F495062

General Info

Members Datasets Scaffolds Average Seq Length
1614 505 3228 68

Family's Representative Sequence

Representative Sequence 3300005329|Ga0070683_101207937|Ga0070683_1012079371
Length 73
Sequence MLGFVALVYASVKDTPVVHAGKAINIFGSMIQAVARQPELKGELTGIQWLGFALTEAVVFYGLIGGLLAYVLV

Samples

Sample ID Description Type Environment
1 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
2 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
3 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
6 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
7 3300005277 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
21 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
33 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
34 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
35 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
36 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
37 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
38 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
39 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
40 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
41 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
42 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
43 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
44 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
45 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
46 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
47 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
48 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
49 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
50 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
51 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
52 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
53 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
54 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
55 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
56 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
57 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
58 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
59 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
60 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
61 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
62 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
63 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
64 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
65 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
66 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
67 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
68 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
69 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
70 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
71 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
72 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
73 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
74 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
75 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
76 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
77 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
78 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
79 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
80 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
81 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
82 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
83 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
84 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
85 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
86 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
87 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
88 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
89 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
90 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
91 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
92 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
93 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
94 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
95 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
96 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
97 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
98 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
99 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
100 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
101 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
102 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
103 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
104 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
105 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
106 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
107 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
108 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
109 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
110 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
111 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
112 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
113 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
114 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
115 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
116 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
117 3300012480 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.yng.040610 Metagenome Rhizosphere
118 3300012481 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.1.yng.040610 Metagenome Rhizosphere
119 3300012483 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610 Metagenome Rhizosphere
120 3300012508 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 Metagenome Rhizosphere
121 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
122 3300013062 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
123 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
124 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
125 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
126 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
127 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
128 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
129 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
130 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
131 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
132 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
133 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
134 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
135 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
136 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
137 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
138 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
139 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
140 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
141 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
142 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
143 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
144 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
145 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
146 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
147 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
148 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
206 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
207 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
208 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
209 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
213 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
214 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
215 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
216 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
217 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
218 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
219 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
220 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
221 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
222 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
223 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
224 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
225 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
226 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
227 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
228 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
229 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
230 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
231 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
232 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
233 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
234 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
235 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
236 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
237 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
238 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
239 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
240 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
241 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
242 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
243 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
244 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
245 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
246 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
247 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
248 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
249 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
250 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
251 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
252 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
253 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
254 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
255 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
256 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
257 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
258 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
259 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
260 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
261 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
262 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
263 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
264 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
265 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
266 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
267 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
268 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
269 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
270 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
271 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
272 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
273 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
274 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
275 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
276 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
277 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
278 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
279 3300042119 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218L_E14_082316_1902 Metagenome Rhizosphere
280 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
281 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
282 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
283 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
284 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
285 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
286 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
287 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
288 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
289 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
290 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
291 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
292 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
293 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
294 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
295 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
296 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
297 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
298 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
299 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
300 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
301 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
302 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
303 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
304 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
305 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
306 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
307 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
308 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
309 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
310 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
311 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
312 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
313 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
314 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
315 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
316 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
317 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
318 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
319 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
320 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
321 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
322 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
323 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
324 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
325 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
326 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
327 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
328 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
329 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
330 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
331 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
332 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
333 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
334 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
335 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
336 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
337 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
338 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
339 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
340 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
341 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
342 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
343 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
344 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
345 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
346 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
347 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
348 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
349 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
350 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
351 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
352 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
353 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
354 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
355 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
356 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
357 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
358 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
359 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
360 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
361 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
362 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
363 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
364 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
365 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
366 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
367 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
368 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
369 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
370 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
371 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
372 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
373 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
374 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
375 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
376 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
377 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
378 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
379 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
380 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
