria | 1568 |
| 1239 | Ga0501043_0213485 | 3300049579 | Bacteria | 1495 |
| 1240 | Ga0501043_0285585 | 3300049579 | Bacteria | 1264 |
| 1241 | Ga0501043_0316327 | 3300049579 | Bacteria | 1191 |
| 1242 | Ga0501043_0770107 | 3300049579 | Bacteria | 698 |
| 1243 | Ga0501043_0833945 | 3300049579 | Bacteria | 665 |
| 1244 | Ga0501046_0002216 | 3300049580 | Bacteria | 18331 |
| 1245 | Ga0501046_0002233 | 3300049580 | Bacteria | 18272 |
| 1246 | Ga0501046_0002756 | 3300049580 | Bacteria | 16358 |
| 1247 | Ga0501046_0015022 | 3300049580 | Bacteria | 6514 |
| 1248 | Ga0501046_0078455 | 3300049580 | Bacteria | 2554 |
| 1249 | Ga0501046_0086060 | 3300049580 | Bacteria | 2423 |
| 1250 | Ga0501046_0163140 | 3300049580 | Bacteria | 1675 |
| 1251 | Ga0501046_0199904 | 3300049580 | Bacteria | 1487 |
| 1252 | Ga0501046_0227262 | 3300049580 | Bacteria | 1380 |
| 1253 | Ga0501046_1204015 | 3300049580 | Bacteria | 520 |
| 1254 | Ga0501047_0038295 | 3300049581 | Bacteria | 4639 |
| 1255 | Ga0501047_0350502 | 3300049581 | Bacteria | 1313 |
| 1256 | Ga0501047_0593094 | 3300049581 | Bacteria | 930 |
| 1257 | Ga0501047_0900163 | 3300049581 | Bacteria | 698 |
| 1258 | Ga0501047_1243881 | 3300049581 | Bacteria | 558 |
| 1259 | Ga0501048_0000617 | 3300049582 | Bacteria | 25363 |
| 1260 | Ga0501048_0002324 | 3300049582 | Bacteria | 14507 |
| 1261 | Ga0501048_0012572 | 3300049582 | Bacteria | 6297 |
| 1262 | Ga0501048_0021108 | 3300049582 | Bacteria | 4769 |
| 1263 | Ga0501048_0028857 | 3300049582 | Bacteria | 4027 |
| 1264 | Ga0501048_0043110 | 3300049582 | Bacteria | 3230 |
| 1265 | Ga0501048_0124224 | 3300049582 | Bacteria | 1824 |
| 1266 | Ga0501048_0129074 | 3300049582 | Bacteria | 1787 |
| 1267 | Ga0501048_0186683 | 3300049582 | Bacteria | 1469 |
| 1268 | Ga0501048_0197091 | 3300049582 | Bacteria | 1427 |
| 1269 | Ga0501048_0552426 | 3300049582 | Bacteria | 826 |
| 1270 | Ga0501048_0804473 | 3300049582 | Bacteria | 675 |
| 1271 | Ga0501067_0017114 | 3300049583 | Bacteria | 4005 |
| 1272 | Ga0501067_0093111 | 3300049583 | Bacteria | 1673 |
| 1273 | Ga0501067_0124694 | 3300049583 | Bacteria | 1433 |
| 1274 | Ga0501067_0363775 | 3300049583 | Bacteria | 806 |
| 1275 | Ga0501067_0861478 | 3300049583 | Bacteria | 511 |
| 1276 | Ga0501068_0001134 | 3300049584 | Bacteria | 14115 |
| 1277 | Ga0501068_0002686 | 3300049584 | Bacteria | 9423 |
| 1278 | Ga0501068_0004047 | 3300049584 | Bacteria | 7971 |
| 1279 | Ga0501068_0007077 | 3300049584 | Bacteria | 6213 |
| 1280 | Ga0501068_0008085 | 3300049584 | Bacteria | 5837 |
| 1281 | Ga0501068_0127889 | 3300049584 | Bacteria | 1587 |
| 1282 | Ga0501068_0310113 | 3300049584 | Unclassified | 1011 |
| 1283 | Ga0501068_0364679 | 3300049584 | Bacteria | 929 |
| 1284 | Ga0501068_0626840 | 3300049584 | Bacteria | 701 |
| 1285 | Ga0501068_1117055 | 3300049584 | Bacteria | 521 |
| 1286 | Ga0501069_0000780 | 3300049585 | Bacteria | 14962 |
| 1287 | Ga0501069_0011537 | 3300049585 | Bacteria | 4682 |
| 1288 | Ga0501069_0041592 | 3300049585 | Bacteria | 2540 |
| 1289 | Ga0501069_0079749 | 3300049585 | Bacteria | 1843 |
| 1290 | Ga0501069_0098152 | 3300049585 | Bacteria | 1661 |
| 1291 | Ga0501069_0113580 | 3300049585 | Bacteria | 1544 |
| 1292 | Ga0501069_0152224 | 3300049585 | Bacteria | 1329 |
| 1293 | Ga0501069_0464503 | 3300049585 | Bacteria | 753 |
| 1294 | Ga0501069_0634701 | 3300049585 | Bacteria | 642 |
| 1295 | Ga0501069_0645376 | 3300049585 | Bacteria | 637 |
| 1296 | Ga0501070_0000228 | 3300049586 | Bacteria | 52799 |
| 1297 | Ga0501070_0001876 | 3300049586 | Bacteria | 18572 |
| 1298 | Ga0501070_0008739 | 3300049586 | Bacteria | 8564 |
| 1299 | Ga0501070_0033133 | 3300049586 | Bacteria | 4322 |
| 1300 | Ga0501070_0087975 | 3300049586 | Bacteria | 2571 |
| 1301 | Ga0501070_0137763 | 3300049586 | Bacteria | 2015 |
| 1302 | Ga0501070_0208137 | 3300049586 | Bacteria | 1606 |
| 1303 | Ga0501070_0211776 | 3300049586 | Bacteria | 1590 |
| 1304 | Ga0501070_0298423 | 3300049586 | Bacteria | 1313 |
| 1305 | Ga0501070_0315026 | 3300049586 | Bacteria | 1273 |
| 1306 | Ga0501070_0826016 | 3300049586 | Bacteria | 726 |
| 1307 | Ga0501071_0000685 | 3300049587 | Bacteria | 17722 |
| 1308 | Ga0501071_0002630 | 3300049587 | Bacteria | 10990 |
| 1309 | Ga0501071_0006021 | 3300049587 | Bacteria | 7854 |
| 1310 | Ga0501071_0012211 | 3300049587 | Bacteria | 5816 |
| 1311 | Ga0501071_0014054 | 3300049587 | Bacteria | 5471 |
| 1312 | Ga0501071_0023786 | 3300049587 | Bacteria | 4280 |
| 1313 | Ga0501071_0034268 | 3300049587 | Bacteria | 3612 |
| 1314 | Ga0501071_0061882 | 3300049587 | Bacteria | 2711 |
| 1315 | Ga0501071_0085528 | 3300049587 | Bacteria | 2312 |
| 1316 | Ga0501071_0132942 | 3300049587 | Bacteria | 1849 |
| 1317 | Ga0501071_0308489 | 3300049587 | Bacteria | 1200 |
| 1318 | Ga0501072_0002801 | 3300049588 | Bacteria | 13086 |
| 1319 | Ga0501072_0003033 | 3300049588 | Bacteria | 12663 |
| 1320 | Ga0501072_0011260 | 3300049588 | Bacteria | 6829 |
| 1321 | Ga0501072_0012221 | 3300049588 | Bacteria | 6561 |
| 1322 | Ga0501072_0020766 | 3300049588 | Bacteria | 5090 |
| 1323 | Ga0501072_0033632 | 3300049588 | Bacteria | 4018 |
| 1324 | Ga0501072_0045270 | 3300049588 | Bacteria | 3459 |
| 1325 | Ga0501072_0046765 | 3300049588 | Bacteria | 3407 |
| 1326 | Ga0501072_0080308 | 3300049588 | Bacteria | 2583 |
| 1327 | Ga0501072_0140886 | 3300049588 | Bacteria | 1922 |
| 1328 | Ga0501072_0261462 | 3300049588 | Bacteria | 1377 |
| 1329 | Ga0501072_0557566 | 3300049588 | Bacteria | 905 |
| 1330 | Ga0501072_1517923 | 3300049588 | Bacteria | 517 |
| 1331 | Ga0501073_0005554 | 3300049589 | Bacteria | 9433 |
| 1332 | Ga0501073_0014941 | 3300049589 | Bacteria | 5633 |
| 1333 | Ga0501073_0049645 | 3300049589 | Bacteria | 2941 |
| 1334 | Ga0501073_0090217 | 3300049589 | Bacteria | 2130 |
| 1335 | Ga0501073_0188182 | 3300049589 | Bacteria | 1428 |
| 1336 | Ga0501073_0387582 | 3300049589 | Bacteria | 965 |
| 1337 | Ga0501073_0741584 | 3300049589 | Unclassified | 677 |
| 1338 | Ga0501074_0003167 | 3300049590 | Bacteria | 11604 |
| 1339 | Ga0501074_0006117 | 3300049590 | Bacteria | 8692 |
| 1340 | Ga0501074_0024769 | 3300049590 | Bacteria | 4360 |
| 1341 | Ga0501074_0030506 | 3300049590 | Bacteria | 3907 |
| 1342 | Ga0501074_0031566 | 3300049590 | Bacteria | 3837 |
| 1343 | Ga0501074_0049675 | 3300049590 | Bacteria | 3029 |
| 1344 | Ga0501074_0050747 | 3300049590 | Bacteria | 2995 |
| 1345 | Ga0501074_0066485 | 3300049590 | Bacteria | 2593 |
| 1346 | Ga0501074_0200675 | 3300049590 | Unclassified | 1421 |
| 1347 | Ga0501074_0350004 | 3300049590 | Bacteria | 1048 |
| 1348 | Ga0501074_0358527 | 3300049590 | Bacteria | 1035 |
| 1349 | Ga0501074_0376633 | 3300049590 | Bacteria | 1007 |
| 1350 | Ga0501075_0002269 | 3300049591 | Bacteria | 12743 |
| 1351 | Ga0501075_0002789 | 3300049591 | Bacteria | 11698 |
| 1352 | Ga0501075_0004313 | 3300049591 | Bacteria | 9621 |
| 1353 | Ga0501075_0028435 | 3300049591 | Bacteria | 4126 |
| 1354 | Ga0501075_0033104 | 3300049591 | Bacteria | 3844 |
| 1355 | Ga0501075_0072302 | 3300049591 | Bacteria | 2607 |
| 1356 | Ga0501075_0079288 | 3300049591 | Bacteria | 2485 |
| 1357 | Ga0501075_0146953 | 3300049591 | Bacteria | 1796 |
| 1358 | Ga0501075_0157384 | 3300049591 | Bacteria | 1732 |
| 1359 | Ga0501075_0343485 | 3300049591 | Bacteria | 1137 |
| 1360 | Ga0501075_0448898 | 3300049591 | Bacteria | 983 |
| 1361 | Ga0501075_0466387 | 3300049591 | Bacteria | 963 |
| 1362 | Ga0501076_0004978 | 3300049592 | Bacteria | 9514 |
| 1363 | Ga0501076_0006009 | 3300049592 | Bacteria | 8773 |
| 1364 | Ga0501076_0008482 | 3300049592 | Bacteria | 7530 |
| 1365 | Ga0501076_0026676 | 3300049592 | Bacteria | 4477 |
| 1366 | Ga0501076_0055715 | 3300049592 | Bacteria | 3135 |
| 1367 | Ga0501076_0060208 | 3300049592 | Bacteria | 3020 |
| 1368 | Ga0501076_0205267 | 3300049592 | Bacteria | 1609 |
| 1369 | Ga0501076_0249700 | 3300049592 | Bacteria | 1451 |
| 1370 | Ga0501076_0286542 | 3300049592 | Bacteria | 1349 |
| 1371 | Ga0501076_0357020 | 3300049592 | Bacteria | 1200 |
| 1372 | Ga0501076_0592464 | 3300049592 | Bacteria | 914 |
| 1373 | Ga0501076_1450927 | 3300049592 | Bacteria | 564 |
| 1374 | Ga0501076_1692532 | 3300049592 | Bacteria | 519 |
| 1375 | Ga0501077_0001985 | 3300049593 | Bacteria | 12345 |
| 1376 | Ga0501077_0003454 | 3300049593 | Bacteria | 9485 |
| 1377 | Ga0501077_0006318 | 3300049593 | Bacteria | 7255 |
| 1378 | Ga0501077_0007003 | 3300049593 | Bacteria | 6951 |
| 1379 | Ga0501077_0028663 | 3300049593 | Bacteria | 3539 |
| 1380 | Ga0501077_0048061 | 3300049593 | Bacteria | 2710 |
| 1381 | Ga0501077_0053496 | 3300049593 | Bacteria | 2563 |
| 1382 | Ga0501077_0069297 | 3300049593 | Bacteria | 2236 |
| 1383 | Ga0501077_0112153 | 3300049593 | Bacteria | 1728 |
| 1384 | Ga0501077_0114771 | 3300049593 | Bacteria | 1707 |
| 1385 | Ga0501077_0159140 | 3300049593 | Bacteria | 1434 |
| 1386 | Ga0501077_0629607 | 3300049593 | Bacteria | 689 |
| 1387 | Ga0501202_176455 | 3300049652 | Bacteria | 574 |
| 1388 | Ga0501209_135717 | 3300049656 | Bacteria | 736 |
| 1389 | Ga0501217_038277 | 3300049661 | Bacteria | 1211 |
| 1390 | Ga0501250_077797 | 3300049680 | Bacteria | 559 |
| 1391 | Ga0501221_090447 | 3300049704 | Bacteria | 748 |
| 1392 | Ga0501225_0199859 | 3300049705 | Bacteria | 634 |
| 1393 | Ga0501079_0009194 | 3300049741 | Bacteria | 7485 |
| 1394 | Ga0501079_0009863 | 3300049741 | Bacteria | 7246 |
| 1395 | Ga0501079_0010403 | 3300049741 | Bacteria | 7072 |
| 1396 | Ga0501079_0011677 | 3300049741 | Bacteria | 6708 |
| 1397 | Ga0501079_0012010 | 3300049741 | Bacteria | 6610 |
| 1398 | Ga0501079_0018239 | 3300049741 | Bacteria | 5360 |
| 1399 | Ga0501079_0021266 | 3300049741 | Bacteria | 4961 |