381 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
382 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
383 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
384 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
385 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
386 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
387 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
388 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
389 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
390 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
391 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
392 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
393 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
394 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
395 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
396 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
397 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
398 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
399 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
400 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
401 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
402 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
403 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
404 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
405 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
406 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
407 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
408 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
409 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
410 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
411 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
412 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
413 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
414 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
415 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
416 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
417 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
418 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
419 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
420 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
421 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
422 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
423 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
424 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
425 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
426 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
427 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
428 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
429 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
430 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
431 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
432 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
433 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
434 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
435 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
436 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
437 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
438 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
439 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
440 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
441 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
442 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
443 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
444 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
445 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
446 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
447 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
448 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
449 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
450 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
451 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
452 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
453 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
454 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
455 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
456 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
457 3300049757 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control Metagenome Rhizosphere
458 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
459 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
460 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
461 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
462 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
463 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
464 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
465 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
466 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
467 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
468 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
469 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
470 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
471 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
472 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
473 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
474 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
475 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
476 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
477 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
478 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
479 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
480 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
481 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
482 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
483 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
484 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
485 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
486 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
487 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
488 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
489 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
490 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
491 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
492 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
493 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
494 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
495 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
496 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
497 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
498 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
499 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
500 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
501 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
502 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
503 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
504 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
505 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.52
Metatranscriptomes 2.48
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.12
Nodule 0
Rhizoplane 3.84
Rhizosphere 94.67
Stem 0
Stem Tuber 0
Unclassified 3.04

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070683_101207937 3300005329 Bacteria 727
2 ARCol0yngRDRAFT_1001060 3300000652 Bacteria 2387
3 JGI24738J21930_10030244 3300002075 Bacteria 1106
4 JGI25406J46586_10011774 3300003203 Unclassified 3819
5 JGI25407J50210_10000553 3300003373 Bacteria 7544
6 JGI25407J50210_10003527 3300003373 Bacteria 3756
7 JGI25407J50210_10005891 3300003373 Bacteria 3031
8 JGI25407J50210_10019566 3300003373 Bacteria 1760
9 JGI25407J50210_10028789 3300003373 Bacteria 1441
10 Ga0058860_11993703 3300004801 Bacteria 641
11 Ga0065716_1005683 3300005277 Bacteria 860
12 Ga0070658_10837135 3300005327 Bacteria 800
13 Ga0070658_11102006 3300005327 Bacteria 691
14 Ga0070658_11281839 3300005327 Bacteria 636
15 Ga0070658_11692384 3300005327 Bacteria 548
16 Ga0070676_10097544 3300005328 Bacteria 1810
17 Ga0070676_10608933 3300005328 Bacteria 788
18 Ga0070683_100005414 3300005329 Bacteria 10657
19 Ga0070683_100100898 3300005329 Bacteria 2717
20 Ga0070683_100106748 3300005329 Bacteria 2640
21 Ga0070683_100188623 3300005329 Bacteria 1957
22 Ga0070683_100511463 3300005329 Bacteria 1147
23 Ga0070683_100807252 3300005329 Bacteria 899
24 Ga0070683_101981896 3300005329 Bacteria 560
25 Ga0070690_100285495 3300005330 Bacteria 1179
26 Ga0070670_100046088 3300005331 Bacteria 3748
27 Ga0070670_100508715 3300005331 Bacteria 1072
28 Ga0070677_10543811 3300005333 Bacteria 636
29 Ga0068869_100060514 3300005334 Bacteria 2775
30 Ga0068869_100851264 3300005334 Bacteria 787
31 Ga0068869_100907922 3300005334 Bacteria 762
32 Ga0070666_10486505 3300005335 Bacteria 894
33 Ga0070680_100015754 3300005336 Bacteria 5936
34 Ga0070680_100034133 3300005336 Bacteria 4102
35 Ga0070680_100054321 3300005336 Bacteria 3270
36 Ga0070680_100097987 3300005336 Bacteria 2431
37 Ga0070680_100145337 3300005336 Bacteria 1989
38 Ga0070682_100022269 3300005337 Bacteria 3751
39 Ga0070682_100027027 3300005337 Unclassified 3440
40 Ga0070682_100041884 3300005337 Bacteria 2824
41 Ga0070682_100244232 3300005337 Bacteria 1291
42 Ga0068868_100178731 3300005338 Bacteria 1759
43 Ga0068868_100618124 3300005338 Bacteria 962
44 Ga0070660_100031833 3300005339 Bacteria 3965
45 Ga0070660_100098992 3300005339 Bacteria 2309
46 Ga0070660_100193179 3300005339 Bacteria 1649
47 Ga0070660_100633915 3300005339 Bacteria 895
48 Ga0070660_100862620 3300005339 Bacteria 763
49 Ga0070660_101054173 3300005339 Bacteria 688
50 Ga0070660_101588444 3300005339 Bacteria 556
51 Ga0070689_101616428 3300005340 Bacteria 589
52 Ga0070691_10006550 3300005341 Bacteria 5326
53 Ga0070691_10126178 3300005341 Bacteria 1293
54 Ga0070687_100438755 3300005343 Bacteria 866
55 Ga0070661_100045876 3300005344 Bacteria 3195
56 Ga0070661_100385297 3300005344 Bacteria 1106
57 Ga0070661_100597897 3300005344 Bacteria 892
58 Ga0070692_10032201 3300005345 Bacteria 2634
59 Ga0070692_10077485 3300005345 Bacteria 1783
60 Ga0070692_10100609 3300005345 Bacteria 1584
61 Ga0070692_10607410 3300005345 Bacteria 724
62 Ga0070668_100677812 3300005347 Bacteria 908
63 Ga0070668_101585021 3300005347 Bacteria 600
64 Ga0070669_100297287 3300005353 Bacteria 1298
65 Ga0070669_100696287 3300005353 Bacteria 858
66 Ga0070669_100890765 3300005353 Bacteria 760
67 Ga0070675_100128487 3300005354 Bacteria 2158
68 Ga0070675_100286654 3300005354 Bacteria 1448
69 Ga0070675_100567293 3300005354 Bacteria 1027
70 Ga0070675_101443228 3300005354 Bacteria 635
71 Ga0070675_101633280 3300005354 Bacteria 595
72 Ga0070671_100132215 3300005355 Bacteria 2102
73 Ga0070674_100097268 3300005356 Bacteria 2138
74 Ga0070674_100117126 3300005356 Bacteria 1966
75 Ga0070674_100287540 3300005356 Bacteria 1306
76 Ga0070674_101286340 3300005356 Bacteria 652
77 Ga0070673_100501683 3300005364 Bacteria 1098
78 Ga0070673_101336151 3300005364 Bacteria 674
79 Ga0070688_101191534 3300005365 Bacteria 612
80 Ga0070659_100034611 3300005366 Bacteria 3930
81 Ga0070659_100436033 3300005366 Bacteria 1109
82 Ga0070659_100559489 3300005366 Bacteria 980
83 Ga0070709_10320854 3300005434 Unclassified 1137
84 Ga0070709_11179855 3300005434 Bacteria 615
85 Ga0070714_100015334 3300005435 Bacteria 6166
86 Ga0070714_100430135 3300005435 Bacteria 1251
87 Ga0070713_101177697 3300005436 Bacteria 742
88 Ga0070701_10231684 3300005438 Bacteria 1106
89 Ga0070711_101432366 3300005439 Bacteria 602
90 Ga0070705_100107071 3300005440 Bacteria 1778
91 Ga0070705_100336368 3300005440 Bacteria 1096
92 Ga0070700_100072761 3300005441 Bacteria 2198
93 Ga0070700_100135725 3300005441 Bacteria 1666
94 Ga0070700_101340993 3300005441 Bacteria 603
95 Ga0070694_100109330 3300005444 Bacteria 1967
96 Ga0070694_100127724 3300005444 Unclassified 1832
97 Ga0070694_100297529 3300005444 Bacteria 1235
98 Ga0070708_100160220 3300005445 Bacteria 2097
99 Ga0070708_101519709 3300005445 Bacteria 624
100 Ga0070663_100989674 3300005455 Bacteria 731
101 Ga0070663_101012701 3300005455 Bacteria 723
102 Ga0070663_101185120 3300005455 Bacteria 671
103 Ga0070663_101211323 3300005455 Bacteria 664
104 Ga0070663_101908135 3300005455 Bacteria 534
105 Ga0070678_100020088 3300005456 Bacteria 4375
106 Ga0070678_100500555 3300005456 Bacteria 1072
107 Ga0070678_100640532 3300005456 Bacteria 952
108 Ga0070678_101924475 3300005456 Bacteria 559
109 Ga0070662_100098582 3300005457 Bacteria 2208
110 Ga0070662_100166324 3300005457 Bacteria 1729
111 Ga0070662_101094012 3300005457 Bacteria 684
112 Ga0070681_10018574 3300005458 Bacteria 6951
113 Ga0070681_10042262 3300005458 Bacteria 4568
114 Ga0070681_10089000 3300005458 Bacteria 3038
115 Ga0070681_10337067 3300005458 Bacteria 1417
116 Ga0070681_10641834 3300005458 Bacteria 977
117 Ga0070681_11235032 3300005458 Bacteria 669
118 Ga0068867_100230565 3300005459 Bacteria 1497
119 Ga0068867_100248089 3300005459 Bacteria 1447
120 Ga0068867_100333484 3300005459 Bacteria 1260
121 Ga0068867_100641431 3300005459 Bacteria 931
122 Ga0068867_100806240 3300005459 Bacteria 838
123 Ga0068867_102232437 3300005459 Bacteria 520
124 Ga0070685_10053763 3300005466 Bacteria 2334
125 Ga0070706_100023684 3300005467 Bacteria 5651
126 Ga0070706_100352826 3300005467 Bacteria 1371
127 Ga0070707_100081792 3300005468 Bacteria 3119
128 Ga0070707_100085098 3300005468 Bacteria 3056
129 Ga0070698_100002914 3300005471 Bacteria 18836
130 Ga0070698_100069760 3300005471 Bacteria 3528
131 Ga0070698_100110270 3300005471 Bacteria 2717
132 Ga0070698_100537509 3300005471 Unclassified 1108
133 Ga0070698_100661958 3300005471 Bacteria 985
134 Ga0070698_100800146 3300005471 Bacteria 887
135 Ga0070699_100024816 3300005518 Bacteria 5168
136 Ga0070699_100034974 3300005518 Bacteria 4342
137 Ga0070699_100466199 3300005518 Bacteria 1146
138 Ga0070699_100699969 3300005518 Bacteria 926
139 Ga0070699_101033444 3300005518 Bacteria 754
140 Ga0070699_101952198 3300005518 Bacteria 537
141 Ga0070679_100120426 3300005530 Bacteria 2609
142 Ga0070679_100129492 3300005530 Bacteria 2505
143 Ga0070679_100178762 3300005530 Bacteria 2095
144 Ga0070679_100217718 3300005530 Bacteria 1871
145 Ga0070679_100219122 3300005530 Bacteria 1864
146 Ga0070679_100597959 3300005530 Bacteria 1046
147 Ga0070684_100067464 3300005535 Bacteria 3142
148 Ga0070684_100099228 3300005535 Bacteria 2599
149 Ga0070684_100140117 3300005535 Bacteria 2187
150 Ga0070684_100190171 3300005535 Bacteria 1868
151 Ga0070684_100414131 3300005535 Bacteria 1243
152 Ga0070684_100432859 3300005535 Bacteria 1215
153 Ga0070684_100844865 3300005535 Bacteria 857
154 Ga0070684_101000308 3300005535 Bacteria 785
155 Ga0070684_101075730 3300005535 Bacteria 755
156 Ga0070697_100253597 3300005536 Bacteria 1505
157 Ga0068853_100148213 3300005539 Bacteria 2111
158 Ga0068853_100154850 3300005539 Bacteria 2065
159 Ga0068853_100160754 3300005539 Bacteria 2027
160 Ga0070672_100377211 3300005543 Bacteria 1212
161 Ga0070672_100713141 3300005543 Bacteria 879
162 Ga0070672_101095601 3300005543 Bacteria 708
163 Ga0070686_100088621 3300005544 Bacteria 2065
164 Ga0070686_101585869 3300005544 Bacteria 553
165 Ga0070695_100102433 3300005545 Bacteria 1931
166 Ga0070696_100103996 3300005546 Bacteria 2038
167 Ga0070693_100382881 3300005547 Bacteria 971
168 Ga0070693_101138823 3300005547 Bacteria 596
169 Ga0070665_100731096 3300005548 Bacteria 1003
170 Ga0070704_100205791 3300005549 Bacteria 1591
171 Ga0068855_101735335 3300005563 Bacteria 636
172 Ga0070664_100036994 3300005564 Bacteria 4102
173 Ga0070664_100151920 3300005564 Bacteria 2044
174 Ga0070664_100304127 3300005564 Bacteria 1441
175 Ga0070664_100639068 3300005564 Bacteria 989
176 Ga0068857_100003001 3300005577 Bacteria 13924
177 Ga0068857_100116161 3300005577 Bacteria 2407
178 Ga0068857_100298940 3300005577 Bacteria 1484
179 Ga0068857_100316532 3300005577 Bacteria 1440
180 Ga0068857_102005162 3300005577 Bacteria 568
181 Ga0068854_100220685 3300005578 Bacteria 1500
182 Ga0068854_100318935 3300005578 Bacteria 1262
183 Ga0068854_100510511 3300005578 Bacteria 1014
184 Ga0068856_100153210 3300005614 Bacteria 2314
185 Ga0068856_100214217 3300005614 Bacteria 1941
186 Ga0070702_100139069 3300005615 Bacteria 1544
187 Ga0070702_100366717 3300005615 Bacteria 1019
188 Ga0070702_101289676 3300005615 Bacteria 593
189 Ga0068852_100272341 3300005616 Bacteria 1630
190 Ga0068852_100736259 3300005616 Bacteria 997
191 Ga0068852_101911305 3300005616 Bacteria 616
192 Ga0068859_100182455 3300005617 Bacteria 2182
193 Ga0068859_100896263 3300005617 Bacteria 972
194 Ga0068864_100072800 3300005618 Bacteria 2996
195 Ga0068864_100720384 3300005618 Bacteria 976
196 Ga0068864_101575851 3300005618 Bacteria 660
197 Ga0068864_102297957 3300005618 Bacteria 546
198 Ga0068866_10591778 3300005718 Bacteria 748
199 Ga0068866_10925786 3300005718 Bacteria 615
200 Ga0068866_11048836 3300005718 Bacteria 582
201 Ga0068861_100094678 3300005719 Bacteria 2364
202 Ga0068861_101262469 3300005719 Bacteria 717
203 Ga0068851_10390861 3300005834 Bacteria 817
204 Ga0068870_10083098 3300005840 Bacteria 1775
205 Ga0068870_10145766 3300005840 Bacteria 1390
206 Ga0068870_10343491 3300005840 Bacteria 955
207 Ga0068870_10438401 3300005840 Bacteria 859
208 Ga0068863_100395589 3300005841 Bacteria 1351
209 Ga0068863_101791611 3300005841 Bacteria 624
210 Ga0068858_100166781 3300005842 Bacteria 2075
211 Ga0068860_100570754 3300005843 Bacteria 1135
212 Ga0068862_100305469 3300005844 Bacteria 1465
213 Ga0081455_10002616 3300005937 Bacteria 21335
214 Ga0081455_10003194 3300005937 Bacteria 18994
215 Ga0081455_10020838 3300005937 Bacteria 6162
216 Ga0081455_10028494 3300005937 Bacteria 5102
217 Ga0081455_10034787 3300005937 Bacteria 4510
218 Ga0081455_10052915 3300005937 Bacteria 3472
219 Ga0081455_10054190 3300005937 Bacteria 3420
220 Ga0081455_10057833 3300005937 Bacteria 3284
221 Ga0081455_10073359 3300005937 Bacteria 2830
222 Ga0081455_10254080 3300005937 Bacteria 1284
223 Ga0081455_10262367 3300005937 Bacteria 1257
224 Ga0081455_10359743 3300005937 Bacteria 1024
225 Ga0081455_10757821 3300005937 Bacteria 613
226 Ga0081538_10000012 3300005981 Bacteria 153046
227 Ga0081538_10000043 3300005981 Bacteria 115532
228 Ga0081538_10000078 3300005981 Bacteria 92826
229 Ga0081538_10001739 3300005981 Bacteria 22122
230 Ga0081538_10003796 3300005981 Bacteria 14123
231 Ga0081538_10006203 3300005981 Bacteria 10584
232 Ga0081538_10012471 3300005981 Bacteria 6811
233 Ga0081538_10018260 3300005981 Bacteria 5279
234 Ga0081538_10024585 3300005981 Bacteria 4286
235 Ga0081538_10028759 3300005981 Bacteria 3813
236 Ga0081538_10040171 3300005981 Bacteria 2988
237 Ga0081538_10040841 3300005981 Bacteria 2953
238 Ga0081538_10052475 3300005981 Bacteria 2436
239 Ga0081538_10069084 3300005981 Bacteria 1959
240 Ga0081538_10171304 3300005981 Bacteria 947
241 Ga0081538_10208422 3300005981 Bacteria 792
242 Ga0081538_10259260 3300005981 Bacteria 657
243 Ga0081539_10001017 3300005985 Bacteria 51648
244 Ga0081539_10001655 3300005985 Bacteria 36118
245 Ga0081539_10008759 3300005985 Bacteria 8685
246 Ga0081539_10091234 3300005985 Bacteria 1574
247 Ga0070717_11680835 3300006028 Bacteria 575
248 Ga0075365_10095091 3300006038 Bacteria 2034
249 Ga0075365_10124097 3300006038 Bacteria 1783
250 Ga0075368_10052943 3300006042 Bacteria 1615
251 Ga0075363_100023210 3300006048 Bacteria 3142
252 Ga0075364_10003002 3300006051 Bacteria 9535
253 Ga0075364_10524287 3300006051 Bacteria 810
254 Ga0075432_10001315 3300006058 Bacteria 8030
255 Ga0075432_10156135 3300006058 Bacteria 880
256 Ga0075432_10269755 3300006058 Bacteria 697
257 Ga0070712_100045012 3300006175 Unclassified 3045
258 Ga0070712_101596957 3300006175 Bacteria 570
259 Ga0075362_10079884 3300006177 Bacteria 1506
260 Ga0075362_10685463 3300006177 Bacteria 534
261 Ga0075367_10009020 3300006178 Bacteria 5195
262 Ga0075427_10013143 3300006194 Bacteria 1264
263 Ga0075427_10057743 3300006194 Bacteria 676
264 Ga0068871_100222874 3300006358 Bacteria 1634
265 Ga0068871_100531919 3300006358 Bacteria 1063
266 Ga0068871_101565789 3300006358 Bacteria 623
267 Ga0068871_101881734 3300006358 Bacteria 569
268 Ga0068871_101915281 3300006358 Bacteria 564
269 Ga0068871_102036583 3300006358 Bacteria 546
270 Ga0075428_100012121 3300006844 Bacteria 9591
271 Ga0075428_100014262 3300006844 Bacteria 8839
272 Ga0075428_100056043 3300006844 Bacteria 4318
273 Ga0075428_100152138 3300006844 Bacteria 2513
274 Ga0075428_100507800 3300006844 Bacteria 1290
275 Ga0075428_101023531 3300006844 Bacteria 874
276 Ga0075428_101074017 3300006844 Bacteria 851
277 Ga0075430_100078687 3300006846 Bacteria 2763
278 Ga0075430_100189359 3300006846 Bacteria 1710
279 Ga0075431_100056374 3300006847 Bacteria 4053
280 Ga0075431_100155187 3300006847 Bacteria 2355
281 Ga0075431_100634509 3300006847 Bacteria 1050
282 Ga0075431_100698963 3300006847 Bacteria 992
283 Ga0075431_100722545 3300006847 Bacteria 973
284 Ga0075431_100727840 3300006847 Bacteria 969
285 Ga0075431_101058972 3300006847 Unclassified 777
286 Ga0075431_101122080 3300006847 Bacteria 751
287 Ga0075431_101272603 3300006847 Bacteria 697
288 Ga0075431_101468346 3300006847 Bacteria 641
289 Ga0075434_100684907 3300006871 Bacteria 1043
290 Ga0075434_100973403 3300006871 Bacteria 863
291 Ga0075429_100023663 3300006880 Bacteria 5331
292 Ga0075429_100173070 3300006880 Bacteria 1891
293 Ga0075429_100185368 3300006880 Bacteria 1823
294 Ga0075429_101116107 3300006880 Bacteria 689
295 Ga0075429_101287011 3300006880 Bacteria 638
296 Ga0068865_100090588 3300006881 Bacteria 2218
297 Ga0068865_100959281 3300006881 Bacteria 747
298 Ga0068865_101155825 3300006881 Bacteria 684
299 Ga0075436_100291063 3300006914 Bacteria 1169
300 Ga0097620_100182458 3300006931 Bacteria 2182
301 Ga0097620_100896166 3300006931 Bacteria 972
302 Ga0075435_101418323 3300007076 Bacteria 609
303 Ga0105250_10323257 3300009092 Bacteria 671
304 Ga0105240_12458240 3300009093 Bacteria 539
305 Ga0111539_10004858 3300009094 Bacteria 17509
306 Ga0111539_10009775 3300009094 Bacteria 12107
307 Ga0111539_10027100 3300009094 Bacteria 6999
308 Ga0111539_10029591 3300009094 Bacteria 6667
309 Ga0111539_10281997 3300009094 Bacteria 1933
310 Ga0111539_10286454 3300009094 Bacteria 1917
311 Ga0111539_10590586 3300009094 Bacteria 1293
312 Ga0111539_10783105 3300009094 Bacteria 1110
313 Ga0111539_11211441 3300009094 Bacteria 877
314 Ga0111539_12252066 3300009094 Bacteria 632
315 Ga0105245_10061841 3300009098 Bacteria 3377
316 Ga0105245_10073114 3300009098 Bacteria 3116
317 Ga0105245_10091194 3300009098 Bacteria 2804
318 Ga0105245_10207111 3300009098 Bacteria 1886
319 Ga0105245_10709359 3300009098 Bacteria 1040
320 Ga0105245_11182387 3300009098 Bacteria 812
321 Ga0105247_10310257 3300009101 Bacteria 1097
322 Ga0114129_10019838 3300009147 Bacteria 9567
323 Ga0114129_10034585 3300009147 Bacteria 7139
324 Ga0114129_10042952 3300009147 Bacteria 6362
325 Ga0114129_10194478 3300009147 Bacteria 2752
326 Ga0114129_10271452 3300009147 Bacteria 2269
327 Ga0114129_10532079 3300009147 Bacteria 1531
328 Ga0114129_11802972 3300009147 Bacteria 744
329 Ga0114129_12206860 3300009147 Bacteria 662
330 Ga0105243_10152295 3300009148 Bacteria 1985
331 Ga0105243_10716425 3300009148 Bacteria 977
332 Ga0105243_11038973 3300009148 Bacteria 824
333 Ga0105241_10426534 3300009174 Bacteria 1168
334 Ga0105242_10140847 3300009176 Bacteria 2092
335 Ga0105242_10228089 3300009176 Bacteria 1668
336 Ga0105242_10465910 3300009176 Bacteria 1194
337 Ga0105242_11156178 3300009176 Bacteria 791
338 Ga0105248_10177812 3300009177 Bacteria 2398
339 Ga0105237_10153292 3300009545 Bacteria 2301
340 Ga0105237_11848547 3300009545 Bacteria 612
341 Ga0105238_10496393 3300009551 Bacteria 1221
342 Ga0105249_10030507 3300009553 Bacteria 4874
343 Ga0105249_10272330 3300009553 Bacteria 1687
344 Ga0105249_10498255 3300009553 Bacteria 1263
345 Ga0105249_11296920 3300009553 Bacteria 800
346 Ga0105239_10158905 3300010375 Bacteria 2525
347 Ga0105239_10279218 3300010375 Bacteria 1880
348 Ga0105239_11377959 3300010375 Bacteria 814
349 Ga0105246_10257522 3300011119 Bacteria 1388
350 Ga0105246_10327644 3300011119 Bacteria 1247
351 Ga0105246_10563148 3300011119 Bacteria 979
352 Ga0105246_10639528 3300011119 Bacteria 924
353 Ga0105246_10893983 3300011119 Bacteria 796
354 Ga0105246_12443260 3300011119 Bacteria 513
355 Ga0157346_1013493 3300012480 Bacteria 632
356 Ga0157320_1013023 3300012481 Bacteria 676
357 Ga0157337_1025459 3300012483 Bacteria 575
358 Ga0157315_1032099 3300012508 Bacteria 622
359 Ga0157338_1046318 3300012515 Bacteria 609
360 Ga0154010_164487 3300013062 Bacteria 519
361 Ga0157373_10694481 3300013100 Bacteria 745
362 Ga0157373_10766196 3300013100 Bacteria 710
363 Ga0157371_10193809 3300013102 Bacteria 1455
364 Ga0157371_10241696 3300013102 Bacteria 1299
365 Ga0157370_10154684 3300013104 Bacteria 2134
366 Ga0157370_11604569 3300013104 Bacteria 584
367 Ga0157369_10144031 3300013105 Bacteria 2520
368 Ga0157374_10058527 3300013296 Bacteria 3601
369 Ga0157374_10392480 3300013296 Bacteria 1383
370 Ga0157374_11449660 3300013296 Bacteria 710
371 Ga0157378_10471694 3300013297 Bacteria 1249
372 Ga0157378_11242545 3300013297 Bacteria 785
373 Ga0157378_12063731 3300013297 Bacteria 620
374 Ga0163162_10105023 3300013306 Bacteria 2919
375 Ga0163162_10572753 3300013306 Bacteria 1256
376 Ga0163162_11345383 3300013306 Bacteria 812
377 Ga0157372_10832749 3300013307 Bacteria 1071
378 Ga0157372_10867950 3300013307 Bacteria 1047
379 Ga0157372_11259598 3300013307 Bacteria 854
380 Ga0157375_10243699 3300013308 Bacteria 1957
381 Ga0157375_10810502 3300013308 Bacteria 1084
382 Ga0157375_13176261 3300013308 Bacteria 548
383 Ga0163163_10299612 3300014325 Bacteria 1660
384 Ga0163163_10597244 3300014325 Bacteria 1167
385 Ga0163163_11544366 3300014325 Bacteria 725
386 Ga0157380_10377392 3300014326 Bacteria 1337
387 Ga0157380_10538822 3300014326 Bacteria 1142
388 Ga0157380_11239550 3300014326 Bacteria 791
389 Ga0157380_11437455 3300014326 Bacteria 741
390 Ga0182008_10002863 3300014497 Bacteria 10684
391 Ga0182008_10778774 3300014497 Bacteria 553
392 Ga0157377_10101653 3300014745 Bacteria 1714
393 Ga0157377_10278226 3300014745 Bacteria 1096
394 Ga0157379_10279969 3300014968 Bacteria 1518
395 Ga0157379_11235946 3300014968 Bacteria 719
396 Ga0157379_11246767 3300014968 Bacteria 716
397 Ga0157376_10214746 3300014969 Bacteria 1778
398 Ga0157376_10289074 3300014969 Bacteria 1547
399 Ga0157376_10483767 3300014969 Bacteria 1213
400 Ga0157376_10754898 3300014969 Bacteria 982
401 Ga0182007_10018713 3300015262 Bacteria 2504
402 Ga0182005_1056312 3300015265 Unclassified 1071
403 Ga0163161_10396685 3300017792 Bacteria 1106
404 Ga0197907_10123201 3300020069 Bacteria 565
405 Ga0197907_10392146 3300020069 Bacteria 733
406 Ga0206355_1580130 3300020076 Bacteria 658
407 Ga0206351_10697763 3300020077 Bacteria 2331
408 Ga0206354_10836039 3300020081 Bacteria 786
409 Ga0206354_11226363 3300020081 Bacteria 736
410 Ga0206353_10089638 3300020082 Bacteria 538
411 Ga0206353_10335316 3300020082 Bacteria 2203
412 Ga0206353_10442328 3300020082 Bacteria 1306
413 Ga0206353_10959623 3300020082 Bacteria 633
414 Ga0154015_1677257 3300020610 Bacteria 898
415 Ga0224712_10187199 3300022467 Bacteria 935
416 Ga0207655_1053832 3300025728 Bacteria 1605
417 Ga0207682_10455960 3300025893 Bacteria 605
418 Ga0207642_10169498 3300025899 Bacteria 1180
419 Ga0207642_10293511 3300025899 Bacteria 940
420 Ga0207688_10011358 3300025901 Bacteria 4850
421 Ga0207688_10030354 3300025901 Bacteria 2980
422 Ga0207647_10222784 3300025904 Bacteria 1087
423 Ga0207685_10227462 3300025905 Bacteria 890
424 Ga0207645_10093656 3300025907 Bacteria 1933
425 Ga0207645_10114835 3300025907 Bacteria 1745
426 Ga0207645_10180877 3300025907 Bacteria 1383
427 Ga0207645_10329572 3300025907 Bacteria 1019
428 Ga0207643_10016941 3300025908 Bacteria 3977
429 Ga0207643_10045405 3300025908 Bacteria 2481
430 Ga0207643_10680655 3300025908 Bacteria 664
431 Ga0207705_10029629 3300025909 Bacteria 3902
432 Ga0207705_10665598 3300025909 Bacteria 810
433 Ga0207705_11419235 3300025909 Bacteria 527
434 Ga0207705_11542694 3300025909 Bacteria 502
435 Ga0207684_10454540 3300025910 Bacteria 1099
436 Ga0207684_10878479 3300025910 Bacteria 755
437 Ga0207684_10942191 3300025910 Bacteria 724
438 Ga0207707_10026096 3300025912 Bacteria 5108
439 Ga0207707_10109194 3300025912 Bacteria 2418
440 Ga0207707_10138023 3300025912 Bacteria 2132
441 Ga0207707_10329499 3300025912 Bacteria 1317
442 Ga0207707_10519161 3300025912 Bacteria 1014
443 Ga0207707_11461571 3300025912 Bacteria 543
444 Ga0207671_10645058 3300025914 Bacteria 843
445 Ga0207693_10170033 3300025915 Bacteria 1716
446 Ga0207693_10991540 3300025915 Bacteria 642
447 Ga0207660_10017811 3300025917 Bacteria 4726
448 Ga0207660_10026727 3300025917 Bacteria 3932
449 Ga0207660_10127350 3300025917 Bacteria 1935
450 Ga0207660_10173935 3300025917 Bacteria 1668
451 Ga0207660_10313371 3300025917 Bacteria 1252
452 Ga0207660_10402713 3300025917 Bacteria 1102
453 Ga0207662_10105715 3300025918 Bacteria 1750
454 Ga0207662_10298434 3300025918 Bacteria 1070
455 Ga0207657_10032675 3300025919 Bacteria 4699
456 Ga0207657_10078394 3300025919 Bacteria 2782
457 Ga0207657_10194906 3300025919 Bacteria 1632
458 Ga0207657_10218387 3300025919 Bacteria 1528
459 Ga0207657_10537251 3300025919 Bacteria 914
460 Ga0207657_11344692 3300025919 Bacteria 538
461 Ga0207649_10006584 3300025920 Bacteria 6310
462 Ga0207649_10906933 3300025920 Bacteria 691
463 Ga0207652_10056627 3300025921 Bacteria 3375
464 Ga0207652_10222124 3300025921 Bacteria 1702
465 Ga0207652_10285733 3300025921 Bacteria 1488
466 Ga0207652_10333662 3300025921 Bacteria 1369
467 Ga0207652_10769610 3300025921 Bacteria 856
468 Ga0207652_11113788 3300025921 Bacteria 690
469 Ga0207646_10073193 3300025922 Bacteria 3061
470 Ga0207646_10504248 3300025922 Bacteria 1090
471 Ga0207646_10601954 3300025922 Bacteria 986
472 Ga0207681_10246541 3300025923 Bacteria 1393
473 Ga0207694_10627374 3300025924 Bacteria 905
474 Ga0207694_10685448 3300025924 Bacteria 864
475 Ga0207650_10203293 3300025925 Bacteria 1588
476 Ga0207650_11912781 3300025925 Bacteria 501
477 Ga0207659_10030117 3300025926 Bacteria 3705
478 Ga0207659_10054344 3300025926 Bacteria 2860
479 Ga0207659_11908055 3300025926 Bacteria 503
480 Ga0207687_10049558 3300025927 Bacteria 2921
481 Ga0207687_10082716 3300025927 Bacteria 2323
482 Ga0207687_10282006 3300025927 Bacteria 1332
483 Ga0207687_10337689 3300025927 Bacteria 1224
484 Ga0207687_10404579 3300025927 Bacteria 1123
485 Ga0207687_10467295 3300025927 Bacteria 1048
486 Ga0207687_11222853 3300025927 Bacteria 646
487 Ga0207687_11546652 3300025927 Bacteria 570
488 Ga0207664_10128515 3300025929 Bacteria 2130
489 Ga0207664_10157072 3300025929 Unclassified 1937
490 Ga0207664_11240979 3300025929 Bacteria 664
491 Ga0207690_10115023 3300025932 Bacteria 1944
492 Ga0207690_10129614 3300025932 Bacteria 1844
493 Ga0207690_11230683 3300025932 Bacteria 625
494 Ga0207690_11793153 3300025932 Bacteria 512
495 Ga0207706_10085744 3300025933 Bacteria 2769
496 Ga0207706_10416761 3300025933 Bacteria 1163
497 Ga0207706_11030380 3300025933 Archaea 690
498 Ga0207686_10045133 3300025934 Bacteria 2710
499 Ga0207686_10350076 3300025934 Bacteria 1112
500 Ga0207709_10175971 3300025935 Bacteria 1507
501 Ga0207709_10343731 3300025935 Bacteria 1124
502 Ga0207709_10656432 3300025935 Bacteria 836
503 Ga0207709_10885908 3300025935 Bacteria 725
504 Ga0207709_11846071 3300025935 Bacteria 503
505 Ga0207670_10040829 3300025936 Bacteria 3047
506 Ga0207669_10568405 3300025937 Bacteria 917
507 Ga0207669_10731804 3300025937 Bacteria 815
508 Ga0207669_11000376 3300025937 Bacteria 702
509 Ga0207669_11003924 3300025937 Bacteria 701
510 Ga0207704_10068690 3300025938 Bacteria 2235
511 Ga0207704_10671958 3300025938 Bacteria 855
512 Ga0207704_10976900 3300025938 Bacteria 715
513 Ga0207704_11919578 3300025938 Bacteria 509
514 Ga0207665_10608374 3300025939 Bacteria 854
515 Ga0207691_10113414 3300025940 Bacteria 2409
516 Ga0207691_10173183 3300025940 Bacteria 1889
517 Ga0207691_10827928 3300025940 Bacteria 777
518 Ga0207691_11154287 3300025940 Bacteria 643
519 Ga0207711_10062058 3300025941 Bacteria 3224
520 Ga0207711_11059163 3300025941 Bacteria 751
521 Ga0207711_11460134 3300025941 Bacteria 627
522 Ga0207689_10108289 3300025942 Bacteria 2283
523 Ga0207689_10183159 3300025942 Bacteria 1727
524 Ga0207689_11428205 3300025942 Bacteria 579
525 Ga0207661_10000297 3300025944 Bacteria 31532
526 Ga0207661_10111178 3300025944 Bacteria 2317
527 Ga0207661_10134616 3300025944 Bacteria 2121
528 Ga0207661_10151127 3300025944 Bacteria 2007
529 Ga0207661_10414770 3300025944 Bacteria 1222
530 Ga0207661_11047459 3300025944 Bacteria 751
531 Ga0207661_11741760 3300025944 Bacteria 568
532 Ga0207679_10137123 3300025945 Bacteria 1972
533 Ga0207679_10423302 3300025945 Bacteria 1176
534 Ga0207679_10497385 3300025945 Bacteria 1087
535 Ga0207667_10486862 3300025949 Bacteria 1252
536 Ga0207667_12138103 3300025949 Bacteria 518
537 Ga0207651_10250545 3300025960 Bacteria 1449
538 Ga0207651_11353330 3300025960 Bacteria 640
539 Ga0207712_10077189 3300025961 Bacteria 2413
540 Ga0207712_10208411 3300025961 Bacteria 1555
541 Ga0207668_11134409 3300025972 Bacteria 701
542 Ga0207640_10194056 3300025981 Bacteria 1533
543 Ga0207640_10215126 3300025981 Bacteria 1467
544 Ga0207640_10551475 3300025981 Bacteria 968
545 Ga0207640_11427667 3300025981 Bacteria 620
546 Ga0207658_10418135 3300025986 Bacteria 1182
547 Ga0207677_10127492 3300026023 Bacteria 1926
548 Ga0207677_11202843 3300026023 Bacteria 694
549 Ga0207677_11473392 3300026023 Bacteria 628
550 Ga0207703_10147744 3300026035 Bacteria 2046
551 Ga0207703_12226423 3300026035 Bacteria 524
552 Ga0207639_10074514 3300026041 Bacteria 2665
553 Ga0207639_10152500 3300026041 Bacteria 1937
554 Ga0207639_10355232 3300026041 Bacteria 1310
555 Ga0207678_10115328 3300026067 Bacteria 2292
556 Ga0207678_10211598 3300026067 Bacteria 1659
557 Ga0207678_11909723 3300026067 Bacteria 518
558 Ga0207708_10010855 3300026075 Bacteria 6776
559 Ga0207708_10037820 3300026075 Bacteria 3676
560 Ga0207708_10147104 3300026075 Bacteria 1852
561 Ga0207708_10322502 3300026075 Bacteria 1261
562 Ga0207708_10646720 3300026075 Bacteria 900
563 Ga0207702_10045112 3300026078 Bacteria 3709
564 Ga0207702_12373241 3300026078 Bacteria 518
565 Ga0207641_10515974 3300026088 Bacteria 1162
566 Ga0207648_10029997 3300026089 Bacteria 4822
567 Ga0207648_10122453 3300026089 Bacteria 2287
568 Ga0207648_10308320 3300026089 Bacteria 1421
569 Ga0207648_10866927 3300026089 Bacteria 842
570 Ga0207648_10960126 3300026089 Bacteria 800
571 Ga0207648_11170023 3300026089 Bacteria 722
572 Ga0207648_12296287 3300026089 Unclassified 500
573 Ga0207676_10279581 3300026095 Bacteria 1515
574 Ga0207676_10637188 3300026095 Bacteria 1027
575 Ga0207676_10866072 3300026095 Bacteria 884
576 Ga0207676_11255334 3300026095 Bacteria 735
577 Ga0207674_10003542 3300026116 Bacteria 19059