| 1400 | Ga0501079_0039464 | 3300049741 | Bacteria | 3641 |
| 1401 | Ga0501079_0084134 | 3300049741 | Bacteria | 2461 |
| 1402 | Ga0501079_0402774 | 3300049741 | Bacteria | 1073 |
| 1403 | Ga0501079_0517321 | 3300049741 | Bacteria | 938 |
| 1404 | Ga0501079_0751924 | 3300049741 | Bacteria | 767 |
| 1405 | Ga0501079_0992209 | 3300049741 | Bacteria | 661 |
| 1406 | Ga0501080_0000687 | 3300049742 | Bacteria | 27069 |
| 1407 | Ga0501080_0011018 | 3300049742 | Bacteria | 8277 |
| 1408 | Ga0501080_0014808 | 3300049742 | Bacteria | 7182 |
| 1409 | Ga0501080_0026542 | 3300049742 | Bacteria | 5381 |
| 1410 | Ga0501080_0047984 | 3300049742 | Bacteria | 3976 |
| 1411 | Ga0501080_0081841 | 3300049742 | Bacteria | 2999 |
| 1412 | Ga0501080_0191276 | 3300049742 | Bacteria | 1880 |
| 1413 | Ga0501080_0193342 | 3300049742 | Bacteria | 1869 |
| 1414 | Ga0501080_0251632 | 3300049742 | Bacteria | 1611 |
| 1415 | Ga0501080_0298839 | 3300049742 | Bacteria | 1460 |
| 1416 | Ga0501080_0835999 | 3300049742 | Bacteria | 806 |
| 1417 | Ga0501080_1252278 | 3300049742 | Bacteria | 636 |
| 1418 | Ga0501080_1401592 | 3300049742 | Bacteria | 596 |
| 1419 | Ga0501081_0006037 | 3300049743 | Bacteria | 7843 |
| 1420 | Ga0501081_0009846 | 3300049743 | Bacteria | 6225 |
| 1421 | Ga0501081_0013639 | 3300049743 | Bacteria | 5342 |
| 1422 | Ga0501081_0024363 | 3300049743 | Bacteria | 4063 |
| 1423 | Ga0501081_0032565 | 3300049743 | Bacteria | 3536 |
| 1424 | Ga0501081_0053343 | 3300049743 | Bacteria | 2791 |
| 1425 | Ga0501081_0057178 | 3300049743 | Bacteria | 2696 |
| 1426 | Ga0501081_0098245 | 3300049743 | Bacteria | 2067 |
| 1427 | Ga0501081_0107555 | 3300049743 | Bacteria | 1977 |
| 1428 | Ga0501081_0107891 | 3300049743 | Bacteria | 1974 |
| 1429 | Ga0501081_0249040 | 3300049743 | Bacteria | 1297 |
| 1430 | Ga0501081_0618732 | 3300049743 | Bacteria | 811 |
| 1431 | Ga0501081_0658164 | 3300049743 | Bacteria | 785 |
| 1432 | Ga0501081_1173792 | 3300049743 | Bacteria | 581 |
| 1433 | Ga0501081_1347264 | 3300049743 | Unclassified | 541 |
| 1434 | Ga0501081_1436817 | 3300049743 | Bacteria | 524 |
| 1435 | Ga0501083_0003918 | 3300049744 | Bacteria | 10451 |
| 1436 | Ga0501083_0017267 | 3300049744 | Bacteria | 5031 |
| 1437 | Ga0501083_0029656 | 3300049744 | Bacteria | 3760 |
| 1438 | Ga0501083_0111615 | 3300049744 | Bacteria | 1797 |
| 1439 | Ga0501083_0224550 | 3300049744 | Bacteria | 1223 |
| 1440 | Ga0501083_0247615 | 3300049744 | Bacteria | 1160 |
| 1441 | Ga0501083_0390078 | 3300049744 | Bacteria | 906 |
| 1442 | Ga0501083_0398302 | 3300049744 | Bacteria | 896 |
| 1443 | Ga0501232_087354 | 3300049757 | Bacteria | 533 |
| 1444 | Ga0501035_0008085 | 3300049822 | Bacteria | 9801 |
| 1445 | Ga0501035_0010116 | 3300049822 | Bacteria | 8756 |
| 1446 | Ga0501035_0012955 | 3300049822 | Bacteria | 7696 |
| 1447 | Ga0501035_0050133 | 3300049822 | Bacteria | 3742 |
| 1448 | Ga0501035_0053961 | 3300049822 | Bacteria | 3592 |
| 1449 | Ga0501035_0292594 | 3300049822 | Bacteria | 1374 |
| 1450 | Ga0501035_0537620 | 3300049822 | Bacteria | 958 |
| 1451 | Ga0501035_0618421 | 3300049822 | Bacteria | 881 |
| 1452 | Ga0501035_0853709 | 3300049822 | Bacteria | 724 |
| 1453 | Ga0501035_0862448 | 3300049822 | Bacteria | 719 |
| 1454 | Ga0501035_1437911 | 3300049822 | Bacteria | 527 |
| 1455 | Ga0501044_0041203 | 3300049823 | Bacteria | 4808 |
| 1456 | Ga0501044_0215535 | 3300049823 | Bacteria | 1872 |
| 1457 | Ga0501044_0348769 | 3300049823 | Bacteria | 1400 |
| 1458 | Ga0501044_0368140 | 3300049823 | Bacteria | 1354 |
| 1459 | Ga0501044_0493580 | 3300049823 | Bacteria | 1126 |
| 1460 | Ga0501044_0702883 | 3300049823 | Unclassified | 896 |
| 1461 | Ga0501044_0989473 | 3300049823 | Bacteria | 713 |
| 1462 | Ga0501044_1301276 | 3300049823 | Bacteria | 593 |
| 1463 | Ga0501044_1600370 | 3300049823 | Bacteria | 516 |
| 1464 | Ga0501045_0000889 | 3300049824 | Bacteria | 19416 |
| 1465 | Ga0501045_0015968 | 3300049824 | Bacteria | 5326 |
| 1466 | Ga0501045_0030153 | 3300049824 | Bacteria | 3924 |
| 1467 | Ga0501045_0046781 | 3300049824 | Bacteria | 3150 |
| 1468 | Ga0501045_0083831 | 3300049824 | Bacteria | 2351 |
| 1469 | Ga0501045_0141450 | 3300049824 | Bacteria | 1789 |
| 1470 | Ga0501045_0180380 | 3300049824 | Bacteria | 1573 |
| 1471 | Ga0501045_0186675 | 3300049824 | Bacteria | 1545 |
| 1472 | Ga0501045_0211782 | 3300049824 | Bacteria | 1444 |
| 1473 | Ga0501045_0231679 | 3300049824 | Bacteria | 1375 |
| 1474 | Ga0501045_0318865 | 3300049824 | Bacteria | 1156 |
| 1475 | Ga0501045_0808293 | 3300049824 | Bacteria | 690 |
| 1476 | Ga0501045_0899709 | 3300049824 | Bacteria | 650 |
| 1477 | Ga0501045_1035687 | 3300049824 | Bacteria | 601 |
| 1478 | nmdc:mga03683_43872_c1 | 3300050489 | Bacteria | 1846 |
| 1479 | nmdc:mga03n38_43033_c1 | 3300050490 | Bacteria | 1977 |
| 1480 | nmdc:mga00v17_31108_c1 | 3300050491 | Bacteria | 3146 |
| 1481 | nmdc:mga00v17_679630_c1 | 3300050491 | Bacteria | 661 |
| 1482 | nmdc:mga06z11_7934_c1 | 3300050494 | Bacteria | 4397 |
| 1483 | nmdc:mga04h51_40534_c1 | 3300050495 | Bacteria | 1518 |
| 1484 | nmdc:mga07m45_404071_c1 | 3300050496 | Bacteria | 793 |
| 1485 | nmdc:mga05p37_10711_c2 | 3300050507 | Bacteria | 10105 |
| 1486 | nmdc:mga05p37_1181908_c1 | 3300050507 | Bacteria | 792 |
| 1487 | nmdc:mga05p37_1183477_c1 | 3300050507 | Bacteria | 791 |
| 1488 | nmdc:mga05p37_1316290_c1 | 3300050507 | Bacteria | 735 |
| 1489 | nmdc:mga05p37_1437251_c1 | 3300050507 | Bacteria | 692 |
| 1490 | nmdc:mga05p37_25601_c1 | 3300050507 | Bacteria | 7177 |
| 1491 | nmdc:mga05p37_29029_c1 | 3300050507 | Bacteria | 4958 |
| 1492 | nmdc:mga05p37_318209_c1 | 3300050507 | Bacteria | 1842 |
| 1493 | nmdc:mga05p37_337656_c1 | 3300050507 | Bacteria | 1778 |
| 1494 | nmdc:mga05p37_397655_c1 | 3300050507 | Bacteria | 1610 |
| 1495 | nmdc:mga09592_153275_c1 | 3300050508 | Bacteria | 1989 |
| 1496 | nmdc:mga09592_32167_c1 | 3300050508 | Bacteria | 4373 |
| 1497 | nmdc:mga09592_406858_c1 | 3300050508 | Bacteria | 1176 |
| 1498 | nmdc:mga09592_461313_c1 | 3300050508 | Bacteria | 1096 |
| 1499 | nmdc:mga0qj67_209656_c1 | 3300050509 | Bacteria | 1583 |
| 1500 | nmdc:mga0qj67_22113_c1 | 3300050509 | Bacteria | 4882 |
| 1501 | nmdc:mga0qj67_248987_c1 | 3300050509 | Bacteria | 1442 |
| 1502 | nmdc:mga0qj67_448264_c1 | 3300050509 | Bacteria | 1040 |
| 1503 | nmdc:mga06r32_1064713_c1 | 3300050510 | Bacteria | 759 |
| 1504 | nmdc:mga06r32_1083178_c1 | 3300050510 | Bacteria | 751 |
| 1505 | nmdc:mga06r32_1087252_c1 | 3300050510 | Bacteria | 749 |
| 1506 | nmdc:mga06r32_1300502_c1 | 3300050510 | Bacteria | 671 |
| 1507 | nmdc:mga06r32_365238_c1 | 3300050510 | Bacteria | 1427 |
| 1508 | nmdc:mga06r32_399914_c1 | 3300050510 | Bacteria | 1356 |
| 1509 | nmdc:mga06r32_87639_c1 | 3300050510 | Bacteria | 3038 |
| 1510 | nmdc:mga08y16_115790_c1 | 3300050511 | Bacteria | 2791 |
| 1511 | nmdc:mga08y16_12151_c1 | 3300050511 | Bacteria | 9050 |
| 1512 | nmdc:mga08y16_1371276_c1 | 3300050511 | Bacteria | 671 |
| 1513 | nmdc:mga08y16_1510353_c1 | 3300050511 | Bacteria | 632 |
| 1514 | nmdc:mga08y16_167946_c1 | 3300050511 | Bacteria | 2280 |
| 1515 | nmdc:mga08y16_241148_c1 | 3300050511 | Bacteria | 1869 |
| 1516 | nmdc:mga08y16_290212_c1 | 3300050511 | Bacteria | 1687 |
| 1517 | nmdc:mga08y16_35922_c1 | 3300050511 | Bacteria | 5205 |
| 1518 | nmdc:mga08y16_842521_c1 | 3300050511 | Unclassified | 907 |
| 1519 | nmdc:mga08y16_85910_c1 | 3300050511 | Bacteria | 3279 |
| 1520 | nmdc:mga0n895_118056_c1 | 3300050512 | Bacteria | 2672 |
| 1521 | nmdc:mga0n895_711023_c1 | 3300050512 | Bacteria | 1000 |
| 1522 | nmdc:mga0n895_856944_c1 | 3300050512 | Bacteria | 896 |
| 1523 | nmdc:mga0rr50_1528052_c1 | 3300050513 | Bacteria | 564 |
| 1524 | nmdc:mga08x19_62128_c1 | 3300050514 | Unclassified | 2421 |
| 1525 | nmdc:mga0a205_30337_c1 | 3300050515 | Bacteria | 5176 |
| 1526 | nmdc:mga0a205_859819_c1 | 3300050515 | Bacteria | 754 |
| 1527 | Ga0495601_0000119 | 3300053077 | Bacteria | 43595 |
| 1528 | Ga0495601_0160937 | 3300053077 | Bacteria | 1467 |
| 1529 | Ga0495601_0182712 | 3300053077 | Bacteria | 1371 |
| 1530 | Ga0495612_0037524 | 3300053078 | Bacteria | 1968 |
| 1531 | Ga0495612_0338613 | 3300053078 | Bacteria | 678 |
| 1532 | Ga0495655_0078624 | 3300053083 | Bacteria | 938 |
| 1533 | Ga0495655_0174116 | 3300053083 | Bacteria | 690 |
| 1534 | Ga0495595_0043685 | 3300053084 | Bacteria | 2057 |
| 1535 | Ga0495595_0073389 | 3300053084 | Bacteria | 1620 |
| 1536 | Ga0495619_0043034 | 3300053085 | Unclassified | 2959 |
| 1537 | Ga0495619_0094354 | 3300053085 | Bacteria | 2029 |
| 1538 | Ga0495619_0162255 | 3300053085 | Bacteria | 1544 |
| 1539 | Ga0495619_0444094 | 3300053085 | Bacteria | 894 |
| 1540 | Ga0500628_143221 | 3300053129 | Bacteria | 664 |
| 1541 | Ga0501084_0006705 | 3300054114 | Bacteria | 9468 |
| 1542 | Ga0501084_0015070 | 3300054114 | Bacteria | 6410 |
| 1543 | Ga0501084_0021021 | 3300054114 | Bacteria | 5444 |
| 1544 | Ga0501084_0022756 | 3300054114 | Bacteria | 5230 |
| 1545 | Ga0501084_0035380 | 3300054114 | Bacteria | 4175 |
| 1546 | Ga0501084_0041810 | 3300054114 | Bacteria | 3834 |
| 1547 | Ga0501084_0067605 | 3300054114 | Bacteria | 2991 |
| 1548 | Ga0501084_0137687 | 3300054114 | Bacteria | 2055 |
| 1549 | Ga0501084_0167054 | 3300054114 | Bacteria | 1857 |
| 1550 | Ga0501084_0269893 | 3300054114 | Bacteria | 1436 |
| 1551 | Ga0501084_0277355 | 3300054114 | Bacteria | 1415 |
| 1552 | Ga0501084_0303103 | 3300054114 | Bacteria | 1349 |
| 1553 | Ga0501084_0758704 | 3300054114 | Bacteria | 817 |
| 1554 | Ga0501084_0874450 | 3300054114 | Bacteria | 756 |
| 1555 | Ga0501084_0889162 | 3300054114 | Bacteria | 749 |
| 1556 | Ga0501084_1102419 | 3300054114 | Bacteria | 666 |
| 1557 | Ga0501084_1321544 | 3300054114 | Bacteria | 604 |
| 1558 | Ga0590071_008391 | 3300059421 | Bacteria | 2434 |
| 1559 | Ga0590074_005887 | 3300059423 | Bacteria | 2036 |
| 1560 | Ga0590074_043475 | 3300059423 | Bacteria | 812 |
| 1561 | Ga0590075_003803 | 3300059424 | Bacteria | 3578 |
| 1562 | Ga0590075_011346 | 3300059424 | Bacteria | 2153 |
| 1563 | Ga0590075_056847 | 3300059424 | Bacteria | 1006 |
| 1564 | Ga0590075_061790 | 3300059424 | Bacteria | 965 |
| 1565 | Ga0590075_100119 | 3300059424 | Bacteria | 754 |
| 1566 | Ga0590077_008165 | 3300059426 | Bacteria | 2143 |
| 1567 | Ga0590077_049431 | 3300059426 | Bacteria | 942 |
| 1568 | Ga0590077_141001 | 3300059426 | Bacteria | 575 |
| 1569 | Ga0587084_021635 | 3300059477 | Bacteria | 966 |
| 1570 | Ga0587066_224931 | 3300059490 | Bacteria | 505 |
| 1571 | Ga0587070_143489 | 3300059491 | Bacteria | 592 |
| 1572 | Ga0587073_0058787 | 3300059492 | Bacteria | 895 |
| 1573 | Ga0587077_086997 | 3300059493 | Unclassified | 728 |
| 1574 | Ga0587080_076237 | 3300059503 | Unclassified | 680 |
| 1575 | Ga0587082_048084 | 3300059504 | Bacteria | 805 |
| 1576 | Ga0587083_0116683 | 3300059505 | Bacteria | 685 |
| 1577 | Ga0587088_063051 | 3300059508 | Bacteria | 756 |
| 1578 | Ga0587090_055926 | 3300059510 | Bacteria | 736 |
| 1579 | Ga0587091_072441 | 3300059511 | Bacteria | 757 |
| 1580 | Ga0587091_163838 | 3300059511 | Bacteria | 574 |
| 1581 | Ga0587067_129796 | 3300059640 | Bacteria | 614 |
| 1582 | Ga0587067_167217 | 3300059640 | Bacteria | 564 |
| 1583 | Ga0587068_131767 | 3300059641 | Bacteria | 551 |
| 1584 | Ga0587072_074232 | 3300059643 | Bacteria | 724 |
| 1585 | Ga0587076_067718 | 3300059645 | Unclassified | 734 |
| 1586 | Ga0587079_047322 | 3300059647 | Bacteria | 891 |
| 1587 | Ga0587079_223223 | 3300059647 | Bacteria | 525 |
| 1588 | Ga0501082_0003225 | 3300060353 | Bacteria | 14216 |
| 1589 | Ga0501082_0010945 | 3300060353 | Bacteria | 7807 |
| 1590 | Ga0501082_0081803 | 3300060353 | Bacteria | 2787 |
| 1591 | Ga0501082_0082153 | 3300060353 | Bacteria | 2780 |
| 1592 | Ga0501082_0088602 | 3300060353 | Bacteria | 2670 |
| 1593 | Ga0501082_0177062 | 3300060353 | Bacteria | 1854 |
| 1594 | Ga0501082_0201280 | 3300060353 | Bacteria | 1732 |
| 1595 | Ga0501082_0216899 | 3300060353 | Bacteria | 1665 |
| 1596 | Ga0501082_0651756 | 3300060353 | Bacteria | 921 |
| 1597 | Ga0501082_0768575 | 3300060353 | Bacteria | 843 |
| 1598 | Ga0501082_1028068 | 3300060353 | Bacteria | 720 |
| 1599 | Ga0501082_1396608 | 3300060353 | Bacteria | 611 |
| 1600 | Ga0466962_0087611 | 3300061719 | Bacteria | 1491 |
| 1601 | Ga0466962_0089723 | 3300061719 | Unclassified | 1472 |
| 1602 | Ga0530510_0006136 | 3300061734 | Bacteria | 8344 |
| 1603 | Ga0530510_0008550 | 3300061734 | Bacteria | 7145 |
| 1604 | Ga0530510_0012893 | 3300061734 | Bacteria | 5877 |
| 1605 | Ga0530510_0013117 | 3300061734 | Bacteria | 5829 |
| 1606 | Ga0530510_0028782 | 3300061734 | Bacteria | 3983 |
| 1607 | Ga0530510_0032815 | 3300061734 | Bacteria | 3736 |
| 1608 | Ga0530510_0044977 | 3300061734 | Bacteria | 3190 |
| 1609 | Ga0530510_0234248 | 3300061734 | Bacteria | 1366 |
| 1610 | Ga0530510_0390463 | 3300061734 | Bacteria | 1048 |
| 1611 | Ga0530510_0437995 | 3300061734 | Bacteria | 987 |
| 1612 | Ga0530510_0558206 | 3300061734 | Bacteria | 870 |
| 1613 | Ga0530510_0566661 | 3300061734 | Bacteria | 863 |
| 1614 | Ga0530510_1151769 | 3300061734 | Bacteria | 594 |
| 1615 | Ga0070683_101207937 | |||
| 1616 | ARCol0yngRDRAFT_1001060 | |||
| 1617 | JGI24738J21930_10030244 | |||
| 1618 | JGI25406J46586_10011774 | |||
| 1619 | JGI25407J50210_10000553 | |||
| 1620 | JGI25407J50210_10003527 | |||
| 1621 | JGI25407J50210_10005891 | |||
| 1622 | JGI25407J50210_10019566 | |||
| 1623 | JGI25407J50210_10028789 | |||
| 1624 | Ga0058860_11993703 | |||
| 1625 | Ga0065716_1005683 | |||
| 1626 | Ga0070658_10837135 | |||
| 1627 | Ga0070658_11102006 | |||
| 1628 | Ga0070658_11281839 | |||
| 1629 | Ga0070658_11692384 | |||
| 1630 | Ga0070676_10097544 | |||
| 1631 | Ga0070676_10608933 | |||
| 1632 | Ga0070683_100005414 | |||
| 1633 | Ga0070683_100100898 | |||
| 1634 | Ga0070683_100106748 | |||
| 1635 | Ga0070683_100188623 | |||
| 1636 | Ga0070683_100511463 | |||
| 1637 | Ga0070683_100807252 | |||
| 1638 | Ga0070683_101981896 | |||
| 1639 | Ga0070690_100285495 | |||
| 1640 | Ga0070670_100046088 | |||
| 1641 | Ga0070670_100508715 | |||
| 1642 | Ga0070677_10543811 | |||
| 1643 | Ga0068869_100060514 | |||
| 1644 | Ga0068869_100851264 | |||
| 1645 | Ga0068869_100907922 | |||
| 1646 | Ga0070666_10486505 | |||
| 1647 | Ga0070680_100015754 | |||
| 1648 | Ga0070680_100034133 | |||
| 1649 | Ga0070680_100054321 | |||
| 1650 | Ga0070680_100097987 | |||
| 1651 | Ga0070680_100145337 | |||
| 1652 | Ga0070682_100022269 | |||
| 1653 | Ga0070682_100027027 | |||
| 1654 | Ga0070682_100041884 | |||
| 1655 | Ga0070682_100244232 | |||
| 1656 | Ga0068868_100178731 | |||
| 1657 | Ga0068868_100618124 | |||
| 1658 | Ga0070660_100031833 | |||
| 1659 | Ga0070660_100098992 | |||
| 1660 | Ga0070660_100193179 | |||
| 1661 | Ga0070660_100633915 | |||
| 1662 | Ga0070660_100862620 | |||
| 1663 | Ga0070660_101054173 | |||
| 1664 | Ga0070660_101588444 | |||
| 1665 | Ga0070689_101616428 | |||
| 1666 | Ga0070691_10006550 | |||
| 1667 | Ga0070691_10126178 | |||
| 1668 | Ga0070687_100438755 | |||
| 1669 | Ga0070661_100045876 | |||
| 1670 | Ga0070661_100385297 | |||
| 1671 | Ga0070661_100597897 | |||
| 1672 | Ga0070692_10032201 | |||
| 1673 | Ga0070692_10077485 | |||
| 1674 | Ga0070692_10100609 | |||
| 1675 | Ga0070692_10607410 | |||
| 1676 | Ga0070668_100677812 | |||
| 1677 | Ga0070668_101585021 | |||
| 1678 | Ga0070669_100297287 | |||
| 1679 | Ga0070669_100696287 | |||
| 1680 | Ga0070669_100890765 | |||
| 1681 | Ga0070675_100128487 | |||
| 1682 | Ga0070675_100286654 | |||
| 1683 | Ga0070675_100567293 | |||
| 1684 | Ga0070675_101443228 | |||
| 1685 | Ga0070675_101633280 | |||
| 1686 | Ga0070671_100132215 | |||
| 1687 | Ga0070674_100097268 | |||
| 1688 | Ga0070674_100117126 | |||
| 1689 | Ga0070674_100287540 | |||
| 1690 | Ga0070674_101286340 | |||
| 1691 | Ga0070673_100501683 | |||
| 1692 | Ga0070673_101336151 | |||
| 1693 | Ga0070688_101191534 | |||
| 1694 | Ga0070659_100034611 | |||
| 1695 | Ga0070659_100436033 | |||
| 1696 | Ga0070659_100559489 | |||
| 1697 | Ga0070709_10320854 | |||
| 1698 | Ga0070709_11179855 | |||
| 1699 | Ga0070714_100015334 | |||
| 1700 | Ga0070714_100430135 | |||
| 1701 | Ga0070713_101177697 | |||
| 1702 | Ga0070701_10231684 | |||
| 1703 | Ga0070711_101432366 | |||
| 1704 | Ga0070705_100107071 | |||
| 1705 | Ga0070705_100336368 | |||
| 1706 | Ga0070700_100072761 | |||
| 1707 | Ga0070700_100135725 | |||
| 1708 | Ga0070700_101340993 | |||
| 1709 | Ga0070694_100109330 | |||
| 1710 | Ga0070694_100127724 | |||
| 1711 | Ga0070694_100297529 | |||
| 1712 | Ga0070708_100160220 | |||
| 1713 | Ga0070708_101519709 | |||
| 1714 | Ga0070663_100989674 | |||
| 1715 | Ga0070663_101012701 | |||
| 1716 | Ga0070663_101185120 | |||
| 1717 | Ga0070663_101211323 | |||
| 1718 | Ga0070663_101908135 | |||
| 1719 | Ga0070678_100020088 | |||
| 1720 | Ga0070678_100500555 | |||
| 1721 | Ga0070678_100640532 | |||
| 1722 | Ga0070678_101924475 | |||
| 1723 | Ga0070662_100098582 | |||
| 1724 | Ga0070662_100166324 | |||
| 1725 | Ga0070662_101094012 | |||
| 1726 | Ga0070681_10018574 | |||
| 1727 | Ga0070681_10042262 | |||
| 1728 | Ga0070681_10089000 | |||
| 1729 | Ga0070681_10337067 | |||
| 1730 | Ga0070681_10641834 | |||
| 1731 | Ga0070681_11235032 | |||
| 1732 | Ga0068867_100230565 | |||
| 1733 | Ga0068867_100248089 | |||
| 1734 | Ga0068867_100333484 | |||
| 1735 | Ga0068867_100641431 | |||
| 1736 | Ga0068867_100806240 | |||
| 1737 | Ga0068867_102232437 | |||
| 1738 | Ga0070685_10053763 | |||
| 1739 | Ga0070706_100023684 | |||
| 1740 | Ga0070706_100352826 | |||
| 1741 | Ga0070707_100081792 | |||
| 1742 | Ga0070707_100085098 | |||
| 1743 | Ga0070698_100002914 | |||
| 1744 | Ga0070698_100069760 | |||
| 1745 | Ga0070698_100110270 | |||
| 1746 | Ga0070698_100537509 | |||
| 1747 | Ga0070698_100661958 | |||
| 1748 | Ga0070698_100800146 | |||
| 1749 | Ga0070699_100024816 | |||
| 1750 | Ga0070699_100034974 | |||
| 1751 | Ga0070699_100466199 | |||
| 1752 | Ga0070699_100699969 | |||
| 1753 | Ga0070699_101033444 | |||
| 1754 | Ga0070699_101952198 | |||
| 1755 | Ga0070679_100120426 | |||
| 1756 | Ga0070679_100129492 | |||
| 1757 | Ga0070679_100178762 | |||
| 1758 | Ga0070679_100217718 | |||
| 1759 | Ga0070679_100219122 | |||
| 1760 | Ga0070679_100597959 | |||
| 1761 | Ga0070684_100067464 | |||
| 1762 | Ga0070684_100099228 | |||
| 1763 | Ga0070684_100140117 | |||
| 1764 | Ga0070684_100190171 | |||
| 1765 | Ga0070684_100414131 | |||
| 1766 | Ga0070684_100432859 | |||
| 1767 | Ga0070684_100844865 | |||
| 1768 | Ga0070684_101000308 | |||
| 1769 | Ga0070684_101075730 | |||
| 1770 | Ga0070697_100253597 | |||
| 1771 | Ga0068853_100148213 | |||
| 1772 | Ga0068853_100154850 | |||
| 1773 | Ga0068853_100160754 | |||
| 1774 | Ga0070672_100377211 | |||
| 1775 | Ga0070672_100713141 | |||
| 1776 | Ga0070672_101095601 | |||
| 1777 | Ga0070686_100088621 | |||
| 1778 | Ga0070686_101585869 | |||
| 1779 | Ga0070695_100102433 | |||
| 1780 | Ga0070696_100103996 | |||
| 1781 | Ga0070693_100382881 | |||
| 1782 | Ga0070693_101138823 | |||
| 1783 | Ga0070665_100731096 | |||
| 1784 | Ga0070704_100205791 | |||
| 1785 | Ga0068855_101735335 | |||
| 1786 | Ga0070664_100036994 | |||
| 1787 | Ga0070664_100151920 | |||
| 1788 | Ga0070664_100304127 | |||
| 1789 | Ga0070664_100639068 | |||
| 1790 | Ga0068857_100003001 | |||