578 Ga0207674_10021743 3300026116 Bacteria 6903
579 Ga0207674_10027993 3300026116 Bacteria 5955
580 Ga0207674_10546103 3300026116 Bacteria 1119
581 Ga0207674_11102424 3300026116 Bacteria 763
582 Ga0207675_100032371 3300026118 Bacteria 4870
583 Ga0207675_101836748 3300026118 Bacteria 625
584 Ga0207675_102413653 3300026118 Bacteria 538
585 Ga0207683_10161641 3300026121 Bacteria 2025
586 Ga0207683_10288215 3300026121 Bacteria 1501
587 Ga0207683_10967292 3300026121 Bacteria 790
588 Ga0207698_10067992 3300026142 Bacteria 2812
589 Ga0207698_10239871 3300026142 Bacteria 1651
590 Ga0207698_11688456 3300026142 Bacteria 649
591 Ga0209968_1040220 3300027526 Bacteria 798
592 Ga0209998_10007307 3300027717 Bacteria 2292
593 Ga0209998_10188806 3300027717 Bacteria 537
594 Ga0209813_10014831 3300027866 Bacteria 2103
595 Ga0207428_10000383 3300027907 Bacteria 55634
596 Ga0207428_10006260 3300027907 Bacteria 10996
597 Ga0207428_10008443 3300027907 Bacteria 9297
598 Ga0207428_10020204 3300027907 Bacteria 5663
599 Ga0207428_10042121 3300027907 Bacteria 3693
600 Ga0207428_10100929 3300027907 Bacteria 2230
601 Ga0207428_11132955 3300027907 Bacteria 546
602 Ga0268266_11544650 3300028379 Bacteria 639
603 Ga0268265_10970772 3300028380 Bacteria 838
604 Ga0268265_12678342 3300028380 Bacteria 504
605 Ga0268264_10729446 3300028381 Bacteria 986
606 Ga0265318_10071394 3300028577 Bacteria 1287
607 Ga0265318_10189202 3300028577 Bacteria 753
608 Ga0265320_10407494 3300031240 Unclassified 600
609 Ga0265340_10059264 3300031247 Bacteria 1837
610 Ga0265327_10075516 3300031251 Bacteria 1676
611 Ga0307408_100076490 3300031548 Bacteria 2490
612 Ga0307408_100265431 3300031548 Bacteria 1423
613 Ga0307408_100631735 3300031548 Bacteria 955
614 Ga0307408_100899569 3300031548 Bacteria 810
615 Ga0307408_101255351 3300031548 Bacteria 693
616 Ga0307408_101521112 3300031548 Unclassified 633
617 Ga0307408_101869845 3300031548 Bacteria 575
618 Ga0307408_102393452 3300031548 Bacteria 512
619 Ga0265313_10075834 3300031595 Bacteria 1538
620 Ga0307405_10051501 3300031731 Bacteria 2555
621 Ga0307405_10357736 3300031731 Bacteria 1128
622 Ga0307405_10718129 3300031731 Bacteria 829
623 Ga0307405_10972912 3300031731 Bacteria 722
624 Ga0307413_10005458 3300031824 Bacteria 5682
625 Ga0307413_10103776 3300031824 Bacteria 1886
626 Ga0307413_10486934 3300031824 Bacteria 987
627 Ga0307413_10919490 3300031824 Bacteria 744
628 Ga0307413_11689474 3300031824 Bacteria 564
629 Ga0307410_10030671 3300031852 Bacteria 3439
630 Ga0307410_10642688 3300031852 Bacteria 889
631 Ga0307410_11881654 3300031852 Bacteria 532
632 Ga0307406_10016045 3300031901 Bacteria 4346
633 Ga0307406_10105772 3300031901 Bacteria 1926
634 Ga0307406_10165556 3300031901 Bacteria 1594
635 Ga0307406_10378626 3300031901 Bacteria 1115
636 Ga0307407_10012114 3300031903 Bacteria 4134
637 Ga0307407_10300042 3300031903 Bacteria 1120
638 Ga0307407_11528664 3300031903 Bacteria 528
639 Ga0307412_10028974 3300031911 Bacteria 3471
640 Ga0307412_10029849 3300031911 Bacteria 3426
641 Ga0307409_100036492 3300031995 Bacteria 3614
642 Ga0307409_100086421 3300031995 Bacteria 2553
643 Ga0307409_100096436 3300031995 Bacteria 2440
644 Ga0307409_100366724 3300031995 Bacteria 1364
645 Ga0307409_100589136 3300031995 Bacteria 1097
646 Ga0307409_100630486 3300031995 Bacteria 1063
647 Ga0307409_101699430 3300031995 Bacteria 660
648 Ga0307409_102060963 3300031995 Bacteria 600
649 Ga0307409_102285266 3300031995 Bacteria 570
650 Ga0307416_100003117 3300032002 Bacteria 9706
651 Ga0307416_100045042 3300032002 Bacteria 3470
652 Ga0307416_100068677 3300032002 Bacteria 2929
653 Ga0307416_100112163 3300032002 Bacteria 2406
654 Ga0307416_100197351 3300032002 Bacteria 1905
655 Ga0307416_100417306 3300032002 Bacteria 1385
656 Ga0307416_100631219 3300032002 Bacteria 1154
657 Ga0307416_100673454 3300032002 Bacteria 1121
658 Ga0307416_100755099 3300032002 Bacteria 1065
659 Ga0307416_101366230 3300032002 Bacteria 814
660 Ga0307411_10020345 3300032005 Bacteria 3857
661 Ga0307415_100002861 3300032126 Bacteria 8640
662 Ga0307415_100029740 3300032126 Bacteria 3495
663 Ga0307415_100118554 3300032126 Bacteria 1979
664 Ga0307415_100168897 3300032126 Bacteria 1704
665 Ga0307415_100655885 3300032126 Bacteria 941
666 Ga0373950_0084939 3300034818 Bacteria 666
667 Ga0373959_0066549 3300034820 Bacteria 807
668 Ga0373928_0041237 3300035084 Bacteria 1061
669 Ga0373949_0143321 3300035090 Bacteria 686
670 Ga0373941_0058241 3300035115 Bacteria 1250
671 Ga0373953_0108946 3300035117 Bacteria 1170
672 Ga0373960_0017129 3300035121 Bacteria 1874
673 Ga0373955_0906984 3300035172 Bacteria 542
674 Ga0373942_0260720 3300035207 Bacteria 592
675 Ga0373962_0365427 3300035242 Bacteria 524
676 Ga0373931_0107781 3300035691 Bacteria 1576
677 Ga0373933_0057580 3300035724 Bacteria 2336
678 Ga0373937_0010090 3300036401 Bacteria 8234
679 Ga0395899_0002627 3300037312 Bacteria 14485
680 Ga0395899_0007615 3300037312 Bacteria 8352
681 Ga0395899_0009566 3300037312 Bacteria 7440
682 Ga0395899_0022065 3300037312 Bacteria 4828
683 Ga0395899_0038109 3300037312 Bacteria 3602
684 Ga0395899_0047261 3300037312 Bacteria 3205
685 Ga0395899_0051194 3300037312 Bacteria 3065
686 Ga0395899_0052759 3300037312 Bacteria 3013
687 Ga0395899_0077455 3300037312 Bacteria 2425
688 Ga0395899_0081383 3300037312 Bacteria 2356
689 Ga0395900_0001846 3300037418 Bacteria 24148
690 Ga0395900_0009429 3300037418 Bacteria 10005
691 Ga0395900_0013373 3300037418 Bacteria 8387
692 Ga0395900_0018988 3300037418 Bacteria 7012
693 Ga0395900_0029483 3300037418 Bacteria 5628
694 Ga0395900_0036371 3300037418 Bacteria 5076
695 Ga0395900_0044072 3300037418 Bacteria 4598
696 Ga0395900_0070500 3300037418 Bacteria 3593
697 Ga0395900_0091363 3300037418 Bacteria 3129
698 Ga0395900_0092038 3300037418 Unclassified 3115
699 Ga0395900_0177306 3300037418 Bacteria 2167
700 Ga0395900_0213443 3300037418 Bacteria 1948
701 Ga0395900_0231275 3300037418 Bacteria 1859
702 Ga0395900_0278004 3300037418 Bacteria 1667
703 Ga0395900_0532104 3300037418 Bacteria 1122
704 Ga0395900_0637198 3300037418 Bacteria 1003
705 Ga0395900_0706805 3300037418 Bacteria 941
706 Ga0395900_0840105 3300037418 Bacteria 844
707 Ga0395900_0926663 3300037418 Bacteria 794
708 Ga0395900_1084601 3300037418 Bacteria 718
709 Ga0395900_1427707 3300037418 Bacteria 605
710 Ga0395898_0005570 3300037466 Bacteria 13576
711 Ga0395898_0026680 3300037466 Bacteria 5807
712 Ga0395898_0033109 3300037466 Bacteria 5159
713 Ga0395898_0035313 3300037466 Bacteria 4973
714 Ga0395898_0035595 3300037466 Bacteria 4948
715 Ga0395898_0040518 3300037466 Bacteria 4606
716 Ga0395898_0069894 3300037466 Unclassified 3396
717 Ga0395898_0112977 3300037466 Bacteria 2603
718 Ga0395898_0145358 3300037466 Bacteria 2269
719 Ga0395898_0178520 3300037466 Bacteria 2029
720 Ga0395898_0208555 3300037466 Bacteria 1864
721 Ga0395898_0210759 3300037466 Bacteria 1853
722 Ga0395898_0223818 3300037466 Unclassified 1795
723 Ga0395898_0291811 3300037466 Bacteria 1556
724 Ga0395898_0295351 3300037466 Bacteria 1546
725 Ga0395898_0304188 3300037466 Archaea 1521
726 Ga0395898_0634839 3300037466 Bacteria 1010
727 Ga0395898_0685312 3300037466 Bacteria 967
728 Ga0395898_0991720 3300037466 Bacteria 776
729 Ga0395898_1229414 3300037466 Bacteria 680
730 Ga0395898_1367412 3300037466 Unclassified 636
731 Ga0395898_1588481 3300037466 Bacteria 578
732 Ga0395905_0004008 3300037471 Bacteria 15477
733 Ga0395905_0010346 3300037471 Bacteria 9079
734 Ga0395905_0011656 3300037471 Bacteria 8489
735 Ga0395905_0025570 3300037471 Bacteria 5567
736 Ga0395905_0031491 3300037471 Bacteria 4994
737 Ga0395905_0037383 3300037471 Bacteria 4558
738 Ga0395905_0053318 3300037471 Bacteria 3785
739 Ga0395905_0096239 3300037471 Unclassified 2779
740 Ga0395905_0177897 3300037471 Bacteria 1997
741 Ga0395905_0310604 3300037471 Bacteria 1465
742 Ga0395905_0528232 3300037471 Bacteria 1080
743 Ga0395905_0567972 3300037471 Bacteria 1036
744 Ga0395901_0009445 3300038443 Bacteria 9895
745 Ga0395901_0015959 3300038443 Bacteria 7651
746 Ga0395901_0018845 3300038443 Bacteria 7054
747 Ga0395901_0033635 3300038443 Bacteria 5293
748 Ga0395901_0038276 3300038443 Bacteria 4961
749 Ga0395901_0059703 3300038443 Bacteria 3968
750 Ga0395901_0063865 3300038443 Bacteria 3832
751 Ga0395901_0083377 3300038443 Bacteria 3341
752 Ga0395901_0094138 3300038443 Bacteria 3138
753 Ga0395901_0162709 3300038443 Bacteria 2343
754 Ga0395901_0224018 3300038443 Bacteria 1965
755 Ga0395901_0316432 3300038443 Unclassified 1616
756 Ga0395901_0344580 3300038443 Bacteria 1539
757 Ga0395901_0402782 3300038443 Bacteria 1405
758 Ga0395901_0968412 3300038443 Bacteria 828
759 Ga0395901_1220753 3300038443 Bacteria 717
760 Ga0395901_1258385 3300038443 Bacteria 703
761 Ga0395901_1510270 3300038443 Bacteria 627
762 Ga0395901_1776392 3300038443 Bacteria 566
763 Ga0395901_1995259 3300038443 Bacteria 526
764 Ga0436360_0951681 3300039438 Bacteria 7280
765 Ga0436360_1157905 3300039438 Bacteria 935
766 Ga0436363_0888617 3300039450 Bacteria 635
767 Ga0436363_1488566 3300039450 Bacteria 1063
768 Ga0436362_0754288 3300039453 Bacteria 502
769 Ga0439438_095989 3300041405 Bacteria 720
770 Ga0439438_096486 3300041405 Bacteria 718
771 Ga0439439_0010319 3300041406 Bacteria 2231
772 Ga0439439_0160852 3300041406 Bacteria 641
773 Ga0439439_0178182 3300041406 Bacteria 611
774 Ga0439461_0000619 3300041410 Bacteria 5124
775 Ga0439461_0037683 3300041410 Bacteria 1034
776 Ga0439466_0020576 3300041411 Bacteria 2350
777 Ga0439466_0034957 3300041411 Bacteria 1701
778 Ga0439465_0079624 3300041413 Bacteria 1109
779 Ga0439465_0252795 3300041413 Bacteria 652
780 Ga0451787_498795 3300041441 Bacteria 938
781 Ga0451800_1006391 3300041459 Bacteria 1005
782 Ga0451802_1694304 3300041460 Bacteria 747
783 Ga0451807_0378497 3300041486 Bacteria 616
784 Ga0451833_0670140 3300041491 Bacteria 719
785 Ga0451843_1366079 3300041509 Bacteria 1320
786 Ga0451853_0882388 3300041512 Bacteria 1081
787 Ga0439431_0014907 3300041997 Bacteria 1806
788 Ga0439431_0260470 3300041997 Bacteria 516
789 Ga0439433_0095913 3300041999 Bacteria 733
790 Ga0439433_0106392 3300041999 Bacteria 699
791 Ga0439437_004317 3300042000 Bacteria 1549
792 Ga0439441_029176 3300042001 Bacteria 1061
793 Ga0439442_025999 3300042002 Bacteria 1218
794 Ga0439445_0012137 3300042004 Bacteria 2066
795 Ga0439445_0025725 3300042004 Bacteria 1503
796 Ga0439445_0179855 3300042004 Bacteria 621
797 Ga0439448_0030851 3300042005 Bacteria 1702
798 Ga0439448_0085420 3300042005 Bacteria 1063
799 Ga0439448_0235799 3300042005 Bacteria 644
800 Ga0439432_052677 3300042006 Unclassified 1267
801 Ga0439432_133780 3300042006 Bacteria 731
802 Ga0439449_0031177 3300042007 Bacteria 1987
803 Ga0439450_123045 3300042008 Bacteria 669
804 Ga0439451_005011 3300042009 Bacteria 2694
805 Ga0439451_122909 3300042009 Bacteria 529
806 Ga0439452_081638 3300042010 Unclassified 704
807 Ga0439454_010851 3300042011 Bacteria 1207
808 Ga0439454_011510 3300042011 Bacteria 1183
809 Ga0439454_062647 3300042011 Bacteria 648
810 Ga0439456_054646 3300042013 Bacteria 874
811 Ga0439457_052188 3300042014 Bacteria 919
812 Ga0439457_076226 3300042014 Bacteria 768
813 Ga0439462_0001216 3300042015 Bacteria 5635
814 Ga0439462_0023904 3300042015 Bacteria 1603
815 Ga0439462_0146042 3300042015 Bacteria 664
816 Ga0439463_064454 3300042016 Bacteria 937
817 Ga0439463_210321 3300042016 Bacteria 505
818 Ga0450914_010151 3300042118 Bacteria 905
819 Ga0450915_002864 3300042119 Bacteria 936
820 Ga0450915_003205 3300042119 Bacteria 907
821 Ga0450920_007020 3300042122 Bacteria 2035
822 Ga0450923_004638 3300042125 Bacteria 2166
823 Ga0450888_008357 3300042126 Bacteria 1164
824 Ga0450890_017802 3300042127 Bacteria 947
825 Ga0450898_025234 3300042134 Bacteria 1066
826 Ga0450898_061645 3300042134 Bacteria 739
827 Ga0450898_133927 3300042134 Bacteria 535
828 Ga0450900_023403 3300042136 Bacteria 872
829 Ga0450902_060043 3300042137 Bacteria 657
830 Ga0450904_019231 3300042139 Bacteria 690
831 Ga0450907_013427 3300042146 Bacteria 1365
832 Ga0450907_016232 3300042146 Bacteria 1242
833 Ga0450907_018107 3300042146 Bacteria 1177
834 Ga0450910_015813 3300042147 Bacteria 1112
835 Ga0450910_084384 3300042147 Bacteria 558
836 Ga0439446_0001871 3300042156 Bacteria 4942
837 Ga0439446_0002997 3300042156 Bacteria 4133
838 Ga0439446_0067040 3300042156 Bacteria 1093
839 Ga0439446_0074421 3300042156 Bacteria 1043
840 Ga0439458_0128823 3300042157 Bacteria 670
841 Ga0450908_026382 3300042184 Bacteria 1014
842 Ga0450908_109462 3300042184 Bacteria 510
843 Ga0450909_037546 3300042185 Bacteria 742
844 Ga0439434_0003699 3300042435 Bacteria 4475
845 Ga0439434_0013912 3300042435 Bacteria 2391
846 Ga0439434_0015819 3300042435 Bacteria 2250
847 Ga0439434_0033142 3300042435 Bacteria 1573
848 Ga0439435_0010298 3300042436 Bacteria 2215
849 Ga0439435_0211134 3300042436 Bacteria 643
850 Ga0439435_0236384 3300042436 Bacteria 612
851 Ga0439459_0063100 3300042438 Bacteria 841
852 Ga0439464_0234559 3300042439 Bacteria 591
853 Ga0439460_0105236 3300042461 Bacteria 911
854 Ga0439460_0122681 3300042461 Bacteria 851
855 Ga0439460_0255701 3300042461 Bacteria 606
856 Ga0450918_041960 3300042531 Bacteria 822
857 Ga0450918_042988 3300042531 Bacteria 813
858 Ga0450918_065991 3300042531 Bacteria 674
859 Ga0450893_0044938 3300042532 Bacteria 817
860 Ga0466969_0187795 3300044656 Unclassified 945
861 Ga0466969_0372773 3300044656 Unclassified 647
862 Ga0466972_0087994 3300044658 Bacteria 1475
863 Ga0466965_0677716 3300044683 Unclassified 590
864 Ga0466966_0007359 3300044684 Bacteria 7302
865 Ga0466966_0020640 3300044684 Bacteria 4329
866 Ga0466966_0090441 3300044684 Bacteria 1901
867 Ga0466966_0096023 3300044684 Bacteria 1836
868 Ga0466961_0025304 3300044693 Bacteria 3817
869 Ga0466961_0088882 3300044693 Bacteria 1951
870 Ga0466961_0104429 3300044693 Bacteria 1784
871 Ga0466961_0631236 3300044693 Unclassified 643
872 Ga0466961_0846082 3300044693 Bacteria 545
873 Ga0466963_0002360 3300044694 Bacteria 10539
874 Ga0466963_0004483 3300044694 Bacteria 8125
875 Ga0466963_0138988 3300044694 Bacteria 1682
876 Ga0466963_0175164 3300044694 Unclassified 1496
877 Ga0466963_0196714 3300044694 Bacteria 1409
878 Ga0466963_0211471 3300044694 Bacteria 1357
879 Ga0466963_0367608 3300044694 Bacteria 1013
880 Ga0466963_0371625 3300044694 Bacteria 1007
881 Ga0466964_0049424 3300044706 Bacteria 1722
882 Ga0466964_0061381 3300044706 Bacteria 1565
883 Ga0466971_0201931 3300044719 Bacteria 938
884 Ga0466968_0202019 3300044735 Bacteria 931
885 Ga0466970_0433797 3300044765 Unclassified 752
886 Ga0466957_0016927 3300044842 Bacteria 4266
887 Ga0466957_0135131 3300044842 Bacteria 1584
888 Ga0466957_0147570 3300044842 Bacteria 1519
889 Ga0466957_0249409 3300044842 Bacteria 1180
890 Ga0466957_1104981 3300044842 Bacteria 572
891 Ga0466960_0045272 3300044901 Bacteria 2101
892 Ga0466960_0084219 3300044901 Bacteria 1609
893 Ga0466960_0178347 3300044901 Bacteria 1150
894 Ga0466960_0591429 3300044901 Bacteria 658
895 Ga0466960_0625060 3300044901 Bacteria 641
896 Ga0466960_0767288 3300044901 Archaea 582
897 Ga0466960_1051913 3300044901 Bacteria 502
898 Ga0466959_0008749 3300045049 Bacteria 7167
899 Ga0451576_0115815 3300045051 Bacteria 2790
900 Ga0451576_1587058 3300045051 Bacteria 679
901 Ga0466958_0004955 3300045836 Bacteria 7106
902 Ga0466958_0015048 3300045836 Bacteria 4426
903 Ga0466958_0036322 3300045836 Bacteria 2949
904 Ga0466958_0136163 3300045836 Bacteria 1544
905 Ga0466958_0138350 3300045836 Bacteria 1532
906 Ga0466967_0006350 3300045976 Bacteria 8348
907 Ga0466967_0016066 3300045976 Bacteria 5890
908 Ga0466967_0067733 3300045976 Bacteria 3185
909 Ga0466967_0180731 3300045976 Bacteria 1990
910 Ga0466967_0263236 3300045976 Unclassified 1650
911 Ga0466967_0326778 3300045976 Bacteria 1480
912 Ga0466967_0413182 3300045976 Bacteria 1314
913 Ga0466967_0445980 3300045976 Unclassified 1264
914 Ga0466967_1311720 3300045976 Bacteria 721
915 Ga0495617_073853 3300046452 Bacteria 1120
916 Ga0495592_0000888 3300046454 Bacteria 20740
917 Ga0495592_0124100 3300046454 Bacteria 1813
918 Ga0495603_0165183 3300046455 Bacteria 1283
919 Ga0495603_0873762 3300046455 Bacteria 511
920 Ga0495590_0254741 3300046457 Bacteria 654
921 Ga0495591_047010 3300046458 Bacteria 1197
922 Ga0495629_0252696 3300046459 Bacteria 1213
923 Ga0495629_0852333 3300046459 Bacteria 599
924 Ga0495629_0900201 3300046459 Bacteria 580
925 Ga0495641_0503644 3300046461 Unclassified 552
926 Ga0495651_0000180 3300046462 Bacteria 46908
927 Ga0495651_0600715 3300046462 Bacteria 694
928 Ga0495653_0002924 3300046463 Bacteria 13667
929 Ga0495653_0635130 3300046463 Bacteria 653
930 Ga0495650_0189396 3300046471 Bacteria 720
931 Ga0495582_0568845 3300046473 Bacteria 656
932 Ga0495605_0032750 3300046474 Bacteria 2644
933 Ga0495605_0288096 3300046474 Bacteria 697
934 Ga0495605_0308889 3300046474 Bacteria 668
935 Ga0495605_0437250 3300046474 Bacteria 540
936 Ga0495639_0295760 3300046475 Bacteria 807
937 Ga0495664_0263796 3300046477 Bacteria 1041
938 Ga0495584_0178201 3300046491 Bacteria 1080
939 Ga0495584_0582548 3300046491 Bacteria 570
940 Ga0495585_0056503 3300046492 Bacteria 2167
941 Ga0495585_0461342 3300046492 Bacteria 607
942 Ga0495585_0600092 3300046492 Bacteria 518
943 Ga0495596_0058005 3300046500 Bacteria 1510
944 Ga0495596_0075595 3300046500 Unclassified 1308
945 Ga0495596_0121458 3300046500 Bacteria 1014
946 Ga0495596_0240682 3300046500 Bacteria 702
947 Ga0495607_0107078 3300046501 Bacteria 1487
948 Ga0495583_0243839 3300046506 Bacteria 722
949 Ga0495583_0292738 3300046506 Bacteria 648
950 Ga0495608_0001686 3300046511 Bacteria 15858
951 Ga0495608_0336179 3300046511 Bacteria 931