| 1791 | Ga0068857_100116161 | |||
| 1792 | Ga0068857_100298940 | |||
| 1793 | Ga0068857_100316532 | |||
| 1794 | Ga0068857_102005162 | |||
| 1795 | Ga0068854_100220685 | |||
| 1796 | Ga0068854_100318935 | |||
| 1797 | Ga0068854_100510511 | |||
| 1798 | Ga0068856_100153210 | |||
| 1799 | Ga0068856_100214217 | |||
| 1800 | Ga0070702_100139069 | |||
| 1801 | Ga0070702_100366717 | |||
| 1802 | Ga0070702_101289676 | |||
| 1803 | Ga0068852_100272341 | |||
| 1804 | Ga0068852_100736259 | |||
| 1805 | Ga0068852_101911305 | |||
| 1806 | Ga0068859_100182455 | |||
| 1807 | Ga0068859_100896263 | |||
| 1808 | Ga0068864_100072800 | |||
| 1809 | Ga0068864_100720384 | |||
| 1810 | Ga0068864_101575851 | |||
| 1811 | Ga0068864_102297957 | |||
| 1812 | Ga0068866_10591778 | |||
| 1813 | Ga0068866_10925786 | |||
| 1814 | Ga0068866_11048836 | |||
| 1815 | Ga0068861_100094678 | |||
| 1816 | Ga0068861_101262469 | |||
| 1817 | Ga0068851_10390861 | |||
| 1818 | Ga0068870_10083098 | |||
| 1819 | Ga0068870_10145766 | |||
| 1820 | Ga0068870_10343491 | |||
| 1821 | Ga0068870_10438401 | |||
| 1822 | Ga0068863_100395589 | |||
| 1823 | Ga0068863_101791611 | |||
| 1824 | Ga0068858_100166781 | |||
| 1825 | Ga0068860_100570754 | |||
| 1826 | Ga0068862_100305469 | |||
| 1827 | Ga0081455_10002616 | |||
| 1828 | Ga0081455_10003194 | |||
| 1829 | Ga0081455_10020838 | |||
| 1830 | Ga0081455_10028494 | |||
| 1831 | Ga0081455_10034787 | |||
| 1832 | Ga0081455_10052915 | |||
| 1833 | Ga0081455_10054190 | |||
| 1834 | Ga0081455_10057833 | |||
| 1835 | Ga0081455_10073359 | |||
| 1836 | Ga0081455_10254080 | |||
| 1837 | Ga0081455_10262367 | |||
| 1838 | Ga0081455_10359743 | |||
| 1839 | Ga0081455_10757821 | |||
| 1840 | Ga0081538_10000012 | |||
| 1841 | Ga0081538_10000043 | |||
| 1842 | Ga0081538_10000078 | |||
| 1843 | Ga0081538_10001739 | |||
| 1844 | Ga0081538_10003796 | |||
| 1845 | Ga0081538_10006203 | |||
| 1846 | Ga0081538_10012471 | |||
| 1847 | Ga0081538_10018260 | |||
| 1848 | Ga0081538_10024585 | |||
| 1849 | Ga0081538_10028759 | |||
| 1850 | Ga0081538_10040171 | |||
| 1851 | Ga0081538_10040841 | |||
| 1852 | Ga0081538_10052475 | |||
| 1853 | Ga0081538_10069084 | |||
| 1854 | Ga0081538_10171304 | |||
| 1855 | Ga0081538_10208422 | |||
| 1856 | Ga0081538_10259260 | |||
| 1857 | Ga0081539_10001017 | |||
| 1858 | Ga0081539_10001655 | |||
| 1859 | Ga0081539_10008759 | |||
| 1860 | Ga0081539_10091234 | |||
| 1861 | Ga0070717_11680835 | |||
| 1862 | Ga0075365_10095091 | |||
| 1863 | Ga0075365_10124097 | |||
| 1864 | Ga0075368_10052943 | |||
| 1865 | Ga0075363_100023210 | |||
| 1866 | Ga0075364_10003002 | |||
| 1867 | Ga0075364_10524287 | |||
| 1868 | Ga0075432_10001315 | |||
| 1869 | Ga0075432_10156135 | |||
| 1870 | Ga0075432_10269755 | |||
| 1871 | Ga0070712_100045012 | |||
| 1872 | Ga0070712_101596957 | |||
| 1873 | Ga0075362_10079884 | |||
| 1874 | Ga0075362_10685463 | |||
| 1875 | Ga0075367_10009020 | |||
| 1876 | Ga0075427_10013143 | |||
| 1877 | Ga0075427_10057743 | |||
| 1878 | Ga0068871_100222874 | |||
| 1879 | Ga0068871_100531919 | |||
| 1880 | Ga0068871_101565789 | |||
| 1881 | Ga0068871_101881734 | |||
| 1882 | Ga0068871_101915281 | |||
| 1883 | Ga0068871_102036583 | |||
| 1884 | Ga0075428_100012121 | |||
| 1885 | Ga0075428_100014262 | |||
| 1886 | Ga0075428_100056043 | |||
| 1887 | Ga0075428_100152138 | |||
| 1888 | Ga0075428_100507800 | |||
| 1889 | Ga0075428_101023531 | |||
| 1890 | Ga0075428_101074017 | |||
| 1891 | Ga0075430_100078687 | |||
| 1892 | Ga0075430_100189359 | |||
| 1893 | Ga0075431_100056374 | |||
| 1894 | Ga0075431_100155187 | |||
| 1895 | Ga0075431_100634509 | |||
| 1896 | Ga0075431_100698963 | |||
| 1897 | Ga0075431_100722545 | |||
| 1898 | Ga0075431_100727840 | |||
| 1899 | Ga0075431_101058972 | |||
| 1900 | Ga0075431_101122080 | |||
| 1901 | Ga0075431_101272603 | |||
| 1902 | Ga0075431_101468346 | |||
| 1903 | Ga0075434_100684907 | |||
| 1904 | Ga0075434_100973403 | |||
| 1905 | Ga0075429_100023663 | |||
| 1906 | Ga0075429_100173070 | |||
| 1907 | Ga0075429_100185368 | |||
| 1908 | Ga0075429_101116107 | |||
| 1909 | Ga0075429_101287011 | |||
| 1910 | Ga0068865_100090588 | |||
| 1911 | Ga0068865_100959281 | |||
| 1912 | Ga0068865_101155825 | |||
| 1913 | Ga0075436_100291063 | |||
| 1914 | Ga0097620_100182458 | |||
| 1915 | Ga0097620_100896166 | |||
| 1916 | Ga0075435_101418323 | |||
| 1917 | Ga0105250_10323257 | |||
| 1918 | Ga0105240_12458240 | |||
| 1919 | Ga0111539_10004858 | |||
| 1920 | Ga0111539_10009775 | |||
| 1921 | Ga0111539_10027100 | |||
| 1922 | Ga0111539_10029591 | |||
| 1923 | Ga0111539_10281997 | |||
| 1924 | Ga0111539_10286454 | |||
| 1925 | Ga0111539_10590586 | |||
| 1926 | Ga0111539_10783105 | |||
| 1927 | Ga0111539_11211441 | |||
| 1928 | Ga0111539_12252066 | |||
| 1929 | Ga0105245_10061841 | |||
| 1930 | Ga0105245_10073114 | |||
| 1931 | Ga0105245_10091194 | |||
| 1932 | Ga0105245_10207111 | |||
| 1933 | Ga0105245_10709359 | |||
| 1934 | Ga0105245_11182387 | |||
| 1935 | Ga0105247_10310257 | |||
| 1936 | Ga0114129_10019838 | |||
| 1937 | Ga0114129_10034585 | |||
| 1938 | Ga0114129_10042952 | |||
| 1939 | Ga0114129_10194478 | |||
| 1940 | Ga0114129_10271452 | |||
| 1941 | Ga0114129_10532079 | |||
| 1942 | Ga0114129_11802972 | |||
| 1943 | Ga0114129_12206860 | |||
| 1944 | Ga0105243_10152295 | |||
| 1945 | Ga0105243_10716425 | |||
| 1946 | Ga0105243_11038973 | |||
| 1947 | Ga0105241_10426534 | |||
| 1948 | Ga0105242_10140847 | |||
| 1949 | Ga0105242_10228089 | |||
| 1950 | Ga0105242_10465910 | |||
| 1951 | Ga0105242_11156178 | |||
| 1952 | Ga0105248_10177812 | |||
| 1953 | Ga0105237_10153292 | |||
| 1954 | Ga0105237_11848547 | |||
| 1955 | Ga0105238_10496393 | |||
| 1956 | Ga0105249_10030507 | |||
| 1957 | Ga0105249_10272330 | |||
| 1958 | Ga0105249_10498255 | |||
| 1959 | Ga0105249_11296920 | |||
| 1960 | Ga0105239_10158905 | |||
| 1961 | Ga0105239_10279218 | |||
| 1962 | Ga0105239_11377959 | |||
| 1963 | Ga0105246_10257522 | |||
| 1964 | Ga0105246_10327644 | |||
| 1965 | Ga0105246_10563148 | |||
| 1966 | Ga0105246_10639528 | |||
| 1967 | Ga0105246_10893983 | |||
| 1968 | Ga0105246_12443260 | |||
| 1969 | Ga0157346_1013493 | |||
| 1970 | Ga0157320_1013023 | |||
| 1971 | Ga0157337_1025459 | |||
| 1972 | Ga0157315_1032099 | |||
| 1973 | Ga0157338_1046318 | |||
| 1974 | Ga0154010_164487 | |||
| 1975 | Ga0157373_10694481 | |||
| 1976 | Ga0157373_10766196 | |||
| 1977 | Ga0157371_10193809 | |||
| 1978 | Ga0157371_10241696 | |||
| 1979 | Ga0157370_10154684 | |||
| 1980 | Ga0157370_11604569 | |||
| 1981 | Ga0157369_10144031 | |||
| 1982 | Ga0157374_10058527 | |||
| 1983 | Ga0157374_10392480 | |||
| 1984 | Ga0157374_11449660 | |||
| 1985 | Ga0157378_10471694 | |||
| 1986 | Ga0157378_11242545 | |||
| 1987 | Ga0157378_12063731 | |||
| 1988 | Ga0163162_10105023 | |||
| 1989 | Ga0163162_10572753 | |||
| 1990 | Ga0163162_11345383 | |||
| 1991 | Ga0157372_10832749 | |||
| 1992 | Ga0157372_10867950 | |||
| 1993 | Ga0157372_11259598 | |||
| 1994 | Ga0157375_10243699 | |||
| 1995 | Ga0157375_10810502 | |||
| 1996 | Ga0157375_13176261 | |||
| 1997 | Ga0163163_10299612 | |||
| 1998 | Ga0163163_10597244 | |||
| 1999 | Ga0163163_11544366 | |||
| 2000 | Ga0157380_10377392 | |||
| 2001 | Ga0157380_10538822 | |||
| 2002 | Ga0157380_11239550 | |||
| 2003 | Ga0157380_11437455 | |||
| 2004 | Ga0182008_10002863 | |||
| 2005 | Ga0182008_10778774 | |||
| 2006 | Ga0157377_10101653 | |||
| 2007 | Ga0157377_10278226 | |||
| 2008 | Ga0157379_10279969 | |||
| 2009 | Ga0157379_11235946 | |||
| 2010 | Ga0157379_11246767 | |||
| 2011 | Ga0157376_10214746 | |||
| 2012 | Ga0157376_10289074 | |||
| 2013 | Ga0157376_10483767 | |||
| 2014 | Ga0157376_10754898 | |||
| 2015 | Ga0182007_10018713 | |||
| 2016 | Ga0182005_1056312 | |||
| 2017 | Ga0163161_10396685 | |||
| 2018 | Ga0197907_10123201 | |||
| 2019 | Ga0197907_10392146 | |||
| 2020 | Ga0206355_1580130 | |||
| 2021 | Ga0206351_10697763 | |||
| 2022 | Ga0206354_10836039 | |||
| 2023 | Ga0206354_11226363 | |||
| 2024 | Ga0206353_10089638 | |||
| 2025 | Ga0206353_10335316 | |||
| 2026 | Ga0206353_10442328 | |||
| 2027 | Ga0206353_10959623 | |||
| 2028 | Ga0154015_1677257 | |||
| 2029 | Ga0224712_10187199 | |||
| 2030 | Ga0207655_1053832 | |||
| 2031 | Ga0207682_10455960 | |||
| 2032 | Ga0207642_10169498 | |||
| 2033 | Ga0207642_10293511 | |||
| 2034 | Ga0207688_10011358 | |||
| 2035 | Ga0207688_10030354 | |||
| 2036 | Ga0207647_10222784 | |||
| 2037 | Ga0207685_10227462 | |||
| 2038 | Ga0207645_10093656 | |||
| 2039 | Ga0207645_10114835 | |||
| 2040 | Ga0207645_10180877 | |||
| 2041 | Ga0207645_10329572 | |||
| 2042 | Ga0207643_10016941 | |||
| 2043 | Ga0207643_10045405 | |||
| 2044 | Ga0207643_10680655 | |||
| 2045 | Ga0207705_10029629 | |||
| 2046 | Ga0207705_10665598 | |||
| 2047 | Ga0207705_11419235 | |||
| 2048 | Ga0207705_11542694 | |||
| 2049 | Ga0207684_10454540 | |||
| 2050 | Ga0207684_10878479 | |||
| 2051 | Ga0207684_10942191 | |||
| 2052 | Ga0207707_10026096 | |||
| 2053 | Ga0207707_10109194 | |||
| 2054 | Ga0207707_10138023 | |||
| 2055 | Ga0207707_10329499 | |||
| 2056 | Ga0207707_10519161 | |||
| 2057 | Ga0207707_11461571 | |||
| 2058 | Ga0207671_10645058 | |||
| 2059 | Ga0207693_10170033 | |||
| 2060 | Ga0207693_10991540 | |||
| 2061 | Ga0207660_10017811 | |||
| 2062 | Ga0207660_10026727 | |||
| 2063 | Ga0207660_10127350 | |||
| 2064 | Ga0207660_10173935 | |||
| 2065 | Ga0207660_10313371 | |||
| 2066 | Ga0207660_10402713 | |||
| 2067 | Ga0207662_10105715 | |||
| 2068 | Ga0207662_10298434 | |||
| 2069 | Ga0207657_10032675 | |||
| 2070 | Ga0207657_10078394 | |||
| 2071 | Ga0207657_10194906 | |||
| 2072 | Ga0207657_10218387 | |||
| 2073 | Ga0207657_10537251 | |||
| 2074 | Ga0207657_11344692 | |||
| 2075 | Ga0207649_10006584 | |||
| 2076 | Ga0207649_10906933 | |||
| 2077 | Ga0207652_10056627 | |||
| 2078 | Ga0207652_10222124 | |||
| 2079 | Ga0207652_10285733 | |||
| 2080 | Ga0207652_10333662 | |||
| 2081 | Ga0207652_10769610 | |||
| 2082 | Ga0207652_11113788 | |||
| 2083 | Ga0207646_10073193 | |||
| 2084 | Ga0207646_10504248 | |||
| 2085 | Ga0207646_10601954 | |||
| 2086 | Ga0207681_10246541 | |||
| 2087 | Ga0207694_10627374 | |||
| 2088 | Ga0207694_10685448 | |||
| 2089 | Ga0207650_10203293 | |||
| 2090 | Ga0207650_11912781 | |||
| 2091 | Ga0207659_10030117 | |||
| 2092 | Ga0207659_10054344 | |||
| 2093 | Ga0207659_11908055 | |||
| 2094 | Ga0207687_10049558 | |||
| 2095 | Ga0207687_10082716 | |||
| 2096 | Ga0207687_10282006 | |||
| 2097 | Ga0207687_10337689 | |||
| 2098 | Ga0207687_10404579 | |||
| 2099 | Ga0207687_10467295 | |||
| 2100 | Ga0207687_11222853 | |||
| 2101 | Ga0207687_11546652 | |||
| 2102 | Ga0207664_10128515 | |||
| 2103 | Ga0207664_10157072 | |||
| 2104 | Ga0207664_11240979 | |||
| 2105 | Ga0207690_10115023 | |||
| 2106 | Ga0207690_10129614 | |||
| 2107 | Ga0207690_11230683 | |||
| 2108 | Ga0207690_11793153 | |||
| 2109 | Ga0207706_10085744 | |||
| 2110 | Ga0207706_10416761 | |||
| 2111 | Ga0207706_11030380 | |||
| 2112 | Ga0207686_10045133 | |||
| 2113 | Ga0207686_10350076 | |||
| 2114 | Ga0207709_10175971 | |||
| 2115 | Ga0207709_10343731 | |||
| 2116 | Ga0207709_10656432 | |||
| 2117 | Ga0207709_10885908 | |||
| 2118 | Ga0207709_11846071 | |||
| 2119 | Ga0207670_10040829 | |||
| 2120 | Ga0207669_10568405 | |||
| 2121 | Ga0207669_10731804 | |||
| 2122 | Ga0207669_11000376 | |||
| 2123 | Ga0207669_11003924 | |||
| 2124 | Ga0207704_10068690 | |||
| 2125 | Ga0207704_10671958 | |||
| 2126 | Ga0207704_10976900 | |||
| 2127 | Ga0207704_11919578 | |||
| 2128 | Ga0207665_10608374 | |||
| 2129 | Ga0207691_10113414 | |||
| 2130 | Ga0207691_10173183 | |||
| 2131 | Ga0207691_10827928 | |||
| 2132 | Ga0207691_11154287 | |||
| 2133 | Ga0207711_10062058 | |||
| 2134 | Ga0207711_11059163 | |||
| 2135 | Ga0207711_11460134 | |||
| 2136 | Ga0207689_10108289 | |||
| 2137 | Ga0207689_10183159 | |||
| 2138 | Ga0207689_11428205 | |||
| 2139 | Ga0207661_10000297 | |||
| 2140 | Ga0207661_10111178 | |||
| 2141 | Ga0207661_10134616 | |||
| 2142 | Ga0207661_10151127 | |||
| 2143 | Ga0207661_10414770 | |||
| 2144 | Ga0207661_11047459 | |||
| 2145 | Ga0207661_11741760 | |||
| 2146 | Ga0207679_10137123 | |||
| 2147 | Ga0207679_10423302 | |||
| 2148 | Ga0207679_10497385 | |||
| 2149 | Ga0207667_10486862 | |||
| 2150 | Ga0207667_12138103 | |||
| 2151 | Ga0207651_10250545 | |||
| 2152 | Ga0207651_11353330 | |||
| 2153 | Ga0207712_10077189 | |||
| 2154 | Ga0207712_10208411 | |||
| 2155 | Ga0207668_11134409 | |||
| 2156 | Ga0207640_10194056 | |||
| 2157 | Ga0207640_10215126 | |||
| 2158 | Ga0207640_10551475 | |||
| 2159 | Ga0207640_11427667 | |||
| 2160 | Ga0207658_10418135 | |||
| 2161 | Ga0207677_10127492 | |||
| 2162 | Ga0207677_11202843 | |||
| 2163 | Ga0207677_11473392 | |||
| 2164 | Ga0207703_10147744 | |||
| 2165 | Ga0207703_12226423 | |||
| 2166 | Ga0207639_10074514 | |||
| 2167 | Ga0207639_10152500 | |||
| 2168 | Ga0207639_10355232 | |||
| 2169 | Ga0207678_10115328 | |||
| 2170 | Ga0207678_10211598 | |||
| 2171 | Ga0207678_11909723 | |||
| 2172 | Ga0207708_10010855 | |||
| 2173 | Ga0207708_10037820 | |||
| 2174 | Ga0207708_10147104 | |||
| 2175 | Ga0207708_10322502 | |||
| 2176 | Ga0207708_10646720 | |||
| 2177 | Ga0207702_10045112 | |||
| 2178 | Ga0207702_12373241 | |||
| 2179 | Ga0207641_10515974 | |||
| 2180 | Ga0207648_10029997 | |||
| 2181 | Ga0207648_10122453 | |||
| 2182 | Ga0207648_10308320 | |||
| 2183 | Ga0207648_10866927 | |||
| 2184 | Ga0207648_10960126 | |||
| 2185 | Ga0207648_11170023 | |||
| 2186 | Ga0207648_12296287 | |||
| 2187 | Ga0207676_10279581 | |||
| 2188 | Ga0207676_10637188 | |||
| 2189 | Ga0207676_10866072 | |||
| 2190 | Ga0207676_11255334 | |||
| 2191 | Ga0207674_10003542 | |||
| 2192 | Ga0207674_10021743 | |||
| 2193 | Ga0207674_10027993 | |||
| 2194 | Ga0207674_10546103 | |||
| 2195 | Ga0207674_11102424 | |||
| 2196 | Ga0207675_100032371 | |||
| 2197 | Ga0207675_101836748 | |||
| 2198 | Ga0207675_102413653 | |||
| 2199 | Ga0207683_10161641 | |||
| 2200 | Ga0207683_10288215 | |||
| 2201 | Ga0207683_10967292 | |||
| 2202 | Ga0207698_10067992 | |||
| 2203 | Ga0207698_10239871 | |||
| 2204 | Ga0207698_11688456 | |||
| 2205 | Ga0209968_1040220 | |||
| 2206 | Ga0209998_10007307 | |||
| 2207 | Ga0209998_10188806 | |||
| 2208 | Ga0209813_10014831 | |||
| 2209 | Ga0207428_10000383 | |||
| 2210 | Ga0207428_10006260 | |||
| 2211 | Ga0207428_10008443 | |||
| 2212 | Ga0207428_10020204 | |||
| 2213 | Ga0207428_10042121 | |||
| 2214 | Ga0207428_10100929 | |||
| 2215 | Ga0207428_11132955 | |||
| 2216 | Ga0268266_11544650 | |||
| 2217 | Ga0268265_10970772 | |||
| 2218 | Ga0268265_12678342 | |||
| 2219 | Ga0268264_10729446 | |||
| 2220 | Ga0265318_10071394 | |||
| 2221 | Ga0265318_10189202 | |||
| 2222 | Ga0265320_10407494 | |||
| 2223 | Ga0265340_10059264 | |||
| 2224 | Ga0265327_10075516 | |||
| 2225 | Ga0307408_100076490 | |||
| 2226 | Ga0307408_100265431 | |||
| 2227 | Ga0307408_100631735 | |||
| 2228 | Ga0307408_100899569 | |||
| 2229 | Ga0307408_101255351 | |||
| 2230 | Ga0307408_101521112 | |||
| 2231 | Ga0307408_101869845 | |||
| 2232 | Ga0307408_102393452 | |||
| 2233 | Ga0265313_10075834 | |||
| 2234 | Ga0307405_10051501 | |||
| 2235 | Ga0307405_10357736 | |||
| 2236 | Ga0307405_10718129 | |||
| 2237 | Ga0307405_10972912 | |||
| 2238 | Ga0307413_10005458 | |||
| 2239 | Ga0307413_10103776 | |||
| 2240 | Ga0307413_10486934 | |||
| 2241 | Ga0307413_10919490 | |||
| 2242 | Ga0307413_11689474 | |||
| 2243 | Ga0307410_10030671 | |||
| 2244 | Ga0307410_10642688 | |||
| 2245 | Ga0307410_11881654 | |||
| 2246 | Ga0307406_10016045 | |||
| 2247 | Ga0307406_10105772 | |||
| 2248 | Ga0307406_10165556 | |||
| 2249 | Ga0307406_10378626 | |||
| 2250 | Ga0307407_10012114 | |||
| 2251 | Ga0307407_10300042 | |||
| 2252 | Ga0307407_11528664 | |||
| 2253 | Ga0307412_10028974 | |||
| 2254 | Ga0307412_10029849 | |||
| 2255 | Ga0307409_100036492 | |||
| 2256 | Ga0307409_100086421 | |||
| 2257 | Ga0307409_100096436 | |||
| 2258 | Ga0307409_100366724 | |||
| 2259 | Ga0307409_100589136 | |||
| 2260 | Ga0307409_100630486 | |||
| 2261 | Ga0307409_101699430 | |||
| 2262 | Ga0307409_102060963 | |||
| 2263 | Ga0307409_102285266 | |||
| 2264 | Ga0307416_100003117 | |||
| 2265 | Ga0307416_100045042 | |||
| 2266 | Ga0307416_100068677 | |||
| 2267 | Ga0307416_100112163 | |||
| 2268 | Ga0307416_100197351 | |||
| 2269 | Ga0307416_100417306 | |||
| 2270 | Ga0307416_100631219 | |||
| 2271 | Ga0307416_100673454 | |||
| 2272 | Ga0307416_100755099 | |||
| 2273 | Ga0307416_101366230 | |||
| 2274 | Ga0307411_10020345 | |||
| 2275 | Ga0307415_100002861 | |||
| 2276 | Ga0307415_100029740 | |||
| 2277 | Ga0307415_100118554 | |||
| 2278 | Ga0307415_100168897 | |||
| 2279 | Ga0307415_100655885 | |||
| 2280 | Ga0373950_0084939 | |||
| 2281 | Ga0373959_0066549 | |||
| 2282 | Ga0373928_0041237 | |||
| 2283 | Ga0373949_0143321 | |||
| 2284 | Ga0373941_0058241 | |||
| 2285 | Ga0373953_0108946 | |||
| 2286 | Ga0373960_0017129 | |||
| 2287 | Ga0373955_0906984 | |||
| 2288 | Ga0373942_0260720 | |||
| 2289 | Ga0373962_0365427 | |||
| 2290 | Ga0373931_0107781 | |||
| 2291 | Ga0373933_0057580 | |||
| 2292 | Ga0373937_0010090 | |||
| 2293 | Ga0395899_0002627 | |||
| 2294 | Ga0395899_0007615 | |||
| 2295 | Ga0395899_0009566 | |||
| 2296 | Ga0395899_0022065 | |||
| 2297 | Ga0395899_0038109 | |||
| 2298 | Ga0395899_0047261 | |||
| 2299 | Ga0395899_0051194 | |||
| 2300 | Ga0395899_0052759 | |||
| 2301 | Ga0395899_0077455 | |||
| 2302 | Ga0395899_0081383 | |||
| 2303 | Ga0395900_0001846 | |||
| 2304 | Ga0395900_0009429 | |||
| 2305 | Ga0395900_0013373 | |||
| 2306 | Ga0395900_0018988 | |||
| 2307 | Ga0395900_0029483 | |||
| 2308 | Ga0395900_0036371 | |||
| 2309 | Ga0395900_0044072 | |||
| 2310 | Ga0395900_0070500 | |||
| 2311 | Ga0395900_0091363 | |||
| 2312 | Ga0395900_0092038 | |||
| 2313 | Ga0395900_0177306 | |||
| 2314 | Ga0395900_0213443 | |||
| 2315 | Ga0395900_0231275 | |||
| 2316 | Ga0395900_0278004 | |||
| 2317 | Ga0395900_0532104 | |||
| 2318 | Ga0395900_0637198 | |||
| 2319 | Ga0395900_0706805 | |||
| 2320 | Ga0395900_0840105 | |||
| 2321 | Ga0395900_0926663 | |||
| 2322 | Ga0395900_1084601 | |||
| 2323 | Ga0395900_1427707 | |||
| 2324 | Ga0395898_0005570 | |||
| 2325 | Ga0395898_0026680 | |||
| 2326 | Ga0395898_0033109 | |||
| 2327 | Ga0395898_0035313 | |||
| 2328 | Ga0395898_0035595 | |||
| 2329 | Ga0395898_0040518 | |||
| 2330 | Ga0395898_0069894 | |||
| 2331 | Ga0395898_0112977 | |||
| 2332 | Ga0395898_0145358 | |||
| 2333 | Ga0395898_0178520 | |||
| 2334 | Ga0395898_0208555 | |||
| 2335 | Ga0395898_0210759 | |||
| 2336 | Ga0395898_0223818 | |||
| 2337 | Ga0395898_0291811 | |||
| 2338 | Ga0395898_0295351 | |||
| 2339 | Ga0395898_0304188 | |||
| 2340 | Ga0395898_0634839 | |||
| 2341 | Ga0395898_0685312 | |||
| 2342 | Ga0395898_0991720 | |||
| 2343 | Ga0395898_1229414 | |||
| 2344 | Ga0395898_1367412 | |||
| 2345 | Ga0395898_1588481 | |||
| 2346 | Ga0395905_0004008 | |||
| 2347 | Ga0395905_0010346 | |||
| 2348 | Ga0395905_0011656 | |||
| 2349 | Ga0395905_0025570 | |||
| 2350 | Ga0395905_0031491 | |||
| 2351 | Ga0395905_0037383 | |||
| 2352 | Ga0395905_0053318 | |||
| 2353 | Ga0395905_0096239 | |||
| 2354 | Ga0395905_0177897 | |||
| 2355 | Ga0395905_0310604 | |||
| 2356 | Ga0395905_0528232 | |||
| 2357 | Ga0395905_0567972 | |||
| 2358 | Ga0395901_0009445 | |||