952 Ga0495610_0316075 3300046512 Bacteria 598
953 Ga0495616_0054636 3300046513 Bacteria 1980
954 Ga0495616_0210481 3300046513 Bacteria 851
955 Ga0495616_0316762 3300046513 Bacteria 656
956 Ga0495618_0012480 3300046514 Bacteria 5160
957 Ga0495620_0022332 3300046515 Bacteria 3049
958 Ga0495620_0345407 3300046515 Bacteria 564
959 Ga0495628_0000067 3300046516 Bacteria 85377
960 Ga0495628_0788631 3300046516 Bacteria 665
961 Ga0495630_0081846 3300046517 Bacteria 2436
962 Ga0495630_0404854 3300046517 Bacteria 1045
963 Ga0495631_0054944 3300046518 Bacteria 1735
964 Ga0495631_0084610 3300046518 Bacteria 1367
965 Ga0495631_0269111 3300046518 Bacteria 726
966 Ga0495631_0444668 3300046518 Bacteria 552
967 Ga0495632_0142562 3300046519 Bacteria 1111
968 Ga0495632_0520542 3300046519 Bacteria 512
969 Ga0495637_0092707 3300046520 Bacteria 1189
970 Ga0495637_0170921 3300046520 Bacteria 811
971 Ga0495644_0305800 3300046523 Bacteria 622
972 Ga0495642_0009720 3300046528 Bacteria 3682
973 Ga0495652_0000315 3300046529 Bacteria 57240
974 Ga0495640_0946791 3300046533 Bacteria 509
975 Ga0495587_0000287 3300046536 Bacteria 35735
976 Ga0495587_0216058 3300046536 Bacteria 1082
977 Ga0495587_0324175 3300046536 Bacteria 860
978 Ga0495598_0032233 3300046537 Unclassified 1480
979 Ga0495598_0081236 3300046537 Bacteria 1040
980 Ga0495609_0214884 3300046538 Bacteria 800
981 Ga0495609_0356633 3300046538 Bacteria 589
982 Ga0495621_0031654 3300046539 Bacteria 1816
983 Ga0495597_0046898 3300046542 Bacteria 1914
984 Ga0495645_0000234 3300046543 Bacteria 40275
985 Ga0495645_0115844 3300046543 Bacteria 1892
986 Ga0495633_0036714 3300046558 Bacteria 2347
987 Ga0495633_0372087 3300046558 Bacteria 647
988 Ga0495633_0417170 3300046558 Bacteria 607
989 Ga0495667_0051835 3300046559 Bacteria 2706
990 Ga0495667_0060341 3300046559 Bacteria 2488
991 Ga0495656_0144301 3300046615 Bacteria 1144
992 Ga0495656_0240034 3300046615 Bacteria 912
993 Ga0495656_0312135 3300046615 Bacteria 808
994 Ga0495656_0707014 3300046615 Bacteria 542
995 Ga0495668_0126987 3300046616 Bacteria 1396
996 Ga0495668_0333762 3300046616 Bacteria 832
997 Ga0495634_0146005 3300046642 Bacteria 1499
998 Ga0495611_0379181 3300046648 Bacteria 647
999 Ga0495635_0298037 3300046663 Bacteria 1081
1000 Ga0495659_0005392 3300046664 Bacteria 4023
1001 Ga0495659_0177241 3300046664 Bacteria 867
1002 Ga0495661_0073887 3300046665 Bacteria 1985
1003 Ga0495661_0306742 3300046665 Bacteria 793
1004 Ga0495588_0191157 3300046674 Bacteria 1081
1005 Ga0495657_0030413 3300046675 Bacteria 3782
1006 Ga0495657_0034883 3300046675 Bacteria 3491
1007 Ga0495657_0414421 3300046675 Bacteria 791
1008 Ga0495599_0000249 3300046678 Bacteria 34129
1009 Ga0495599_0875064 3300046678 Bacteria 510
1010 Ga0495623_0000144 3300046679 Bacteria 43790
1011 Ga0495623_0257898 3300046679 Bacteria 978
1012 Ga0495646_0000614 3300046680 Bacteria 19439
1013 Ga0495647_0331979 3300046681 Bacteria 690
1014 Ga0495669_0051344 3300046684 Bacteria 1851
1015 Ga0495669_0292207 3300046684 Bacteria 785
1016 Ga0495613_1014977 3300046689 Bacteria 532
1017 Ga0495624_0954229 3300046690 Bacteria 504
1018 Ga0495670_0094543 3300046691 Bacteria 1533
1019 Ga0495670_0443928 3300046691 Bacteria 703
1020 Ga0495670_0445784 3300046691 Bacteria 701
1021 Ga0495670_0790016 3300046691 Bacteria 518
1022 Ga0495671_0141049 3300046692 Bacteria 1174
1023 Ga0495671_0434642 3300046692 Bacteria 628
1024 Ga0495649_0198625 3300046694 Bacteria 1042
1025 Ga0495589_0040099 3300046794 Bacteria 2339
1026 Ga0495589_0091039 3300046794 Bacteria 1481
1027 Ga0495589_0129373 3300046794 Bacteria 1213
1028 Ga0495589_0377739 3300046794 Bacteria 651
1029 Ga0495600_0190425 3300046809 Unclassified 1319
1030 Ga0495600_0195398 3300046809 Bacteria 1300
1031 Ga0495600_0584456 3300046809 Bacteria 680
1032 Ga0495660_0077023 3300046810 Bacteria 1756
1033 Ga0495660_0255491 3300046810 Bacteria 811
1034 Ga0495660_0336195 3300046810 Bacteria 675
1035 Ga0495660_0382387 3300046810 Bacteria 620
1036 Ga0495581_0186089 3300047315 Bacteria 1215
1037 Ga0495604_0000076 3300047317 Bacteria 85332
1038 Ga0495604_0224250 3300047317 Bacteria 1292
1039 Ga0495604_0666779 3300047317 Bacteria 662
1040 Ga0495636_0043642 3300047318 Bacteria 1866
1041 Ga0495636_0426777 3300047318 Bacteria 634
1042 Ga0495674_0323066 3300047319 Bacteria 1257
1043 Ga0495674_0677644 3300047319 Bacteria 811
1044 Ga0495680_0056788 3300047322 Bacteria 3030
1045 Ga0495680_0151804 3300047322 Unclassified 1688
1046 Ga0495683_0021829 3300047323 Bacteria 3298
1047 Ga0495683_0424280 3300047323 Bacteria 549
1048 Ga0495675_0015013 3300047444 Bacteria 4896
1049 Ga0495675_0175608 3300047444 Bacteria 1314
1050 Ga0495677_0014856 3300047445 Bacteria 2832
1051 Ga0495679_065970 3300047446 Bacteria 1052
1052 Ga0495679_134141 3300047446 Bacteria 671
1053 Ga0495679_137826 3300047446 Bacteria 660
1054 Ga0495685_034722 3300047447 Bacteria 1733
1055 Ga0495681_0028720 3300047470 Bacteria 2857
1056 Ga0495681_0226384 3300047470 Bacteria 748
1057 Ga0495684_0020664 3300047471 Bacteria 5073
1058 Ga0495684_0897722 3300047471 Bacteria 571
1059 Ga0495593_0601021 3300047673 Bacteria 552
1060 Ga0495602_0000247 3300048088 Bacteria 50489
1061 Ga0495614_0329403 3300048089 Bacteria 709
1062 Ga0495615_0013300 3300048090 Bacteria 1717
1063 Ga0495626_0241050 3300048091 Bacteria 728
1064 Ga0496100_0175107 3300048903 Bacteria 1548
1065 Ga0496100_0303868 3300048903 Bacteria 1195
1066 Ga0496100_1538221 3300048903 Bacteria 526
1067 Ga0496101_0078025 3300048904 Bacteria 2442
1068 Ga0496101_0841511 3300048904 Bacteria 723
1069 Ga0496101_1169584 3300048904 Bacteria 603
1070 Ga0496101_1326021 3300048904 Bacteria 562
1071 Ga0496102_0615589 3300048905 Bacteria 1009
1072 Ga0496102_0759579 3300048905 Bacteria 892
1073 Ga0496102_1213080 3300048905 Bacteria 674
1074 Ga0496102_1418269 3300048905 Bacteria 613
1075 Ga0496103_0192928 3300048906 Bacteria 1310
1076 Ga0496103_0384997 3300048906 Bacteria 901
1077 Ga0496104_0003234 3300048907 Bacteria 14027
1078 Ga0496104_0158074 3300048907 Bacteria 2175
1079 Ga0496105_0083225 3300048908 Bacteria 2643
1080 Ga0496106_0212251 3300048909 Bacteria 1542
1081 Ga0496106_0374663 3300048909 Bacteria 1144
1082 Ga0496106_0847823 3300048909 Bacteria 723
1083 Ga0496107_0096029 3300048910 Bacteria 2169
1084 Ga0496107_0098643 3300048910 Bacteria 2140
1085 Ga0496107_0445779 3300048910 Bacteria 962
1086 Ga0496107_0791404 3300048910 Bacteria 695
1087 Ga0496108_0004178 3300048911 Bacteria 11627
1088 Ga0496108_0018043 3300048911 Bacteria 5773
1089 Ga0496108_0044721 3300048911 Bacteria 3696
1090 Ga0496108_0123552 3300048911 Bacteria 2221
1091 Ga0496108_0173491 3300048911 Bacteria 1866
1092 Ga0496108_0185332 3300048911 Bacteria 1803
1093 Ga0496108_1161403 3300048911 Bacteria 654
1094 Ga0496108_1794579 3300048911 Bacteria 502
1095 Ga0496109_0005943 3300048912 Bacteria 10242
1096 Ga0496109_0011028 3300048912 Bacteria 7746
1097 Ga0496109_0030731 3300048912 Bacteria 4814
1098 Ga0496109_0102452 3300048912 Bacteria 2656
1099 Ga0496109_0198403 3300048912 Bacteria 1887
1100 Ga0496109_0420874 3300048912 Bacteria 1262
1101 Ga0496110_0004216 3300048913 Bacteria 11120
1102 Ga0496110_0027118 3300048913 Bacteria 4908
1103 Ga0496110_0350691 3300048913 Bacteria 1344
1104 Ga0496110_1385745 3300048913 Bacteria 612
1105 Ga0496110_1520834 3300048913 Bacteria 579
1106 Ga0496111_0000393 3300048914 Bacteria 21943
1107 Ga0496111_0007348 3300048914 Bacteria 7211
1108 Ga0496111_0090525 3300048914 Bacteria 2241
1109 Ga0496111_0236133 3300048914 Bacteria 1358
1110 Ga0496111_0451377 3300048914 Bacteria 948
1111 Ga0496112_0124184 3300048915 Bacteria 2552
1112 Ga0496113_0014014 3300048916 Bacteria 5455
1113 Ga0496113_0133419 3300048916 Bacteria 1950
1114 Ga0496113_0345003 3300048916 Bacteria 1194
1115 Ga0496114_0049879 3300048917 Bacteria 3483
1116 Ga0496114_0190020 3300048917 Bacteria 1797
1117 Ga0496114_0271639 3300048917 Bacteria 1494
1118 Ga0496114_0556989 3300048917 Unclassified 1013
1119 Ga0496114_0792951 3300048917 Bacteria 826
1120 Ga0496114_1029061 3300048917 Bacteria 707
1121 Ga0496115_0255332 3300048918 Bacteria 1442
1122 Ga0501309_089122 3300049129 Bacteria 524
1123 Ga0501307_038129 3300049162 Bacteria 690
1124 Ga0501299_209127 3300049522 Bacteria 522
1125 Ga0501311_036429 3300049527 Bacteria 731
1126 Ga0501313_044581 3300049529 Bacteria 603
1127 Ga0501316_071380 3300049532 Bacteria 526
1128 Ga0501317_085189 3300049533 Bacteria 552
1129 Ga0501321_039901 3300049537 Bacteria 657
1130 Ga0501031_0000706 3300049568 Bacteria 19927
1131 Ga0501031_0005850 3300049568 Bacteria 8015
1132 Ga0501031_0043735 3300049568 Bacteria 2922
1133 Ga0501031_0050750 3300049568 Bacteria 2702
1134 Ga0501031_0110681 3300049568 Bacteria 1793
1135 Ga0501031_0130436 3300049568 Bacteria 1642
1136 Ga0501031_0130858 3300049568 Bacteria 1639
1137 Ga0501031_0187617 3300049568 Bacteria 1350
1138 Ga0501031_0198994 3300049568 Bacteria 1307
1139 Ga0501031_0200654 3300049568 Bacteria 1301
1140 Ga0501031_0530971 3300049568 Unclassified 758
1141 Ga0501031_0701890 3300049568 Bacteria 649
1142 Ga0501031_0794061 3300049568 Bacteria 607
1143 Ga0501031_0921361 3300049568 Bacteria 559
1144 Ga0501032_0016227 3300049569 Bacteria 5239
1145 Ga0501032_0018329 3300049569 Bacteria 4905
1146 Ga0501032_0047603 3300049569 Bacteria 2895
1147 Ga0501032_0114899 3300049569 Bacteria 1780
1148 Ga0501032_0152060 3300049569 Bacteria 1521
1149 Ga0501032_0717000 3300049569 Bacteria 633
1150 Ga0501033_0010945 3300049570 Bacteria 6953
1151 Ga0501033_0170851 3300049570 Bacteria 1561
1152 Ga0501033_0260823 3300049570 Bacteria 1226
1153 Ga0501033_0312085 3300049570 Unclassified 1105
1154 Ga0501033_0331947 3300049570 Bacteria 1067
1155 Ga0501033_0353750 3300049570 Bacteria 1028
1156 Ga0501033_1188061 3300049570 Bacteria 505
1157 Ga0501034_0005653 3300049571 Bacteria 13605
1158 Ga0501034_0195508 3300049571 Bacteria 1983
1159 Ga0501034_0283514 3300049571 Bacteria 1596
1160 Ga0501034_0755012 3300049571 Bacteria 868
1161 Ga0501034_1028107 3300049571 Unclassified 707
1162 Ga0501034_1444928 3300049571 Bacteria 562
1163 Ga0501036_0003757 3300049572 Bacteria 12167
1164 Ga0501036_0007382 3300049572 Bacteria 8956
1165 Ga0501036_0035879 3300049572 Bacteria 4195
1166 Ga0501036_0062512 3300049572 Bacteria 3153
1167 Ga0501036_0113188 3300049572 Bacteria 2293
1168 Ga0501036_0121770 3300049572 Bacteria 2203
1169 Ga0501036_0124465 3300049572 Bacteria 2177
1170 Ga0501036_0150408 3300049572 Bacteria 1963
1171 Ga0501036_0337166 3300049572 Bacteria 1259
1172 Ga0501036_0631634 3300049572 Bacteria 887
1173 Ga0501036_0780228 3300049572 Bacteria 787
1174 Ga0501037_0006885 3300049573 Bacteria 8304
1175 Ga0501037_0023639 3300049573 Bacteria 4544
1176 Ga0501037_0119963 3300049573 Bacteria 1891
1177 Ga0501037_0144876 3300049573 Bacteria 1699
1178 Ga0501037_0257106 3300049573 Bacteria 1221
1179 Ga0501037_0327762 3300049573 Bacteria 1059
1180 Ga0501037_0735831 3300049573 Bacteria 654
1181 Ga0501037_1075436 3300049573 Bacteria 522
1182 Ga0501038_0001115 3300049574 Bacteria 24376
1183 Ga0501038_0009144 3300049574 Bacteria 9091
1184 Ga0501038_0013764 3300049574 Bacteria 7372
1185 Ga0501038_0018951 3300049574 Bacteria 6210
1186 Ga0501038_0028196 3300049574 Bacteria 4989
1187 Ga0501038_0157363 3300049574 Bacteria 1849
1188 Ga0501038_0234398 3300049574 Bacteria 1459
1189 Ga0501039_0000660 3300049575 Bacteria 24915
1190 Ga0501039_0007924 3300049575 Bacteria 8094
1191 Ga0501039_0008099 3300049575 Bacteria 8006
1192 Ga0501039_0033291 3300049575 Bacteria 3975
1193 Ga0501039_0041562 3300049575 Bacteria 3551
1194 Ga0501039_0049372 3300049575 Bacteria 3252
1195 Ga0501039_0053511 3300049575 Bacteria 3124
1196 Ga0501039_0074546 3300049575 Bacteria 2637
1197 Ga0501039_0086913 3300049575 Bacteria 2435
1198 Ga0501039_0266870 3300049575 Bacteria 1345
1199 Ga0501039_0511975 3300049575 Bacteria 942
1200 Ga0501039_1227992 3300049575 Bacteria 579
1201 Ga0501039_1266092 3300049575 Bacteria 569
1202 Ga0501040_0000728 3300049576 Bacteria 20356
1203 Ga0501040_0006365 3300049576 Bacteria 7667
1204 Ga0501040_0010406 3300049576 Bacteria 6081
1205 Ga0501040_0017443 3300049576 Bacteria 4766
1206 Ga0501040_0040218 3300049576 Bacteria 3181
1207 Ga0501040_0054331 3300049576 Bacteria 2745
1208 Ga0501040_0106290 3300049576 Bacteria 1961
1209 Ga0501040_0208933 3300049576 Bacteria 1387
1210 Ga0501040_0244845 3300049576 Bacteria 1278
1211 Ga0501040_0315473 3300049576 Bacteria 1118
1212 Ga0501041_0003781 3300049577 Bacteria 8710
1213 Ga0501041_0003881 3300049577 Bacteria 8608
1214 Ga0501041_0008611 3300049577 Bacteria 6009
1215 Ga0501041_0013072 3300049577 Bacteria 4920
1216 Ga0501041_0014750 3300049577 Bacteria 4640
1217 Ga0501041_0051949 3300049577 Bacteria 2498
1218 Ga0501041_0064403 3300049577 Bacteria 2245
1219 Ga0501041_0107124 3300049577 Bacteria 1732
1220 Ga0501041_0620415 3300049577 Bacteria 690
1221 Ga0501041_0903048 3300049577 Bacteria 567
1222 Ga0501042_0002963 3300049578 Bacteria 10555
1223 Ga0501042_0007578 3300049578 Bacteria 7120
1224 Ga0501042_0011188 3300049578 Bacteria 6045
1225 Ga0501042_0031230 3300049578 Bacteria 3768
1226 Ga0501042_0047422 3300049578 Bacteria 3064
1227 Ga0501042_0061732 3300049578 Bacteria 2677
1228 Ga0501042_0084864 3300049578 Bacteria 2271
1229 Ga0501042_0092038 3300049578 Bacteria 2177
1230 Ga0501042_0106568 3300049578 Bacteria 2017
1231 Ga0501042_0126877 3300049578 Bacteria 1837
1232 Ga0501042_0159818 3300049578 Bacteria 1625
1233 Ga0501042_0586818 3300049578 Bacteria 810
1234 Ga0501042_0755061 3300049578 Bacteria 707
1235 Ga0501043_0007842 3300049579 Bacteria 8440
1236 Ga0501043_0008472 3300049579 Bacteria 8093
1237 Ga0501043_0128791 3300049579 Bacteria 1984
1238 Ga0501043_0196146 3300049579 Bacteria 1568
1239 Ga0501043_0213485 3300049579 Bacteria 1495
1240 Ga0501043_0285585 3300049579 Bacteria 1264
1241 Ga0501043_0316327 3300049579 Bacteria 1191
1242 Ga0501043_0770107 3300049579 Bacteria 698
1243 Ga0501043_0833945 3300049579 Bacteria 665
1244 Ga0501046_0002216 3300049580 Bacteria 18331
1245 Ga0501046_0002233 3300049580 Bacteria 18272
1246 Ga0501046_0002756 3300049580 Bacteria 16358
1247 Ga0501046_0015022 3300049580 Bacteria 6514
1248 Ga0501046_0078455 3300049580 Bacteria 2554
1249 Ga0501046_0086060 3300049580 Bacteria 2423
1250 Ga0501046_0163140 3300049580 Bacteria 1675
1251 Ga0501046_0199904 3300049580 Bacteria 1487
1252 Ga0501046_0227262 3300049580 Bacteria 1380
1253 Ga0501046_1204015 3300049580 Bacteria 520
1254 Ga0501047_0038295 3300049581 Bacteria 4639
1255 Ga0501047_0350502 3300049581 Bacteria 1313
1256 Ga0501047_0593094 3300049581 Bacteria 930
1257 Ga0501047_0900163 3300049581 Bacteria 698
1258 Ga0501047_1243881 3300049581 Bacteria 558
1259 Ga0501048_0000617 3300049582 Bacteria 25363
1260 Ga0501048_0002324 3300049582 Bacteria 14507
1261 Ga0501048_0012572 3300049582 Bacteria 6297
1262 Ga0501048_0021108 3300049582 Bacteria 4769
1263 Ga0501048_0028857 3300049582 Bacteria 4027
1264 Ga0501048_0043110 3300049582 Bacteria 3230
1265 Ga0501048_0124224 3300049582 Bacteria 1824
1266 Ga0501048_0129074 3300049582 Bacteria 1787
1267 Ga0501048_0186683 3300049582 Bacteria 1469
1268 Ga0501048_0197091 3300049582 Bacteria 1427
1269 Ga0501048_0552426 3300049582 Bacteria 826
1270 Ga0501048_0804473 3300049582 Bacteria 675
1271 Ga0501067_0017114 3300049583 Bacteria 4005
1272 Ga0501067_0093111 3300049583 Bacteria 1673
1273 Ga0501067_0124694 3300049583 Bacteria 1433
1274 Ga0501067_0363775 3300049583 Bacteria 806
1275 Ga0501067_0861478 3300049583 Bacteria 511
1276 Ga0501068_0001134 3300049584 Bacteria 14115
1277 Ga0501068_0002686 3300049584 Bacteria 9423
1278 Ga0501068_0004047 3300049584 Bacteria 7971
1279 Ga0501068_0007077 3300049584 Bacteria 6213
1280 Ga0501068_0008085 3300049584 Bacteria 5837
1281 Ga0501068_0127889 3300049584 Bacteria 1587
1282 Ga0501068_0310113 3300049584 Unclassified 1011
1283 Ga0501068_0364679 3300049584 Bacteria 929
1284 Ga0501068_0626840 3300049584 Bacteria 701
1285 Ga0501068_1117055 3300049584 Bacteria 521
1286 Ga0501069_0000780 3300049585 Bacteria 14962
1287 Ga0501069_0011537 3300049585 Bacteria 4682
1288 Ga0501069_0041592 3300049585 Bacteria 2540
1289 Ga0501069_0079749 3300049585 Bacteria 1843
1290 Ga0501069_0098152 3300049585 Bacteria 1661
1291 Ga0501069_0113580 3300049585 Bacteria 1544
1292 Ga0501069_0152224 3300049585 Bacteria 1329
1293 Ga0501069_0464503 3300049585 Bacteria 753
1294 Ga0501069_0634701 3300049585 Bacteria 642
1295 Ga0501069_0645376 3300049585 Bacteria 637
1296 Ga0501070_0000228 3300049586 Bacteria 52799
1297 Ga0501070_0001876 3300049586 Bacteria 18572
1298 Ga0501070_0008739 3300049586 Bacteria 8564
1299 Ga0501070_0033133 3300049586 Bacteria 4322
1300 Ga0501070_0087975 3300049586 Bacteria 2571
1301 Ga0501070_0137763 3300049586 Bacteria 2015
1302 Ga0501070_0208137 3300049586 Bacteria 1606
1303 Ga0501070_0211776 3300049586 Bacteria 1590
1304 Ga0501070_0298423 3300049586 Bacteria 1313
1305 Ga0501070_0315026 3300049586 Bacteria 1273
1306 Ga0501070_0826016 3300049586 Bacteria 726
1307 Ga0501071_0000685 3300049587 Bacteria 17722
1308 Ga0501071_0002630 3300049587 Bacteria 10990
1309 Ga0501071_0006021 3300049587 Bacteria 7854
1310 Ga0501071_0012211 3300049587 Bacteria 5816
1311 Ga0501071_0014054 3300049587 Bacteria 5471
1312 Ga0501071_0023786 3300049587 Bacteria 4280
1313 Ga0501071_0034268 3300049587 Bacteria 3612
1314 Ga0501071_0061882 3300049587 Bacteria 2711
1315 Ga0501071_0085528 3300049587 Bacteria 2312
1316 Ga0501071_0132942 3300049587 Bacteria 1849
1317 Ga0501071_0308489 3300049587 Bacteria 1200
1318 Ga0501072_0002801 3300049588 Bacteria 13086
1319 Ga0501072_0003033 3300049588 Bacteria 12663