| 2359 | Ga0395901_0015959 | |||
| 2360 | Ga0395901_0018845 | |||
| 2361 | Ga0395901_0033635 | |||
| 2362 | Ga0395901_0038276 | |||
| 2363 | Ga0395901_0059703 | |||
| 2364 | Ga0395901_0063865 | |||
| 2365 | Ga0395901_0083377 | |||
| 2366 | Ga0395901_0094138 | |||
| 2367 | Ga0395901_0162709 | |||
| 2368 | Ga0395901_0224018 | |||
| 2369 | Ga0395901_0316432 | |||
| 2370 | Ga0395901_0344580 | |||
| 2371 | Ga0395901_0402782 | |||
| 2372 | Ga0395901_0968412 | |||
| 2373 | Ga0395901_1220753 | |||
| 2374 | Ga0395901_1258385 | |||
| 2375 | Ga0395901_1510270 | |||
| 2376 | Ga0395901_1776392 | |||
| 2377 | Ga0395901_1995259 | |||
| 2378 | Ga0436360_0951681 | |||
| 2379 | Ga0436360_1157905 | |||
| 2380 | Ga0436363_0888617 | |||
| 2381 | Ga0436363_1488566 | |||
| 2382 | Ga0436362_0754288 | |||
| 2383 | Ga0439438_095989 | |||
| 2384 | Ga0439438_096486 | |||
| 2385 | Ga0439439_0010319 | |||
| 2386 | Ga0439439_0160852 | |||
| 2387 | Ga0439439_0178182 | |||
| 2388 | Ga0439461_0000619 | |||
| 2389 | Ga0439461_0037683 | |||
| 2390 | Ga0439466_0020576 | |||
| 2391 | Ga0439466_0034957 | |||
| 2392 | Ga0439465_0079624 | |||
| 2393 | Ga0439465_0252795 | |||
| 2394 | Ga0451787_498795 | |||
| 2395 | Ga0451800_1006391 | |||
| 2396 | Ga0451802_1694304 | |||
| 2397 | Ga0451807_0378497 | |||
| 2398 | Ga0451833_0670140 | |||
| 2399 | Ga0451843_1366079 | |||
| 2400 | Ga0451853_0882388 | |||
| 2401 | Ga0439431_0014907 | |||
| 2402 | Ga0439431_0260470 | |||
| 2403 | Ga0439433_0095913 | |||
| 2404 | Ga0439433_0106392 | |||
| 2405 | Ga0439437_004317 | |||
| 2406 | Ga0439441_029176 | |||
| 2407 | Ga0439442_025999 | |||
| 2408 | Ga0439445_0012137 | |||
| 2409 | Ga0439445_0025725 | |||
| 2410 | Ga0439445_0179855 | |||
| 2411 | Ga0439448_0030851 | |||
| 2412 | Ga0439448_0085420 | |||
| 2413 | Ga0439448_0235799 | |||
| 2414 | Ga0439432_052677 | |||
| 2415 | Ga0439432_133780 | |||
| 2416 | Ga0439449_0031177 | |||
| 2417 | Ga0439450_123045 | |||
| 2418 | Ga0439451_005011 | |||
| 2419 | Ga0439451_122909 | |||
| 2420 | Ga0439452_081638 | |||
| 2421 | Ga0439454_010851 | |||
| 2422 | Ga0439454_011510 | |||
| 2423 | Ga0439454_062647 | |||
| 2424 | Ga0439456_054646 | |||
| 2425 | Ga0439457_052188 | |||
| 2426 | Ga0439457_076226 | |||
| 2427 | Ga0439462_0001216 | |||
| 2428 | Ga0439462_0023904 | |||
| 2429 | Ga0439462_0146042 | |||
| 2430 | Ga0439463_064454 | |||
| 2431 | Ga0439463_210321 | |||
| 2432 | Ga0450914_010151 | |||
| 2433 | Ga0450915_002864 | |||
| 2434 | Ga0450915_003205 | |||
| 2435 | Ga0450920_007020 | |||
| 2436 | Ga0450923_004638 | |||
| 2437 | Ga0450888_008357 | |||
| 2438 | Ga0450890_017802 | |||
| 2439 | Ga0450898_025234 | |||
| 2440 | Ga0450898_061645 | |||
| 2441 | Ga0450898_133927 | |||
| 2442 | Ga0450900_023403 | |||
| 2443 | Ga0450902_060043 | |||
| 2444 | Ga0450904_019231 | |||
| 2445 | Ga0450907_013427 | |||
| 2446 | Ga0450907_016232 | |||
| 2447 | Ga0450907_018107 | |||
| 2448 | Ga0450910_015813 | |||
| 2449 | Ga0450910_084384 | |||
| 2450 | Ga0439446_0001871 | |||
| 2451 | Ga0439446_0002997 | |||
| 2452 | Ga0439446_0067040 | |||
| 2453 | Ga0439446_0074421 | |||
| 2454 | Ga0439458_0128823 | |||
| 2455 | Ga0450908_026382 | |||
| 2456 | Ga0450908_109462 | |||
| 2457 | Ga0450909_037546 | |||
| 2458 | Ga0439434_0003699 | |||
| 2459 | Ga0439434_0013912 | |||
| 2460 | Ga0439434_0015819 | |||
| 2461 | Ga0439434_0033142 | |||
| 2462 | Ga0439435_0010298 | |||
| 2463 | Ga0439435_0211134 | |||
| 2464 | Ga0439435_0236384 | |||
| 2465 | Ga0439459_0063100 | |||
| 2466 | Ga0439464_0234559 | |||
| 2467 | Ga0439460_0105236 | |||
| 2468 | Ga0439460_0122681 | |||
| 2469 | Ga0439460_0255701 | |||
| 2470 | Ga0450918_041960 | |||
| 2471 | Ga0450918_042988 | |||
| 2472 | Ga0450918_065991 | |||
| 2473 | Ga0450893_0044938 | |||
| 2474 | Ga0466969_0187795 | |||
| 2475 | Ga0466969_0372773 | |||
| 2476 | Ga0466972_0087994 | |||
| 2477 | Ga0466965_0677716 | |||
| 2478 | Ga0466966_0007359 | |||
| 2479 | Ga0466966_0020640 | |||
| 2480 | Ga0466966_0090441 | |||
| 2481 | Ga0466966_0096023 | |||
| 2482 | Ga0466961_0025304 | |||
| 2483 | Ga0466961_0088882 | |||
| 2484 | Ga0466961_0104429 | |||
| 2485 | Ga0466961_0631236 | |||
| 2486 | Ga0466961_0846082 | |||
| 2487 | Ga0466963_0002360 | |||
| 2488 | Ga0466963_0004483 | |||
| 2489 | Ga0466963_0138988 | |||
| 2490 | Ga0466963_0175164 | |||
| 2491 | Ga0466963_0196714 | |||
| 2492 | Ga0466963_0211471 | |||
| 2493 | Ga0466963_0367608 | |||
| 2494 | Ga0466963_0371625 | |||
| 2495 | Ga0466964_0049424 | |||
| 2496 | Ga0466964_0061381 | |||
| 2497 | Ga0466971_0201931 | |||
| 2498 | Ga0466968_0202019 | |||
| 2499 | Ga0466970_0433797 | |||
| 2500 | Ga0466957_0016927 | |||
| 2501 | Ga0466957_0135131 | |||
| 2502 | Ga0466957_0147570 | |||
| 2503 | Ga0466957_0249409 | |||
| 2504 | Ga0466957_1104981 | |||
| 2505 | Ga0466960_0045272 | |||
| 2506 | Ga0466960_0084219 | |||
| 2507 | Ga0466960_0178347 | |||
| 2508 | Ga0466960_0591429 | |||
| 2509 | Ga0466960_0625060 | |||
| 2510 | Ga0466960_0767288 | |||
| 2511 | Ga0466960_1051913 | |||
| 2512 | Ga0466959_0008749 | |||
| 2513 | Ga0451576_0115815 | |||
| 2514 | Ga0451576_1587058 | |||
| 2515 | Ga0466958_0004955 | |||
| 2516 | Ga0466958_0015048 | |||
| 2517 | Ga0466958_0036322 | |||
| 2518 | Ga0466958_0136163 | |||
| 2519 | Ga0466958_0138350 | |||
| 2520 | Ga0466967_0006350 | |||
| 2521 | Ga0466967_0016066 | |||
| 2522 | Ga0466967_0067733 | |||
| 2523 | Ga0466967_0180731 | |||
| 2524 | Ga0466967_0263236 | |||
| 2525 | Ga0466967_0326778 | |||
| 2526 | Ga0466967_0413182 | |||
| 2527 | Ga0466967_0445980 | |||
| 2528 | Ga0466967_1311720 | |||
| 2529 | Ga0495617_073853 | |||
| 2530 | Ga0495592_0000888 | |||
| 2531 | Ga0495592_0124100 | |||
| 2532 | Ga0495603_0165183 | |||
| 2533 | Ga0495603_0873762 | |||
| 2534 | Ga0495590_0254741 | |||
| 2535 | Ga0495591_047010 | |||
| 2536 | Ga0495629_0252696 | |||
| 2537 | Ga0495629_0852333 | |||
| 2538 | Ga0495629_0900201 | |||
| 2539 | Ga0495641_0503644 | |||
| 2540 | Ga0495651_0000180 | |||
| 2541 | Ga0495651_0600715 | |||
| 2542 | Ga0495653_0002924 | |||
| 2543 | Ga0495653_0635130 | |||
| 2544 | Ga0495650_0189396 | |||
| 2545 | Ga0495582_0568845 | |||
| 2546 | Ga0495605_0032750 | |||
| 2547 | Ga0495605_0288096 | |||
| 2548 | Ga0495605_0308889 | |||
| 2549 | Ga0495605_0437250 | |||
| 2550 | Ga0495639_0295760 | |||
| 2551 | Ga0495664_0263796 | |||
| 2552 | Ga0495584_0178201 | |||
| 2553 | Ga0495584_0582548 | |||
| 2554 | Ga0495585_0056503 | |||
| 2555 | Ga0495585_0461342 | |||
| 2556 | Ga0495585_0600092 | |||
| 2557 | Ga0495596_0058005 | |||
| 2558 | Ga0495596_0075595 | |||
| 2559 | Ga0495596_0121458 | |||
| 2560 | Ga0495596_0240682 | |||
| 2561 | Ga0495607_0107078 | |||
| 2562 | Ga0495583_0243839 | |||
| 2563 | Ga0495583_0292738 | |||
| 2564 | Ga0495608_0001686 | |||
| 2565 | Ga0495608_0336179 | |||
| 2566 | Ga0495610_0316075 | |||
| 2567 | Ga0495616_0054636 | |||
| 2568 | Ga0495616_0210481 | |||
| 2569 | Ga0495616_0316762 | |||
| 2570 | Ga0495618_0012480 | |||
| 2571 | Ga0495620_0022332 | |||
| 2572 | Ga0495620_0345407 | |||
| 2573 | Ga0495628_0000067 | |||
| 2574 | Ga0495628_0788631 | |||
| 2575 | Ga0495630_0081846 | |||
| 2576 | Ga0495630_0404854 | |||
| 2577 | Ga0495631_0054944 | |||
| 2578 | Ga0495631_0084610 | |||
| 2579 | Ga0495631_0269111 | |||
| 2580 | Ga0495631_0444668 | |||
| 2581 | Ga0495632_0142562 | |||
| 2582 | Ga0495632_0520542 | |||
| 2583 | Ga0495637_0092707 | |||
| 2584 | Ga0495637_0170921 | |||
| 2585 | Ga0495644_0305800 | |||
| 2586 | Ga0495642_0009720 | |||
| 2587 | Ga0495652_0000315 | |||
| 2588 | Ga0495640_0946791 | |||
| 2589 | Ga0495587_0000287 | |||
| 2590 | Ga0495587_0216058 | |||
| 2591 | Ga0495587_0324175 | |||
| 2592 | Ga0495598_0032233 | |||
| 2593 | Ga0495598_0081236 | |||
| 2594 | Ga0495609_0214884 | |||
| 2595 | Ga0495609_0356633 | |||
| 2596 | Ga0495621_0031654 | |||
| 2597 | Ga0495597_0046898 | |||
| 2598 | Ga0495645_0000234 | |||
| 2599 | Ga0495645_0115844 | |||
| 2600 | Ga0495633_0036714 | |||
| 2601 | Ga0495633_0372087 | |||
| 2602 | Ga0495633_0417170 | |||
| 2603 | Ga0495667_0051835 | |||
| 2604 | Ga0495667_0060341 | |||
| 2605 | Ga0495656_0144301 | |||
| 2606 | Ga0495656_0240034 | |||
| 2607 | Ga0495656_0312135 | |||
| 2608 | Ga0495656_0707014 | |||
| 2609 | Ga0495668_0126987 | |||
| 2610 | Ga0495668_0333762 | |||
| 2611 | Ga0495634_0146005 | |||
| 2612 | Ga0495611_0379181 | |||
| 2613 | Ga0495635_0298037 | |||
| 2614 | Ga0495659_0005392 | |||
| 2615 | Ga0495659_0177241 | |||
| 2616 | Ga0495661_0073887 | |||
| 2617 | Ga0495661_0306742 | |||
| 2618 | Ga0495588_0191157 | |||
| 2619 | Ga0495657_0030413 | |||
| 2620 | Ga0495657_0034883 | |||
| 2621 | Ga0495657_0414421 | |||
| 2622 | Ga0495599_0000249 | |||
| 2623 | Ga0495599_0875064 | |||
| 2624 | Ga0495623_0000144 | |||
| 2625 | Ga0495623_0257898 | |||
| 2626 | Ga0495646_0000614 | |||
| 2627 | Ga0495647_0331979 | |||
| 2628 | Ga0495669_0051344 | |||
| 2629 | Ga0495669_0292207 | |||
| 2630 | Ga0495613_1014977 | |||
| 2631 | Ga0495624_0954229 | |||
| 2632 | Ga0495670_0094543 | |||
| 2633 | Ga0495670_0443928 | |||
| 2634 | Ga0495670_0445784 | |||
| 2635 | Ga0495670_0790016 | |||
| 2636 | Ga0495671_0141049 | |||
| 2637 | Ga0495671_0434642 | |||
| 2638 | Ga0495649_0198625 | |||
| 2639 | Ga0495589_0040099 | |||
| 2640 | Ga0495589_0091039 | |||
| 2641 | Ga0495589_0129373 | |||
| 2642 | Ga0495589_0377739 | |||
| 2643 | Ga0495600_0190425 | |||
| 2644 | Ga0495600_0195398 | |||
| 2645 | Ga0495600_0584456 | |||
| 2646 | Ga0495660_0077023 | |||
| 2647 | Ga0495660_0255491 | |||
| 2648 | Ga0495660_0336195 | |||
| 2649 | Ga0495660_0382387 | |||
| 2650 | Ga0495581_0186089 | |||
| 2651 | Ga0495604_0000076 | |||
| 2652 | Ga0495604_0224250 | |||
| 2653 | Ga0495604_0666779 | |||
| 2654 | Ga0495636_0043642 | |||
| 2655 | Ga0495636_0426777 | |||
| 2656 | Ga0495674_0323066 | |||
| 2657 | Ga0495674_0677644 | |||
| 2658 | Ga0495680_0056788 | |||
| 2659 | Ga0495680_0151804 | |||
| 2660 | Ga0495683_0021829 | |||
| 2661 | Ga0495683_0424280 | |||
| 2662 | Ga0495675_0015013 | |||
| 2663 | Ga0495675_0175608 | |||
| 2664 | Ga0495677_0014856 | |||
| 2665 | Ga0495679_065970 | |||
| 2666 | Ga0495679_134141 | |||
| 2667 | Ga0495679_137826 | |||
| 2668 | Ga0495685_034722 | |||
| 2669 | Ga0495681_0028720 | |||
| 2670 | Ga0495681_0226384 | |||
| 2671 | Ga0495684_0020664 | |||
| 2672 | Ga0495684_0897722 | |||
| 2673 | Ga0495593_0601021 | |||
| 2674 | Ga0495602_0000247 | |||
| 2675 | Ga0495614_0329403 | |||
| 2676 | Ga0495615_0013300 | |||
| 2677 | Ga0495626_0241050 | |||
| 2678 | Ga0496100_0175107 | |||
| 2679 | Ga0496100_0303868 | |||
| 2680 | Ga0496100_1538221 | |||
| 2681 | Ga0496101_0078025 | |||
| 2682 | Ga0496101_0841511 | |||
| 2683 | Ga0496101_1169584 | |||
| 2684 | Ga0496101_1326021 | |||
| 2685 | Ga0496102_0615589 | |||
| 2686 | Ga0496102_0759579 | |||
| 2687 | Ga0496102_1213080 | |||
| 2688 | Ga0496102_1418269 | |||
| 2689 | Ga0496103_0192928 | |||
| 2690 | Ga0496103_0384997 | |||
| 2691 | Ga0496104_0003234 | |||
| 2692 | Ga0496104_0158074 | |||
| 2693 | Ga0496105_0083225 | |||
| 2694 | Ga0496106_0212251 | |||
| 2695 | Ga0496106_0374663 | |||
| 2696 | Ga0496106_0847823 | |||
| 2697 | Ga0496107_0096029 | |||
| 2698 | Ga0496107_0098643 | |||
| 2699 | Ga0496107_0445779 | |||
| 2700 | Ga0496107_0791404 | |||
| 2701 | Ga0496108_0004178 | |||
| 2702 | Ga0496108_0018043 | |||
| 2703 | Ga0496108_0044721 | |||
| 2704 | Ga0496108_0123552 | |||
| 2705 | Ga0496108_0173491 | |||
| 2706 | Ga0496108_0185332 | |||
| 2707 | Ga0496108_1161403 | |||
| 2708 | Ga0496108_1794579 | |||
| 2709 | Ga0496109_0005943 | |||
| 2710 | Ga0496109_0011028 | |||
| 2711 | Ga0496109_0030731 | |||
| 2712 | Ga0496109_0102452 | |||
| 2713 | Ga0496109_0198403 | |||
| 2714 | Ga0496109_0420874 | |||
| 2715 | Ga0496110_0004216 | |||
| 2716 | Ga0496110_0027118 | |||
| 2717 | Ga0496110_0350691 | |||
| 2718 | Ga0496110_1385745 | |||
| 2719 | Ga0496110_1520834 | |||
| 2720 | Ga0496111_0000393 | |||
| 2721 | Ga0496111_0007348 | |||
| 2722 | Ga0496111_0090525 | |||
| 2723 | Ga0496111_0236133 | |||
| 2724 | Ga0496111_0451377 | |||
| 2725 | Ga0496112_0124184 | |||
| 2726 | Ga0496113_0014014 | |||
| 2727 | Ga0496113_0133419 | |||
| 2728 | Ga0496113_0345003 | |||
| 2729 | Ga0496114_0049879 | |||
| 2730 | Ga0496114_0190020 | |||
| 2731 | Ga0496114_0271639 | |||
| 2732 | Ga0496114_0556989 | |||
| 2733 | Ga0496114_0792951 | |||
| 2734 | Ga0496114_1029061 | |||
| 2735 | Ga0496115_0255332 | |||
| 2736 | Ga0501309_089122 | |||
| 2737 | Ga0501307_038129 | |||
| 2738 | Ga0501299_209127 | |||
| 2739 | Ga0501311_036429 | |||
| 2740 | Ga0501313_044581 | |||
| 2741 | Ga0501316_071380 | |||
| 2742 | Ga0501317_085189 | |||
| 2743 | Ga0501321_039901 | |||
| 2744 | Ga0501031_0000706 | |||
| 2745 | Ga0501031_0005850 | |||
| 2746 | Ga0501031_0043735 | |||
| 2747 | Ga0501031_0050750 | |||
| 2748 | Ga0501031_0110681 | |||
| 2749 | Ga0501031_0130436 | |||
| 2750 | Ga0501031_0130858 | |||
| 2751 | Ga0501031_0187617 | |||
| 2752 | Ga0501031_0198994 | |||
| 2753 | Ga0501031_0200654 | |||
| 2754 | Ga0501031_0530971 | |||
| 2755 | Ga0501031_0701890 | |||
| 2756 | Ga0501031_0794061 | |||
| 2757 | Ga0501031_0921361 | |||
| 2758 | Ga0501032_0016227 | |||
| 2759 | Ga0501032_0018329 | |||
| 2760 | Ga0501032_0047603 | |||
| 2761 | Ga0501032_0114899 | |||
| 2762 | Ga0501032_0152060 | |||
| 2763 | Ga0501032_0717000 | |||
| 2764 | Ga0501033_0010945 | |||
| 2765 | Ga0501033_0170851 | |||
| 2766 | Ga0501033_0260823 | |||
| 2767 | Ga0501033_0312085 | |||
| 2768 | Ga0501033_0331947 | |||
| 2769 | Ga0501033_0353750 | |||
| 2770 | Ga0501033_1188061 | |||
| 2771 | Ga0501034_0005653 | |||
| 2772 | Ga0501034_0195508 | |||
| 2773 | Ga0501034_0283514 | |||
| 2774 | Ga0501034_0755012 | |||
| 2775 | Ga0501034_1028107 | |||
| 2776 | Ga0501034_1444928 | |||
| 2777 | Ga0501036_0003757 | |||
| 2778 | Ga0501036_0007382 | |||
| 2779 | Ga0501036_0035879 | |||
| 2780 | Ga0501036_0062512 | |||
| 2781 | Ga0501036_0113188 | |||
| 2782 | Ga0501036_0121770 | |||
| 2783 | Ga0501036_0124465 | |||
| 2784 | Ga0501036_0150408 | |||
| 2785 | Ga0501036_0337166 | |||
| 2786 | Ga0501036_0631634 | |||
| 2787 | Ga0501036_0780228 | |||
| 2788 | Ga0501037_0006885 | |||
| 2789 | Ga0501037_0023639 | |||
| 2790 | Ga0501037_0119963 | |||
| 2791 | Ga0501037_0144876 | |||
| 2792 | Ga0501037_0257106 | |||
| 2793 | Ga0501037_0327762 | |||
| 2794 | Ga0501037_0735831 | |||
| 2795 | Ga0501037_1075436 | |||
| 2796 | Ga0501038_0001115 | |||
| 2797 | Ga0501038_0009144 | |||
| 2798 | Ga0501038_0013764 | |||
| 2799 | Ga0501038_0018951 | |||
| 2800 | Ga0501038_0028196 | |||
| 2801 | Ga0501038_0157363 | |||
| 2802 | Ga0501038_0234398 | |||
| 2803 | Ga0501039_0000660 | |||
| 2804 | Ga0501039_0007924 | |||
| 2805 | Ga0501039_0008099 | |||
| 2806 | Ga0501039_0033291 | |||
| 2807 | Ga0501039_0041562 | |||
| 2808 | Ga0501039_0049372 | |||
| 2809 | Ga0501039_0053511 | |||
| 2810 | Ga0501039_0074546 | |||
| 2811 | Ga0501039_0086913 | |||
| 2812 | Ga0501039_0266870 | |||
| 2813 | Ga0501039_0511975 | |||
| 2814 | Ga0501039_1227992 | |||
| 2815 | Ga0501039_1266092 | |||
| 2816 | Ga0501040_0000728 | |||
| 2817 | Ga0501040_0006365 | |||
| 2818 | Ga0501040_0010406 | |||
| 2819 | Ga0501040_0017443 | |||
| 2820 | Ga0501040_0040218 | |||
| 2821 | Ga0501040_0054331 | |||
| 2822 | Ga0501040_0106290 | |||
| 2823 | Ga0501040_0208933 | |||
| 2824 | Ga0501040_0244845 | |||
| 2825 | Ga0501040_0315473 | |||
| 2826 | Ga0501041_0003781 | |||
| 2827 | Ga0501041_0003881 | |||
| 2828 | Ga0501041_0008611 | |||
| 2829 | Ga0501041_0013072 | |||
| 2830 | Ga0501041_0014750 | |||
| 2831 | Ga0501041_0051949 | |||
| 2832 | Ga0501041_0064403 | |||
| 2833 | Ga0501041_0107124 | |||
| 2834 | Ga0501041_0620415 | |||
| 2835 | Ga0501041_0903048 | |||
| 2836 | Ga0501042_0002963 | |||
| 2837 | Ga0501042_0007578 | |||
| 2838 | Ga0501042_0011188 | |||
| 2839 | Ga0501042_0031230 | |||
| 2840 | Ga0501042_0047422 | |||
| 2841 | Ga0501042_0061732 | |||
| 2842 | Ga0501042_0084864 | |||
| 2843 | Ga0501042_0092038 | |||
| 2844 | Ga0501042_0106568 | |||
| 2845 | Ga0501042_0126877 | |||
| 2846 | Ga0501042_0159818 | |||
| 2847 | Ga0501042_0586818 | |||
| 2848 | Ga0501042_0755061 | |||
| 2849 | Ga0501043_0007842 | |||
| 2850 | Ga0501043_0008472 | |||
| 2851 | Ga0501043_0128791 | |||
| 2852 | Ga0501043_0196146 | |||
| 2853 | Ga0501043_0213485 | |||
| 2854 | Ga0501043_0285585 | |||
| 2855 | Ga0501043_0316327 | |||
| 2856 | Ga0501043_0770107 | |||
| 2857 | Ga0501043_0833945 | |||
| 2858 | Ga0501046_0002216 | |||
| 2859 | Ga0501046_0002233 | |||
| 2860 | Ga0501046_0002756 | |||
| 2861 | Ga0501046_0015022 | |||
| 2862 | Ga0501046_0078455 | |||
| 2863 | Ga0501046_0086060 | |||
| 2864 | Ga0501046_0163140 | |||
| 2865 | Ga0501046_0199904 | |||
| 2866 | Ga0501046_0227262 | |||
| 2867 | Ga0501046_1204015 | |||
| 2868 | Ga0501047_0038295 | |||
| 2869 | Ga0501047_0350502 | |||
| 2870 | Ga0501047_0593094 | |||
| 2871 | Ga0501047_0900163 | |||
| 2872 | Ga0501047_1243881 | |||
| 2873 | Ga0501048_0000617 | |||
| 2874 | Ga0501048_0002324 | |||
| 2875 | Ga0501048_0012572 | |||
| 2876 | Ga0501048_0021108 | |||
| 2877 | Ga0501048_0028857 | |||
| 2878 | Ga0501048_0043110 | |||
| 2879 | Ga0501048_0124224 | |||
| 2880 | Ga0501048_0129074 | |||
| 2881 | Ga0501048_0186683 | |||
| 2882 | Ga0501048_0197091 | |||
| 2883 | Ga0501048_0552426 | |||
| 2884 | Ga0501048_0804473 | |||
| 2885 | Ga0501067_0017114 | |||
| 2886 | Ga0501067_0093111 | |||
| 2887 | Ga0501067_0124694 | |||
| 2888 | Ga0501067_0363775 | |||
| 2889 | Ga0501067_0861478 | |||
| 2890 | Ga0501068_0001134 | |||
| 2891 | Ga0501068_0002686 | |||
| 2892 | Ga0501068_0004047 | |||
| 2893 | Ga0501068_0007077 | |||
| 2894 | Ga0501068_0008085 | |||
| 2895 | Ga0501068_0127889 | |||
| 2896 | Ga0501068_0310113 | |||
| 2897 | Ga0501068_0364679 | |||
| 2898 | Ga0501068_0626840 | |||
| 2899 | Ga0501068_1117055 | |||
| 2900 | Ga0501069_0000780 | |||
| 2901 | Ga0501069_0011537 | |||
| 2902 | Ga0501069_0041592 | |||
| 2903 | Ga0501069_0079749 | |||
| 2904 | Ga0501069_0098152 | |||
| 2905 | Ga0501069_0113580 | |||
| 2906 | Ga0501069_0152224 | |||
| 2907 | Ga0501069_0464503 | |||
| 2908 | Ga0501069_0634701 | |||
| 2909 | Ga0501069_0645376 | |||
| 2910 | Ga0501070_0000228 | |||
| 2911 | Ga0501070_0001876 | |||
| 2912 | Ga0501070_0008739 | |||
| 2913 | Ga0501070_0033133 | |||
| 2914 | Ga0501070_0087975 | |||
| 2915 | Ga0501070_0137763 | |||
| 2916 | Ga0501070_0208137 | |||
| 2917 | Ga0501070_0211776 | |||
| 2918 | Ga0501070_0298423 | |||
| 2919 | Ga0501070_0315026 | |||
| 2920 | Ga0501070_0826016 | |||
| 2921 | Ga0501071_0000685 | |||
| 2922 | Ga0501071_0002630 | |||
| 2923 | Ga0501071_0006021 | |||
| 2924 | Ga0501071_0012211 | |||
| 2925 | Ga0501071_0014054 | |||
| 2926 | Ga0501071_0023786 | |||
| 2927 | Ga0501071_0034268 | |||
| 2928 | Ga0501071_0061882 | |||
| 2929 | Ga0501071_0085528 | |||
| 2930 | Ga0501071_0132942 | |||
| 2931 | Ga0501071_0308489 | |||
| 2932 | Ga0501072_0002801 | |||
| 2933 | Ga0501072_0003033 | |||
| 2934 | Ga0501072_0011260 | |||
| 2935 | Ga0501072_0012221 | |||
| 2936 | Ga0501072_0020766 | |||
| 2937 | Ga0501072_0033632 | |||
| 2938 | Ga0501072_0045270 | |||
| 2939 | Ga0501072_0046765 | |||
| 2940 | Ga0501072_0080308 | |||
| 2941 | Ga0501072_0140886 | |||
| 2942 | Ga0501072_0261462 | |||
| 2943 | Ga0501072_0557566 | |||
| 2944 | Ga0501072_1517923 | |||
| 2945 | Ga0501073_0005554 | |||