1320 Ga0501072_0011260 3300049588 Bacteria 6829
1321 Ga0501072_0012221 3300049588 Bacteria 6561
1322 Ga0501072_0020766 3300049588 Bacteria 5090
1323 Ga0501072_0033632 3300049588 Bacteria 4018
1324 Ga0501072_0045270 3300049588 Bacteria 3459
1325 Ga0501072_0046765 3300049588 Bacteria 3407
1326 Ga0501072_0080308 3300049588 Bacteria 2583
1327 Ga0501072_0140886 3300049588 Bacteria 1922
1328 Ga0501072_0261462 3300049588 Bacteria 1377
1329 Ga0501072_0557566 3300049588 Bacteria 905
1330 Ga0501072_1517923 3300049588 Bacteria 517
1331 Ga0501073_0005554 3300049589 Bacteria 9433
1332 Ga0501073_0014941 3300049589 Bacteria 5633
1333 Ga0501073_0049645 3300049589 Bacteria 2941
1334 Ga0501073_0090217 3300049589 Bacteria 2130
1335 Ga0501073_0188182 3300049589 Bacteria 1428
1336 Ga0501073_0387582 3300049589 Bacteria 965
1337 Ga0501073_0741584 3300049589 Unclassified 677
1338 Ga0501074_0003167 3300049590 Bacteria 11604
1339 Ga0501074_0006117 3300049590 Bacteria 8692
1340 Ga0501074_0024769 3300049590 Bacteria 4360
1341 Ga0501074_0030506 3300049590 Bacteria 3907
1342 Ga0501074_0031566 3300049590 Bacteria 3837
1343 Ga0501074_0049675 3300049590 Bacteria 3029
1344 Ga0501074_0050747 3300049590 Bacteria 2995
1345 Ga0501074_0066485 3300049590 Bacteria 2593
1346 Ga0501074_0200675 3300049590 Unclassified 1421
1347 Ga0501074_0350004 3300049590 Bacteria 1048
1348 Ga0501074_0358527 3300049590 Bacteria 1035
1349 Ga0501074_0376633 3300049590 Bacteria 1007
1350 Ga0501075_0002269 3300049591 Bacteria 12743
1351 Ga0501075_0002789 3300049591 Bacteria 11698
1352 Ga0501075_0004313 3300049591 Bacteria 9621
1353 Ga0501075_0028435 3300049591 Bacteria 4126
1354 Ga0501075_0033104 3300049591 Bacteria 3844
1355 Ga0501075_0072302 3300049591 Bacteria 2607
1356 Ga0501075_0079288 3300049591 Bacteria 2485
1357 Ga0501075_0146953 3300049591 Bacteria 1796
1358 Ga0501075_0157384 3300049591 Bacteria 1732
1359 Ga0501075_0343485 3300049591 Bacteria 1137
1360 Ga0501075_0448898 3300049591 Bacteria 983
1361 Ga0501075_0466387 3300049591 Bacteria 963
1362 Ga0501076_0004978 3300049592 Bacteria 9514
1363 Ga0501076_0006009 3300049592 Bacteria 8773
1364 Ga0501076_0008482 3300049592 Bacteria 7530
1365 Ga0501076_0026676 3300049592 Bacteria 4477
1366 Ga0501076_0055715 3300049592 Bacteria 3135
1367 Ga0501076_0060208 3300049592 Bacteria 3020
1368 Ga0501076_0205267 3300049592 Bacteria 1609
1369 Ga0501076_0249700 3300049592 Bacteria 1451
1370 Ga0501076_0286542 3300049592 Bacteria 1349
1371 Ga0501076_0357020 3300049592 Bacteria 1200
1372 Ga0501076_0592464 3300049592 Bacteria 914
1373 Ga0501076_1450927 3300049592 Bacteria 564
1374 Ga0501076_1692532 3300049592 Bacteria 519
1375 Ga0501077_0001985 3300049593 Bacteria 12345
1376 Ga0501077_0003454 3300049593 Bacteria 9485
1377 Ga0501077_0006318 3300049593 Bacteria 7255
1378 Ga0501077_0007003 3300049593 Bacteria 6951
1379 Ga0501077_0028663 3300049593 Bacteria 3539
1380 Ga0501077_0048061 3300049593 Bacteria 2710
1381 Ga0501077_0053496 3300049593 Bacteria 2563
1382 Ga0501077_0069297 3300049593 Bacteria 2236
1383 Ga0501077_0112153 3300049593 Bacteria 1728
1384 Ga0501077_0114771 3300049593 Bacteria 1707
1385 Ga0501077_0159140 3300049593 Bacteria 1434
1386 Ga0501077_0629607 3300049593 Bacteria 689
1387 Ga0501202_176455 3300049652 Bacteria 574
1388 Ga0501209_135717 3300049656 Bacteria 736
1389 Ga0501217_038277 3300049661 Bacteria 1211
1390 Ga0501250_077797 3300049680 Bacteria 559
1391 Ga0501221_090447 3300049704 Bacteria 748
1392 Ga0501225_0199859 3300049705 Bacteria 634
1393 Ga0501079_0009194 3300049741 Bacteria 7485
1394 Ga0501079_0009863 3300049741 Bacteria 7246
1395 Ga0501079_0010403 3300049741 Bacteria 7072
1396 Ga0501079_0011677 3300049741 Bacteria 6708
1397 Ga0501079_0012010 3300049741 Bacteria 6610
1398 Ga0501079_0018239 3300049741 Bacteria 5360
1399 Ga0501079_0021266 3300049741 Bacteria 4961
1400 Ga0501079_0039464 3300049741 Bacteria 3641
1401 Ga0501079_0084134 3300049741 Bacteria 2461
1402 Ga0501079_0402774 3300049741 Bacteria 1073
1403 Ga0501079_0517321 3300049741 Bacteria 938
1404 Ga0501079_0751924 3300049741 Bacteria 767
1405 Ga0501079_0992209 3300049741 Bacteria 661
1406 Ga0501080_0000687 3300049742 Bacteria 27069
1407 Ga0501080_0011018 3300049742 Bacteria 8277
1408 Ga0501080_0014808 3300049742 Bacteria 7182
1409 Ga0501080_0026542 3300049742 Bacteria 5381
1410 Ga0501080_0047984 3300049742 Bacteria 3976
1411 Ga0501080_0081841 3300049742 Bacteria 2999
1412 Ga0501080_0191276 3300049742 Bacteria 1880
1413 Ga0501080_0193342 3300049742 Bacteria 1869
1414 Ga0501080_0251632 3300049742 Bacteria 1611
1415 Ga0501080_0298839 3300049742 Bacteria 1460
1416 Ga0501080_0835999 3300049742 Bacteria 806
1417 Ga0501080_1252278 3300049742 Bacteria 636
1418 Ga0501080_1401592 3300049742 Bacteria 596
1419 Ga0501081_0006037 3300049743 Bacteria 7843
1420 Ga0501081_0009846 3300049743 Bacteria 6225
1421 Ga0501081_0013639 3300049743 Bacteria 5342
1422 Ga0501081_0024363 3300049743 Bacteria 4063
1423 Ga0501081_0032565 3300049743 Bacteria 3536
1424 Ga0501081_0053343 3300049743 Bacteria 2791
1425 Ga0501081_0057178 3300049743 Bacteria 2696
1426 Ga0501081_0098245 3300049743 Bacteria 2067
1427 Ga0501081_0107555 3300049743 Bacteria 1977
1428 Ga0501081_0107891 3300049743 Bacteria 1974
1429 Ga0501081_0249040 3300049743 Bacteria 1297
1430 Ga0501081_0618732 3300049743 Bacteria 811
1431 Ga0501081_0658164 3300049743 Bacteria 785
1432 Ga0501081_1173792 3300049743 Bacteria 581
1433 Ga0501081_1347264 3300049743 Unclassified 541
1434 Ga0501081_1436817 3300049743 Bacteria 524
1435 Ga0501083_0003918 3300049744 Bacteria 10451
1436 Ga0501083_0017267 3300049744 Bacteria 5031
1437 Ga0501083_0029656 3300049744 Bacteria 3760
1438 Ga0501083_0111615 3300049744 Bacteria 1797
1439 Ga0501083_0224550 3300049744 Bacteria 1223
1440 Ga0501083_0247615 3300049744 Bacteria 1160
1441 Ga0501083_0390078 3300049744 Bacteria 906
1442 Ga0501083_0398302 3300049744 Bacteria 896
1443 Ga0501232_087354 3300049757 Bacteria 533
1444 Ga0501035_0008085 3300049822 Bacteria 9801
1445 Ga0501035_0010116 3300049822 Bacteria 8756
1446 Ga0501035_0012955 3300049822 Bacteria 7696
1447 Ga0501035_0050133 3300049822 Bacteria 3742
1448 Ga0501035_0053961 3300049822 Bacteria 3592
1449 Ga0501035_0292594 3300049822 Bacteria 1374
1450 Ga0501035_0537620 3300049822 Bacteria 958
1451 Ga0501035_0618421 3300049822 Bacteria 881
1452 Ga0501035_0853709 3300049822 Bacteria 724
1453 Ga0501035_0862448 3300049822 Bacteria 719
1454 Ga0501035_1437911 3300049822 Bacteria 527
1455 Ga0501044_0041203 3300049823 Bacteria 4808
1456 Ga0501044_0215535 3300049823 Bacteria 1872
1457 Ga0501044_0348769 3300049823 Bacteria 1400
1458 Ga0501044_0368140 3300049823 Bacteria 1354
1459 Ga0501044_0493580 3300049823 Bacteria 1126
1460 Ga0501044_0702883 3300049823 Unclassified 896
1461 Ga0501044_0989473 3300049823 Bacteria 713
1462 Ga0501044_1301276 3300049823 Bacteria 593
1463 Ga0501044_1600370 3300049823 Bacteria 516
1464 Ga0501045_0000889 3300049824 Bacteria 19416
1465 Ga0501045_0015968 3300049824 Bacteria 5326
1466 Ga0501045_0030153 3300049824 Bacteria 3924
1467 Ga0501045_0046781 3300049824 Bacteria 3150
1468 Ga0501045_0083831 3300049824 Bacteria 2351
1469 Ga0501045_0141450 3300049824 Bacteria 1789
1470 Ga0501045_0180380 3300049824 Bacteria 1573
1471 Ga0501045_0186675 3300049824 Bacteria 1545
1472 Ga0501045_0211782 3300049824 Bacteria 1444
1473 Ga0501045_0231679 3300049824 Bacteria 1375
1474 Ga0501045_0318865 3300049824 Bacteria 1156
1475 Ga0501045_0808293 3300049824 Bacteria 690
1476 Ga0501045_0899709 3300049824 Bacteria 650
1477 Ga0501045_1035687 3300049824 Bacteria 601
1478 nmdc:mga03683_43872_c1 3300050489 Bacteria 1846
1479 nmdc:mga03n38_43033_c1 3300050490 Bacteria 1977
1480 nmdc:mga00v17_31108_c1 3300050491 Bacteria 3146
1481 nmdc:mga00v17_679630_c1 3300050491 Bacteria 661
1482 nmdc:mga06z11_7934_c1 3300050494 Bacteria 4397
1483 nmdc:mga04h51_40534_c1 3300050495 Bacteria 1518
1484 nmdc:mga07m45_404071_c1 3300050496 Bacteria 793
1485 nmdc:mga05p37_10711_c2 3300050507 Bacteria 10105
1486 nmdc:mga05p37_1181908_c1 3300050507 Bacteria 792
1487 nmdc:mga05p37_1183477_c1 3300050507 Bacteria 791
1488 nmdc:mga05p37_1316290_c1 3300050507 Bacteria 735
1489 nmdc:mga05p37_1437251_c1 3300050507 Bacteria 692
1490 nmdc:mga05p37_25601_c1 3300050507 Bacteria 7177
1491 nmdc:mga05p37_29029_c1 3300050507 Bacteria 4958
1492 nmdc:mga05p37_318209_c1 3300050507 Bacteria 1842
1493 nmdc:mga05p37_337656_c1 3300050507 Bacteria 1778
1494 nmdc:mga05p37_397655_c1 3300050507 Bacteria 1610
1495 nmdc:mga09592_153275_c1 3300050508 Bacteria 1989
1496 nmdc:mga09592_32167_c1 3300050508 Bacteria 4373
1497 nmdc:mga09592_406858_c1 3300050508 Bacteria 1176
1498 nmdc:mga09592_461313_c1 3300050508 Bacteria 1096
1499 nmdc:mga0qj67_209656_c1 3300050509 Bacteria 1583
1500 nmdc:mga0qj67_22113_c1 3300050509 Bacteria 4882
1501 nmdc:mga0qj67_248987_c1 3300050509 Bacteria 1442
1502 nmdc:mga0qj67_448264_c1 3300050509 Bacteria 1040
1503 nmdc:mga06r32_1064713_c1 3300050510 Bacteria 759
1504 nmdc:mga06r32_1083178_c1 3300050510 Bacteria 751
1505 nmdc:mga06r32_1087252_c1 3300050510 Bacteria 749
1506 nmdc:mga06r32_1300502_c1 3300050510 Bacteria 671
1507 nmdc:mga06r32_365238_c1 3300050510 Bacteria 1427
1508 nmdc:mga06r32_399914_c1 3300050510 Bacteria 1356
1509 nmdc:mga06r32_87639_c1 3300050510 Bacteria 3038
1510 nmdc:mga08y16_115790_c1 3300050511 Bacteria 2791
1511 nmdc:mga08y16_12151_c1 3300050511 Bacteria 9050
1512 nmdc:mga08y16_1371276_c1 3300050511 Bacteria 671
1513 nmdc:mga08y16_1510353_c1 3300050511 Bacteria 632
1514 nmdc:mga08y16_167946_c1 3300050511 Bacteria 2280
1515 nmdc:mga08y16_241148_c1 3300050511 Bacteria 1869
1516 nmdc:mga08y16_290212_c1 3300050511 Bacteria 1687
1517 nmdc:mga08y16_35922_c1 3300050511 Bacteria 5205
1518 nmdc:mga08y16_842521_c1 3300050511 Unclassified 907
1519 nmdc:mga08y16_85910_c1 3300050511 Bacteria 3279
1520 nmdc:mga0n895_118056_c1 3300050512 Bacteria 2672
1521 nmdc:mga0n895_711023_c1 3300050512 Bacteria 1000
1522 nmdc:mga0n895_856944_c1 3300050512 Bacteria 896
1523 nmdc:mga0rr50_1528052_c1 3300050513 Bacteria 564
1524 nmdc:mga08x19_62128_c1 3300050514 Unclassified 2421
1525 nmdc:mga0a205_30337_c1 3300050515 Bacteria 5176
1526 nmdc:mga0a205_859819_c1 3300050515 Bacteria 754
1527 Ga0495601_0000119 3300053077 Bacteria 43595
1528 Ga0495601_0160937 3300053077 Bacteria 1467
1529 Ga0495601_0182712 3300053077 Bacteria 1371
1530 Ga0495612_0037524 3300053078 Bacteria 1968
1531 Ga0495612_0338613 3300053078 Bacteria 678
1532 Ga0495655_0078624 3300053083 Bacteria 938
1533 Ga0495655_0174116 3300053083 Bacteria 690
1534 Ga0495595_0043685 3300053084 Bacteria 2057
1535 Ga0495595_0073389 3300053084 Bacteria 1620
1536 Ga0495619_0043034 3300053085 Unclassified 2959
1537 Ga0495619_0094354 3300053085 Bacteria 2029
1538 Ga0495619_0162255 3300053085 Bacteria 1544
1539 Ga0495619_0444094 3300053085 Bacteria 894
1540 Ga0500628_143221 3300053129 Bacteria 664
1541 Ga0501084_0006705 3300054114 Bacteria 9468
1542 Ga0501084_0015070 3300054114 Bacteria 6410
1543 Ga0501084_0021021 3300054114 Bacteria 5444
1544 Ga0501084_0022756 3300054114 Bacteria 5230
1545 Ga0501084_0035380 3300054114 Bacteria 4175
1546 Ga0501084_0041810 3300054114 Bacteria 3834
1547 Ga0501084_0067605 3300054114 Bacteria 2991
1548 Ga0501084_0137687 3300054114 Bacteria 2055
1549 Ga0501084_0167054 3300054114 Bacteria 1857
1550 Ga0501084_0269893 3300054114 Bacteria 1436
1551 Ga0501084_0277355 3300054114 Bacteria 1415
1552 Ga0501084_0303103 3300054114 Bacteria 1349
1553 Ga0501084_0758704 3300054114 Bacteria 817
1554 Ga0501084_0874450 3300054114 Bacteria 756
1555 Ga0501084_0889162 3300054114 Bacteria 749
1556 Ga0501084_1102419 3300054114 Bacteria 666
1557 Ga0501084_1321544 3300054114 Bacteria 604
1558 Ga0590071_008391 3300059421 Bacteria 2434
1559 Ga0590074_005887 3300059423 Bacteria 2036
1560 Ga0590074_043475 3300059423 Bacteria 812
1561 Ga0590075_003803 3300059424 Bacteria 3578
1562 Ga0590075_011346 3300059424 Bacteria 2153
1563 Ga0590075_056847 3300059424 Bacteria 1006
1564 Ga0590075_061790 3300059424 Bacteria 965
1565 Ga0590075_100119 3300059424 Bacteria 754
1566 Ga0590077_008165 3300059426 Bacteria 2143
1567 Ga0590077_049431 3300059426 Bacteria 942
1568 Ga0590077_141001 3300059426 Bacteria 575
1569 Ga0587084_021635 3300059477 Bacteria 966
1570 Ga0587066_224931 3300059490 Bacteria 505
1571 Ga0587070_143489 3300059491 Bacteria 592
1572 Ga0587073_0058787 3300059492 Bacteria 895
1573 Ga0587077_086997 3300059493 Unclassified 728
1574 Ga0587080_076237 3300059503 Unclassified 680
1575 Ga0587082_048084 3300059504 Bacteria 805
1576 Ga0587083_0116683 3300059505 Bacteria 685
1577 Ga0587088_063051 3300059508 Bacteria 756
1578 Ga0587090_055926 3300059510 Bacteria 736
1579 Ga0587091_072441 3300059511 Bacteria 757
1580 Ga0587091_163838 3300059511 Bacteria 574
1581 Ga0587067_129796 3300059640 Bacteria 614
1582 Ga0587067_167217 3300059640 Bacteria 564
1583 Ga0587068_131767 3300059641 Bacteria 551
1584 Ga0587072_074232 3300059643 Bacteria 724
1585 Ga0587076_067718 3300059645 Unclassified 734
1586 Ga0587079_047322 3300059647 Bacteria 891
1587 Ga0587079_223223 3300059647 Bacteria 525
1588 Ga0501082_0003225 3300060353 Bacteria 14216
1589 Ga0501082_0010945 3300060353 Bacteria 7807
1590 Ga0501082_0081803 3300060353 Bacteria 2787
1591 Ga0501082_0082153 3300060353 Bacteria 2780
1592 Ga0501082_0088602 3300060353 Bacteria 2670
1593 Ga0501082_0177062 3300060353 Bacteria 1854
1594 Ga0501082_0201280 3300060353 Bacteria 1732
1595 Ga0501082_0216899 3300060353 Bacteria 1665
1596 Ga0501082_0651756 3300060353 Bacteria 921
1597 Ga0501082_0768575 3300060353 Bacteria 843
1598 Ga0501082_1028068 3300060353 Bacteria 720
1599 Ga0501082_1396608 3300060353 Bacteria 611
1600 Ga0466962_0087611 3300061719 Bacteria 1491
1601 Ga0466962_0089723 3300061719 Unclassified 1472
1602 Ga0530510_0006136 3300061734 Bacteria 8344
1603 Ga0530510_0008550 3300061734 Bacteria 7145
1604 Ga0530510_0012893 3300061734 Bacteria 5877
1605 Ga0530510_0013117 3300061734 Bacteria 5829
1606 Ga0530510_0028782 3300061734 Bacteria 3983
1607 Ga0530510_0032815 3300061734 Bacteria 3736
1608 Ga0530510_0044977 3300061734 Bacteria 3190
1609 Ga0530510_0234248 3300061734 Bacteria 1366
1610 Ga0530510_0390463 3300061734 Bacteria 1048
1611 Ga0530510_0437995 3300061734 Bacteria 987
1612 Ga0530510_0558206 3300061734 Bacteria 870
1613 Ga0530510_0566661 3300061734 Bacteria 863
1614 Ga0530510_1151769 3300061734 Bacteria 594
1615 Ga0070683_101207937
1616 ARCol0yngRDRAFT_1001060
1617 JGI24738J21930_10030244
1618 JGI25406J46586_10011774
1619 JGI25407J50210_10000553
1620 JGI25407J50210_10003527
1621 JGI25407J50210_10005891
1622 JGI25407J50210_10019566
1623 JGI25407J50210_10028789
1624 Ga0058860_11993703
1625 Ga0065716_1005683
1626 Ga0070658_10837135
1627 Ga0070658_11102006
1628 Ga0070658_11281839
1629 Ga0070658_11692384
1630 Ga0070676_10097544
1631 Ga0070676_10608933
1632 Ga0070683_100005414
1633 Ga0070683_100100898
1634 Ga0070683_100106748
1635 Ga0070683_100188623
1636 Ga0070683_100511463
1637 Ga0070683_100807252
1638 Ga0070683_101981896
1639 Ga0070690_100285495
1640 Ga0070670_100046088
1641 Ga0070670_100508715
1642 Ga0070677_10543811
1643 Ga0068869_100060514
1644 Ga0068869_100851264
1645 Ga0068869_100907922
1646 Ga0070666_10486505
1647 Ga0070680_100015754
1648 Ga0070680_100034133
1649 Ga0070680_100054321
1650 Ga0070680_100097987
1651 Ga0070680_100145337
1652 Ga0070682_100022269
1653 Ga0070682_100027027
1654 Ga0070682_100041884
1655 Ga0070682_100244232
1656 Ga0068868_100178731
1657 Ga0068868_100618124
1658 Ga0070660_100031833
1659 Ga0070660_100098992
1660 Ga0070660_100193179
1661 Ga0070660_100633915
1662 Ga0070660_100862620
1663 Ga0070660_101054173
1664 Ga0070660_101588444
1665 Ga0070689_101616428
1666 Ga0070691_10006550
1667 Ga0070691_10126178
1668 Ga0070687_100438755
1669 Ga0070661_100045876
1670 Ga0070661_100385297
1671 Ga0070661_100597897
1672 Ga0070692_10032201
1673 Ga0070692_10077485
1674 Ga0070692_10100609
1675 Ga0070692_10607410
1676 Ga0070668_100677812
1677 Ga0070668_101585021
1678 Ga0070669_100297287
1679 Ga0070669_100696287
1680 Ga0070669_100890765
1681 Ga0070675_100128487
1682 Ga0070675_100286654
1683 Ga0070675_100567293
1684 Ga0070675_101443228
1685 Ga0070675_101633280
1686 Ga0070671_100132215
1687 Ga0070674_100097268
1688 Ga0070674_100117126
1689 Ga0070674_100287540
1690 Ga0070674_101286340
1691 Ga0070673_100501683
1692 Ga0070673_101336151
1693 Ga0070688_101191534
1694 Ga0070659_100034611
1695 Ga0070659_100436033
1696 Ga0070659_100559489
1697 Ga0070709_10320854
1698 Ga0070709_11179855
1699 Ga0070714_100015334
1700 Ga0070714_100430135
1701 Ga0070713_101177697
1702 Ga0070701_10231684
1703 Ga0070711_101432366
1704 Ga0070705_100107071
1705 Ga0070705_100336368
1706 Ga0070700_100072761
1707 Ga0070700_100135725
1708 Ga0070700_101340993
1709 Ga0070694_100109330
1710 Ga0070694_100127724
1711 Ga0070694_100297529
1712 Ga0070708_100160220
1713 Ga0070708_101519709
1714 Ga0070663_100989674
1715 Ga0070663_101012701
1716 Ga0070663_101185120
1717 Ga0070663_101211323
1718 Ga0070663_101908135
1719 Ga0070678_100020088
1720 Ga0070678_100500555
1721 Ga0070678_100640532
1722 Ga0070678_101924475
1723 Ga0070662_100098582
1724 Ga0070662_100166324
1725 Ga0070662_101094012
1726 Ga0070681_10018574
1727 Ga0070681_10042262
1728 Ga0070681_10089000
1729 Ga0070681_10337067
1730 Ga0070681_10641834
1731 Ga0070681_11235032
1732 Ga0068867_100230565
1733 Ga0068867_100248089
1734 Ga0068867_100333484
1735 Ga0068867_100641431
1736 Ga0068867_100806240
1737 Ga0068867_102232437
1738 Ga0070685_10053763
1739 Ga0070706_100023684
1740 Ga0070706_100352826
1741 Ga0070707_100081792
1742 Ga0070707_100085098
1743 Ga0070698_100002914
1744 Ga0070698_100069760
1745 Ga0070698_100110270
1746 Ga0070698_100537509
1747 Ga0070698_100661958
1748 Ga0070698_100800146
1749 Ga0070699_100024816
1750 Ga0070699_100034974
1751 Ga0070699_100466199
1752 Ga0070699_100699969
1753 Ga0070699_101033444
1754 Ga0070699_101952198
1755 Ga0070679_100120426
1756 Ga0070679_100129492
1757 Ga0070679_100178762
1758 Ga0070679_100217718
1759 Ga0070679_100219122
1760 Ga0070679_100597959
1761 Ga0070684_100067464
1762 Ga0070684_100099228
1763 Ga0070684_100140117
1764 Ga0070684_100190171
1765 Ga0070684_100414131
1766 Ga0070684_100432859
1767 Ga0070684_100844865
1768 Ga0070684_101000308
1769 Ga0070684_101075730
1770 Ga0070697_100253597
1771 Ga0068853_100148213
1772 Ga0068853_100154850
1773 Ga0068853_100160754
1774 Ga0070672_100377211
1775 Ga0070672_100713141
1776 Ga0070672_101095601
1777 Ga0070686_100088621
1778 Ga0070686_101585869
1779 Ga0070695_100102433
1780 Ga0070696_100103996
1781 Ga0070693_100382881
1782 Ga0070693_101138823
1783 Ga0070665_100731096
1784 Ga0070704_100205791
1785 Ga0068855_101735335
1786 Ga0070664_100036994
1787 Ga0070664_100151920
1788 Ga0070664_100304127
1789 Ga0070664_100639068
1790 Ga0068857_100003001
1791 Ga0068857_100116161
1792 Ga0068857_100298940
1793 Ga0068857_100316532
1794 Ga0068857_102005162
1795 Ga0068854_100220685
1796 Ga0068854_100318935
1797 Ga0068854_100510511
1798 Ga0068856_100153210
1799 Ga0068856_100214217
1800 Ga0070702_100139069
1801 Ga0070702_100366717
1802 Ga0070702_101289676
1803 Ga0068852_100272341
1804 Ga0068852_100736259
1805 Ga0068852_101911305
1806 Ga0068859_100182455
1807 Ga0068859_100896263
1808 Ga0068864_100072800
1809 Ga0068864_100720384
1810 Ga0068864_101575851
1811 Ga0068864_102297957
1812 Ga0068866_10591778
1813 Ga0068866_10925786
1814 Ga0068866_11048836
1815 Ga0068861_100094678
1816 Ga0068861_101262469
1817 Ga0068851_10390861
1818 Ga0068870_10083098
1819 Ga0068870_10145766
1820 Ga0068870_10343491
1821 Ga0068870_10438401
1822 Ga0068863_100395589
1823 Ga0068863_101791611
1824 Ga0068858_100166781
1825 Ga0068860_100570754
1826 Ga0068862_100305469
1827 Ga0081455_10002616
1828 Ga0081455_10003194
1829 Ga0081455_10020838
1830 Ga0081455_10028494
1831 Ga0081455_10034787
1832 Ga0081455_10052915
1833 Ga0081455_10054190
1834 Ga0081455_10057833
1835 Ga0081455_10073359
1836 Ga0081455_10254080
1837 Ga0081455_10262367
1838 Ga0081455_10359743
1839 Ga0081455_10757821
1840 Ga0081538_10000012
1841 Ga0081538_10000043
1842 Ga0081538_10000078
1843 Ga0081538_10001739
1844 Ga0081538_10003796
1845 Ga0081538_10006203
1846 Ga0081538_10012471
1847 Ga0081538_10018260
1848 Ga0081538_10024585
1849 Ga0081538_10028759
1850 Ga0081538_10040171
1851 Ga0081538_10040841
1852 Ga0081538_10052475
1853 Ga0081538_10069084
1854 Ga0081538_10171304
1855 Ga0081538_10208422
1856 Ga0081538_10259260
1857 Ga0081539_10001017
1858 Ga0081539_10001655
1859 Ga0081539_10008759
1860 Ga0081539_10091234
1861 Ga0070717_11680835
1862 Ga0075365_10095091
1863 Ga0075365_10124097
1864 Ga0075368_10052943
1865 Ga0075363_100023210
1866 Ga0075364_10003002
1867 Ga0075364_10524287
1868 Ga0075432_10001315
1869 Ga0075432_10156135
1870 Ga0075432_10269755
1871 Ga0070712_100045012
1872 Ga0070712_101596957
1873 Ga0075362_10079884
1874 Ga0075362_10685463
1875 Ga0075367_10009020
1876 Ga0075427_10013143
1877 Ga0075427_10057743
1878 Ga0068871_100222874
1879 Ga0068871_100531919
1880 Ga0068871_101565789
1881 Ga0068871_101881734
1882 Ga0068871_101915281
1883 Ga0068871_102036583
1884 Ga0075428_100012121
1885 Ga0075428_100014262
1886 Ga0075428_100056043
1887 Ga0075428_100152138
1888 Ga0075428_100507800
1889 Ga0075428_101023531
1890 Ga0075428_101074017
1891 Ga0075430_100078687
1892 Ga0075430_100189359
1893 Ga0075431_100056374
1894 Ga0075431_100155187
1895 Ga0075431_100634509
1896 Ga0075431_100698963
1897 Ga0075431_100722545
1898 Ga0075431_100727840
1899 Ga0075431_101058972
1900 Ga0075431_101122080
1901 Ga0075431_101272603
1902 Ga0075431_101468346
1903 Ga0075434_100684907
1904 Ga0075434_100973403
1905 Ga0075429_100023663
1906 Ga0075429_100173070
1907 Ga0075429_100185368
1908 Ga0075429_101116107
1909 Ga0075429_101287011
1910 Ga0068865_100090588
1911 Ga0068865_100959281
1912 Ga0068865_101155825
1913 Ga0075436_100291063
1914 Ga0097620_100182458
1915 Ga0097620_100896166
1916 Ga0075435_101418323
1917 Ga0105250_10323257
1918 Ga0105240_12458240
1919 Ga0111539_10004858
1920 Ga0111539_10009775
1921 Ga0111539_10027100
1922 Ga0111539_10029591
1923 Ga0111539_10281997
1924 Ga0111539_10286454
1925 Ga0111539_10590586
1926 Ga0111539_10783105
1927 Ga0111539_11211441
1928 Ga0111539_12252066
1929 Ga0105245_10061841
1930 Ga0105245_10073114
1931 Ga0105245_10091194
1932 Ga0105245_10207111
1933 Ga0105245_10709359
1934 Ga0105245_11182387
1935 Ga0105247_10310257
1936 Ga0114129_10019838
1937 Ga0114129_10034585
1938 Ga0114129_10042952
1939 Ga0114129_10194478
1940 Ga0114129_10271452
1941 Ga0114129_10532079
1942 Ga0114129_11802972
1943 Ga0114129_12206860
1944 Ga0105243_10152295
1945 Ga0105243_10716425
1946 Ga0105243_11038973
1947 Ga0105241_10426534
1948 Ga0105242_10140847
1949 Ga0105242_10228089
1950 Ga0105242_10465910
1951 Ga0105242_11156178
1952 Ga0105248_10177812
1953 Ga0105237_10153292
1954 Ga0105237_11848547
1955 Ga0105238_10496393
1956 Ga0105249_10030507
1957 Ga0105249_10272330
1958 Ga0105249_10498255
1959 Ga0105249_11296920
1960 Ga0105239_10158905
1961 Ga0105239_10279218
1962 Ga0105239_11377959
1963 Ga0105246_10257522
1964 Ga0105246_10327644
1965 Ga0105246_10563148
1966 Ga0105246_10639528
1967 Ga0105246_10893983
1968 Ga0105246_12443260
1969 Ga0157346_1013493
1970 Ga0157320_1013023
1971 Ga0157337_1025459
1972 Ga0157315_1032099
1973 Ga0157338_1046318
1974 Ga0154010_164487
1975 Ga0157373_10694481
1976 Ga0157373_10766196
1977 Ga0157371_10193809
1978 Ga0157371_10241696
1979 Ga0157370_10154684
1980 Ga0157370_11604569
1981 Ga0157369_10144031
1982 Ga0157374_10058527
1983 Ga0157374_10392480
1984 Ga0157374_11449660
1985 Ga0157378_10471694
1986 Ga0157378_11242545
1987 Ga0157378_12063731
1988 Ga0163162_10105023
1989 Ga0163162_10572753
1990 Ga0163162_11345383
1991 Ga0157372_10832749
1992 Ga0157372_10867950
1993 Ga0157372_11259598
1994 Ga0157375_10243699
1995 Ga0157375_10810502
1996 Ga0157375_13176261
1997 Ga0163163_10299612
1998 Ga0163163_10597244
1999 Ga0163163_11544366
2000 Ga0157380_10377392
2001 Ga0157380_10538822
2002 Ga0157380_11239550
2003 Ga0157380_11437455
2004 Ga0182008_10002863
2005 Ga0182008_10778774
2006 Ga0157377_10101653
2007 Ga0157377_10278226
2008 Ga0157379_10279969
2009 Ga0157379_11235946
2010 Ga0157379_11246767
2011 Ga0157376_10214746
2012 Ga0157376_10289074
2013 Ga0157376_10483767
2014 Ga0157376_10754898
2015 Ga0182007_10018713
2016 Ga0182005_1056312
2017 Ga0163161_10396685
2018 Ga0197907_10123201
2019 Ga0197907_10392146
2020 Ga0206355_1580130
2021 Ga0206351_10697763
2022 Ga0206354_10836039
2023 Ga0206354_11226363
2024 Ga0206353_10089638
2025 Ga0206353_10335316
2026 Ga0206353_10442328
2027 Ga0206353_10959623
2028 Ga0154015_1677257
2029 Ga0224712_10187199
2030 Ga0207655_1053832
2031 Ga0207682_10455960
2032 Ga0207642_10169498
2033 Ga0207642_10293511
2034 Ga0207688_10011358
2035 Ga0207688_10030354
2036 Ga0207647_10222784
2037 Ga0207685_10227462
2038 Ga0207645_10093656
2039 Ga0207645_10114835
2040 Ga0207645_10180877
2041 Ga0207645_10329572
2042 Ga0207643_10016941
2043 Ga0207643_10045405
2044 Ga0207643_10680655
2045 Ga0207705_10029629
2046 Ga0207705_10665598
2047 Ga0207705_11419235
2048 Ga0207705_11542694
2049 Ga0207684_10454540
2050 Ga0207684_10878479
2051 Ga0207684_10942191
2052 Ga0207707_10026096
2053 Ga0207707_10109194
2054 Ga0207707_10138023
2055 Ga0207707_10329499
2056 Ga0207707_10519161
2057 Ga0207707_11461571
2058 Ga0207671_10645058
2059 Ga0207693_10170033
2060 Ga0207693_10991540
2061 Ga0207660_10017811
2062 Ga0207660_10026727
2063 Ga0207660_10127350
2064 Ga0207660_10173935
2065 Ga0207660_10313371
2066 Ga0207660_10402713
2067 Ga0207662_10105715
2068 Ga0207662_10298434
2069 Ga0207657_10032675
2070 Ga0207657_10078394
2071 Ga0207657_10194906
2072 Ga0207657_10218387
2073 Ga0207657_10537251
2074 Ga0207657_11344692
2075 Ga0207649_10006584
2076 Ga0207649_10906933
2077 Ga0207652_10056627
2078 Ga0207652_10222124
2079 Ga0207652_10285733
2080 Ga0207652_10333662
2081 Ga0207652_10769610
2082 Ga0207652_11113788
2083 Ga0207646_10073193
2084 Ga0207646_10504248
2085 Ga0207646_10601954
2086 Ga0207681_10246541
2087 Ga0207694_10627374
2088 Ga0207694_10685448
2089 Ga0207650_10203293
2090 Ga0207650_11912781
2091 Ga0207659_10030117
2092 Ga0207659_10054344
2093 Ga0207659_11908055
2094 Ga0207687_10049558
2095 Ga0207687_10082716
2096 Ga0207687_10282006
2097 Ga0207687_10337689
2098 Ga0207687_10404579
2099 Ga0207687_10467295
2100 Ga0207687_11222853
2101 Ga0207687_11546652
2102 Ga0207664_10128515
2103 Ga0207664_10157072
2104 Ga0207664_11240979
2105 Ga0207690_10115023
2106 Ga0207690_10129614
2107 Ga0207690_11230683
2108 Ga0207690_11793153
2109 Ga0207706_10085744
2110 Ga0207706_10416761
2111 Ga0207706_11030380
2112 Ga0207686_10045133
2113 Ga0207686_10350076
2114 Ga0207709_10175971
2115 Ga0207709_10343731
2116 Ga0207709_10656432
2117 Ga0207709_10885908
2118 Ga0207709_11846071
2119 Ga0207670_10040829
2120 Ga0207669_10568405
2121 Ga0207669_10731804
2122 Ga0207669_11000376
2123 Ga0207669_11003924
2124 Ga0207704_10068690
2125 Ga0207704_10671958
2126 Ga0207704_10976900
2127 Ga0207704_11919578
2128 Ga0207665_10608374
2129 Ga0207691_10113414
2130 Ga0207691_10173183
2131 Ga0207691_10827928
2132 Ga0207691_11154287
2133 Ga0207711_10062058
2134 Ga0207711_11059163
2135 Ga0207711_11460134
2136 Ga0207689_10108289
2137 Ga0207689_10183159
2138 Ga0207689_11428205
2139 Ga0207661_10000297
2140 Ga0207661_10111178
2141 Ga0207661_10134616
2142 Ga0207661_10151127
2143 Ga0207661_10414770
2144 Ga0207661_11047459
2145 Ga0207661_11741760
2146 Ga0207679_10137123
2147 Ga0207679_10423302
2148 Ga0207679_10497385
2149 Ga0207667_10486862
2150 Ga0207667_12138103
2151 Ga0207651_10250545
2152 Ga0207651_11353330
2153 Ga0207712_10077189
2154 Ga0207712_10208411
2155 Ga0207668_11134409
2156 Ga0207640_10194056
2157 Ga0207640_10215126
2158 Ga0207640_10551475
2159 Ga0207640_11427667
2160 Ga0207658_10418135
2161 Ga0207677_10127492
2162 Ga0207677_11202843
2163 Ga0207677_11473392
2164 Ga0207703_10147744
2165 Ga0207703_12226423
2166 Ga0207639_10074514
2167 Ga0207639_10152500
2168 Ga0207639_10355232
2169 Ga0207678_10115328
2170 Ga0207678_10211598
2171 Ga0207678_11909723
2172 Ga0207708_10010855
2173 Ga0207708_10037820
2174 Ga0207708_10147104
2175 Ga0207708_10322502
2176 Ga0207708_10646720
2177 Ga0207702_10045112
2178 Ga0207702_12373241
2179 Ga0207641_10515974
2180 Ga0207648_10029997
2181 Ga0207648_10122453
2182 Ga0207648_10308320
2183 Ga0207648_10866927
2184 Ga0207648_10960126
2185 Ga0207648_11170023
2186 Ga0207648_12296287
2187 Ga0207676_10279581
2188 Ga0207676_10637188
2189 Ga0207676_10866072
2190 Ga0207676_11255334
2191 Ga0207674_10003542
2192 Ga0207674_10021743
2193 Ga0207674_10027993
2194 Ga0207674_10546103
2195 Ga0207674_11102424
2196 Ga0207675_100032371
2197 Ga0207675_101836748
2198 Ga0207675_102413653
2199 Ga0207683_10161641
2200 Ga0207683_10288215
2201 Ga0207683_10967292
2202 Ga0207698_10067992
2203 Ga0207698_10239871
2204 Ga0207698_11688456
2205 Ga0209968_1040220
2206 Ga0209998_10007307
2207 Ga0209998_10188806
2208 Ga0209813_10014831
2209 Ga0207428_10000383
2210 Ga0207428_10006260
2211 Ga0207428_10008443
2212 Ga0207428_10020204
2213 Ga0207428_10042121
2214 Ga0207428_10100929
2215 Ga0207428_11132955
2216 Ga0268266_11544650
2217 Ga0268265_10970772
2218 Ga0268265_12678342
2219 Ga0268264_10729446
2220 Ga0265318_10071394
2221 Ga0265318_10189202
2222 Ga0265320_10407494
2223 Ga0265340_10059264
2224 Ga0265327_10075516
2225 Ga0307408_100076490
2226 Ga0307408_100265431
2227 Ga0307408_100631735
2228 Ga0307408_100899569
2229 Ga0307408_101255351
2230 Ga0307408_101521112
2231 Ga0307408_101869845
2232 Ga0307408_102393452
2233 Ga0265313_10075834
2234 Ga0307405_10051501
2235 Ga0307405_10357736
2236 Ga0307405_10718129
2237 Ga0307405_10972912
2238 Ga0307413_10005458
2239 Ga0307413_10103776
2240 Ga0307413_10486934
2241 Ga0307413_10919490
2242 Ga0307413_11689474
2243 Ga0307410_10030671
2244 Ga0307410_10642688
2245 Ga0307410_11881654
2246 Ga0307406_10016045
2247 Ga0307406_10105772
2248 Ga0307406_10165556
2249 Ga0307406_10378626
2250 Ga0307407_10012114
2251 Ga0307407_10300042
2252 Ga0307407_11528664
2253 Ga0307412_10028974
2254 Ga0307412_10029849
2255 Ga0307409_100036492
2256 Ga0307409_100086421
2257 Ga0307409_100096436
2258 Ga0307409_100366724
2259 Ga0307409_100589136
2260 Ga0307409_100630486
2261 Ga0307409_101699430
2262 Ga0307409_102060963
2263 Ga0307409_102285266
2264 Ga0307416_100003117
2265 Ga0307416_100045042
2266 Ga0307416_100068677
2267 Ga0307416_100112163
2268 Ga0307416_100197351
2269 Ga0307416_100417306
2270 Ga0307416_100631219
2271 Ga0307416_100673454
2272 Ga0307416_100755099
2273 Ga0307416_101366230
2274 Ga0307411_10020345
2275 Ga0307415_100002861
2276 Ga0307415_100029740
2277 Ga0307415_100118554
2278 Ga0307415_100168897
2279 Ga0307415_100655885
2280 Ga0373950_0084939
2281 Ga0373959_0066549
2282 Ga0373928_0041237
2283 Ga0373949_0143321
2284 Ga0373941_0058241
2285 Ga0373953_0108946
2286 Ga0373960_0017129
2287 Ga0373955_0906984
2288 Ga0373942_0260720
2289 Ga0373962_0365427
2290 Ga0373931_0107781
2291 Ga0373933_0057580
2292 Ga0373937_0010090
2293 Ga0395899_0002627
2294 Ga0395899_0007615
2295 Ga0395899_0009566
2296 Ga0395899_0022065
2297 Ga0395899_0038109
2298 Ga0395899_0047261
2299 Ga0395899_0051194
2300 Ga0395899_0052759
2301 Ga0395899_0077455
2302 Ga0395899_0081383
2303 Ga0395900_0001846
2304 Ga0395900_0009429
2305 Ga0395900_0013373
2306 Ga0395900_0018988
2307 Ga0395900_0029483
2308 Ga0395900_0036371
2309 Ga0395900_0044072
2310 Ga0395900_0070500
2311 Ga0395900_0091363
2312 Ga0395900_0092038
2313 Ga0395900_0177306
2314 Ga0395900_0213443
2315 Ga0395900_0231275
2316 Ga0395900_0278004
2317 Ga0395900_0532104
2318 Ga0395900_0637198
2319 Ga0395900_0706805
2320 Ga0395900_0840105
2321 Ga0395900_0926663
2322 Ga0395900_1084601
2323 Ga0395900_1427707
2324 Ga0395898_0005570
2325 Ga0395898_0026680
2326 Ga0395898_0033109
2327 Ga0395898_0035313
2328 Ga0395898_0035595
2329 Ga0395898_0040518
2330 Ga0395898_0069894
2331 Ga0395898_0112977
2332 Ga0395898_0145358
2333 Ga0395898_0178520
2334 Ga0395898_0208555
2335 Ga0395898_0210759
2336 Ga0395898_0223818
2337 Ga0395898_0291811
2338 Ga0395898_0295351
2339 Ga0395898_0304188
2340 Ga0395898_0634839
2341 Ga0395898_0685312
2342 Ga0395898_0991720
2343 Ga0395898_1229414
2344 Ga0395898_1367412
2345 Ga0395898_1588481
2346 Ga0395905_0004008
2347 Ga0395905_0010346
2348 Ga0395905_0011656
2349 Ga0395905_0025570
2350 Ga0395905_0031491
2351 Ga0395905_0037383
2352 Ga0395905_0053318
2353 Ga0395905_0096239
2354 Ga0395905_0177897
2355 Ga0395905_0310604
2356 Ga0395905_0528232
2357 Ga0395905_0567972
2358 Ga0395901_0009445
2359 Ga0395901_0015959
2360 Ga0395901_0018845
2361 Ga0395901_0033635
2362 Ga0395901_0038276
2363 Ga0395901_0059703
2364 Ga0395901_0063865
2365 Ga0395901_0083377
2366 Ga0395901_0094138
2367 Ga0395901_0162709
2368 Ga0395901_0224018
2369 Ga0395901_0316432
2370 Ga0395901_0344580
2371 Ga0395901_0402782
2372 Ga0395901_0968412
2373 Ga0395901_1220753
2374 Ga0395901_1258385
2375 Ga0395901_1510270
2376 Ga0395901_1776392
2377 Ga0395901_1995259
2378 Ga0436360_0951681
2379 Ga0436360_1157905
2380 Ga0436363_0888617
2381 Ga0436363_1488566
2382 Ga0436362_0754288
2383 Ga0439438_095989
2384 Ga0439438_096486
2385 Ga0439439_0010319
2386 Ga0439439_0160852
2387 Ga0439439_0178182
2388 Ga0439461_0000619
2389 Ga0439461_0037683
2390 Ga0439466_0020576
2391 Ga0439466_0034957
2392 Ga0439465_0079624
2393 Ga0439465_0252795
2394 Ga0451787_498795
2395 Ga0451800_1006391
2396 Ga0451802_1694304
2397 Ga0451807_0378497
2398 Ga0451833_0670140
2399 Ga0451843_1366079
2400 Ga0451853_0882388
2401 Ga0439431_0014907
2402 Ga0439431_0260470
2403 Ga0439433_0095913
2404 Ga0439433_0106392
2405 Ga0439437_004317
2406 Ga0439441_029176
2407 Ga0439442_025999
2408 Ga0439445_0012137
2409 Ga0439445_0025725
2410 Ga0439445_0179855
2411 Ga0439448_0030851
2412 Ga0439448_0085420
2413 Ga0439448_0235799
2414 Ga0439432_052677
2415 Ga0439432_133780
2416 Ga0439449_0031177
2417 Ga0439450_123045
2418 Ga0439451_005011
2419 Ga0439451_122909
2420 Ga0439452_081638
2421 Ga0439454_010851
2422 Ga0439454_011510
2423 Ga0439454_062647
2424 Ga0439456_054646
2425 Ga0439457_052188
2426 Ga0439457_076226
2427 Ga0439462_0001216
2428 Ga0439462_0023904
2429 Ga0439462_0146042
2430 Ga0439463_064454
2431 Ga0439463_210321
2432 Ga0450914_010151
2433 Ga0450915_002864
2434 Ga0450915_003205
2435 Ga0450920_007020
2436 Ga0450923_004638
2437 Ga0450888_008357
2438 Ga0450890_017802
2439 Ga0450898_025234
2440 Ga0450898_061645
2441 Ga0450898_133927
2442 Ga0450900_023403
2443 Ga0450902_060043
2444 Ga0450904_019231
2445 Ga0450907_013427
2446 Ga0450907_016232
2447 Ga0450907_018107
2448 Ga0450910_015813
2449 Ga0450910_084384
2450 Ga0439446_0001871
2451 Ga0439446_0002997
2452 Ga0439446_0067040
2453 Ga0439446_0074421
2454 Ga0439458_0128823
2455 Ga0450908_026382
2456 Ga0450908_109462
2457 Ga0450909_037546
2458 Ga0439434_0003699
2459 Ga0439434_0013912
2460 Ga0439434_0015819
2461 Ga0439434_0033142
2462 Ga0439435_0010298
2463 Ga0439435_0211134
2464 Ga0439435_0236384
2465 Ga0439459_0063100
2466 Ga0439464_0234559
2467 Ga0439460_0105236
2468 Ga0439460_0122681
2469 Ga0439460_0255701
2470 Ga0450918_041960
2471 Ga0450918_042988
2472 Ga0450918_065991
2473 Ga0450893_0044938
2474 Ga0466969_0187795
2475 Ga0466969_0372773
2476 Ga0466972_0087994
2477 Ga0466965_0677716
2478 Ga0466966_0007359
2479 Ga0466966_0020640
2480 Ga0466966_0090441
2481 Ga0466966_0096023
2482 Ga0466961_0025304
2483 Ga0466961_0088882
2484 Ga0466961_0104429
2485 Ga0466961_0631236
2486 Ga0466961_0846082
2487 Ga0466963_0002360
2488 Ga0466963_0004483
2489 Ga0466963_0138988
2490 Ga0466963_0175164
2491 Ga0466963_0196714
2492 Ga0466963_0211471
2493 Ga0466963_0367608
2494 Ga0466963_0371625
2495 Ga0466964_0049424
2496 Ga0466964_0061381
2497 Ga0466971_0201931
2498 Ga0466968_0202019
2499 Ga0466970_0433797
2500 Ga0466957_0016927
2501 Ga0466957_0135131
2502 Ga0466957_0147570
2503 Ga0466957_0249409
2504 Ga0466957_1104981
2505 Ga0466960_0045272
2506 Ga0466960_0084219
2507 Ga0466960_0178347
2508 Ga0466960_0591429
2509 Ga0466960_0625060
2510 Ga0466960_0767288
2511 Ga0466960_1051913
2512 Ga0466959_0008749
2513 Ga0451576_0115815
2514 Ga0451576_1587058
2515 Ga0466958_0004955
2516 Ga0466958_0015048
2517 Ga0466958_0036322
2518 Ga0466958_0136163
2519 Ga0466958_0138350
2520 Ga0466967_0006350
2521 Ga0466967_0016066
2522 Ga0466967_0067733
2523 Ga0466967_0180731
2524 Ga0466967_0263236
2525 Ga0466967_0326778
2526 Ga0466967_0413182
2527 Ga0466967_0445980
2528 Ga0466967_1311720
2529 Ga0495617_073853
2530 Ga0495592_0000888
2531 Ga0495592_0124100
2532 Ga0495603_0165183
2533 Ga0495603_0873762
2534 Ga0495590_0254741
2535 Ga0495591_047010
2536 Ga0495629_0252696
2537 Ga0495629_0852333
2538 Ga0495629_0900201
2539 Ga0495641_0503644
2540 Ga0495651_0000180
2541 Ga0495651_0600715
2542 Ga0495653_0002924
2543 Ga0495653_0635130
2544 Ga0495650_0189396
2545 Ga0495582_0568845
2546 Ga0495605_0032750
2547 Ga0495605_0288096
2548 Ga0495605_0308889
2549 Ga0495605_0437250
2550 Ga0495639_0295760
2551 Ga0495664_0263796
2552 Ga0495584_0178201
2553 Ga0495584_0582548
2554 Ga0495585_0056503
2555 Ga0495585_0461342
2556 Ga0495585_0600092
2557 Ga0495596_0058005
2558 Ga0495596_0075595
2559 Ga0495596_0121458
2560 Ga0495596_0240682
2561 Ga0495607_0107078
2562 Ga0495583_0243839
2563 Ga0495583_0292738
2564 Ga0495608_0001686
2565 Ga0495608_0336179
2566 Ga0495610_0316075
2567 Ga0495616_0054636
2568 Ga0495616_0210481
2569 Ga0495616_0316762
2570 Ga0495618_0012480
2571 Ga0495620_0022332
2572 Ga0495620_0345407
2573 Ga0495628_0000067
2574 Ga0495628_0788631
2575 Ga0495630_0081846
2576 Ga0495630_0404854
2577 Ga0495631_0054944
2578 Ga0495631_0084610
2579 Ga0495631_0269111
2580 Ga0495631_0444668
2581 Ga0495632_0142562
2582 Ga0495632_0520542
2583 Ga0495637_0092707
2584 Ga0495637_0170921
2585 Ga0495644_0305800
2586 Ga0495642_0009720
2587 Ga0495652_0000315
2588 Ga0495640_0946791
2589 Ga0495587_0000287
2590 Ga0495587_0216058
2591 Ga0495587_0324175
2592 Ga0495598_0032233
2593 Ga0495598_0081236
2594 Ga0495609_0214884
2595 Ga0495609_0356633
2596 Ga0495621_0031654
2597 Ga0495597_0046898
2598 Ga0495645_0000234
2599 Ga0495645_0115844
2600 Ga0495633_0036714
2601 Ga0495633_0372087
2602 Ga0495633_0417170
2603 Ga0495667_0051835
2604 Ga0495667_0060341
2605 Ga0495656_0144301
2606 Ga0495656_0240034
2607 Ga0495656_0312135
2608 Ga0495656_0707014
2609 Ga0495668_0126987
2610 Ga0495668_0333762
2611 Ga0495634_0146005
2612 Ga0495611_0379181
2613 Ga0495635_0298037
2614 Ga0495659_0005392
2615 Ga0495659_0177241
2616 Ga0495661_0073887
2617 Ga0495661_0306742
2618 Ga0495588_0191157
2619 Ga0495657_0030413
2620 Ga0495657_0034883
2621 Ga0495657_0414421
2622 Ga0495599_0000249
2623 Ga0495599_0875064
2624 Ga0495623_0000144
2625 Ga0495623_0257898
2626 Ga0495646_0000614
2627 Ga0495647_0331979
2628 Ga0495669_0051344
2629 Ga0495669_0292207
2630 Ga0495613_1014977
2631 Ga0495624_0954229
2632 Ga0495670_0094543
2633 Ga0495670_0443928
2634 Ga0495670_0445784
2635 Ga0495670_0790016
2636 Ga0495671_0141049
2637 Ga0495671_0434642
2638 Ga0495649_0198625
2639 Ga0495589_0040099
2640 Ga0495589_0091039
2641 Ga0495589_0129373
2642 Ga0495589_0377739
2643 Ga0495600_0190425
2644 Ga0495600_0195398
2645 Ga0495600_0584456
2646 Ga0495660_0077023
2647 Ga0495660_0255491
2648 Ga0495660_0336195
2649 Ga0495660_0382387
2650 Ga0495581_0186089
2651 Ga0495604_0000076
2652 Ga0495604_0224250
2653 Ga0495604_0666779
2654 Ga0495636_0043642
2655 Ga0495636_0426777
2656 Ga0495674_0323066
2657 Ga0495674_0677644
2658 Ga0495680_0056788
2659 Ga0495680_0151804
2660 Ga0495683_0021829
2661 Ga0495683_0424280
2662 Ga0495675_0015013
2663 Ga0495675_0175608
2664 Ga0495677_0014856
2665 Ga0495679_065970
2666 Ga0495679_134141
2667 Ga0495679_137826
2668 Ga0495685_034722
2669 Ga0495681_0028720
2670 Ga0495681_0226384
2671 Ga0495684_0020664
2672 Ga0495684_0897722
2673 Ga0495593_0601021
2674 Ga0495602_0000247
2675 Ga0495614_0329403
2676 Ga0495615_0013300
2677 Ga0495626_0241050
2678 Ga0496100_0175107
2679 Ga0496100_0303868
2680 Ga0496100_1538221
2681 Ga0496101_0078025
2682 Ga0496101_0841511
2683 Ga0496101_1169584
2684 Ga0496101_1326021
2685 Ga0496102_0615589
2686 Ga0496102_0759579
2687 Ga0496102_1213080
2688 Ga0496102_1418269
2689 Ga0496103_0192928
2690 Ga0496103_0384997
2691 Ga0496104_0003234
2692 Ga0496104_0158074
2693 Ga0496105_0083225
2694 Ga0496106_0212251
2695 Ga0496106_0374663
2696 Ga0496106_0847823
2697 Ga0496107_0096029
2698 Ga0496107_0098643
2699 Ga0496107_0445779
2700 Ga0496107_0791404
2701 Ga0496108_0004178
2702 Ga0496108_0018043
2703 Ga0496108_0044721
2704 Ga0496108_0123552
2705 Ga0496108_0173491
2706 Ga0496108_0185332
2707 Ga0496108_1161403
2708 Ga0496108_1794579
2709 Ga0496109_0005943
2710 Ga0496109_0011028
2711 Ga0496109_0030731
2712 Ga0496109_0102452
2713 Ga0496109_0198403
2714 Ga0496109_0420874
2715 Ga0496110_0004216
2716 Ga0496110_0027118
2717 Ga0496110_0350691
2718 Ga0496110_1385745
2719 Ga0496110_1520834
2720 Ga0496111_0000393
2721 Ga0496111_0007348
2722 Ga0496111_0090525
2723 Ga0496111_0236133
2724 Ga0496111_0451377
2725 Ga0496112_0124184
2726 Ga0496113_0014014
2727 Ga0496113_0133419
2728 Ga0496113_0345003
2729 Ga0496114_0049879
2730 Ga0496114_0190020
2731 Ga0496114_0271639
2732 Ga0496114_0556989
2733 Ga0496114_0792951
2734 Ga0496114_1029061
2735 Ga0496115_0255332
2736 Ga0501309_089122
2737 Ga0501307_038129
2738 Ga0501299_209127
2739 Ga0501311_036429
2740 Ga0501313_044581
2741 Ga0501316_071380
2742 Ga0501317_085189
2743 Ga0501321_039901
2744 Ga0501031_0000706
2745 Ga0501031_0005850
2746 Ga0501031_0043735
2747 Ga0501031_0050750
2748 Ga0501031_0110681
2749 Ga0501031_0130436
2750 Ga0501031_0130858
2751 Ga0501031_0187617
2752 Ga0501031_0198994
2753 Ga0501031_0200654
2754 Ga0501031_0530971
2755 Ga0501031_0701890
2756 Ga0501031_0794061
2757 Ga0501031_0921361
2758 Ga0501032_0016227
2759 Ga0501032_0018329
2760 Ga0501032_0047603
2761 Ga0501032_0114899
2762 Ga0501032_0152060
2763 Ga0501032_0717000
2764 Ga0501033_0010945
2765 Ga0501033_0170851
2766 Ga0501033_0260823
2767 Ga0501033_0312085
2768 Ga0501033_0331947
2769 Ga0501033_0353750
2770 Ga0501033_1188061
2771 Ga0501034_0005653
2772 Ga0501034_0195508
2773 Ga0501034_0283514
2774 Ga0501034_0755012
2775 Ga0501034_1028107
2776 Ga0501034_1444928
2777 Ga0501036_0003757
2778 Ga0501036_0007382
2779 Ga0501036_0035879
2780 Ga0501036_0062512
2781 Ga0501036_0113188
2782 Ga0501036_0121770
2783 Ga0501036_0124465
2784 Ga0501036_0150408
2785 Ga0501036_0337166
2786 Ga0501036_0631634
2787 Ga0501036_0780228
2788 Ga0501037_0006885
2789 Ga0501037_0023639
2790 Ga0501037_0119963
2791 Ga0501037_0144876
2792 Ga0501037_0257106
2793 Ga0501037_0327762
2794 Ga0501037_0735831
2795 Ga0501037_1075436
2796 Ga0501038_0001115
2797 Ga0501038_0009144
2798 Ga0501038_0013764
2799 Ga0501038_0018951
2800 Ga0501038_0028196
2801 Ga0501038_0157363
2802 Ga0501038_0234398
2803 Ga0501039_0000660
2804 Ga0501039_0007924
2805 Ga0501039_0008099
2806 Ga0501039_0033291
2807 Ga0501039_0041562
2808 Ga0501039_0049372
2809 Ga0501039_0053511
2810 Ga0501039_0074546
2811 Ga0501039_0086913
2812 Ga0501039_0266870
2813 Ga0501039_0511975
2814 Ga0501039_1227992
2815 Ga0501039_1266092
2816 Ga0501040_0000728
2817 Ga0501040_0006365
2818 Ga0501040_0010406
2819 Ga0501040_0017443
2820 Ga0501040_0040218
2821 Ga0501040_0054331
2822 Ga0501040_0106290
2823 Ga0501040_0208933
2824 Ga0501040_0244845
2825 Ga0501040_0315473
2826 Ga0501041_0003781
2827 Ga0501041_0003881
2828 Ga0501041_0008611
2829 Ga0501041_0013072
2830 Ga0501041_0014750
2831 Ga0501041_0051949
2832 Ga0501041_0064403
2833 Ga0501041_0107124
2834 Ga0501041_0620415
2835 Ga0501041_0903048
2836 Ga0501042_0002963
2837 Ga0501042_0007578
2838 Ga0501042_0011188
2839 Ga0501042_0031230
2840 Ga0501042_0047422
2841 Ga0501042_0061732
2842 Ga0501042_0084864
2843 Ga0501042_0092038
2844 Ga0501042_0106568
2845 Ga0501042_0126877
2846 Ga0501042_0159818
2847 Ga0501042_0586818
2848 Ga0501042_0755061
2849 Ga0501043_0007842
2850 Ga0501043_0008472
2851 Ga0501043_0128791
2852 Ga0501043_0196146
2853 Ga0501043_0213485
2854 Ga0501043_0285585
2855 Ga0501043_0316327
2856 Ga0501043_0770107
2857 Ga0501043_0833945
2858 Ga0501046_0002216
2859 Ga0501046_0002233
2860 Ga0501046_0002756
2861 Ga0501046_0015022
2862 Ga0501046_0078455
2863 Ga0501046_0086060
2864 Ga0501046_0163140
2865 Ga0501046_0199904
2866 Ga0501046_0227262
2867 Ga0501046_1204015
2868 Ga0501047_0038295
2869 Ga0501047_0350502
2870 Ga0501047_0593094
2871 Ga0501047_0900163
2872 Ga0501047_1243881
2873 Ga0501048_0000617
2874 Ga0501048_0002324
2875 Ga0501048_0012572
2876 Ga0501048_0021108
2877 Ga0501048_0028857
2878 Ga0501048_0043110
2879 Ga0501048_0124224
2880 Ga0501048_0129074
2881 Ga0501048_0186683
2882 Ga0501048_0197091
2883 Ga0501048_0552426
2884 Ga0501048_0804473
2885 Ga0501067_0017114
2886 Ga0501067_0093111
2887 Ga0501067_0124694
2888 Ga0501067_0363775
2889 Ga0501067_0861478
2890 Ga0501068_0001134
2891 Ga0501068_0002686
2892 Ga0501068_0004047
2893 Ga0501068_0007077
2894 Ga0501068_0008085
2895 Ga0501068_0127889
2896 Ga0501068_0310113
2897 Ga0501068_0364679
2898 Ga0501068_0626840
2899 Ga0501068_1117055
2900 Ga0501069_0000780
2901 Ga0501069_0011537
2902 Ga0501069_0041592
2903 Ga0501069_0079749
2904 Ga0501069_0098152
2905 Ga0501069_0113580
2906 Ga0501069_0152224
2907 Ga0501069_0464503
2908 Ga0501069_0634701
2909 Ga0501069_0645376
2910 Ga0501070_0000228
2911 Ga0501070_0001876
2912 Ga0501070_0008739
2913 Ga0501070_0033133
2914 Ga0501070_0087975
2915 Ga0501070_0137763
2916 Ga0501070_0208137
2917 Ga0501070_0211776
2918 Ga0501070_0298423
2919 Ga0501070_0315026
2920 Ga0501070_0826016
2921 Ga0501071_0000685
2922 Ga0501071_0002630
2923 Ga0501071_0006021
2924 Ga0501071_0012211
2925 Ga0501071_0014054
2926 Ga0501071_0023786
2927 Ga0501071_0034268
2928 Ga0501071_0061882
2929 Ga0501071_0085528
2930 Ga0501071_0132942
2931 Ga0501071_0308489
2932 Ga0501072_0002801
2933 Ga0501072_0003033
2934 Ga0501072_0011260
2935 Ga0501072_0012221
2936 Ga0501072_0020766
2937 Ga0501072_0033632
2938 Ga0501072_0045270
2939 Ga0501072_0046765
2940 Ga0501072_0080308
2941 Ga0501072_0140886
2942 Ga0501072_0261462
2943 Ga0501072_0557566
2944 Ga0501072_1517923
2945 Ga0501073_0005554
2946 Ga0501073_0014941
2947 Ga0501073_0049645
2948 Ga0501073_0090217
2949 Ga0501073_0188182
2950 Ga0501073_0387582
2951 Ga0501073_0741584
2952 Ga0501074_0003167
2953 Ga0501074_0006117
2954 Ga0501074_0024769
2955 Ga0501074_0030506
2956 Ga0501074_0031566
2957 Ga0501074_0049675
2958 Ga0501074_0050747
2959 Ga0501074_0066485
2960 Ga0501074_0200675
2961 Ga0501074_0350004
2962 Ga0501074_0358527
2963 Ga0501074_0376633
2964 Ga0501075_0002269
2965 Ga0501075_0002789
2966 Ga0501075_0004313
2967 Ga0501075_0028435
2968 Ga0501075_0033104
2969 Ga0501075_0072302
2970 Ga0501075_0079288
2971 Ga0501075_0146953
2972 Ga0501075_0157384
2973 Ga0501075_0343485
2974 Ga0501075_0448898
2975 Ga0501075_0466387
2976 Ga0501076_0004978
2977 Ga0501076_0006009
2978 Ga0501076_0008482
2979 Ga0501076_0026676
2980 Ga0501076_0055715
2981 Ga0501076_0060208
2982 Ga0501076_0205267
2983 Ga0501076_0249700
2984 Ga0501076_0286542
2985 Ga0501076_0357020
2986 Ga0501076_0592464
2987 Ga0501076_1450927
2988 Ga0501076_1692532
2989 Ga0501077_0001985
2990 Ga0501077_0003454
2991 Ga0501077_0006318
2992 Ga0501077_0007003
2993 Ga0501077_0028663
2994 Ga0501077_0048061
2995 Ga0501077_0053496
2996 Ga0501077_0069297
2997 Ga0501077_0112153
2998 Ga0501077_0114771
2999 Ga0501077_0159140
3000 Ga0501077_0629607
3001 Ga0501202_176455
3002 Ga0501209_135717
3003 Ga0501217_038277
3004 Ga0501250_077797
3005 Ga0501221_090447
3006 Ga0501225_0199859
3007 Ga0501079_0009194
3008 Ga0501079_0009863
3009 Ga0501079_0010403
3010 Ga0501079_0011677
3011 Ga0501079_0012010
3012 Ga0501079_0018239
3013 Ga0501079_0021266
3014 Ga0501079_0039464
3015 Ga0501079_0084134
3016 Ga0501079_0402774
3017 Ga0501079_0517321
3018 Ga0501079_0751924
3019 Ga0501079_0992209
3020 Ga0501080_0000687
3021 Ga0501080_0011018
3022 Ga0501080_0014808
3023 Ga0501080_0026542
3024 Ga0501080_0047984
3025 Ga0501080_0081841
3026 Ga0501080_0191276
3027 Ga0501080_0193342
3028 Ga0501080_0251632
3029 Ga0501080_0298839
3030 Ga0501080_0835999
3031 Ga0501080_1252278
3032 Ga0501080_1401592
3033 Ga0501081_0006037
3034 Ga0501081_0009846
3035 Ga0501081_0013639
3036 Ga0501081_0024363
3037 Ga0501081_0032565
3038 Ga0501081_0053343
3039 Ga0501081_0057178
3040 Ga0501081_0098245
3041 Ga0501081_0107555
3042 Ga0501081_0107891
3043 Ga0501081_0249040
3044 Ga0501081_0618732
3045 Ga0501081_0658164
3046 Ga0501081_1173792
3047 Ga0501081_1347264
3048 Ga0501081_1436817
3049 Ga0501083_0003918
3050 Ga0501083_0017267
3051 Ga0501083_0029656
3052 Ga0501083_0111615
3053 Ga0501083_0224550
3054 Ga0501083_0247615
3055 Ga0501083_0390078
3056 Ga0501083_0398302
3057 Ga0501232_087354
3058 Ga0501035_0008085
3059 Ga0501035_0010116
3060 Ga0501035_0012955
3061 Ga0501035_0050133
3062 Ga0501035_0053961
3063 Ga0501035_0292594
3064 Ga0501035_0537620
3065 Ga0501035_0618421
3066 Ga0501035_0853709
3067 Ga0501035_0862448
3068 Ga0501035_1437911
3069 Ga0501044_0041203
3070 Ga0501044_0215535
3071 Ga0501044_0348769
3072 Ga0501044_0368140
3073 Ga0501044_0493580
3074 Ga0501044_0702883
3075 Ga0501044_0989473
3076 Ga0501044_1301276
3077 Ga0501044_1600370
3078 Ga0501045_0000889
3079 Ga0501045_0015968
3080 Ga0501045_0030153
3081 Ga0501045_0046781
3082 Ga0501045_0083831
3083 Ga0501045_0141450
3084 Ga0501045_0180380
3085 Ga0501045_0186675
3086 Ga0501045_0211782
3087 Ga0501045_0231679
3088 Ga0501045_0318865
3089 Ga0501045_0808293
3090 Ga0501045_0899709
3091 Ga0501045_1035687
3092 nmdc:mga03683_43872_c1
3093 nmdc:mga03n38_43033_c1
3094 nmdc:mga00v17_31108_c1
3095 nmdc:mga00v17_679630_c1
3096 nmdc:mga06z11_7934_c1
3097 nmdc:mga04h51_40534_c1
3098 nmdc:mga07m45_404071_c1
3099 nmdc:mga05p37_10711_c2
3100 nmdc:mga05p37_1181908_c1
3101 nmdc:mga05p37_1183477_c1
3102 nmdc:mga05p37_1316290_c1
3103 nmdc:mga05p37_1437251_c1
3104 nmdc:mga05p37_25601_c1
3105 nmdc:mga05p37_29029_c1
3106 nmdc:mga05p37_318209_c1
3107 nmdc:mga05p37_337656_c1
3108 nmdc:mga05p37_397655_c1
3109 nmdc:mga09592_153275_c1
3110 nmdc:mga09592_32167_c1
3111 nmdc:mga09592_406858_c1
3112 nmdc:mga09592_461313_c1
3113 nmdc:mga0qj67_209656_c1
3114 nmdc:mga0qj67_22113_c1
3115 nmdc:mga0qj67_248987_c1
3116 nmdc:mga0qj67_448264_c1
3117 nmdc:mga06r32_1064713_c1
3118 nmdc:mga06r32_1083178_c1
3119 nmdc:mga06r32_1087252_c1
3120 nmdc:mga06r32_1300502_c1
3121 nmdc:mga06r32_365238_c1
3122 nmdc:mga06r32_399914_c1
3123 nmdc:mga06r32_87639_c1
3124 nmdc:mga08y16_115790_c1
3125 nmdc:mga08y16_12151_c1
3126 nmdc:mga08y16_1371276_c1
3127 nmdc:mga08y16_1510353_c1
3128 nmdc:mga08y16_167946_c1
3129 nmdc:mga08y16_241148_c1
3130 nmdc:mga08y16_290212_c1
3131 nmdc:mga08y16_35922_c1
3132 nmdc:mga08y16_842521_c1
3133 nmdc:mga08y16_85910_c1
3134 nmdc:mga0n895_118056_c1
3135 nmdc:mga0n895_711023_c1
3136 nmdc:mga0n895_856944_c1
3137 nmdc:mga0rr50_1528052_c1
3138 nmdc:mga08x19_62128_c1
3139 nmdc:mga0a205_30337_c1
3140 nmdc:mga0a205_859819_c1
3141 Ga0495601_0000119
3142 Ga0495601_0160937
3143 Ga0495601_0182712
3144 Ga0495612_0037524
3145 Ga0495612_0338613
3146 Ga0495655_0078624
3147 Ga0495655_0174116
3148 Ga0495595_0043685
3149 Ga0495595_0073389
3150 Ga0495619_0043034
3151 Ga0495619_0094354
3152 Ga0495619_0162255
3153 Ga0495619_0444094
3154 Ga0500628_143221
3155 Ga0501084_0006705
3156 Ga0501084_0015070
3157 Ga0501084_0021021
3158 Ga0501084_0022756
3159 Ga0501084_0035380
3160 Ga0501084_0041810
3161 Ga0501084_0067605
3162 Ga0501084_0137687
3163 Ga0501084_0167054
3164 Ga0501084_0269893
3165 Ga0501084_0277355
3166 Ga0501084_0303103
3167 Ga0501084_0758704
3168 Ga0501084_0874450
3169 Ga0501084_0889162
3170 Ga0501084_1102419
3171 Ga0501084_1321544
3172 Ga0590071_008391
3173 Ga0590074_005887
3174 Ga0590074_043475
3175 Ga0590075_003803
3176 Ga0590075_011346
3177 Ga0590075_056847
3178 Ga0590075_061790
3179 Ga0590075_100119
3180 Ga0590077_008165
3181 Ga0590077_049431
3182 Ga0590077_141001
3183 Ga0587084_021635
3184 Ga0587066_224931
3185 Ga0587070_143489
3186 Ga0587073_0058787
3187 Ga0587077_086997
3188 Ga0587080_076237
3189 Ga0587082_048084
3190 Ga0587083_0116683
3191 Ga0587088_063051
3192 Ga0587090_055926
3193 Ga0587091_072441
3194 Ga0587091_163838
3195 Ga0587067_129796
3196 Ga0587067_167217
3197 Ga0587068_131767
3198 Ga0587072_074232
3199 Ga0587076_067718
3200 Ga0587079_047322
3201 Ga0587079_223223
3202 Ga0501082_0003225
3203 Ga0501082_0010945
3204 Ga0501082_0081803
3205 Ga0501082_0082153
3206 Ga0501082_0088602
3207 Ga0501082_0177062
3208 Ga0501082_0201280
3209 Ga0501082_0216899
3210 Ga0501082_0651756
3211 Ga0501082_0768575
3212 Ga0501082_1028068
3213 Ga0501082_1396608
3214 Ga0466962_0087611
3215 Ga0466962_0089723
3216 Ga0530510_0006136
3217 Ga0530510_0008550
3218 Ga0530510_0012893
3219 Ga0530510_0013117
3220 Ga0530510_0028782
3221 Ga0530510_0032815
3222 Ga0530510_0044977
3223 Ga0530510_0234248
3224 Ga0530510_0390463
3225 Ga0530510_0437995
3226 Ga0530510_0558206
3227 Ga0530510_0566661
3228 Ga0530510_1151769

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00137

ATP-synt_C

ATP synthase subunit C

17

69

0.91

Map