| 2946 | Ga0501073_0014941 | |||
| 2947 | Ga0501073_0049645 | |||
| 2948 | Ga0501073_0090217 | |||
| 2949 | Ga0501073_0188182 | |||
| 2950 | Ga0501073_0387582 | |||
| 2951 | Ga0501073_0741584 | |||
| 2952 | Ga0501074_0003167 | |||
| 2953 | Ga0501074_0006117 | |||
| 2954 | Ga0501074_0024769 | |||
| 2955 | Ga0501074_0030506 | |||
| 2956 | Ga0501074_0031566 | |||
| 2957 | Ga0501074_0049675 | |||
| 2958 | Ga0501074_0050747 | |||
| 2959 | Ga0501074_0066485 | |||
| 2960 | Ga0501074_0200675 | |||
| 2961 | Ga0501074_0350004 | |||
| 2962 | Ga0501074_0358527 | |||
| 2963 | Ga0501074_0376633 | |||
| 2964 | Ga0501075_0002269 | |||
| 2965 | Ga0501075_0002789 | |||
| 2966 | Ga0501075_0004313 | |||
| 2967 | Ga0501075_0028435 | |||
| 2968 | Ga0501075_0033104 | |||
| 2969 | Ga0501075_0072302 | |||
| 2970 | Ga0501075_0079288 | |||
| 2971 | Ga0501075_0146953 | |||
| 2972 | Ga0501075_0157384 | |||
| 2973 | Ga0501075_0343485 | |||
| 2974 | Ga0501075_0448898 | |||
| 2975 | Ga0501075_0466387 | |||
| 2976 | Ga0501076_0004978 | |||
| 2977 | Ga0501076_0006009 | |||
| 2978 | Ga0501076_0008482 | |||
| 2979 | Ga0501076_0026676 | |||
| 2980 | Ga0501076_0055715 | |||
| 2981 | Ga0501076_0060208 | |||
| 2982 | Ga0501076_0205267 | |||
| 2983 | Ga0501076_0249700 | |||
| 2984 | Ga0501076_0286542 | |||
| 2985 | Ga0501076_0357020 | |||
| 2986 | Ga0501076_0592464 | |||
| 2987 | Ga0501076_1450927 | |||
| 2988 | Ga0501076_1692532 | |||
| 2989 | Ga0501077_0001985 | |||
| 2990 | Ga0501077_0003454 | |||
| 2991 | Ga0501077_0006318 | |||
| 2992 | Ga0501077_0007003 | |||
| 2993 | Ga0501077_0028663 | |||
| 2994 | Ga0501077_0048061 | |||
| 2995 | Ga0501077_0053496 | |||
| 2996 | Ga0501077_0069297 | |||
| 2997 | Ga0501077_0112153 | |||
| 2998 | Ga0501077_0114771 | |||
| 2999 | Ga0501077_0159140 | |||
| 3000 | Ga0501077_0629607 | |||
| 3001 | Ga0501202_176455 | |||
| 3002 | Ga0501209_135717 | |||
| 3003 | Ga0501217_038277 | |||
| 3004 | Ga0501250_077797 | |||
| 3005 | Ga0501221_090447 | |||
| 3006 | Ga0501225_0199859 | |||
| 3007 | Ga0501079_0009194 | |||
| 3008 | Ga0501079_0009863 | |||
| 3009 | Ga0501079_0010403 | |||
| 3010 | Ga0501079_0011677 | |||
| 3011 | Ga0501079_0012010 | |||
| 3012 | Ga0501079_0018239 | |||
| 3013 | Ga0501079_0021266 | |||
| 3014 | Ga0501079_0039464 | |||
| 3015 | Ga0501079_0084134 | |||
| 3016 | Ga0501079_0402774 | |||
| 3017 | Ga0501079_0517321 | |||
| 3018 | Ga0501079_0751924 | |||
| 3019 | Ga0501079_0992209 | |||
| 3020 | Ga0501080_0000687 | |||
| 3021 | Ga0501080_0011018 | |||
| 3022 | Ga0501080_0014808 | |||
| 3023 | Ga0501080_0026542 | |||
| 3024 | Ga0501080_0047984 | |||
| 3025 | Ga0501080_0081841 | |||
| 3026 | Ga0501080_0191276 | |||
| 3027 | Ga0501080_0193342 | |||
| 3028 | Ga0501080_0251632 | |||
| 3029 | Ga0501080_0298839 | |||
| 3030 | Ga0501080_0835999 | |||
| 3031 | Ga0501080_1252278 | |||
| 3032 | Ga0501080_1401592 | |||
| 3033 | Ga0501081_0006037 | |||
| 3034 | Ga0501081_0009846 | |||
| 3035 | Ga0501081_0013639 | |||
| 3036 | Ga0501081_0024363 | |||
| 3037 | Ga0501081_0032565 | |||
| 3038 | Ga0501081_0053343 | |||
| 3039 | Ga0501081_0057178 | |||
| 3040 | Ga0501081_0098245 | |||
| 3041 | Ga0501081_0107555 | |||
| 3042 | Ga0501081_0107891 | |||
| 3043 | Ga0501081_0249040 | |||
| 3044 | Ga0501081_0618732 | |||
| 3045 | Ga0501081_0658164 | |||
| 3046 | Ga0501081_1173792 | |||
| 3047 | Ga0501081_1347264 | |||
| 3048 | Ga0501081_1436817 | |||
| 3049 | Ga0501083_0003918 | |||
| 3050 | Ga0501083_0017267 | |||
| 3051 | Ga0501083_0029656 | |||
| 3052 | Ga0501083_0111615 | |||
| 3053 | Ga0501083_0224550 | |||
| 3054 | Ga0501083_0247615 | |||
| 3055 | Ga0501083_0390078 | |||
| 3056 | Ga0501083_0398302 | |||
| 3057 | Ga0501232_087354 | |||
| 3058 | Ga0501035_0008085 | |||
| 3059 | Ga0501035_0010116 | |||
| 3060 | Ga0501035_0012955 | |||
| 3061 | Ga0501035_0050133 | |||
| 3062 | Ga0501035_0053961 | |||
| 3063 | Ga0501035_0292594 | |||
| 3064 | Ga0501035_0537620 | |||
| 3065 | Ga0501035_0618421 | |||
| 3066 | Ga0501035_0853709 | |||
| 3067 | Ga0501035_0862448 | |||
| 3068 | Ga0501035_1437911 | |||
| 3069 | Ga0501044_0041203 | |||
| 3070 | Ga0501044_0215535 | |||
| 3071 | Ga0501044_0348769 | |||
| 3072 | Ga0501044_0368140 | |||
| 3073 | Ga0501044_0493580 | |||
| 3074 | Ga0501044_0702883 | |||
| 3075 | Ga0501044_0989473 | |||
| 3076 | Ga0501044_1301276 | |||
| 3077 | Ga0501044_1600370 | |||
| 3078 | Ga0501045_0000889 | |||
| 3079 | Ga0501045_0015968 | |||
| 3080 | Ga0501045_0030153 | |||
| 3081 | Ga0501045_0046781 | |||
| 3082 | Ga0501045_0083831 | |||
| 3083 | Ga0501045_0141450 | |||
| 3084 | Ga0501045_0180380 | |||
| 3085 | Ga0501045_0186675 | |||
| 3086 | Ga0501045_0211782 | |||
| 3087 | Ga0501045_0231679 | |||
| 3088 | Ga0501045_0318865 | |||
| 3089 | Ga0501045_0808293 | |||
| 3090 | Ga0501045_0899709 | |||
| 3091 | Ga0501045_1035687 | |||
| 3092 | nmdc:mga03683_43872_c1 | |||
| 3093 | nmdc:mga03n38_43033_c1 | |||
| 3094 | nmdc:mga00v17_31108_c1 | |||
| 3095 | nmdc:mga00v17_679630_c1 | |||
| 3096 | nmdc:mga06z11_7934_c1 | |||
| 3097 | nmdc:mga04h51_40534_c1 | |||
| 3098 | nmdc:mga07m45_404071_c1 | |||
| 3099 | nmdc:mga05p37_10711_c2 | |||
| 3100 | nmdc:mga05p37_1181908_c1 | |||
| 3101 | nmdc:mga05p37_1183477_c1 | |||
| 3102 | nmdc:mga05p37_1316290_c1 | |||
| 3103 | nmdc:mga05p37_1437251_c1 | |||
| 3104 | nmdc:mga05p37_25601_c1 | |||
| 3105 | nmdc:mga05p37_29029_c1 | |||
| 3106 | nmdc:mga05p37_318209_c1 | |||
| 3107 | nmdc:mga05p37_337656_c1 | |||
| 3108 | nmdc:mga05p37_397655_c1 | |||
| 3109 | nmdc:mga09592_153275_c1 | |||
| 3110 | nmdc:mga09592_32167_c1 | |||
| 3111 | nmdc:mga09592_406858_c1 | |||
| 3112 | nmdc:mga09592_461313_c1 | |||
| 3113 | nmdc:mga0qj67_209656_c1 | |||
| 3114 | nmdc:mga0qj67_22113_c1 | |||
| 3115 | nmdc:mga0qj67_248987_c1 | |||
| 3116 | nmdc:mga0qj67_448264_c1 | |||
| 3117 | nmdc:mga06r32_1064713_c1 | |||
| 3118 | nmdc:mga06r32_1083178_c1 | |||
| 3119 | nmdc:mga06r32_1087252_c1 | |||
| 3120 | nmdc:mga06r32_1300502_c1 | |||
| 3121 | nmdc:mga06r32_365238_c1 | |||
| 3122 | nmdc:mga06r32_399914_c1 | |||
| 3123 | nmdc:mga06r32_87639_c1 | |||
| 3124 | nmdc:mga08y16_115790_c1 | |||
| 3125 | nmdc:mga08y16_12151_c1 | |||
| 3126 | nmdc:mga08y16_1371276_c1 | |||
| 3127 | nmdc:mga08y16_1510353_c1 | |||
| 3128 | nmdc:mga08y16_167946_c1 | |||
| 3129 | nmdc:mga08y16_241148_c1 | |||
| 3130 | nmdc:mga08y16_290212_c1 | |||
| 3131 | nmdc:mga08y16_35922_c1 | |||
| 3132 | nmdc:mga08y16_842521_c1 | |||
| 3133 | nmdc:mga08y16_85910_c1 | |||
| 3134 | nmdc:mga0n895_118056_c1 | |||
| 3135 | nmdc:mga0n895_711023_c1 | |||
| 3136 | nmdc:mga0n895_856944_c1 | |||
| 3137 | nmdc:mga0rr50_1528052_c1 | |||
| 3138 | nmdc:mga08x19_62128_c1 | |||
| 3139 | nmdc:mga0a205_30337_c1 | |||
| 3140 | nmdc:mga0a205_859819_c1 | |||
| 3141 | Ga0495601_0000119 | |||
| 3142 | Ga0495601_0160937 | |||
| 3143 | Ga0495601_0182712 | |||
| 3144 | Ga0495612_0037524 | |||
| 3145 | Ga0495612_0338613 | |||
| 3146 | Ga0495655_0078624 | |||
| 3147 | Ga0495655_0174116 | |||
| 3148 | Ga0495595_0043685 | |||
| 3149 | Ga0495595_0073389 | |||
| 3150 | Ga0495619_0043034 | |||
| 3151 | Ga0495619_0094354 | |||
| 3152 | Ga0495619_0162255 | |||
| 3153 | Ga0495619_0444094 | |||
| 3154 | Ga0500628_143221 | |||
| 3155 | Ga0501084_0006705 | |||
| 3156 | Ga0501084_0015070 | |||
| 3157 | Ga0501084_0021021 | |||
| 3158 | Ga0501084_0022756 | |||
| 3159 | Ga0501084_0035380 | |||
| 3160 | Ga0501084_0041810 | |||
| 3161 | Ga0501084_0067605 | |||
| 3162 | Ga0501084_0137687 | |||
| 3163 | Ga0501084_0167054 | |||
| 3164 | Ga0501084_0269893 | |||
| 3165 | Ga0501084_0277355 | |||
| 3166 | Ga0501084_0303103 | |||
| 3167 | Ga0501084_0758704 | |||
| 3168 | Ga0501084_0874450 | |||
| 3169 | Ga0501084_0889162 | |||
| 3170 | Ga0501084_1102419 | |||
| 3171 | Ga0501084_1321544 | |||
| 3172 | Ga0590071_008391 | |||
| 3173 | Ga0590074_005887 | |||
| 3174 | Ga0590074_043475 | |||
| 3175 | Ga0590075_003803 | |||
| 3176 | Ga0590075_011346 | |||
| 3177 | Ga0590075_056847 | |||
| 3178 | Ga0590075_061790 | |||
| 3179 | Ga0590075_100119 | |||
| 3180 | Ga0590077_008165 | |||
| 3181 | Ga0590077_049431 | |||
| 3182 | Ga0590077_141001 | |||
| 3183 | Ga0587084_021635 | |||
| 3184 | Ga0587066_224931 | |||
| 3185 | Ga0587070_143489 | |||
| 3186 | Ga0587073_0058787 | |||
| 3187 | Ga0587077_086997 | |||
| 3188 | Ga0587080_076237 | |||
| 3189 | Ga0587082_048084 | |||
| 3190 | Ga0587083_0116683 | |||
| 3191 | Ga0587088_063051 | |||
| 3192 | Ga0587090_055926 | |||
| 3193 | Ga0587091_072441 | |||
| 3194 | Ga0587091_163838 | |||
| 3195 | Ga0587067_129796 | |||
| 3196 | Ga0587067_167217 | |||
| 3197 | Ga0587068_131767 | |||
| 3198 | Ga0587072_074232 | |||
| 3199 | Ga0587076_067718 | |||
| 3200 | Ga0587079_047322 | |||
| 3201 | Ga0587079_223223 | |||
| 3202 | Ga0501082_0003225 | |||
| 3203 | Ga0501082_0010945 | |||
| 3204 | Ga0501082_0081803 | |||
| 3205 | Ga0501082_0082153 | |||
| 3206 | Ga0501082_0088602 | |||
| 3207 | Ga0501082_0177062 | |||
| 3208 | Ga0501082_0201280 | |||
| 3209 | Ga0501082_0216899 | |||
| 3210 | Ga0501082_0651756 | |||
| 3211 | Ga0501082_0768575 | |||
| 3212 | Ga0501082_1028068 | |||
| 3213 | Ga0501082_1396608 | |||
| 3214 | Ga0466962_0087611 | |||
| 3215 | Ga0466962_0089723 | |||
| 3216 | Ga0530510_0006136 | |||
| 3217 | Ga0530510_0008550 | |||
| 3218 | Ga0530510_0012893 | |||
| 3219 | Ga0530510_0013117 | |||
| 3220 | Ga0530510_0028782 | |||
| 3221 | Ga0530510_0032815 | |||
| 3222 | Ga0530510_0044977 | |||
| 3223 | Ga0530510_0234248 | |||
| 3224 | Ga0530510_0390463 | |||
| 3225 | Ga0530510_0437995 | |||
| 3226 | Ga0530510_0558206 | |||
| 3227 | Ga0530510_0566661 | |||
| 3228 | Ga0530510_1151769 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy