F494796

General Info

Members Datasets Scaffolds Average Seq Length
1567 421 3134 82

Family's Representative Sequence

Representative Sequence 3300005548|Ga0070665_101648752|Ga0070665_1016487521
Length 98
Sequence VLREPAERTAAVSTERTRVEPLPDLGKLSDDELKKLIDDLTHEEQEVSYRRRLLHGKIDILRAELVARLQKSGGKSVLEQVDMDALTDILAGKAAPPG

Samples

Sample ID Description Type Environment
1 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
2 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
3 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
6 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
7 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
31 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
32 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
33 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
34 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
35 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
36 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
37 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
38 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
39 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
40 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
41 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
42 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
43 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
44 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
45 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
46 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
47 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
48 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
49 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
50 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
51 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
52 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
53 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
54 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
55 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
56 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
57 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
58 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
59 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
60 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
61 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
62 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
63 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
64 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
65 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
66 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
67 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
68 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
69 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
70 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
71 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
72 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
73 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
74 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
75 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
76 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
77 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
78 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
79 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
80 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
81 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
82 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
83 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
84 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
85 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
86 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
87 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
88 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
89 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
90 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
91 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
92 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
93 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
94 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
95 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
96 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
97 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
98 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
99 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
100 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
101 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
102 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
103 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
104 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
105 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
106 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
107 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
108 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
109 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
110 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
111 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
112 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
113 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
114 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
115 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
116 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
117 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
118 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
119 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
120 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
121 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
122 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
123 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
124 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
125 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
126 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
127 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
128 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
129 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
130 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
131 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
132 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
133 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
134 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
135 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
136 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
137 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
138 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
139 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
140 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
141 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
142 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
143 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
144 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
206 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
210 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
211 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
212 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
213 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
214 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
215 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
216 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
217 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
218 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
219 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
220 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
221 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
222 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
223 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
224 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
225 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
226 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
227 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
228 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
229 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
230 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
231 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
232 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
233 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
234 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
235 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
236 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
237 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
238 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
239 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
240 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
241 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
242 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
243 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
244 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
245 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
246 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
247 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
248 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
249 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
250 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
251 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
252 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
253 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
254 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
255 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
256 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
257 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
258 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
259 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
260 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
261 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
262 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
263 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
264 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
265 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
266 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
267 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
268 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
269 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
270 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
271 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
272 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
273 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
274 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
275 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
276 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
277 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
278 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
279 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
280 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
281 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
282 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
283 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
284 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
285 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
286 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
287 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
288 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
289 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
290 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
291 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
292 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
293 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
294 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
295 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
296 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
297 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
298 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
299 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
300 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
301 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
302 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
303 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
304 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
305 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
306 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
307 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
308 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
309 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
310 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
311 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
312 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
313 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
314 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
315 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
316 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
317 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
318 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
319 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
320 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
321 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
322 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
323 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
324 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
325 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
326 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
327 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
328 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
329 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
330 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
331 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
332 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
333 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
334 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
335 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
336 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
337 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
338 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
339 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
340 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
341 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
342 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
343 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
344 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
345 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
346 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
347 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
348 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
349 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
350 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
351 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
352 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
353 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
354 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
355 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
356 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
357 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
358 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
359 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
360 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
361 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
362 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
363 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
364 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
365 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
366 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
367 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
368 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
369 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
370 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
371 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
372 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
373 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
374 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
375 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
376 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
377 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
378 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
379 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
380 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
381 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
382 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
383 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
384 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
385 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
386 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
387 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
388 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
389 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
390 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
391 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
392 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
393 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
394 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
395 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
396 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
397 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
398 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
399 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
400 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
401 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
402 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
403 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
404 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
405 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
406 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
407 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
408 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
409 3300053728 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 endosphere Metagenome Endosphere
410 3300059478 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
411 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
412 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
413 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
414 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
415 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
416 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
417 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
418 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
419 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
420 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
421 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.49
Metatranscriptomes 3.51
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.77
Nodule 0
Rhizoplane 8.23
Rhizosphere 90.17
Stem 0
Stem Tuber 0
Unclassified 7.47

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070665_101648752 3300005548 Bacteria 649
2 JGI24745J21846_1044921 3300002073 Unclassified 552
3 JGI24751J29686_10093367 3300002459 Bacteria 626
4 JGI25406J46586_10074125 3300003203 Bacteria 1060
5 JGI25407J50210_10001838 3300003373 Bacteria 4908
6 JGI25407J50210_10050282 3300003373 Bacteria 1057
7 Ga0058860_11557948 3300004801 Bacteria 641
8 Ga0058862_12802645 3300004803 Bacteria 524
9 Ga0070658_10028387 3300005327 Bacteria 4491
10 Ga0070658_10055724 3300005327 Bacteria 3212
11 Ga0070658_10241315 3300005327 Bacteria 1532
12 Ga0070658_10874173 3300005327 Bacteria 781
13 Ga0070658_10928036 3300005327 Bacteria 757
14 Ga0070658_11669185 3300005327 Bacteria 552
15 Ga0070676_10329984 3300005328 Bacteria 1043
16 Ga0070683_100001516 3300005329 Bacteria 17949
17 Ga0070683_100029653 3300005329 Bacteria 4957
18 Ga0070683_100035623 3300005329 Bacteria 4549
19 Ga0070683_100111966 3300005329 Bacteria 2575
20 Ga0070683_100171298 3300005329 Unclassified 2061
21 Ga0070683_100376993 3300005329 Bacteria 1352
22 Ga0070683_100380765 3300005329 Bacteria 1344
23 Ga0070683_100634376 3300005329 Bacteria 1023
24 Ga0070683_101285424 3300005329 Bacteria 703
25 Ga0070690_100122327 3300005330 Bacteria 1748
26 Ga0068869_100207731 3300005334 Bacteria 1547
27 Ga0070666_10345719 3300005335 Bacteria 1064
28 Ga0070680_100039688 3300005336 Bacteria 3808
29 Ga0070680_100045740 3300005336 Bacteria 3559
30 Ga0070680_100076876 3300005336 Bacteria 2749
31 Ga0070680_100308652 3300005336 Bacteria 1342
32 Ga0070680_100354486 3300005336 Bacteria 1248
33 Ga0070680_100444143 3300005336 Bacteria 1108
34 Ga0070680_100814745 3300005336 Bacteria 805
35 Ga0070682_100030117 3300005337 Bacteria 3273
36 Ga0070682_100039818 3300005337 Bacteria 2889
37 Ga0070682_100161528 3300005337 Bacteria 1548
38 Ga0070682_100412646 3300005337 Unclassified 1024
39 Ga0070682_100691774 3300005337 Unclassified 816
40 Ga0068868_100029603 3300005338 Bacteria 4194
41 Ga0068868_100196838 3300005338 Bacteria 1678
42 Ga0068868_100647292 3300005338 Bacteria 941
43 Ga0068868_100817442 3300005338 Unclassified 842
44 Ga0070660_100004468 3300005339 Bacteria 9669
45 Ga0070660_100012056 3300005339 Bacteria 6168
46 Ga0070660_100015792 3300005339 Bacteria 5462
47 Ga0070660_100152860 3300005339 Bacteria 1856
48 Ga0070660_100240780 3300005339 Bacteria 1474
49 Ga0070660_100257799 3300005339 Unclassified 1423
50 Ga0070660_100282045 3300005339 Bacteria 1359
51 Ga0070660_101007098 3300005339 Bacteria 704
52 Ga0070660_101724037 3300005339 Unclassified 533
53 Ga0070660_101892336 3300005339 Bacteria 508
54 Ga0070691_10372336 3300005341 Bacteria 798
55 Ga0070687_100218855 3300005343 Bacteria 1165
56 Ga0070661_100028090 3300005344 Bacteria 4056
57 Ga0070661_100070321 3300005344 Bacteria 2574
58 Ga0070661_100083059 3300005344 Unclassified 2366
59 Ga0070661_100349907 3300005344 Bacteria 1159
60 Ga0070661_100371690 3300005344 Bacteria 1125
61 Ga0070692_10044626 3300005345 Bacteria 2284
62 Ga0070692_10415147 3300005345 Bacteria 853
63 Ga0070692_10514878 3300005345 Bacteria 778
64 Ga0070668_101012507 3300005347 Bacteria 747
65 Ga0070668_101268023 3300005347 Bacteria 669
66 Ga0070669_100489098 3300005353 Bacteria 1019
67 Ga0070669_101436324 3300005353 Bacteria 599
68 Ga0070675_100552983 3300005354 Bacteria 1041
69 Ga0070671_100124421 3300005355 Bacteria 2170
70 Ga0070671_100298766 3300005355 Bacteria 1371
71 Ga0070671_101544417 3300005355 Bacteria 588
72 Ga0070674_100514219 3300005356 Unclassified 999
73 Ga0070674_100631193 3300005356 Bacteria 909
74 Ga0070674_100838163 3300005356 Unclassified 797
75 Ga0070674_101022002 3300005356 Bacteria 726
76 Ga0070673_100152090 3300005364 Bacteria 1961
77 Ga0070673_100457354 3300005364 Bacteria 1149
78 Ga0070659_100011172 3300005366 Bacteria 6635
79 Ga0070659_100059278 3300005366 Bacteria 3022
80 Ga0070659_100101278 3300005366 Bacteria 2319
81 Ga0070659_100472951 3300005366 Bacteria 1065
82 Ga0070659_100537230 3300005366 Bacteria 1000
83 Ga0070659_100773535 3300005366 Bacteria 834
84 Ga0070659_101336304 3300005366 Unclassified 636
85 Ga0070667_100053537 3300005367 Bacteria 3406
86 Ga0070667_100753195 3300005367 Bacteria 903
87 Ga0070667_101743527 3300005367 Bacteria 586
88 Ga0070703_10152108 3300005406 Bacteria 870
89 Ga0070709_10154889 3300005434 Bacteria 1587
90 Ga0070709_10446823 3300005434 Bacteria 973
91 Ga0070709_10915842 3300005434 Unclassified 694
92 Ga0070714_100065808 3300005435 Bacteria 3122
93 Ga0070714_100156636 3300005435 Bacteria 2057
94 Ga0070714_100211025 3300005435 Bacteria 1780
95 Ga0070714_100296920 3300005435 Bacteria 1505
96 Ga0070714_100440365 3300005435 Bacteria 1237
97 Ga0070714_100586619 3300005435 Bacteria 1069
98 Ga0070714_100701066 3300005435 Bacteria 977
99 Ga0070714_100846378 3300005435 Bacteria 887
100 Ga0070714_102441497 3300005435 Bacteria 508
101 Ga0070713_100146523 3300005436 Bacteria 2096
102 Ga0070713_100466365 3300005436 Bacteria 1188
103 Ga0070713_100610162 3300005436 Bacteria 1037
104 Ga0070713_100618289 3300005436 Bacteria 1030
105 Ga0070713_100629333 3300005436 Bacteria 1021
106 Ga0070713_101019495 3300005436 Bacteria 799
107 Ga0070713_101202094 3300005436 Bacteria 734
108 Ga0070710_10220109 3300005437 Bacteria 1207
109 Ga0070710_10309292 3300005437 Bacteria 1034
110 Ga0070710_10334452 3300005437 Bacteria 998
111 Ga0070710_10862529 3300005437 Bacteria 651
112 Ga0070711_100117659 3300005439 Bacteria 1960
113 Ga0070711_100914177 3300005439 Bacteria 749
114 Ga0070705_100292153 3300005440 Bacteria 1164
115 Ga0070705_100703648 3300005440 Bacteria 794
116 Ga0070700_100053755 3300005441 Bacteria 2515
117 Ga0070694_100692249 3300005444 Bacteria 828
118 Ga0070708_100350711 3300005445 Bacteria 1391
119 Ga0070708_100465996 3300005445 Unclassified 1192
120 Ga0070663_100348312 3300005455 Bacteria 1199
121 Ga0070663_100631146 3300005455 Bacteria 904
122 Ga0070678_100357970 3300005456 Bacteria 1257
123 Ga0070678_100531188 3300005456 Bacteria 1042
124 Ga0070678_100658671 3300005456 Bacteria 940
125 Ga0070662_100175470 3300005457 Bacteria 1686
126 Ga0070662_100393289 3300005457 Bacteria 1143
127 Ga0070681_10001211 3300005458 Bacteria 22450
128 Ga0070681_10005563 3300005458 Bacteria 12170
129 Ga0070681_10015890 3300005458 Bacteria 7505
130 Ga0070681_10055397 3300005458 Bacteria 3948
131 Ga0070681_10095959 3300005458 Bacteria 2913
132 Ga0070681_10098288 3300005458 Bacteria 2873
133 Ga0070681_10103113 3300005458 Bacteria 2797
134 Ga0070681_10236761 3300005458 Bacteria 1739
135 Ga0070681_10262891 3300005458 Bacteria 1637
136 Ga0070681_10702216 3300005458 Bacteria 927
137 Ga0068867_100244821 3300005459 Bacteria 1456
138 Ga0068867_100412508 3300005459 Bacteria 1142
139 Ga0068867_101334033 3300005459 Bacteria 663
140 Ga0070685_10462594 3300005466 Bacteria 891
141 Ga0070706_100454381 3300005467 Bacteria 1192
142 Ga0070706_100981740 3300005467 Bacteria 779
143 Ga0070707_100013228 3300005468 Bacteria 7716
144 Ga0070707_100234246 3300005468 Bacteria 1787
145 Ga0070707_100256792 3300005468 Bacteria 1701
146 Ga0070707_101299773 3300005468 Bacteria 694
147 Ga0070698_100393156 3300005471 Bacteria 1319
148 Ga0070698_100824819 3300005471 Bacteria 872
149 Ga0070698_100946414 3300005471 Unclassified 808
150 Ga0070699_100960595 3300005518 Bacteria 783
151 Ga0070699_101054283 3300005518 Bacteria 746
152 Ga0070679_100023485 3300005530 Bacteria 6036
153 Ga0070679_100028786 3300005530 Bacteria 5479
154 Ga0070679_100044117 3300005530 Bacteria 4442
155 Ga0070679_100074158 3300005530 Bacteria 3394
156 Ga0070679_100078979 3300005530 Bacteria 3280
157 Ga0070679_100097560 3300005530 Bacteria 2926
158 Ga0070679_100144665 3300005530 Bacteria 2356
159 Ga0070679_100439485 3300005530 Bacteria 1249
160 Ga0070679_100449217 3300005530 Bacteria 1234
161 Ga0070679_100704477 3300005530 Bacteria 952
162 Ga0070679_101380529 3300005530 Bacteria 651
163 Ga0070684_100073692 3300005535 Bacteria 3009
164 Ga0070684_100076788 3300005535 Bacteria 2949
165 Ga0070684_100088473 3300005535 Bacteria 2751
166 Ga0070684_100100256 3300005535 Bacteria 2586
167 Ga0070684_100145817 3300005535 Bacteria 2143
168 Ga0070684_100185966 3300005535 Bacteria 1889
169 Ga0070684_100233221 3300005535 Bacteria 1680
170 Ga0070684_100257576 3300005535 Bacteria 1595
171 Ga0070684_100295381 3300005535 Bacteria 1486
172 Ga0070684_100651207 3300005535 Bacteria 981
173 Ga0070684_100735393 3300005535 Bacteria 921
174 Ga0070684_101696973 3300005535 Bacteria 596
175 Ga0070697_100668972 3300005536 Unclassified 915
176 Ga0070697_101343215 3300005536 Bacteria 638
177 Ga0068853_100092361 3300005539 Bacteria 2663
178 Ga0068853_100153614 3300005539 Bacteria 2073
179 Ga0068853_100345781 3300005539 Bacteria 1382
180 Ga0068853_100633656 3300005539 Bacteria 1017
181 Ga0068853_100775610 3300005539 Bacteria 917
182 Ga0068853_101955753 3300005539 Bacteria 569
183 Ga0070686_100025331 3300005544 Bacteria 3569
184 Ga0070686_101059878 3300005544 Bacteria 668
185 Ga0070695_101822495 3300005545 Bacteria 511
186 Ga0070696_100023949 3300005546 Bacteria 4149
187 Ga0070696_100411062 3300005546 Bacteria 1061
188 Ga0070693_100038554 3300005547 Bacteria 2671
189 Ga0070693_101205163 3300005547 Bacteria 582
190 Ga0070665_100138441 3300005548 Bacteria 2437
191 Ga0070665_101059052 3300005548 Bacteria 823
192 Ga0070704_100299843 3300005549 Bacteria 1338
193 Ga0070704_100574204 3300005549 Bacteria 988
194 Ga0068855_100004804 3300005563 Bacteria 16497
195 Ga0068855_100008572 3300005563 Bacteria 12362
196 Ga0068855_100058196 3300005563 Bacteria 4527
197 Ga0068855_100065367 3300005563 Bacteria 4240
198 Ga0068855_100206562 3300005563 Bacteria 2209
199 Ga0068855_100735769 3300005563 Bacteria 1053
200 Ga0068855_101002323 3300005563 Bacteria 877
201 Ga0068855_101254480 3300005563 Bacteria 769
202 Ga0068855_102177613 3300005563 Bacteria 557
203 Ga0070664_100619862 3300005564 Bacteria 1004
204 Ga0070664_100906309 3300005564 Unclassified 827
205 Ga0068857_100150005 3300005577 Unclassified 2111
206 Ga0068857_100153277 3300005577 Bacteria 2089
207 Ga0068857_100213181 3300005577 Bacteria 1762
208 Ga0068857_101962732 3300005577 Bacteria 574
209 Ga0068857_102282732 3300005577 Unclassified 531
210 Ga0068854_100025573 3300005578 Bacteria 4051
211 Ga0068854_100286661 3300005578 Bacteria 1328
212 Ga0068854_100419470 3300005578 Bacteria 1111
213 Ga0068854_100483671 3300005578 Bacteria 1040
214 Ga0068856_100009219 3300005614 Bacteria 9595
215 Ga0068856_100085826 3300005614 Bacteria 3127
216 Ga0068856_100150263 3300005614 Bacteria 2338
217 Ga0068856_100212757 3300005614 Bacteria 1948
218 Ga0068856_100362727 3300005614 Bacteria 1467
219 Ga0068856_100369909 3300005614 Unclassified 1452
220 Ga0068856_100846343 3300005614 Bacteria 934
221 Ga0068856_100944227 3300005614 Bacteria 881
222 Ga0068856_101832812 3300005614 Unclassified 618
223 Ga0070702_100022737 3300005615 Bacteria 3321
224 Ga0070702_100182944 3300005615 Unclassified 1373
225 Ga0070702_100684676 3300005615 Bacteria 780
226 Ga0068852_100042747 3300005616 Bacteria 3838
227 Ga0068852_100149182 3300005616 Bacteria 2173
228 Ga0068852_100248987 3300005616 Unclassified 1701
229 Ga0068852_100308947 3300005616 Bacteria 1532
230 Ga0068852_100401410 3300005616 Bacteria 1348
231 Ga0068852_100807201 3300005616 Bacteria 952
232 Ga0068852_101121458 3300005616 Bacteria 807
233 Ga0068852_101276914 3300005616 Bacteria 756
234 Ga0068859_100109888 3300005617 Bacteria 2819
235 Ga0068859_101913362 3300005617 Bacteria 655
236 Ga0068864_100053294 3300005618 Bacteria 3489
237 Ga0068851_10847368 3300005834 Bacteria 570
238 Ga0068870_10111205 3300005840 Bacteria 1564
239 Ga0068863_100100332 3300005841 Bacteria 2751
240 Ga0068863_100364443 3300005841 Bacteria 1409
241 Ga0068858_100063116 3300005842 Bacteria 3427
242 Ga0068858_100579812 3300005842 Bacteria 1087
243 Ga0068858_100725042 3300005842 Bacteria 968
244 Ga0068858_101789113 3300005842 Bacteria 607
245 Ga0068860_100260411 3300005843 Bacteria 1690
246 Ga0068862_100333315 3300005844 Bacteria 1403
247 Ga0081455_10007900 3300005937 Bacteria 11133
248 Ga0081455_10021298 3300005937 Bacteria 6083
249 Ga0081455_10025744 3300005937 Bacteria 5425
250 Ga0081455_10045022 3300005937 Bacteria 3843
251 Ga0081455_10083659 3300005937 Bacteria 2607
252 Ga0081538_10000231 3300005981 Bacteria 62826
253 Ga0081538_10000286 3300005981 Bacteria 57937
254 Ga0081538_10000667 3300005981 Bacteria 37780
255 Ga0081538_10003199 3300005981 Bacteria 15559
256 Ga0081538_10019178 3300005981 Bacteria 5099
257 Ga0081538_10146137 3300005981 Bacteria 1080
258 Ga0081538_10186440 3300005981 Bacteria 878
259 Ga0081539_10002640 3300005985 Bacteria 24492
260 Ga0081539_10007140 3300005985 Bacteria 10309
261 Ga0070717_10138093 3300006028 Bacteria 2100
262 Ga0070717_10162415 3300006028 Bacteria 1938
263 Ga0070717_10187047 3300006028 Bacteria 1808
264 Ga0070717_10197165 3300006028 Bacteria 1762
265 Ga0070717_10246830 3300006028 Bacteria 1576
266 Ga0070717_10423215 3300006028 Bacteria 1198
267 Ga0070717_10886661 3300006028 Bacteria 812
268 Ga0070717_11067375 3300006028 Bacteria 735
269 Ga0070717_12044071 3300006028 Bacteria 516
270 Ga0075365_10003335 3300006038 Bacteria 8250
271 Ga0075365_10172134 3300006038 Bacteria 1512
272 Ga0075364_10005953 3300006051 Bacteria 7131
273 Ga0075364_10193774 3300006051 Bacteria 1377
274 Ga0075432_10005425 3300006058 Bacteria 4347
275 Ga0070715_10398117 3300006163 Bacteria 765
276 Ga0070716_100095303 3300006173 Bacteria 1811
277 Ga0070716_100197571 3300006173 Bacteria 1334
278 Ga0070716_100821040 3300006173 Bacteria 721
279 Ga0070716_101239129 3300006173 Unclassified 601
280 Ga0070716_101252303 3300006173 Unclassified 598
281 Ga0070712_100064422 3300006175 Bacteria 2599
282 Ga0070712_100341536 3300006175 Bacteria 1223
283 Ga0070712_100487553 3300006175 Bacteria 1031
284 Ga0070712_101212035 3300006175 Unclassified 657
285 Ga0070712_101843277 3300006175 Bacteria 530
286 Ga0075362_10037347 3300006177 Bacteria 2129
287 Ga0097621_100248969 3300006237 Bacteria 1555
288 Ga0097621_100590075 3300006237 Bacteria 1015
289 Ga0068871_100082631 3300006358 Bacteria 2664
290 Ga0068871_100394802 3300006358 Bacteria 1231
291 Ga0075428_100018520 3300006844 Bacteria 7699
292 Ga0075428_101221317 3300006844 Bacteria 792
293 Ga0075428_101264870 3300006844 Bacteria 777
294 Ga0075430_100008779 3300006846 Bacteria 8528
295 Ga0075430_100204470 3300006846 Bacteria 1639
296 Ga0075431_100052006 3300006847 Bacteria 4224
297 Ga0075433_10070060 3300006852 Bacteria 3081
298 Ga0075433_10236764 3300006852 Bacteria 1621
299 Ga0075433_10495187 3300006852 Bacteria 1076
300 Ga0075434_100004007 3300006871 Bacteria 13191
301 Ga0075434_100004302 3300006871 Bacteria 12793
302 Ga0075434_100519808 3300006871 Bacteria 1211
303 Ga0075434_100878070 3300006871 Bacteria 912
304 Ga0075434_100972858 3300006871 Bacteria 863
305 Ga0075429_100007741 3300006880 Bacteria 9328
306 Ga0075429_100104603 3300006880 Bacteria 2473
307 Ga0075429_100571160 3300006880 Bacteria 991
308 Ga0068865_100291903 3300006881 Unclassified 1302
309 Ga0068865_100372099 3300006881 Bacteria 1163
310 Ga0068865_101000769 3300006881 Bacteria 732
311 Ga0075436_100002762 3300006914 Bacteria 12054
312 Ga0075436_100487400 3300006914 Bacteria 901
313 Ga0097620_100109888 3300006931 Bacteria 2819
314 Ga0097620_101913508 3300006931 Bacteria 655
315 Ga0075435_100003383 3300007076 Bacteria 10817
316 Ga0075435_100022089 3300007076 Bacteria 4906
317 Ga0075435_100148659 3300007076 Unclassified 1969
318 Ga0075435_100955641 3300007076 Bacteria 748
319 Ga0105240_10014640 3300009093 Bacteria 10702
320 Ga0105240_10086768 3300009093 Bacteria 3833
321 Ga0105240_10169048 3300009093 Bacteria 2591
322 Ga0105240_10590980 3300009093 Bacteria 1223
323 Ga0105240_11331915 3300009093 Bacteria 756
324 Ga0111539_10019934 3300009094 Bacteria 8260
325 Ga0111539_10585994 3300009094 Bacteria 1299
326 Ga0105245_10021132 3300009098 Bacteria 5708
327 Ga0105245_10047644 3300009098 Bacteria 3832
328 Ga0105245_10079582 3300009098 Bacteria 2993
329 Ga0105245_10264161 3300009098 Bacteria 1676
330 Ga0105245_10407871 3300009098 Bacteria 1359
331 Ga0105245_10531070 3300009098 Bacteria 1196
332 Ga0105245_10579126 3300009098 Bacteria 1147
333 Ga0105245_10599399 3300009098 Bacteria 1128
334 Ga0105247_10067308 3300009101 Bacteria 2231
335 Ga0105247_10783842 3300009101 Bacteria 726
336 Ga0114129_10037464 3300009147 Bacteria 6845
337 Ga0114129_10117145 3300009147 Bacteria 3671
338 Ga0114129_10311272 3300009147 Bacteria 2096
339 Ga0114129_10546064 3300009147 Bacteria 1508
340 Ga0114129_12786665 3300009147 Unclassified 581
341 Ga0105243_10016260 3300009148 Bacteria 5630
342 Ga0105243_10293294 3300009148 Bacteria 1471
343 Ga0105243_10502910 3300009148 Bacteria 1149
344 Ga0105241_10060131 3300009174 Bacteria 2922
345 Ga0105241_10264074 3300009174 Bacteria 1464
346 Ga0105241_10267207 3300009174 Bacteria 1456
347 Ga0105241_10948701 3300009174 Bacteria 802
348 Ga0105242_10042065 3300009176 Bacteria 3687
349 Ga0105242_10064698 3300009176 Bacteria 3015
350 Ga0105242_10237248 3300009176 Bacteria 1637
351 Ga0105242_10274951 3300009176 Bacteria 1527
352 Ga0105242_10950816 3300009176 Bacteria 863
353 Ga0105242_12198722 3300009176 Bacteria 597
354 Ga0105242_13325727 3300009176 Bacteria 500
355 Ga0105248_10525512 3300009177 Bacteria 1334
356 Ga0105248_10540665 3300009177 Bacteria 1314
357 Ga0105237_10340697 3300009545 Bacteria 1504
358 Ga0105237_10500624 3300009545 Bacteria 1221
359 Ga0105237_10640573 3300009545 Bacteria 1070
360 Ga0105237_10830905 3300009545 Bacteria 930
361 Ga0105237_11104865 3300009545 Bacteria 800
362 Ga0105237_12124720 3300009545 Bacteria 571
363 Ga0105238_10028919 3300009551 Bacteria 5646
364 Ga0105238_10033949 3300009551 Bacteria 5191
365 Ga0105238_10063726 3300009551 Bacteria 3686
366 Ga0105238_10193973 3300009551 Bacteria 2007
367 Ga0105238_10721690 3300009551 Bacteria 1009
368 Ga0105238_11796335 3300009551 Bacteria 645
369 Ga0105238_11910224 3300009551 Bacteria 627
370 Ga0105238_12636660 3300009551 Bacteria 539
371 Ga0105249_10027388 3300009553 Bacteria 5142
372 Ga0105249_10440212 3300009553 Bacteria 1340
373 Ga0105249_10533235 3300009553 Bacteria 1223
374 Ga0105239_10277631 3300010375 Bacteria 1886
375 Ga0105239_10520460 3300010375 Bacteria 1353
376 Ga0105239_10756551 3300010375 Bacteria 1112
377 Ga0105239_11314594 3300010375 Bacteria 834
378 Ga0105239_11503789 3300010375 Bacteria 778
379 Ga0105239_13332306 3300010375 Bacteria 523
380 Ga0105239_13400597 3300010375 Unclassified 518
381 Ga0105246_10013171 3300011119 Bacteria 5178
382 Ga0105246_10422846 3300011119 Bacteria 1112
383 Ga0105246_10573465 3300011119 Bacteria 971
384 Ga0105246_10736920 3300011119 Bacteria 868
385 Ga0157347_1020588 3300012502 Bacteria 769
386 Ga0157342_1024066 3300012507 Bacteria 727
387 Ga0157327_1008019 3300012512 Bacteria 936
388 Ga0157373_10053326 3300013100 Bacteria 2876
389 Ga0157373_10206232 3300013100 Unclassified 1386
390 Ga0157373_10328744 3300013100 Bacteria 1088
391 Ga0157373_10517687 3300013100 Bacteria 863
392 Ga0157373_11021732 3300013100 Bacteria 618
393 Ga0157371_10224898 3300013102 Bacteria 1348
394 Ga0157371_10277009 3300013102 Bacteria 1211
395 Ga0157371_10868707 3300013102 Bacteria 683
396 Ga0157371_11536489 3300013102 Bacteria 520
397 Ga0157370_10022109 3300013104 Bacteria 6331
398 Ga0157370_10032325 3300013104 Bacteria 5110
399 Ga0157370_10046103 3300013104 Bacteria 4180
400 Ga0157370_10287230 3300013104 Bacteria 1520
401 Ga0157370_10772719 3300013104 Archaea 875
402 Ga0157369_10002320 3300013105 Bacteria 22898
403 Ga0157369_10271581 3300013105 Bacteria 1767
404 Ga0157369_10335773 3300013105 Bacteria 1570
405 Ga0157369_10454011 3300013105 Bacteria 1327
406 Ga0157369_10532527 3300013105 Bacteria 1215
407 Ga0157369_10714610 3300013105 Bacteria 1032
408 Ga0157369_10733318 3300013105 Bacteria 1017
409 Ga0157374_10019586 3300013296 Bacteria 5990
410 Ga0157374_10102876 3300013296 Bacteria 2740
411 Ga0157374_10153005 3300013296 Bacteria 2244
412 Ga0157374_10257725 3300013296 Unclassified 1717
413 Ga0157374_10379637 3300013296 Bacteria 1408
414 Ga0157374_10579426 3300013296 Bacteria 1131
415 Ga0157374_10795959 3300013296 Unclassified 961
416 Ga0157374_11447036 3300013296 Bacteria 710
417 Ga0157374_11880393 3300013296 Bacteria 624
418 Ga0157378_10763788 3300013297 Bacteria 990
419 Ga0157378_10880663 3300013297 Bacteria 925
420 Ga0157378_11277356 3300013297 Bacteria 775
421 Ga0157378_11325178 3300013297 Bacteria 761
422 Ga0157378_11862405 3300013297 Bacteria 650
423 Ga0157378_12024738 3300013297 Bacteria 626
424 Ga0163162_10138016 3300013306 Bacteria 2550
425 Ga0163162_10830844 3300013306 Bacteria 1040
426 Ga0163162_11052929 3300013306 Bacteria 921
427 Ga0163162_13189683 3300013306 Bacteria 526
428 Ga0157372_10037624 3300013307 Bacteria 5339
429 Ga0157372_10060489 3300013307 Bacteria 4239
430 Ga0157372_10120458 3300013307 Bacteria 3013
431 Ga0157372_10273028 3300013307 Bacteria 1965
432 Ga0157372_10372016 3300013307 Bacteria 1665
433 Ga0157372_11489667 3300013307 Bacteria 780
434 Ga0157375_10118405 3300013308 Bacteria 2755
435 Ga0157375_10283717 3300013308 Unclassified 1819
436 Ga0157375_10284443 3300013308 Bacteria 1817
437 Ga0163163_10009378 3300014325 Bacteria 8736
438 Ga0163163_12410620 3300014325 Unclassified 584
439 Ga0157380_13156933 3300014326 Unclassified 526
440 Ga0182008_10040176 3300014497 Bacteria 2336
441 Ga0182008_10089928 3300014497 Bacteria 1513
442 Ga0182008_10213276 3300014497 Bacteria 986
443 Ga0157377_10008185 3300014745 Bacteria 5087
444 Ga0157377_10138887 3300014745 Unclassified 1491
445 Ga0157379_10208168 3300014968 Unclassified 1770
446 Ga0157379_11655921 3300014968 Bacteria 626
447 Ga0157379_11932211 3300014968 Bacteria 582
448 Ga0157379_12318350 3300014968 Bacteria 535
449 Ga0157376_10027031 3300014969 Bacteria 4543
450 Ga0157376_10308200 3300014969 Bacteria 1501
451 Ga0157376_10377624 3300014969 Bacteria 1364
452 Ga0157376_10395260 3300014969 Bacteria 1335
453 Ga0182007_10120785 3300015262 Bacteria 877
454 Ga0182007_10258024 3300015262 Unclassified 627
455 Ga0163161_10627152 3300017792 Bacteria 889
456 Ga0197907_10557898 3300020069 Archaea 535
457 Ga0197907_10788161 3300020069 Bacteria 1938
458 Ga0197907_10852630 3300020069 Bacteria 1069
459 Ga0197907_11239336 3300020069 Bacteria 1654
460 Ga0206356_10159383 3300020070 Bacteria 852
461 Ga0206356_10378944 3300020070 Bacteria 996
462 Ga0206356_10708941 3300020070 Bacteria 3064
463 Ga0206356_10916098 3300020070 Bacteria 857
464 Ga0206356_11582479 3300020070 Bacteria 1543
465 Ga0206356_11610073 3300020070 Bacteria 1367
466 Ga0206356_11635300 3300020070 Bacteria 2820
467 Ga0206349_1178519 3300020075 Bacteria 742
468 Ga0206355_1050139 3300020076 Bacteria 608
469 Ga0206355_1276088 3300020076 Bacteria 622
470 Ga0206355_1376991 3300020076 Bacteria 634
471 Ga0206355_1471482 3300020076 Unclassified 538
472 Ga0206351_10377887 3300020077 Bacteria 635
473 Ga0206351_10656248 3300020077 Bacteria 640
474 Ga0206351_10859689 3300020077 Bacteria 521
475 Ga0206352_10369212 3300020078 Bacteria 706
476 Ga0206352_10610482 3300020078 Bacteria 602
477 Ga0206350_10244322 3300020080 Bacteria 532
478 Ga0206350_10755670 3300020080 Bacteria 1212
479 Ga0206350_11166980 3300020080 Bacteria 787
480 Ga0206354_10231726 3300020081 Bacteria 2060
481 Ga0206354_10481326 3300020081 Bacteria 905
482 Ga0206354_11187472 3300020081 Bacteria 681
483 Ga0206354_11421046 3300020081 Bacteria 1571
484 Ga0206354_11537208 3300020081 Bacteria 525
485 Ga0206353_10017982 3300020082 Bacteria 1183
486 Ga0206353_10446025 3300020082 Bacteria 693
487 Ga0206353_10612272 3300020082 Bacteria 1311
488 Ga0206353_10781712 3300020082 Bacteria 3429
489 Ga0206353_10919416 3300020082 Bacteria 5082
490 Ga0206353_11166285 3300020082 Bacteria 922
491 Ga0206353_11739036 3300020082 Bacteria 803
492 Ga0213874_10095634 3300021377 Unclassified 982
493 Ga0213874_10121219 3300021377 Bacteria 889
494 Ga0213876_10023437 3300021384 Bacteria 3262
495 Ga0213875_10178370 3300021388 Unclassified 998
496 Ga0224712_10011301 3300022467 Bacteria 2765
497 Ga0224712_10022451 3300022467 Bacteria 2175
498 Ga0224712_10089695 3300022467 Unclassified 1286
499 Ga0224712_10259405 3300022467 Bacteria 805
500 Ga0224712_10292080 3300022467 Bacteria 761
501 Ga0224712_10319429 3300022467 Bacteria 729
502 Ga0224712_10638585 3300022467 Unclassified 521
503 Ga0224712_10657853 3300022467 Bacteria 514
504 Ga0207656_10594374 3300025321 Bacteria 565
505 Ga0207653_10037151 3300025885 Bacteria 1588
506 Ga0207692_10168848 3300025898 Bacteria 1266
507 Ga0207692_10444391 3300025898 Bacteria 815
508 Ga0207692_10543385 3300025898 Unclassified 742
509 Ga0207692_11035061 3300025898 Bacteria 543
510 Ga0207642_10344023 3300025899 Bacteria 878
511 Ga0207710_10055540 3300025900 Bacteria 1785
512 Ga0207710_10463359 3300025900 Bacteria 655
513 Ga0207688_10038649 3300025901 Bacteria 2649
514 Ga0207688_10155143 3300025901 Bacteria 1355
515 Ga0207688_10836296 3300025901 Bacteria 583
516 Ga0207680_10035015 3300025903 Bacteria 2878
517 Ga0207647_10064947 3300025904 Bacteria 2216
518 Ga0207647_10307419 3300025904 Bacteria 902
519 Ga0207685_10259461 3300025905 Bacteria 844
520 Ga0207699_10356280 3300025906 Bacteria 1034
521 Ga0207699_10742399 3300025906 Bacteria 720
522 Ga0207645_10258926 3300025907 Bacteria 1152
523 Ga0207643_10439397 3300025908 Bacteria 829
524 Ga0207705_10014835 3300025909 Bacteria 5602
525 Ga0207705_10047609 3300025909 Bacteria 3083
526 Ga0207705_10087228 3300025909 Bacteria 2281
527 Ga0207705_10098696 3300025909 Bacteria 2146
528 Ga0207705_10772421 3300025909 Bacteria 746
529 Ga0207705_10793554 3300025909 Bacteria 735
530 Ga0207705_10863536 3300025909 Bacteria 701
531 Ga0207705_11248379 3300025909 Bacteria 569
532 Ga0207654_10038145 3300025911 Bacteria 2694
533 Ga0207654_10046709 3300025911 Bacteria 2470
534 Ga0207654_10168255 3300025911 Bacteria 1421
535 Ga0207654_11276280 3300025911 Bacteria 535
536 Ga0207707_10012220 3300025912 Bacteria 7464
537 Ga0207707_10012425 3300025912 Bacteria 7402
538 Ga0207707_10062306 3300025912 Bacteria 3245
539 Ga0207707_10122204 3300025912 Bacteria 2277
540 Ga0207707_10257344 3300025912 Bacteria 1515
541 Ga0207707_10351324 3300025912 Bacteria 1270
542 Ga0207707_10353367 3300025912 Bacteria 1266
543 Ga0207707_10662960 3300025912 Bacteria 879
544 Ga0207695_10148932 3300025913 Bacteria 2281
545 Ga0207695_10426091 3300025913 Bacteria 1211
546 Ga0207695_10579951 3300025913 Bacteria 1003
547 Ga0207695_10709007 3300025913 Bacteria 887
548 Ga0207695_10946595 3300025913 Bacteria 741
549 Ga0207695_11078072 3300025913 Bacteria 683
550 Ga0207671_10136721 3300025914 Bacteria 1885
551 Ga0207671_10191442 3300025914 Bacteria 1595
552 Ga0207671_11578931 3300025914 Unclassified 505
553 Ga0207693_10033503 3300025915 Bacteria 4054
554 Ga0207693_10042789 3300025915 Bacteria 3565
555 Ga0207693_10052457 3300025915 Bacteria 3199
556 Ga0207693_10112890 3300025915 Bacteria 2132
557 Ga0207693_10456362 3300025915 Bacteria 998
558 Ga0207693_10682311 3300025915 Bacteria 797
559 Ga0207663_10308049 3300025916 Bacteria 1186
560 Ga0207663_10418927 3300025916 Bacteria 1028
561 Ga0207663_10754221 3300025916 Bacteria 773
562 Ga0207663_11213707 3300025916 Bacteria 607
563 Ga0207660_10042937 3300025917 Bacteria 3176
564 Ga0207660_10083496 3300025917 Bacteria 2352
565 Ga0207660_10348710 3300025917 Bacteria 1186
566 Ga0207660_10373504 3300025917 Bacteria 1145
567 Ga0207660_10471223 3300025917 Bacteria 1017
568 Ga0207660_10803429 3300025917 Bacteria 768
569 Ga0207660_11333072 3300025917 Bacteria 582
570 Ga0207660_11485197 3300025917 Bacteria 548
571 Ga0207660_11538452 3300025917 Bacteria 537
572 Ga0207662_10044516 3300025918 Bacteria 2620
573 Ga0207662_10377752 3300025918 Unclassified 957
574 Ga0207657_10000054 3300025919 Bacteria 106767
575 Ga0207657_10001075 3300025919 Bacteria 28931
576 Ga0207657_10001255 3300025919 Bacteria 27138
577 Ga0207657_10007381 3300025919 Bacteria 11277
578 Ga0207657_10008257 3300025919 Bacteria 10599
579 Ga0207657_10051326 3300025919 Bacteria 3585
580 Ga0207657_10222148 3300025919 Bacteria 1513
581 Ga0207657_10452555 3300025919 Bacteria 1007
582 Ga0207657_10458850 3300025919 Bacteria 999
583 Ga0207657_10579824 3300025919 Bacteria 876
584 Ga0207649_10078373 3300025920 Bacteria 2132
585 Ga0207649_10121488 3300025920 Bacteria 1761
586 Ga0207649_10218778 3300025920 Bacteria 1355
587 Ga0207652_10053360 3300025921 Bacteria 3472
588 Ga0207652_10058771 3300025921 Bacteria 3313
589 Ga0207652_10074054 3300025921 Bacteria 2964
590 Ga0207652_10074769 3300025921 Bacteria 2951
591 Ga0207652_10098968 3300025921 Bacteria 2573
592 Ga0207652_10169975 3300025921 Bacteria 1956
593 Ga0207652_10173903 3300025921 Bacteria 1933
594 Ga0207652_10212704 3300025921 Bacteria 1741
595 Ga0207652_10775809 3300025921 Bacteria 852
596 Ga0207652_10932454 3300025921 Bacteria 766
597 Ga0207652_11416136 3300025921 Bacteria 598
598 Ga0207646_10001441 3300025922 Bacteria 29529
599 Ga0207646_10118695 3300025922 Bacteria 2376
600 Ga0207646_10176404 3300025922 Bacteria 1930
601 Ga0207646_10375212 3300025922 Bacteria 1285
602 Ga0207694_10033295 3300025924 Bacteria 3948
603 Ga0207694_10058043 3300025924 Bacteria 3010
604 Ga0207694_10107410 3300025924 Bacteria 2217
605 Ga0207694_10603668 3300025924 Bacteria 923
606 Ga0207659_10444250 3300025926 Bacteria 1091
607 Ga0207687_10015379 3300025927 Bacteria 5016
608 Ga0207687_10042209 3300025927 Bacteria 3136
609 Ga0207687_10080429 3300025927 Bacteria 2352
610 Ga0207687_10109199 3300025927 Bacteria 2049
611 Ga0207687_10227911 3300025927 Bacteria 1471
612 Ga0207687_10236458 3300025927 Bacteria 1446
613 Ga0207687_10851679 3300025927 Bacteria 779
614 Ga0207687_11329517 3300025927 Bacteria 618
615 Ga0207687_11411295 3300025927 Bacteria 598
616 Ga0207700_10198685 3300025928 Bacteria 1689
617 Ga0207700_10424560 3300025928 Bacteria 1168
618 Ga0207700_10455036 3300025928 Bacteria 1129
619 Ga0207700_10562975 3300025928 Bacteria 1012
620 Ga0207700_10635225 3300025928 Bacteria 951
621 Ga0207700_10849679 3300025928 Bacteria 817
622 Ga0207700_11158495 3300025928 Bacteria 691
623 Ga0207700_11581610 3300025928 Bacteria 580
624 Ga0207664_10412519 3300025929 Bacteria 1202
625 Ga0207664_10431611 3300025929 Unclassified 1174
626 Ga0207664_10662908 3300025929 Bacteria 938
627 Ga0207664_10808620 3300025929 Bacteria 843
628 Ga0207664_10884949 3300025929 Bacteria 802
629 Ga0207664_11402492 3300025929 Unclassified 619
630 Ga0207664_11434657 3300025929 Bacteria 611
631 Ga0207664_11541722 3300025929 Bacteria 586
632 Ga0207664_11865241 3300025929 Unclassified 524
633 Ga0207644_10089503 3300025931 Bacteria 2291
634 Ga0207644_10139439 3300025931 Bacteria 1866
635 Ga0207690_10002378 3300025932 Bacteria 11401
636 Ga0207690_10040448 3300025932 Bacteria 3048
637 Ga0207690_10163381 3300025932 Bacteria 1662
638 Ga0207690_10324374 3300025932 Bacteria 1211
639 Ga0207706_10054711 3300025933 Bacteria 3521
640 Ga0207706_10203018 3300025933 Bacteria 1738
641 Ga0207686_10052028 3300025934 Bacteria 2554
642 Ga0207686_10154413 3300025934 Bacteria 1602
643 Ga0207686_10278449 3300025934 Bacteria 1234
644 Ga0207686_10384300 3300025934 Bacteria 1065
645 Ga0207686_10642320 3300025934 Bacteria 839
646 Ga0207709_10041105 3300025935 Bacteria 2773
647 Ga0207670_11012724 3300025936 Bacteria 699
648 Ga0207669_10338668 3300025937 Unclassified 1158
649 Ga0207704_10072413 3300025938 Bacteria 2190
650 Ga0207704_11443764 3300025938 Bacteria 590
651 Ga0207704_11941060 3300025938 Bacteria 506
652 Ga0207665_10043153 3300025939 Bacteria 3015
653 Ga0207665_10308420 3300025939 Bacteria 1185
654 Ga0207665_10522360 3300025939 Bacteria 919
655 Ga0207665_11426895 3300025939 Bacteria 551
656 Ga0207691_10327447 3300025940 Bacteria 1313
657 Ga0207691_10909320 3300025940 Bacteria 737
658 Ga0207711_10258186 3300025941 Bacteria 1601
659 Ga0207711_10314043 3300025941 Bacteria 1447
660 Ga0207711_10338085 3300025941 Bacteria 1393
661 Ga0207661_10020944 3300025944 Bacteria 4896
662 Ga0207661_10070838 3300025944 Bacteria 2847
663 Ga0207661_10098620 3300025944 Bacteria 2449
664 Ga0207661_10393406 3300025944 Bacteria 1256
665 Ga0207661_10474490 3300025944 Bacteria 1141
666 Ga0207661_10689500 3300025944 Bacteria 939
667 Ga0207679_10368007 3300025945 Unclassified 1257
668 Ga0207667_10071922 3300025949 Bacteria 3595
669 Ga0207667_10082068 3300025949 Bacteria 3340
670 Ga0207667_10115354 3300025949 Bacteria 2768
671 Ga0207667_10174403 3300025949 Bacteria 2209
672 Ga0207667_10181179 3300025949 Bacteria 2163
673 Ga0207667_10332376 3300025949 Bacteria 1551
674 Ga0207667_10656266 3300025949 Bacteria 1054
675 Ga0207667_10666747 3300025949 Bacteria 1044
676 Ga0207651_10594431 3300025960 Bacteria 967
677 Ga0207651_11897747 3300025960 Bacteria 536
678 Ga0207712_10472788 3300025961 Bacteria 1067
679 Ga0207712_10530238 3300025961 Bacteria 1010
680 Ga0207712_11034823 3300025961 Bacteria 729
681 Ga0207668_10342835 3300025972 Bacteria 1247
682 Ga0207668_10343335 3300025972 Bacteria 1246
683 Ga0207640_10709786 3300025981 Bacteria 863
684 Ga0207640_11175220 3300025981 Bacteria 681
685 Ga0207658_10014581 3300025986 Bacteria 5382
686 Ga0207658_11314677 3300025986 Bacteria 661
687 Ga0207677_10031103 3300026023 Bacteria 3416
688 Ga0207677_10039990 3300026023 Bacteria 3087
689 Ga0207677_10509867 3300026023 Bacteria 1042
690 Ga0207677_10687369 3300026023 Unclassified 906
691 Ga0207703_10100530 3300026035 Bacteria 2450
692 Ga0207703_10333854 3300026035 Bacteria 1391
693 Ga0207703_10887266 3300026035 Bacteria 854
694 Ga0207639_10062603 3300026041 Bacteria 2878
695 Ga0207639_10170303 3300026041 Bacteria 1844
696 Ga0207639_10219301 3300026041 Bacteria 1642
697 Ga0207639_10666463 3300026041 Bacteria 963
698 Ga0207678_10053177 3300026067 Bacteria 3491
699 Ga0207678_10505585 3300026067 Bacteria 1054
700 Ga0207708_10196226 3300026075 Bacteria 1609
701 Ga0207708_10331811 3300026075 Bacteria 1244
702 Ga0207702_10002160 3300026078 Bacteria 18887
703 Ga0207702_10130604 3300026078 Bacteria 2260
704 Ga0207702_10207597 3300026078 Bacteria 1819
705 Ga0207702_10403860 3300026078 Bacteria 1318
706 Ga0207702_10538565 3300026078 Bacteria 1141
707 Ga0207702_10609433 3300026078 Bacteria 1072
708 Ga0207702_10857581 3300026078 Bacteria 899
709 Ga0207641_10440004 3300026088 Bacteria 1258
710 Ga0207641_10507237 3300026088 Bacteria 1172
711 Ga0207648_10152368 3300026089 Bacteria 2040
712 Ga0207648_10718940 3300026089 Bacteria 926
713 Ga0207676_10211131 3300026095 Bacteria 1722
714 Ga0207674_10053698 3300026116 Bacteria 4106
715 Ga0207674_10159297 3300026116 Bacteria 2212
716 Ga0207674_10167092 3300026116 Bacteria 2154
717 Ga0207674_11187893 3300026116 Unclassified 732
718 Ga0207674_11707950 3300026116 Bacteria 598
719 Ga0207683_10055645 3300026121 Bacteria 3469
720 Ga0207683_10104344 3300026121 Bacteria 2533
721 Ga0207698_10058341 3300026142 Bacteria 2991
722 Ga0207698_10307404 3300026142 Bacteria 1479
723 Ga0207698_10457648 3300026142 Bacteria 1233
724 Ga0207698_10506287 3300026142 Bacteria 1176
725 Ga0207698_11162584 3300026142 Bacteria 785
726 Ga0207698_11485780 3300026142 Bacteria 693
727 Ga0207698_12372150 3300026142 Unclassified 542
728 Ga0207428_10002365 3300027907 Bacteria 18835
729 Ga0268266_10059309 3300028379 Bacteria 3297
730 Ga0268266_10081241 3300028379 Bacteria 2826
731 Ga0268266_10774543 3300028379 Bacteria 926
732 Ga0268265_11261046 3300028380 Bacteria 738
733 Ga0268264_10171684 3300028381 Bacteria 1962
734 Ga0265337_1090596 3300028556 Bacteria 834
735 Ga0265326_10257653 3300028558 Bacteria 504
736 Ga0265319_1020126 3300028563 Bacteria 2481
737 Ga0265319_1050512 3300028563 Bacteria 1373
738 Ga0265319_1117124 3300028563 Bacteria 831
739 Ga0265319_1145256 3300028563 Bacteria 735
740 Ga0265319_1163791 3300028563 Unclassified 687
741 Ga0265334_10073313 3300028573 Bacteria 1271
742 Ga0265334_10232894 3300028573 Bacteria 636
743 Ga0265318_10006408 3300028577 Bacteria 5419
744 Ga0265318_10067811 3300028577 Bacteria 1324
745 Ga0265318_10081795 3300028577 Bacteria 1193
746 Ga0265318_10199626 3300028577 Bacteria 731
747 Ga0265318_10309750 3300028577 Bacteria 576
748 Ga0265323_10068454 3300028653 Bacteria 1219
749 Ga0265336_10001147 3300028666 Bacteria 12675
750 Ga0265338_10005100 3300028800 Bacteria 17325
751 Ga0265338_10007755 3300028800 Bacteria 13209
752 Ga0265338_10020589 3300028800 Bacteria 6931
753 Ga0265338_10026919 3300028800 Bacteria 5785
754 Ga0265338_10081701 3300028800 Bacteria 2708
755 Ga0265338_10123267 3300028800 Bacteria 2061
756 Ga0265338_10131371 3300028800 Bacteria 1976
757 Ga0265338_10142381 3300028800 Bacteria 1876
758 Ga0265324_10008358 3300029957 Bacteria 4115
759 Ga0265332_10141529 3300031238 Bacteria 1008
760 Ga0265320_10093432 3300031240 Bacteria 1392
761 Ga0265320_10119407 3300031240 Bacteria 1203
762 Ga0265320_10342665 3300031240 Bacteria 660
763 Ga0265325_10276032 3300031241 Bacteria 755
764 Ga0265340_10042361 3300031247 Bacteria 2235
765 Ga0265340_10269992 3300031247 Bacteria 756
766 Ga0265339_10162809 3300031249 Bacteria 1122
767 Ga0265316_10589057 3300031344 Bacteria 789
768 Ga0265316_10714300 3300031344 Bacteria 706
769 Ga0307408_102053960 3300031548 Bacteria 550
770 Ga0265313_10004487 3300031595 Bacteria 10683
771 Ga0265313_10206493 3300031595 Unclassified 815
772 Ga0265314_10013102 3300031711 Bacteria 6718
773 Ga0265314_10416319 3300031711 Bacteria 723
774 Ga0265314_10567123 3300031711 Unclassified 589
775 Ga0265342_10284431 3300031712 Bacteria 874
776 Ga0307409_102113783 3300031995 Bacteria 593
777 Ga0307416_100966122 3300032002 Bacteria 954
778 Ga0307415_100499327 3300032126 Bacteria 1063
779 Ga0373938_0161036 3300034957 Bacteria 603
780 Ga0373926_0027594 3300035083 Bacteria 1990
781 Ga0373926_0041034 3300035083 Bacteria 1653
782 Ga0373934_0066375 3300035086 Bacteria 1441
783 Ga0373944_0003405 3300035089 Bacteria 4100
784 Ga0373944_0017421 3300035089 Bacteria 2039
785 Ga0373944_0034813 3300035089 Bacteria 1532
786 Ga0373944_0072422 3300035089 Unclassified 1125
787 Ga0373949_0102209 3300035090 Bacteria 787
788 Ga0373923_0009617 3300035111 Bacteria 3495
789 Ga0373923_0112107 3300035111 Bacteria 1212
790 Ga0373936_0012158 3300035113 Bacteria 3270
791 Ga0373936_0031292 3300035113 Bacteria 2101
792 Ga0373936_0034868 3300035113 Bacteria 2001
793 Ga0373945_0003331 3300035116 Bacteria 5047
794 Ga0373945_0008817 3300035116 Bacteria 3294
795 Ga0373945_0021731 3300035116 Bacteria 2207
796 Ga0373945_0033306 3300035116 Bacteria 1830
797 Ga0373953_0080481 3300035117 Bacteria 1354
798 Ga0373953_0213009 3300035117 Bacteria 836
799 Ga0373954_0008966 3300035118 Bacteria 4404
800 Ga0373954_0086516 3300035118 Bacteria 1502
801 Ga0373954_0594280 3300035118 Bacteria 549
802 Ga0373956_0073808 3300035119 Bacteria 1559
803 Ga0373957_0038874 3300035120 Bacteria 1783
804 Ga0373943_0000693 3300035170 Bacteria 14694
805 Ga0373943_0001040 3300035170 Bacteria 12335
806 Ga0373943_0001343 3300035170 Bacteria 11085
807 Ga0373943_0006737 3300035170 Bacteria 5157
808 Ga0373946_0031421 3300035171 Bacteria 2126
809 Ga0373946_0050342 3300035171 Bacteria 1740
810 Ga0373946_0120483 3300035171 Unclassified 1197
811 Ga0373946_0559320 3300035171 Bacteria 591
812 Ga0373955_0012109 3300035172 Bacteria 4138
813 Ga0373955_0195877 3300035172 Bacteria 1202
814 Ga0373955_0209553 3300035172 Bacteria 1162
815 Ga0373924_0024092 3300035410 Bacteria 2395
816 Ga0373924_0045859 3300035410 Bacteria 1799
817 Ga0373924_0160201 3300035410 Bacteria 987
818 Ga0373924_0196163 3300035410 Bacteria 890
819 Ga0373924_0304719 3300035410 Bacteria 708
820 Ga0373935_0016894 3300035692 Bacteria 4419
821 Ga0373935_0017594 3300035692 Bacteria 4340
822 Ga0373935_0027291 3300035692 Bacteria 3529
823 Ga0373935_0558880 3300035692 Bacteria 834
824 Ga0373935_0690893 3300035692 Bacteria 750
825 Ga0373927_0028499 3300035695 Bacteria 3643
826 Ga0373927_0133645 3300035695 Bacteria 1621
827 Ga0373927_0135003 3300035695 Bacteria 1612
828 Ga0373927_0304447 3300035695 Unclassified 1049
829 Ga0373933_0050952 3300035724 Bacteria 2473
830 Ga0373933_0113076 3300035724 Bacteria 1695
831 Ga0373933_0383579 3300035724 Bacteria 915
832 Ga0373947_0001170 3300035725 Bacteria 16135
833 Ga0373947_0099387 3300035725 Bacteria 1826
834 Ga0373947_0104473 3300035725 Bacteria 1783
835 Ga0373947_0106346 3300035725 Unclassified 1768
836 Ga0373947_0583399 3300035725 Bacteria 762
837 Ga0373937_0012607 3300036401 Bacteria 7439
838 Ga0373937_0168279 3300036401 Bacteria 2056
839 Ga0373937_0301151 3300036401 Bacteria 1515
840 Ga0373937_0402272 3300036401 Bacteria 1299
841 Ga0373925_0002413 3300037068 Bacteria 14989
842 Ga0373925_0002841 3300037068 Bacteria 13667
843 Ga0373925_0005888 3300037068 Bacteria 9086
844 Ga0373925_0101668 3300037068 Bacteria 2210
845 Ga0373925_0745852 3300037068 Unclassified 807
846 Ga0395899_0046455 3300037312 Bacteria 3234
847 Ga0395899_0119121 3300037312 Bacteria 1893
848 Ga0395899_0135136 3300037312 Bacteria 1758
849 Ga0395899_0135739 3300037312 Bacteria 1754
850 Ga0395899_0218398 3300037312 Bacteria 1321
851 Ga0395899_0289200 3300037312 Bacteria 1112
852 Ga0395900_0034383 3300037418 Bacteria 5219
853 Ga0395900_0042427 3300037418 Bacteria 4688
854 Ga0395900_0048345 3300037418 Bacteria 4382
855 Ga0395900_0068352 3300037418 Bacteria 3651
856 Ga0395900_0084734 3300037418 Bacteria 3257
857 Ga0395900_0184594 3300037418 Bacteria 2117
858 Ga0395900_0224573 3300037418 Bacteria 1891
859 Ga0395900_0229982 3300037418 Bacteria 1865
860 Ga0395900_0261756 3300037418 Bacteria 1727
861 Ga0395900_0262135 3300037418 Unclassified 1725
862 Ga0395900_0342073 3300037418 Bacteria 1471
863 Ga0395900_0901850 3300037418 Bacteria 807
864 Ga0395900_1385357 3300037418 Bacteria 616
865 Ga0395900_1424650 3300037418 Bacteria 606
866 Ga0395898_0002613 3300037466 Bacteria 20969
867 Ga0395898_0013164 3300037466 Bacteria 8524
868 Ga0395898_0020929 3300037466 Bacteria 6639
869 Ga0395898_0029711 3300037466 Bacteria 5471
870 Ga0395898_0030941 3300037466 Bacteria 5352
871 Ga0395898_0082415 3300037466 Bacteria 3100
872 Ga0395898_0083641 3300037466 Bacteria 3076
873 Ga0395898_0094034 3300037466 Bacteria 2881
874 Ga0395898_0214966 3300037466 Bacteria 1834
875 Ga0395898_0264555 3300037466 Bacteria 1640
876 Ga0395898_0342707 3300037466 Bacteria 1425
877 Ga0395898_0387390 3300037466 Bacteria 1333
878 Ga0395898_0448942 3300037466 Bacteria 1228
879 Ga0395898_0514803 3300037466 Bacteria 1138
880 Ga0395898_0544788 3300037466 Bacteria 1102
881 Ga0395898_0617722 3300037466 Unclassified 1026
882 Ga0395898_0894398 3300037466 Bacteria 826
883 Ga0395898_1548123 3300037466 Unclassified 588
884 Ga0395898_1723376 3300037466 Unclassified 549
885 Ga0395905_0039611 3300037471 Bacteria 4421
886 Ga0395905_0060677 3300037471 Bacteria 3536
887 Ga0395905_0081507 3300037471 Bacteria 3032
888 Ga0395905_0106658 3300037471 Bacteria 2630
889 Ga0395905_0116059 3300037471 Bacteria 2516
890 Ga0395905_0252809 3300037471 Bacteria 1646
891 Ga0395905_0384153 3300037471 Bacteria 1298
892 Ga0395905_0941404 3300037471 Bacteria 767
893 Ga0395901_0001850 3300038443 Bacteria 21884
894 Ga0395901_0005193 3300038443 Bacteria 13144
895 Ga0395901_0023082 3300038443 Bacteria 6376
896 Ga0395901_0045262 3300038443 Bacteria 4566
897 Ga0395901_0046896 3300038443 Bacteria 4489
898 Ga0395901_0048579 3300038443 Bacteria 4407
899 Ga0395901_0075489 3300038443 Bacteria 3516
900 Ga0395901_0076133 3300038443 Bacteria 3500
901 Ga0395901_0081065 3300038443 Bacteria 3389
902 Ga0395901_0109361 3300038443 Bacteria 2902
903 Ga0395901_0598475 3300038443 Bacteria 1112
904 Ga0395901_0684837 3300038443 Unclassified 1024
905 Ga0395901_0701527 3300038443 Bacteria 1009
906 Ga0395901_0852269 3300038443 Bacteria 896
907 Ga0395901_1280683 3300038443 Bacteria 696
908 Ga0395901_2080522 3300038443 Unclassified 513
909 Ga0436365_1173242 3300039437 Bacteria 578
910 Ga0436363_0218384 3300039450 Bacteria 1625
911 Ga0451793_0437514 3300041452 Bacteria 954
912 Ga0451804_0573671 3300041463 Unclassified 564
913 Ga0451835_1263189 3300041492 Bacteria 980
914 Ga0451837_0215669 3300041494 Bacteria 515
915 Ga0451839_0131976 3300041496 Bacteria 617
916 Ga0451845_0298016 3300041501 Bacteria 712
917 Ga0451853_1676111 3300041512 Unclassified 830
918 Ga0451853_3292590 3300041512 Bacteria 594
919 Ga0439443_085973 3300042003 Unclassified 589
920 Ga0439451_075188 3300042009 Bacteria 677
921 Ga0439455_0220570 3300042012 Bacteria 551
922 Ga0439463_077933 3300042016 Bacteria 851
923 Ga0450888_009755 3300042126 Bacteria 1102
924 Ga0439444_0023645 3300042437 Bacteria 1105
925 Ga0439464_0134370 3300042439 Bacteria 767
926 Ga0439460_0020566 3300042461 Bacteria 1795
927 Ga0439460_0374627 3300042461 Bacteria 504
928 Ga0439440_0157209 3300042993 Bacteria 654
929 Ga0466969_0001239 3300044656 Bacteria 13785
930 Ga0466969_0086127 3300044656 Bacteria 1493
931 Ga0466969_0229652 3300044656 Bacteria 843
932 Ga0466969_0436385 3300044656 Bacteria 595
933 Ga0466972_0016657 3300044658 Bacteria 3675
934 Ga0466965_0015721 3300044683 Bacteria 3596
935 Ga0466965_0109866 3300044683 Bacteria 1416
936 Ga0466966_0081999 3300044684 Bacteria 2007
937 Ga0466966_0095148 3300044684 Bacteria 1846
938 Ga0466966_0177618 3300044684 Bacteria 1292
939 Ga0466966_0216994 3300044684 Bacteria 1155
940 Ga0466966_0252379 3300044684 Bacteria 1062
941 Ga0466966_0275536 3300044684 Bacteria 1012
942 Ga0466966_0329691 3300044684 Bacteria 917
943 Ga0466961_0019216 3300044693 Bacteria 4398
944 Ga0466961_0027794 3300044693 Bacteria 3637
945 Ga0466961_0136405 3300044693 Bacteria 1537
946 Ga0466961_0181480 3300044693 Bacteria 1307
947 Ga0466961_0189684 3300044693 Bacteria 1274
948 Ga0466961_0461676 3300044693 Bacteria 768
949 Ga0466961_0610459 3300044693 Bacteria 656
950 Ga0466961_0624433 3300044693 Bacteria 647
951 Ga0466963_0012694 3300044694 Bacteria 5159
952 Ga0466963_0026856 3300044694 Bacteria 3683
953 Ga0466963_0029064 3300044694 Bacteria 3554
954 Ga0466963_0032315 3300044694 Bacteria 3388
955 Ga0466963_0051866 3300044694 Bacteria 2720
956 Ga0466963_0063868 3300044694 Bacteria 2465
957 Ga0466963_0074337 3300044694 Bacteria 2292
958 Ga0466963_0083780 3300044694 Bacteria 2163
959 Ga0466963_0398754 3300044694 Bacteria 970
960 Ga0466963_0466099 3300044694 Bacteria 891
961 Ga0466963_0576306 3300044694 Unclassified 795
962 Ga0466963_0806392 3300044694 Unclassified 662
963 Ga0466964_0009210 3300044706 Bacteria 3713
964 Ga0466964_0036923 3300044706 Bacteria 1961
965 Ga0466964_0055404 3300044706 Bacteria 1637
966 Ga0466964_0084912 3300044706 Bacteria 1366
967 Ga0466964_0085815 3300044706 Bacteria 1360
968 Ga0466964_0128566 3300044706 Bacteria 1151
969 Ga0466964_0213666 3300044706 Bacteria 933
970 Ga0466964_0572286 3300044706 Bacteria 616
971 Ga0466971_0000146 3300044719 Bacteria 26422
972 Ga0466971_0020229 3300044719 Bacteria 2959
973 Ga0466971_0104248 3300044719 Bacteria 1305
974 Ga0466971_0114361 3300044719 Bacteria 1247
975 Ga0466971_0302490 3300044719 Bacteria 768
976 Ga0466971_0643349 3300044719 Unclassified 531
977 Ga0466968_0002981 3300044735 Bacteria 6250
978 Ga0466968_0003980 3300044735 Bacteria 5488
979 Ga0466968_0129042 3300044735 Bacteria 1149
980 Ga0466968_0174426 3300044735 Bacteria 997
981 Ga0466968_0282069 3300044735 Bacteria 795
982 Ga0466968_0485114 3300044735 Bacteria 614
983 Ga0466968_0726008 3300044735 Bacteria 508
984 Ga0466970_0007704 3300044765 Bacteria 5403
985 Ga0466970_0024506 3300044765 Bacteria 3155
986 Ga0466970_0126304 3300044765 Bacteria 1403
987 Ga0466957_0007245 3300044842 Bacteria 6270
988 Ga0466957_0011691 3300044842 Bacteria 5074
989 Ga0466957_0038873 3300044842 Bacteria 2869
990 Ga0466957_0144937 3300044842 Bacteria 1532
991 Ga0466957_1002484 3300044842 Bacteria 600
992 Ga0466957_1350381 3300044842 Bacteria 518
993 Ga0466960_0119058 3300044901 Bacteria 1381
994 Ga0466960_0168032 3300044901 Bacteria 1182
995 Ga0466960_0185119 3300044901 Bacteria 1131
996 Ga0466960_0725852 3300044901 Archaea 597
997 Ga0466960_1043453 3300044901 Bacteria 503
998 Ga0466959_0043199 3300045049 Bacteria 3324
999 Ga0466959_0062730 3300045049 Bacteria 2700
1000 Ga0466959_0075226 3300045049 Bacteria 2440
1001 Ga0466959_0245574 3300045049 Bacteria 1235
1002 Ga0466959_0472047 3300045049 Bacteria 849
1003 Ga0451576_0228034 3300045051 Bacteria 1945
1004 Ga0451576_1046881 3300045051 Bacteria 855
1005 Ga0466958_0005202 3300045836 Bacteria 6970
1006 Ga0466958_0008076 3300045836 Bacteria 5822
1007 Ga0466958_0065001 3300045836 Bacteria 2226
1008 Ga0466967_0001223 3300045976 Bacteria 14490
1009 Ga0466967_0004614 3300045976 Bacteria 9336
1010 Ga0466967_0008381 3300045976 Bacteria 7566
1011 Ga0466967_0011834 3300045976 Bacteria 6636
1012 Ga0466967_0013205 3300045976 Bacteria 6369
1013 Ga0466967_0028771 3300045976 Bacteria 4644
1014 Ga0466967_0032874 3300045976 Bacteria 4385
1015 Ga0466967_0038514 3300045976 Bacteria 4101
1016 Ga0466967_0045188 3300045976 Bacteria 3825
1017 Ga0466967_0050959 3300045976 Bacteria 3626
1018 Ga0466967_0053989 3300045976 Bacteria 3534
1019 Ga0466967_0059430 3300045976 Bacteria 3384
1020 Ga0466967_0107548 3300045976 Bacteria 2558
1021 Ga0466967_0141347 3300045976 Bacteria 2242
1022 Ga0466967_0141755 3300045976 Bacteria 2239
1023 Ga0466967_0285519 3300045976 Unclassified 1584
1024 Ga0466967_0441151 3300045976 Unclassified 1271
1025 Ga0466967_0645628 3300045976 Bacteria 1046
1026 Ga0466967_1238436 3300045976 Bacteria 743
1027 Ga0466967_1366007 3300045976 Bacteria 706
1028 Ga0466967_1591840 3300045976 Bacteria 651
1029 Ga0466967_1705295 3300045976 Archaea 627
1030 Ga0466967_2314368 3300045976 Bacteria 533
1031 Ga0466967_2445211 3300045976 Bacteria 517
1032 Ga0495592_0035738 3300046454 Bacteria 3743
1033 Ga0495592_0158712 3300046454 Bacteria 1558
1034 Ga0495592_0173325 3300046454 Bacteria 1475
1035 Ga0495592_0203643 3300046454 Unclassified 1334
1036 Ga0495592_0511420 3300046454 Bacteria 744
1037 Ga0495592_0650144 3300046454 Bacteria 639
1038 Ga0495592_0713994 3300046454 Bacteria 602
1039 Ga0495592_0792038 3300046454 Bacteria 564
1040 Ga0495592_0829635 3300046454 Bacteria 547
1041 Ga0495603_0079558 3300046455 Bacteria 1921
1042 Ga0495603_0096109 3300046455 Bacteria 1731
1043 Ga0495603_0415376 3300046455 Bacteria 771
1044 Ga0495603_0562591 3300046455 Bacteria 653
1045 Ga0495603_0835772 3300046455 Bacteria 524
1046 Ga0495629_0000319 3300046459 Bacteria 41153
1047 Ga0495629_0020444 3300046459 Bacteria 4728
1048 Ga0495629_0046949 3300046459 Bacteria 3028
1049 Ga0495629_0155073 3300046459 Bacteria 1591
1050 Ga0495629_0201724 3300046459 Bacteria 1375
1051 Ga0495629_0380482 3300046459 Bacteria 960
1052 Ga0495641_0005764 3300046461 Bacteria 8229
1053 Ga0495641_0016039 3300046461 Bacteria 3962
1054 Ga0495641_0019178 3300046461 Bacteria 3509
1055 Ga0495641_0044455 3300046461 Bacteria 2049
1056 Ga0495641_0044716 3300046461 Bacteria 2041
1057 Ga0495641_0105938 3300046461 Bacteria 1254
1058 Ga0495641_0445532 3300046461 Bacteria 589
1059 Ga0495641_0459922 3300046461 Bacteria 579
1060 Ga0495651_0017133 3300046462 Bacteria 5614
1061 Ga0495651_0039212 3300046462 Bacteria 3688
1062 Ga0495651_0053665 3300046462 Bacteria 3102
1063 Ga0495651_0057032 3300046462 Bacteria 2999
1064 Ga0495651_0088314 3300046462 Bacteria 2330
1065 Ga0495651_0101621 3300046462 Bacteria 2139
1066 Ga0495651_0135760 3300046462 Bacteria 1790
1067 Ga0495651_0400102 3300046462 Bacteria 897
1068 Ga0495651_0483789 3300046462 Bacteria 795
1069 Ga0495651_0992152 3300046462 Bacteria 510
1070 Ga0495653_0012965 3300046463 Bacteria 6800
1071 Ga0495653_0013190 3300046463 Bacteria 6738
1072 Ga0495653_0041082 3300046463 Bacteria 3612
1073 Ga0495653_0087151 3300046463 Bacteria 2293
1074 Ga0495653_0093433 3300046463 Bacteria 2194
1075 Ga0495653_0095777 3300046463 Bacteria 2160
1076 Ga0495653_0222237 3300046463 Bacteria 1269
1077 Ga0495653_0539593 3300046463 Bacteria 723
1078 Ga0495653_0981299 3300046463 Unclassified 500
1079 Ga0495580_0025973 3300046472 Bacteria 4274
1080 Ga0495580_0248207 3300046472 Bacteria 1219
1081 Ga0495580_0663506 3300046472 Bacteria 685
1082 Ga0495582_0000358 3300046473 Bacteria 24948
1083 Ga0495582_0029168 3300046473 Bacteria 3028
1084 Ga0495582_0049271 3300046473 Bacteria 2319
1085 Ga0495582_0140278 3300046473 Bacteria 1369
1086 Ga0495582_0265089 3300046473 Bacteria 985
1087 Ga0495639_0002626 3300046475 Bacteria 7825
1088 Ga0495639_0008199 3300046475 Bacteria 4488
1089 Ga0495662_0002647 3300046476 Bacteria 9048
1090 Ga0495662_0004470 3300046476 Bacteria 7022
1091 Ga0495662_0014253 3300046476 Bacteria 3866
1092 Ga0495664_0047907 3300046477 Bacteria 2537
1093 Ga0495664_0080526 3300046477 Bacteria 1952
1094 Ga0495664_0234406 3300046477 Bacteria 1110
1095 Ga0495664_0340953 3300046477 Bacteria 903
1096 Ga0495664_0406201 3300046477 Bacteria 818
1097 Ga0495664_0504518 3300046477 Unclassified 722
1098 Ga0495664_0536658 3300046477 Bacteria 698
1099 Ga0495584_0008227 3300046491 Bacteria 5407
1100 Ga0495585_0024932 3300046492 Bacteria 3428
1101 Ga0495594_0008671 3300046499 Bacteria 5240
1102 Ga0495594_0041557 3300046499 Bacteria 2518
1103 Ga0495594_0446089 3300046499 Bacteria 736
1104 Ga0495594_0674514 3300046499 Bacteria 585
1105 Ga0495596_0034089 3300046500 Bacteria 2024
1106 Ga0495607_0026956 3300046501 Bacteria 3560
1107 Ga0495608_0003300 3300046511 Bacteria 11537
1108 Ga0495608_0011142 3300046511 Bacteria 6260
1109 Ga0495608_0015297 3300046511 Bacteria 5323
1110 Ga0495608_0148817 3300046511 Bacteria 1493
1111 Ga0495608_0163932 3300046511 Bacteria 1412
1112 Ga0495608_0165641 3300046511 Unclassified 1404
1113 Ga0495608_0377992 3300046511 Bacteria 869
1114 Ga0495608_0567253 3300046511 Bacteria 683
1115 Ga0495618_0027070 3300046514 Bacteria 3569
1116 Ga0495618_0230659 3300046514 Bacteria 1166
1117 Ga0495618_0306520 3300046514 Bacteria 986
1118 Ga0495618_0538243 3300046514 Unclassified 700
1119 Ga0495628_0003751 3300046516 Bacteria 13525
1120 Ga0495628_0040215 3300046516 Bacteria 3737
1121 Ga0495628_0042846 3300046516 Bacteria 3608
1122 Ga0495628_0107147 3300046516 Unclassified 2152
1123 Ga0495628_0221382 3300046516 Bacteria 1421
1124 Ga0495628_0233378 3300046516 Bacteria 1378
1125 Ga0495630_0020826 3300046517 Bacteria 4839
1126 Ga0495630_0020828 3300046517 Bacteria 4839
1127 Ga0495630_0026489 3300046517 Bacteria 4292
1128 Ga0495630_0038705 3300046517 Bacteria 3568
1129 Ga0495630_0043068 3300046517 Bacteria 3372
1130 Ga0495630_0053585 3300046517 Bacteria 3021
1131 Ga0495630_0203386 3300046517 Bacteria 1511
1132 Ga0495630_0307374 3300046517 Bacteria 1212
1133 Ga0495630_0729887 3300046517 Bacteria 757
1134 Ga0495630_0961931 3300046517 Bacteria 649
1135 Ga0495631_0039597 3300046518 Bacteria 2091
1136 Ga0495631_0067783 3300046518 Unclassified 1544
1137 Ga0495644_0000819 3300046523 Bacteria 12808
1138 Ga0495644_0084747 3300046523 Unclassified 1195
1139 Ga0495663_0200780 3300046525 Bacteria 696
1140 Ga0495666_0003469 3300046526 Bacteria 7961
1141 Ga0495666_0015670 3300046526 Bacteria 3775
1142 Ga0495666_0108113 3300046526 Bacteria 1307
1143 Ga0495666_0309813 3300046526 Unclassified 713
1144 Ga0495666_0478711 3300046526 Bacteria 557
1145 Ga0495642_0016114 3300046528 Bacteria 2911
1146 Ga0495652_0017796 3300046529 Bacteria 6342
1147 Ga0495652_0026148 3300046529 Bacteria 5158
1148 Ga0495652_0068899 3300046529 Bacteria 2962
1149 Ga0495652_0157109 3300046529 Bacteria 1770
1150 Ga0495652_0165410 3300046529 Bacteria 1712
1151 Ga0495652_0179986 3300046529 Bacteria 1623
1152 Ga0495652_0429953 3300046529 Bacteria 928
1153 Ga0495654_0451184 3300046530 Bacteria 506
1154 Ga0495665_0012337 3300046531 Bacteria 4623
1155 Ga0495665_0022839 3300046531 Bacteria 3359
1156 Ga0495665_0612094 3300046531 Bacteria 544
1157 Ga0495640_0010306 3300046533 Bacteria 7227
1158 Ga0495640_0039198 3300046533 Bacteria 3326
1159 Ga0495640_0118474 3300046533 Bacteria 1723
1160 Ga0495640_0132953 3300046533 Bacteria 1609
1161 Ga0495640_0598584 3300046533 Bacteria 666
1162 Ga0495586_0009166 3300046535 Bacteria 5266
1163 Ga0495586_0013906 3300046535 Bacteria 4271
1164 Ga0495586_0076673 3300046535 Bacteria 1832
1165 Ga0495587_0047960 3300046536 Unclassified 2531
1166 Ga0495587_0156001 3300046536 Bacteria 1300
1167 Ga0495587_0212471 3300046536 Bacteria 1092
1168 Ga0495587_0225081 3300046536 Bacteria 1057
1169 Ga0495587_0647488 3300046536 Bacteria 581
1170 Ga0495587_0708540 3300046536 Bacteria 552
1171 Ga0495598_0052258 3300046537 Unclassified 1234
1172 Ga0495609_0079067 3300046538 Bacteria 1439
1173 Ga0495645_0012470 3300046543 Bacteria 5988
1174 Ga0495645_0179639 3300046543 Bacteria 1451
1175 Ga0495645_0200208 3300046543 Bacteria 1355
1176 Ga0495645_0212942 3300046543 Bacteria 1304
1177 Ga0495645_0250567 3300046543 Archaea 1177
1178 Ga0495645_0402189 3300046543 Bacteria 872
1179 Ga0495645_0678808 3300046543 Unclassified 627
1180 Ga0495645_0741696 3300046543 Bacteria 593
1181 Ga0495622_0532799 3300046557 Bacteria 501
1182 Ga0495667_0015868 3300046559 Bacteria 5092
1183 Ga0495667_0019234 3300046559 Bacteria 4608
1184 Ga0495667_0028003 3300046559 Bacteria 3794
1185 Ga0495667_0070896 3300046559 Bacteria 2273
1186 Ga0495667_0130580 3300046559 Bacteria 1620
1187 Ga0495667_0134022 3300046559 Bacteria 1597
1188 Ga0495667_0529840 3300046559 Bacteria 737
1189 Ga0495667_0719244 3300046559 Bacteria 618
1190 Ga0495656_0000621 3300046615 Bacteria 11326
1191 Ga0495668_0149722 3300046616 Unclassified 1278
1192 Ga0495634_0003395 3300046642 Bacteria 12784
1193 Ga0495634_0028964 3300046642 Bacteria 3838
1194 Ga0495634_0610370 3300046642 Bacteria 632
1195 Ga0495634_0673166 3300046642 Bacteria 596
1196 Ga0495611_0069496 3300046648 Bacteria 1609
1197 Ga0495635_0021997 3300046663 Bacteria 4443
1198 Ga0495635_0050625 3300046663 Bacteria 2863
1199 Ga0495635_0067003 3300046663 Bacteria 2462
1200 Ga0495635_0166290 3300046663 Bacteria 1501
1201 Ga0495635_0654962 3300046663 Bacteria 683
1202 Ga0495659_0053108 3300046664 Unclassified 1480
1203 Ga0495661_0124357 3300046665 Unclassified 1421
1204 Ga0495588_0017973 3300046674 Bacteria 3443
1205 Ga0495657_0041962 3300046675 Bacteria 3127
1206 Ga0495657_0066345 3300046675 Bacteria 2371
1207 Ga0495657_0118277 3300046675 Bacteria 1671
1208 Ga0495657_0135637 3300046675 Unclassified 1538
1209 Ga0495657_0138910 3300046675 Bacteria 1516
1210 Ga0495657_0270660 3300046675 Bacteria 1018
1211 Ga0495657_0670295 3300046675 Bacteria 597
1212 Ga0495599_0020210 3300046678 Bacteria 4148
1213 Ga0495599_0066938 3300046678 Bacteria 2244
1214 Ga0495599_0130034 3300046678 Bacteria 1564
1215 Ga0495599_0138294 3300046678 Bacteria 1511
1216 Ga0495599_0613570 3300046678 Bacteria 633
1217 Ga0495623_0026708 3300046679 Bacteria 3715
1218 Ga0495623_0077461 3300046679 Bacteria 2061
1219 Ga0495623_0129369 3300046679 Bacteria 1513
1220 Ga0495623_0396815 3300046679 Bacteria 743
1221 Ga0495646_0091022 3300046680 Bacteria 1761
1222 Ga0495646_0118989 3300046680 Bacteria 1496
1223 Ga0495646_0178606 3300046680 Bacteria 1166
1224 Ga0495646_0269118 3300046680 Bacteria 908
1225 Ga0495646_0302686 3300046680 Bacteria 845
1226 Ga0495647_0002047 3300046681 Bacteria 6312
1227 Ga0495647_0107647 3300046681 Bacteria 1160
1228 Ga0495658_0000384 3300046683 Bacteria 24849
1229 Ga0495658_0000524 3300046683 Bacteria 20922
1230 Ga0495658_0009679 3300046683 Bacteria 4806
1231 Ga0495658_0023104 3300046683 Bacteria 3298
1232 Ga0495658_0039216 3300046683 Bacteria 2627
1233 Ga0495658_0422204 3300046683 Bacteria 851
1234 Ga0495658_0524731 3300046683 Bacteria 758
1235 Ga0495658_0952835 3300046683 Bacteria 548
1236 Ga0495669_0270881 3300046684 Bacteria 816
1237 Ga0495613_0012745 3300046689 Bacteria 6250
1238 Ga0495613_0047516 3300046689 Bacteria 3171
1239 Ga0495613_0049317 3300046689 Bacteria 3107
1240 Ga0495613_0131009 3300046689 Unclassified 1796
1241 Ga0495613_0213620 3300046689 Bacteria 1356
1242 Ga0495613_0330458 3300046689 Bacteria 1051
1243 Ga0495613_0422686 3300046689 Bacteria 906
1244 Ga0495613_0632479 3300046689 Bacteria 709
1245 Ga0495613_0727805 3300046689 Unclassified 651
1246 Ga0495624_0023590 3300046690 Bacteria 4056
1247 Ga0495624_0025679 3300046690 Bacteria 3866
1248 Ga0495624_0116212 3300046690 Bacteria 1644
1249 Ga0495624_0138164 3300046690 Bacteria 1493
1250 Ga0495624_0668369 3300046690 Bacteria 617
1251 Ga0495670_0029338 3300046691 Unclassified 2730
1252 Ga0495671_0139557 3300046692 Bacteria 1181
1253 Ga0495589_0030160 3300046794 Bacteria 2732
1254 Ga0495589_0050413 3300046794 Bacteria 2059
1255 Ga0495600_0043381 3300046809 Bacteria 2933
1256 Ga0495600_0048692 3300046809 Bacteria 2764
1257 Ga0495600_0094000 3300046809 Bacteria 1955
1258 Ga0495600_0131471 3300046809 Bacteria 1627
1259 Ga0495600_0163468 3300046809 Bacteria 1438
1260 Ga0495600_0223988 3300046809 Bacteria 1202
1261 Ga0495600_0365700 3300046809 Bacteria 902
1262 Ga0495581_0001964 3300047315 Bacteria 11525
1263 Ga0495581_0003702 3300047315 Bacteria 8805
1264 Ga0495581_0006490 3300047315 Bacteria 6784
1265 Ga0495581_0120733 3300047315 Bacteria 1525
1266 Ga0495581_0769062 3300047315 Bacteria 553
1267 Ga0495604_0016942 3300047317 Bacteria 5827
1268 Ga0495604_0078805 3300047317 Bacteria 2472
1269 Ga0495604_0144390 3300047317 Bacteria 1697
1270 Ga0495604_0184191 3300047317 Bacteria 1459
1271 Ga0495604_0836230 3300047317 Bacteria 578
1272 Ga0495604_0869029 3300047317 Bacteria 565
1273 Ga0495636_0124034 3300047318 Unclassified 1145
1274 Ga0495674_0001135 3300047319 Bacteria 25640
1275 Ga0495674_0075986 3300047319 Bacteria 2889
1276 Ga0495674_0078674 3300047319 Bacteria 2833
1277 Ga0495674_0082781 3300047319 Bacteria 2751
1278 Ga0495674_0110059 3300047319 Bacteria 2336
1279 Ga0495674_0403700 3300047319 Bacteria 1103
1280 Ga0495674_0411608 3300047319 Unclassified 1090
1281 Ga0495674_0481669 3300047319 Bacteria 994
1282 Ga0495674_0621061 3300047319 Bacteria 854
1283 Ga0495674_0794857 3300047319 Bacteria 736
1284 Ga0495676_0005182 3300047321 Bacteria 11930
1285 Ga0495676_0028449 3300047321 Bacteria 4771
1286 Ga0495676_0074178 3300047321 Bacteria 2606
1287 Ga0495676_0130524 3300047321 Bacteria 1814
1288 Ga0495676_0287725 3300047321 Unclassified 1111
1289 Ga0495676_0531132 3300047321 Bacteria 770
1290 Ga0495676_0705796 3300047321 Bacteria 652
1291 Ga0495680_0006719 3300047322 Bacteria 10637
1292 Ga0495680_0007716 3300047322 Bacteria 9827
1293 Ga0495680_0028462 3300047322 Bacteria 4581
1294 Ga0495680_0043380 3300047322 Bacteria 3561
1295 Ga0495680_0074473 3300047322 Bacteria 2578
1296 Ga0495680_0179393 3300047322 Bacteria 1529
1297 Ga0495680_0239931 3300047322 Bacteria 1288
1298 Ga0495680_0264061 3300047322 Bacteria 1217
1299 Ga0495680_0336184 3300047322 Bacteria 1054
1300 Ga0495680_0337949 3300047322 Bacteria 1051
1301 Ga0495675_0093658 3300047444 Bacteria 1884
1302 Ga0495675_0221340 3300047444 Bacteria 1145
1303 Ga0495675_0316570 3300047444 Bacteria 924
1304 Ga0495675_0353554 3300047444 Bacteria 864
1305 Ga0495677_0046016 3300047445 Unclassified 1601
1306 Ga0495677_0336518 3300047445 Unclassified 595
1307 Ga0495679_017240 3300047446 Bacteria 2589
1308 Ga0495684_0004315 3300047471 Bacteria 11107
1309 Ga0495684_0004656 3300047471 Bacteria 10704
1310 Ga0495684_0020981 3300047471 Bacteria 5032
1311 Ga0495684_0041920 3300047471 Bacteria 3507
1312 Ga0495684_0077843 3300047471 Bacteria 2516
1313 Ga0495684_0214846 3300047471 Bacteria 1412
1314 Ga0495684_0272699 3300047471 Bacteria 1223
1315 Ga0495684_0344121 3300047471 Bacteria 1060
1316 Ga0495684_0455250 3300047471 Bacteria 888
1317 Ga0495684_0937321 3300047471 Bacteria 555
1318 Ga0495593_0005983 3300047673 Bacteria 7167
1319 Ga0495593_0011644 3300047673 Bacteria 5047
1320 Ga0495593_0022099 3300047673 Bacteria 3549
1321 Ga0495593_0113318 3300047673 Bacteria 1384
1322 Ga0495593_0161965 3300047673 Unclassified 1129
1323 Ga0495602_0028615 3300048088 Bacteria 5328
1324 Ga0495602_0031949 3300048088 Bacteria 4965
1325 Ga0495602_0056851 3300048088 Bacteria 3437
1326 Ga0495602_0060318 3300048088 Bacteria 3306
1327 Ga0495602_0120423 3300048088 Bacteria 2112
1328 Ga0495602_0132534 3300048088 Bacteria 1985
1329 Ga0495614_0000691 3300048089 Bacteria 14197
1330 Ga0495614_0006789 3300048089 Bacteria 5121
1331 Ga0495614_0018916 3300048089 Bacteria 2982
1332 Ga0495614_0158272 3300048089 Bacteria 1013
1333 Ga0496100_0005889 3300048903 Bacteria 6639
1334 Ga0496100_0021727 3300048903 Bacteria 3871
1335 Ga0496100_0034383 3300048903 Bacteria 3180
1336 Ga0496100_0065983 3300048903 Bacteria 2400
1337 Ga0496100_0118634 3300048903 Bacteria 1848
1338 Ga0496100_0188443 3300048903 Bacteria 1496
1339 Ga0496100_0641605 3300048903 Bacteria 826
1340 Ga0496100_0847498 3300048903 Bacteria 717
1341 Ga0496101_0004773 3300048904 Bacteria 8596
1342 Ga0496101_0010082 3300048904 Bacteria 6228
1343 Ga0496101_0017360 3300048904 Bacteria 4883
1344 Ga0496101_0113060 3300048904 Bacteria 2046
1345 Ga0496101_0164776 3300048904 Bacteria 1701
1346 Ga0496101_0173111 3300048904 Bacteria 1660
1347 Ga0496101_0316791 3300048904 Bacteria 1223
1348 Ga0496101_0602657 3300048904 Bacteria 868
1349 Ga0496101_0790314 3300048904 Bacteria 748
1350 Ga0496102_0009192 3300048905 Bacteria 8479
1351 Ga0496102_0030938 3300048905 Bacteria 4794
1352 Ga0496102_0048111 3300048905 Bacteria 3877
1353 Ga0496102_0102048 3300048905 Bacteria 2666
1354 Ga0496102_0135068 3300048905 Bacteria 2311
1355 Ga0496102_0526804 3300048905 Bacteria 1104
1356 Ga0496102_0636690 3300048905 Bacteria 989
1357 Ga0496102_1175197 3300048905 Bacteria 687
1358 Ga0496102_1497545 3300048905 Bacteria 593
1359 Ga0496103_0030622 3300048906 Bacteria 3275
1360 Ga0496103_0047524 3300048906 Bacteria 2652
1361 Ga0496103_0115083 3300048906 Bacteria 1710
1362 Ga0496103_0327252 3300048906 Unclassified 986
1363 Ga0496103_0440962 3300048906 Bacteria 835
1364 Ga0496103_0496524 3300048906 Bacteria 781
1365 Ga0496104_0056464 3300048907 Bacteria 3713
1366 Ga0496104_0108756 3300048907 Bacteria 2657
1367 Ga0496104_0332452 3300048907 Bacteria 1432
1368 Ga0496104_0344961 3300048907 Bacteria 1402
1369 Ga0496104_0760558 3300048907 Bacteria 876
1370 Ga0496104_1032935 3300048907 Bacteria 726
1371 Ga0496104_1267007 3300048907 Bacteria 640
1372 Ga0496105_0001696 3300048908 Bacteria 15709
1373 Ga0496105_0010820 3300048908 Bacteria 7185
1374 Ga0496105_0030988 3300048908 Bacteria 4384
1375 Ga0496105_0048434 3300048908 Bacteria 3508
1376 Ga0496106_0001537 3300048909 Bacteria 17362
1377 Ga0496106_0019337 3300048909 Bacteria 5050
1378 Ga0496106_0020948 3300048909 Bacteria 4851
1379 Ga0496106_0065848 3300048909 Bacteria 2758
1380 Ga0496106_0123701 3300048909 Unclassified 2024
1381 Ga0496106_0131775 3300048909 Bacteria 1961
1382 Ga0496106_0546781 3300048909 Bacteria 929
1383 Ga0496106_1221713 3300048909 Unclassified 586
1384 Ga0496106_1361551 3300048909 Bacteria 549
1385 Ga0496106_1531462 3300048909 Bacteria 512
1386 Ga0496107_0003573 3300048910 Bacteria 10418
1387 Ga0496107_0003674 3300048910 Bacteria 10313
1388 Ga0496107_0013371 3300048910 Bacteria 5735
1389 Ga0496107_0052027 3300048910 Bacteria 2955
1390 Ga0496107_0122346 3300048910 Bacteria 1917
1391 Ga0496107_0229417 3300048910 Bacteria 1381
1392 Ga0496107_0908368 3300048910 Bacteria 642
1393 Ga0496107_0920011 3300048910 Bacteria 637
1394 Ga0496107_0959269 3300048910 Bacteria 622
1395 Ga0496108_0006227 3300048911 Bacteria 9662
1396 Ga0496108_0018620 3300048911 Bacteria 5689
1397 Ga0496108_0055610 3300048911 Bacteria 3323
1398 Ga0496108_0080618 3300048911 Bacteria 2757
1399 Ga0496108_0081016 3300048911 Bacteria 2751
1400 Ga0496108_0113016 3300048911 Bacteria 2324
1401 Ga0496108_0331971 3300048911 Bacteria 1326
1402 Ga0496108_0778285 3300048911 Unclassified 826
1403 Ga0496108_1262390 3300048911 Bacteria 623
1404 Ga0496109_0002950 3300048912 Bacteria 14231
1405 Ga0496109_0004692 3300048912 Bacteria 11405
1406 Ga0496109_0011347 3300048912 Bacteria 7656
1407 Ga0496109_0032736 3300048912 Bacteria 4675
1408 Ga0496109_0086639 3300048912 Bacteria 2892
1409 Ga0496109_0098361 3300048912 Bacteria 2712
1410 Ga0496109_0160980 3300048912 Bacteria 2103
1411 Ga0496109_0301307 3300048912 Bacteria 1511
1412 Ga0496109_0429484 3300048912 Bacteria 1248
1413 Ga0496110_0002127 3300048913 Bacteria 14790
1414 Ga0496110_0037596 3300048913 Bacteria 4208
1415 Ga0496110_0041284 3300048913 Bacteria 4025
1416 Ga0496110_0053559 3300048913 Bacteria 3548
1417 Ga0496110_0472601 3300048913 Bacteria 1142
1418 Ga0496110_0613109 3300048913 Bacteria 987
1419 Ga0496110_1098716 3300048913 Bacteria 703
1420 Ga0496110_1519316 3300048913 Bacteria 579
1421 Ga0496110_1555457 3300048913 Bacteria 571
1422 Ga0496111_0007535 3300048914 Bacteria 7139
1423 Ga0496111_0036550 3300048914 Bacteria 3512
1424 Ga0496111_0036562 3300048914 Bacteria 3512
1425 Ga0496111_0092384 3300048914 Bacteria 2218
1426 Ga0496111_0354599 3300048914 Unclassified 1086
1427 Ga0496111_0428138 3300048914 Unclassified 977
1428 Ga0496111_0460682 3300048914 Bacteria 938
1429 Ga0496111_0512502 3300048914 Bacteria 882
1430 Ga0496112_0025388 3300048915 Bacteria 5689
1431 Ga0496112_0026036 3300048915 Bacteria 5623
1432 Ga0496112_0038757 3300048915 Bacteria 4655
1433 Ga0496112_0041236 3300048915 Bacteria 4516
1434 Ga0496112_0059478 3300048915 Bacteria 3765
1435 Ga0496112_0089385 3300048915 Bacteria 3048
1436 Ga0496112_0137906 3300048915 Bacteria 2409
1437 Ga0496112_0497010 3300048915 Bacteria 1155
1438 Ga0496112_0805827 3300048915 Bacteria 864
1439 Ga0496112_0825980 3300048915 Bacteria 851
1440 Ga0496112_1490299 3300048915 Bacteria 590
1441 Ga0496113_0001497 3300048916 Bacteria 13072
1442 Ga0496113_0006676 3300048916 Bacteria 7341
1443 Ga0496113_0077158 3300048916 Bacteria 2547
1444 Ga0496113_0094321 3300048916 Bacteria 2312
1445 Ga0496113_0103619 3300048916 Bacteria 2207
1446 Ga0496113_0292209 3300048916 Bacteria 1304
1447 Ga0496113_0521227 3300048916 Bacteria 954
1448 Ga0496113_0870526 3300048916 Bacteria 714
1449 Ga0496114_0013258 3300048917 Bacteria 6607
1450 Ga0496114_0022160 3300048917 Bacteria 5174
1451 Ga0496114_0071029 3300048917 Bacteria 2925
1452 Ga0496114_0216049 3300048917 Bacteria 1682
1453 Ga0496114_0340987 3300048917 Bacteria 1325
1454 Ga0496115_0001529 3300048918 Bacteria 16618
1455 Ga0496115_0007349 3300048918 Bacteria 8105
1456 Ga0496115_0058429 3300048918 Bacteria 3103
1457 Ga0496115_0075125 3300048918 Bacteria 2745
1458 Ga0496115_0077920 3300048918 Bacteria 2696
1459 Ga0496115_0783067 3300048918 Bacteria 743
1460 Ga0501037_0419028 3300049573 Unclassified 917
1461 Ga0501041_0365965 3300049577 Bacteria 912
1462 Ga0501043_0977394 3300049579 Bacteria 604
1463 Ga0501046_0257850 3300049580 Bacteria 1282
1464 Ga0501047_0080204 3300049581 Bacteria 3137
1465 Ga0501047_0087698 3300049581 Bacteria 2989
1466 Ga0501047_1190645 3300049581 Bacteria 575
1467 Ga0501069_0056205 3300049585 Bacteria 2192
1468 Ga0501069_0478991 3300049585 Unclassified 741
1469 Ga0501069_0660168 3300049585 Unclassified 630
1470 Ga0501070_0057784 3300049586 Bacteria 3216
1471 Ga0501070_0130602 3300049586 Unclassified 2075
1472 Ga0501070_0355886 3300049586 Bacteria 1188
1473 Ga0501070_0986885 3300049586 Unclassified 654
1474 Ga0501073_0738806 3300049589 Archaea 679
1475 Ga0501074_0027630 3300049590 Bacteria 4114
1476 Ga0501074_0087495 3300049590 Bacteria 2231
1477 Ga0501074_0217452 3300049590 Bacteria 1361
1478 Ga0501074_0991744 3300049590 Bacteria 591
1479 Ga0501075_1384021 3300049591 Unclassified 533
1480 Ga0501079_0833461 3300049741 Unclassified 726
1481 Ga0501080_0173707 3300049742 Bacteria 1986
1482 Ga0501080_0204460 3300049742 Bacteria 1812
1483 Ga0501080_0435972 3300049742 Bacteria 1176
1484 Ga0501080_0602270 3300049742 Bacteria 975
1485 Ga0501080_1026315 3300049742 Bacteria 714
1486 Ga0501044_0153939 3300049823 Bacteria 2280
1487 Ga0501044_0356336 3300049823 Unclassified 1382
1488 nmdc:mga03683_4155_c1 3300050489 Bacteria 4764
1489 nmdc:mga00v17_2661_c1 3300050491 Bacteria 9158
1490 nmdc:mga00v17_539352_c1 3300050491 Bacteria 755
1491 nmdc:mga0yw44_2792_c1 3300050492 Bacteria 7562
1492 nmdc:mga0yw44_66374_c1 3300050492 Bacteria 2226
1493 nmdc:mga05p37_16425_c1 3300050507 Bacteria 8920
1494 nmdc:mga05p37_308233_c1 3300050507 Bacteria 1878
1495 nmdc:mga05p37_377420_c1 3300050507 Bacteria 1662
1496 nmdc:mga05p37_75954_c1 3300050507 Bacteria 4136
1497 nmdc:mga09592_10288_c1 3300050508 Bacteria 7614
1498 nmdc:mga09592_131509_c1 3300050508 Bacteria 2153
1499 nmdc:mga0qj67_105438_c1 3300050509 Bacteria 2274
1500 nmdc:mga0qj67_11246_c1 3300050509 Bacteria 6705
1501 nmdc:mga06r32_32372_c1 3300050510 Bacteria 4919
1502 nmdc:mga08y16_2037963_c1 3300050511 Bacteria 522
1503 nmdc:mga08y16_221705_c1 3300050511 Bacteria 1957
1504 nmdc:mga08y16_6427_c1 3300050511 Bacteria 12320
1505 nmdc:mga0n895_12158_c1 3300050512 Bacteria 7706
1506 nmdc:mga0n895_17465_c1 3300050512 Bacteria 6611
1507 nmdc:mga0n895_1973348_c1 3300050512 Bacteria 542
1508 nmdc:mga0n895_742320_c1 3300050512 Bacteria 975
1509 nmdc:mga0rr50_1486_c1 3300050513 Bacteria 12869
1510 nmdc:mga0rr50_177413_c1 3300050513 Unclassified 1740
1511 nmdc:mga0rr50_789695_c1 3300050513 Bacteria 810
1512 nmdc:mga08x19_23986_c1 3300050514 Bacteria 3787
1513 nmdc:mga0a205_216343_c1 3300050515 Bacteria 1803
1514 nmdc:mga0a205_572458_c1 3300050515 Bacteria 984
1515 nmdc:mga0a205_99370_c2 3300050515 Bacteria 1778
1516 Ga0495601_0005905 3300053077 Bacteria 7137
1517 Ga0495601_0024199 3300053077 Bacteria 3739
1518 Ga0495601_0025101 3300053077 Bacteria 3674
1519 Ga0495601_0032047 3300053077 Bacteria 3269
1520 Ga0495601_0033861 3300053077 Bacteria 3184
1521 Ga0495601_0072282 3300053077 Bacteria 2203
1522 Ga0495601_0126065 3300053077 Bacteria 1666
1523 Ga0495601_0147281 3300053077 Bacteria 1537
1524 Ga0495601_0228999 3300053077 Bacteria 1214
1525 Ga0495601_0263034 3300053077 Archaea 1126
1526 Ga0495601_0526895 3300053077 Bacteria 761
1527 Ga0495612_0001993 3300053078 Bacteria 8410
1528 Ga0495612_0004267 3300053078 Bacteria 5938
1529 Ga0495612_0034396 3300053078 Bacteria 2052
1530 Ga0495612_0092270 3300053078 Bacteria 1283
1531 Ga0495612_0159110 3300053078 Bacteria 985
1532 Ga0495612_0182099 3300053078 Unclassified 923
1533 Ga0495612_0371877 3300053078 Bacteria 647
1534 Ga0495655_0002920 3300053083 Bacteria 2763
1535 Ga0495655_0044265 3300053083 Bacteria 1151
1536 Ga0495595_0034469 3300053084 Bacteria 2289
1537 Ga0495595_0072720 3300053084 Bacteria 1627
1538 Ga0495595_0239949 3300053084 Bacteria 906
1539 Ga0495595_0363342 3300053084 Bacteria 731
1540 Ga0495619_0002851 3300053085 Bacteria 11265
1541 Ga0495619_0011960 3300053085 Bacteria 5467
1542 Ga0495619_0015294 3300053085 Bacteria 4853
1543 Ga0495619_0149861 3300053085 Bacteria 1609
1544 Ga0495619_0155557 3300053085 Bacteria 1577
1545 Ga0495619_0213204 3300053085 Bacteria 1337
1546 Ga0495619_0237608 3300053085 Bacteria 1263
1547 Ga0495619_0281800 3300053085 Bacteria 1152
1548 Ga0495619_0348624 3300053085 Bacteria 1024
1549 Ga0495619_0736827 3300053085 Bacteria 669
1550 Ga0495619_0923709 3300053085 Bacteria 586
1551 Ga0500566_0035762 3300053094 Bacteria 2885
1552 Ga0500657_152291 3300053728 Bacteria 856
1553 Ga0587093_086003 3300059478 Bacteria 549
1554 Ga0587066_031106 3300059490 Bacteria 952
1555 Ga0587073_0227976 3300059492 Bacteria 573
1556 Ga0587082_176197 3300059504 Bacteria 521
1557 Ga0587086_101637 3300059507 Bacteria 530
1558 Ga0587094_077601 3300059513 Bacteria 609
1559 Ga0587076_176811 3300059645 Bacteria 535
1560 Ga0587078_046469 3300059646 Bacteria 627
1561 Ga0587111_0259867 3300060346 Bacteria 517
1562 Ga0501082_1259361 3300060353 Bacteria 646
1563 Ga0466962_0000557 3300061719 Bacteria 16369
1564 Ga0466962_0010989 3300061719 Bacteria 4357
1565 Ga0466962_0089495 3300061719 Bacteria 1474
1566 Ga0466962_0143270 3300061719 Bacteria 1158
1567 Ga0530510_0665322 3300061734 Bacteria 793
1568 Ga0070665_101648752
1569 JGI24745J21846_1044921
1570 JGI24751J29686_10093367
1571 JGI25406J46586_10074125
1572 JGI25407J50210_10001838
1573 JGI25407J50210_10050282
1574 Ga0058860_11557948
1575 Ga0058862_12802645
1576 Ga0070658_10028387
1577 Ga0070658_10055724
1578 Ga0070658_10241315
1579 Ga0070658_10874173
1580 Ga0070658_10928036
1581 Ga0070658_11669185
1582 Ga0070676_10329984
1583 Ga0070683_100001516
1584 Ga0070683_100029653
1585 Ga0070683_100035623
1586 Ga0070683_100111966
1587 Ga0070683_100171298
1588 Ga0070683_100376993
1589 Ga0070683_100380765
1590 Ga0070683_100634376
1591 Ga0070683_101285424
1592 Ga0070690_100122327
1593 Ga0068869_100207731
1594 Ga0070666_10345719
1595 Ga0070680_100039688
1596 Ga0070680_100045740
1597 Ga0070680_100076876
1598 Ga0070680_100308652
1599 Ga0070680_100354486
1600 Ga0070680_100444143
1601 Ga0070680_100814745
1602 Ga0070682_100030117
1603 Ga0070682_100039818
1604 Ga0070682_100161528
1605 Ga0070682_100412646
1606 Ga0070682_100691774
1607 Ga0068868_100029603
1608 Ga0068868_100196838
1609 Ga0068868_100647292
1610 Ga0068868_100817442
1611 Ga0070660_100004468
1612 Ga0070660_100012056
1613 Ga0070660_100015792
1614 Ga0070660_100152860
1615 Ga0070660_100240780
1616 Ga0070660_100257799
1617 Ga0070660_100282045
1618 Ga0070660_101007098
1619 Ga0070660_101724037
1620 Ga0070660_101892336
1621 Ga0070691_10372336
1622 Ga0070687_100218855
1623 Ga0070661_100028090
1624 Ga0070661_100070321
1625 Ga0070661_100083059
1626 Ga0070661_100349907
1627 Ga0070661_100371690
1628 Ga0070692_10044626
1629 Ga0070692_10415147
1630 Ga0070692_10514878
1631 Ga0070668_101012507
1632 Ga0070668_101268023
1633 Ga0070669_100489098
1634 Ga0070669_101436324
1635 Ga0070675_100552983
1636 Ga0070671_100124421
1637 Ga0070671_100298766
1638 Ga0070671_101544417
1639 Ga0070674_100514219
1640 Ga0070674_100631193
1641 Ga0070674_100838163
1642 Ga0070674_101022002
1643 Ga0070673_100152090
1644 Ga0070673_100457354
1645 Ga0070659_100011172
1646 Ga0070659_100059278
1647 Ga0070659_100101278
1648 Ga0070659_100472951
1649 Ga0070659_100537230
1650 Ga0070659_100773535
1651 Ga0070659_101336304
1652 Ga0070667_100053537
1653 Ga0070667_100753195
1654 Ga0070667_101743527
1655 Ga0070703_10152108
1656 Ga0070709_10154889
1657 Ga0070709_10446823
1658 Ga0070709_10915842
1659 Ga0070714_100065808
1660 Ga0070714_100156636
1661 Ga0070714_100211025
1662 Ga0070714_100296920
1663 Ga0070714_100440365
1664 Ga0070714_100586619
1665 Ga0070714_100701066
1666 Ga0070714_100846378
1667 Ga0070714_102441497
1668 Ga0070713_100146523
1669 Ga0070713_100466365
1670 Ga0070713_100610162
1671 Ga0070713_100618289
1672 Ga0070713_100629333
1673 Ga0070713_101019495
1674 Ga0070713_101202094
1675 Ga0070710_10220109
1676 Ga0070710_10309292
1677 Ga0070710_10334452
1678 Ga0070710_10862529
1679 Ga0070711_100117659
1680 Ga0070711_100914177
1681 Ga0070705_100292153
1682 Ga0070705_100703648
1683 Ga0070700_100053755
1684 Ga0070694_100692249
1685 Ga0070708_100350711
1686 Ga0070708_100465996
1687 Ga0070663_100348312
1688 Ga0070663_100631146
1689 Ga0070678_100357970
1690 Ga0070678_100531188
1691 Ga0070678_100658671
1692 Ga0070662_100175470
1693 Ga0070662_100393289
1694 Ga0070681_10001211
1695 Ga0070681_10005563
1696 Ga0070681_10015890
1697 Ga0070681_10055397
1698 Ga0070681_10095959
1699 Ga0070681_10098288
1700 Ga0070681_10103113
1701 Ga0070681_10236761
1702 Ga0070681_10262891
1703 Ga0070681_10702216
1704 Ga0068867_100244821
1705 Ga0068867_100412508
1706 Ga0068867_101334033
1707 Ga0070685_10462594
1708 Ga0070706_100454381
1709 Ga0070706_100981740
1710 Ga0070707_100013228
1711 Ga0070707_100234246
1712 Ga0070707_100256792
1713 Ga0070707_101299773
1714 Ga0070698_100393156
1715 Ga0070698_100824819
1716 Ga0070698_100946414
1717 Ga0070699_100960595
1718 Ga0070699_101054283
1719 Ga0070679_100023485
1720 Ga0070679_100028786
1721 Ga0070679_100044117
1722 Ga0070679_100074158
1723 Ga0070679_100078979
1724 Ga0070679_100097560
1725 Ga0070679_100144665
1726 Ga0070679_100439485
1727 Ga0070679_100449217
1728 Ga0070679_100704477
1729 Ga0070679_101380529
1730 Ga0070684_100073692
1731 Ga0070684_100076788
1732 Ga0070684_100088473
1733 Ga0070684_100100256
1734 Ga0070684_100145817
1735 Ga0070684_100185966
1736 Ga0070684_100233221
1737 Ga0070684_100257576
1738 Ga0070684_100295381
1739 Ga0070684_100651207
1740 Ga0070684_100735393
1741 Ga0070684_101696973
1742 Ga0070697_100668972
1743 Ga0070697_101343215
1744 Ga0068853_100092361
1745 Ga0068853_100153614
1746 Ga0068853_100345781
1747 Ga0068853_100633656
1748 Ga0068853_100775610
1749 Ga0068853_101955753
1750 Ga0070686_100025331
1751 Ga0070686_101059878
1752 Ga0070695_101822495
1753 Ga0070696_100023949
1754 Ga0070696_100411062
1755 Ga0070693_100038554
1756 Ga0070693_101205163
1757 Ga0070665_100138441
1758 Ga0070665_101059052
1759 Ga0070704_100299843
1760 Ga0070704_100574204
1761 Ga0068855_100004804
1762 Ga0068855_100008572
1763 Ga0068855_100058196
1764 Ga0068855_100065367
1765 Ga0068855_100206562
1766 Ga0068855_100735769
1767 Ga0068855_101002323
1768 Ga0068855_101254480
1769 Ga0068855_102177613
1770 Ga0070664_100619862
1771 Ga0070664_100906309
1772 Ga0068857_100150005
1773 Ga0068857_100153277
1774 Ga0068857_100213181
1775 Ga0068857_101962732
1776 Ga0068857_102282732
1777 Ga0068854_100025573
1778 Ga0068854_100286661
1779 Ga0068854_100419470
1780 Ga0068854_100483671
1781 Ga0068856_100009219
1782 Ga0068856_100085826
1783 Ga0068856_100150263
1784 Ga0068856_100212757
1785 Ga0068856_100362727
1786 Ga0068856_100369909
1787 Ga0068856_100846343
1788 Ga0068856_100944227
1789 Ga0068856_101832812
1790 Ga0070702_100022737
1791 Ga0070702_100182944
1792 Ga0070702_100684676
1793 Ga0068852_100042747
1794 Ga0068852_100149182
1795 Ga0068852_100248987
1796 Ga0068852_100308947
1797 Ga0068852_100401410
1798 Ga0068852_100807201
1799 Ga0068852_101121458
1800 Ga0068852_101276914
1801 Ga0068859_100109888
1802 Ga0068859_101913362
1803 Ga0068864_100053294
1804 Ga0068851_10847368
1805 Ga0068870_10111205
1806 Ga0068863_100100332
1807 Ga0068863_100364443
1808 Ga0068858_100063116
1809 Ga0068858_100579812
1810 Ga0068858_100725042
1811 Ga0068858_101789113
1812 Ga0068860_100260411
1813 Ga0068862_100333315
1814 Ga0081455_10007900
1815 Ga0081455_10021298
1816 Ga0081455_10025744
1817 Ga0081455_10045022
1818 Ga0081455_10083659
1819 Ga0081538_10000231
1820 Ga0081538_10000286
1821 Ga0081538_10000667
1822 Ga0081538_10003199
1823 Ga0081538_10019178
1824 Ga0081538_10146137
1825 Ga0081538_10186440
1826 Ga0081539_10002640
1827 Ga0081539_10007140
1828 Ga0070717_10138093
1829 Ga0070717_10162415
1830 Ga0070717_10187047
1831 Ga0070717_10197165
1832 Ga0070717_10246830
1833 Ga0070717_10423215
1834 Ga0070717_10886661
1835 Ga0070717_11067375
1836 Ga0070717_12044071
1837 Ga0075365_10003335
1838 Ga0075365_10172134
1839 Ga0075364_10005953
1840 Ga0075364_10193774
1841 Ga0075432_10005425
1842 Ga0070715_10398117
1843 Ga0070716_100095303
1844 Ga0070716_100197571
1845 Ga0070716_100821040
1846 Ga0070716_101239129
1847 Ga0070716_101252303
1848 Ga0070712_100064422
1849 Ga0070712_100341536
1850 Ga0070712_100487553
1851 Ga0070712_101212035
1852 Ga0070712_101843277
1853 Ga0075362_10037347
1854 Ga0097621_100248969
1855 Ga0097621_100590075
1856 Ga0068871_100082631
1857 Ga0068871_100394802
1858 Ga0075428_100018520
1859 Ga0075428_101221317
1860 Ga0075428_101264870
1861 Ga0075430_100008779
1862 Ga0075430_100204470
1863 Ga0075431_100052006
1864 Ga0075433_10070060
1865 Ga0075433_10236764
1866 Ga0075433_10495187
1867 Ga0075434_100004007
1868 Ga0075434_100004302
1869 Ga0075434_100519808
1870 Ga0075434_100878070
1871 Ga0075434_100972858
1872 Ga0075429_100007741
1873 Ga0075429_100104603
1874 Ga0075429_100571160
1875 Ga0068865_100291903
1876 Ga0068865_100372099
1877 Ga0068865_101000769
1878 Ga0075436_100002762
1879 Ga0075436_100487400
1880 Ga0097620_100109888
1881 Ga0097620_101913508
1882 Ga0075435_100003383
1883 Ga0075435_100022089
1884 Ga0075435_100148659
1885 Ga0075435_100955641
1886 Ga0105240_10014640
1887 Ga0105240_10086768
1888 Ga0105240_10169048
1889 Ga0105240_10590980
1890 Ga0105240_11331915
1891 Ga0111539_10019934
1892 Ga0111539_10585994
1893 Ga0105245_10021132
1894 Ga0105245_10047644
1895 Ga0105245_10079582
1896 Ga0105245_10264161
1897 Ga0105245_10407871
1898 Ga0105245_10531070
1899 Ga0105245_10579126
1900 Ga0105245_10599399
1901 Ga0105247_10067308
1902 Ga0105247_10783842
1903 Ga0114129_10037464
1904 Ga0114129_10117145
1905 Ga0114129_10311272
1906 Ga0114129_10546064
1907 Ga0114129_12786665
1908 Ga0105243_10016260
1909 Ga0105243_10293294
1910 Ga0105243_10502910
1911 Ga0105241_10060131
1912 Ga0105241_10264074
1913 Ga0105241_10267207
1914 Ga0105241_10948701
1915 Ga0105242_10042065
1916 Ga0105242_10064698
1917 Ga0105242_10237248
1918 Ga0105242_10274951
1919 Ga0105242_10950816
1920 Ga0105242_12198722
1921 Ga0105242_13325727
1922 Ga0105248_10525512
1923 Ga0105248_10540665
1924 Ga0105237_10340697
1925 Ga0105237_10500624
1926 Ga0105237_10640573
1927 Ga0105237_10830905
1928 Ga0105237_11104865
1929 Ga0105237_12124720
1930 Ga0105238_10028919
1931 Ga0105238_10033949
1932 Ga0105238_10063726
1933 Ga0105238_10193973
1934 Ga0105238_10721690
1935 Ga0105238_11796335
1936 Ga0105238_11910224
1937 Ga0105238_12636660
1938 Ga0105249_10027388
1939 Ga0105249_10440212
1940 Ga0105249_10533235
1941 Ga0105239_10277631
1942 Ga0105239_10520460
1943 Ga0105239_10756551
1944 Ga0105239_11314594
1945 Ga0105239_11503789
1946 Ga0105239_13332306
1947 Ga0105239_13400597
1948 Ga0105246_10013171
1949 Ga0105246_10422846
1950 Ga0105246_10573465
1951 Ga0105246_10736920
1952 Ga0157347_1020588
1953 Ga0157342_1024066
1954 Ga0157327_1008019
1955 Ga0157373_10053326
1956 Ga0157373_10206232
1957 Ga0157373_10328744
1958 Ga0157373_10517687
1959 Ga0157373_11021732
1960 Ga0157371_10224898
1961 Ga0157371_10277009
1962 Ga0157371_10868707
1963 Ga0157371_11536489
1964 Ga0157370_10022109
1965 Ga0157370_10032325
1966 Ga0157370_10046103
1967 Ga0157370_10287230
1968 Ga0157370_10772719
1969 Ga0157369_10002320
1970 Ga0157369_10271581
1971 Ga0157369_10335773
1972 Ga0157369_10454011
1973 Ga0157369_10532527
1974 Ga0157369_10714610
1975 Ga0157369_10733318
1976 Ga0157374_10019586
1977 Ga0157374_10102876
1978 Ga0157374_10153005
1979 Ga0157374_10257725
1980 Ga0157374_10379637
1981 Ga0157374_10579426
1982 Ga0157374_10795959
1983 Ga0157374_11447036
1984 Ga0157374_11880393
1985 Ga0157378_10763788
1986 Ga0157378_10880663
1987 Ga0157378_11277356
1988 Ga0157378_11325178
1989 Ga0157378_11862405
1990 Ga0157378_12024738
1991 Ga0163162_10138016
1992 Ga0163162_10830844
1993 Ga0163162_11052929
1994 Ga0163162_13189683
1995 Ga0157372_10037624
1996 Ga0157372_10060489
1997 Ga0157372_10120458
1998 Ga0157372_10273028
1999 Ga0157372_10372016
2000 Ga0157372_11489667
2001 Ga0157375_10118405
2002 Ga0157375_10283717
2003 Ga0157375_10284443
2004 Ga0163163_10009378
2005 Ga0163163_12410620
2006 Ga0157380_13156933
2007 Ga0182008_10040176
2008 Ga0182008_10089928
2009 Ga0182008_10213276
2010 Ga0157377_10008185
2011 Ga0157377_10138887
2012 Ga0157379_10208168
2013 Ga0157379_11655921
2014 Ga0157379_11932211
2015 Ga0157379_12318350
2016 Ga0157376_10027031
2017 Ga0157376_10308200
2018 Ga0157376_10377624
2019 Ga0157376_10395260
2020 Ga0182007_10120785
2021 Ga0182007_10258024
2022 Ga0163161_10627152
2023 Ga0197907_10557898
2024 Ga0197907_10788161
2025 Ga0197907_10852630
2026 Ga0197907_11239336
2027 Ga0206356_10159383
2028 Ga0206356_10378944
2029 Ga0206356_10708941
2030 Ga0206356_10916098
2031 Ga0206356_11582479
2032 Ga0206356_11610073
2033 Ga0206356_11635300
2034 Ga0206349_1178519
2035 Ga0206355_1050139
2036 Ga0206355_1276088
2037 Ga0206355_1376991
2038 Ga0206355_1471482
2039 Ga0206351_10377887
2040 Ga0206351_10656248
2041 Ga0206351_10859689
2042 Ga0206352_10369212
2043 Ga0206352_10610482
2044 Ga0206350_10244322
2045 Ga0206350_10755670
2046 Ga0206350_11166980
2047 Ga0206354_10231726
2048 Ga0206354_10481326
2049 Ga0206354_11187472
2050 Ga0206354_11421046
2051 Ga0206354_11537208
2052 Ga0206353_10017982
2053 Ga0206353_10446025
2054 Ga0206353_10612272
2055 Ga0206353_10781712
2056 Ga0206353_10919416
2057 Ga0206353_11166285
2058 Ga0206353_11739036
2059 Ga0213874_10095634
2060 Ga0213874_10121219
2061 Ga0213876_10023437
2062 Ga0213875_10178370
2063 Ga0224712_10011301
2064 Ga0224712_10022451
2065 Ga0224712_10089695
2066 Ga0224712_10259405
2067 Ga0224712_10292080
2068 Ga0224712_10319429
2069 Ga0224712_10638585
2070 Ga0224712_10657853
2071 Ga0207656_10594374
2072 Ga0207653_10037151
2073 Ga0207692_10168848
2074 Ga0207692_10444391
2075 Ga0207692_10543385
2076 Ga0207692_11035061
2077 Ga0207642_10344023
2078 Ga0207710_10055540
2079 Ga0207710_10463359
2080 Ga0207688_10038649
2081 Ga0207688_10155143
2082 Ga0207688_10836296
2083 Ga0207680_10035015
2084 Ga0207647_10064947
2085 Ga0207647_10307419
2086 Ga0207685_10259461
2087 Ga0207699_10356280
2088 Ga0207699_10742399
2089 Ga0207645_10258926
2090 Ga0207643_10439397
2091 Ga0207705_10014835
2092 Ga0207705_10047609
2093 Ga0207705_10087228
2094 Ga0207705_10098696
2095 Ga0207705_10772421
2096 Ga0207705_10793554
2097 Ga0207705_10863536
2098 Ga0207705_11248379
2099 Ga0207654_10038145
2100 Ga0207654_10046709
2101 Ga0207654_10168255
2102 Ga0207654_11276280
2103 Ga0207707_10012220
2104 Ga0207707_10012425
2105 Ga0207707_10062306
2106 Ga0207707_10122204
2107 Ga0207707_10257344
2108 Ga0207707_10351324
2109 Ga0207707_10353367
2110 Ga0207707_10662960
2111 Ga0207695_10148932
2112 Ga0207695_10426091
2113 Ga0207695_10579951
2114 Ga0207695_10709007
2115 Ga0207695_10946595
2116 Ga0207695_11078072
2117 Ga0207671_10136721
2118 Ga0207671_10191442
2119 Ga0207671_11578931
2120 Ga0207693_10033503
2121 Ga0207693_10042789
2122 Ga0207693_10052457
2123 Ga0207693_10112890
2124 Ga0207693_10456362
2125 Ga0207693_10682311
2126 Ga0207663_10308049
2127 Ga0207663_10418927
2128 Ga0207663_10754221
2129 Ga0207663_11213707
2130 Ga0207660_10042937
2131 Ga0207660_10083496
2132 Ga0207660_10348710
2133 Ga0207660_10373504
2134 Ga0207660_10471223
2135 Ga0207660_10803429
2136 Ga0207660_11333072
2137 Ga0207660_11485197
2138 Ga0207660_11538452
2139 Ga0207662_10044516
2140 Ga0207662_10377752
2141 Ga0207657_10000054
2142 Ga0207657_10001075
2143 Ga0207657_10001255
2144 Ga0207657_10007381
2145 Ga0207657_10008257
2146 Ga0207657_10051326
2147 Ga0207657_10222148
2148 Ga0207657_10452555
2149 Ga0207657_10458850
2150 Ga0207657_10579824
2151 Ga0207649_10078373
2152 Ga0207649_10121488
2153 Ga0207649_10218778
2154 Ga0207652_10053360
2155 Ga0207652_10058771
2156 Ga0207652_10074054
2157 Ga0207652_10074769
2158 Ga0207652_10098968
2159 Ga0207652_10169975
2160 Ga0207652_10173903
2161 Ga0207652_10212704
2162 Ga0207652_10775809
2163 Ga0207652_10932454
2164 Ga0207652_11416136
2165 Ga0207646_10001441
2166 Ga0207646_10118695
2167 Ga0207646_10176404
2168 Ga0207646_10375212
2169 Ga0207694_10033295
2170 Ga0207694_10058043
2171 Ga0207694_10107410
2172 Ga0207694_10603668
2173 Ga0207659_10444250
2174 Ga0207687_10015379
2175 Ga0207687_10042209
2176 Ga0207687_10080429
2177 Ga0207687_10109199
2178 Ga0207687_10227911
2179 Ga0207687_10236458
2180 Ga0207687_10851679
2181 Ga0207687_11329517
2182 Ga0207687_11411295
2183 Ga0207700_10198685
2184 Ga0207700_10424560
2185 Ga0207700_10455036
2186 Ga0207700_10562975
2187 Ga0207700_10635225
2188 Ga0207700_10849679
2189 Ga0207700_11158495
2190 Ga0207700_11581610
2191 Ga0207664_10412519
2192 Ga0207664_10431611
2193 Ga0207664_10662908
2194 Ga0207664_10808620
2195 Ga0207664_10884949
2196 Ga0207664_11402492
2197 Ga0207664_11434657
2198 Ga0207664_11541722
2199 Ga0207664_11865241
2200 Ga0207644_10089503
2201 Ga0207644_10139439
2202 Ga0207690_10002378
2203 Ga0207690_10040448
2204 Ga0207690_10163381
2205 Ga0207690_10324374
2206 Ga0207706_10054711
2207 Ga0207706_10203018
2208 Ga0207686_10052028
2209 Ga0207686_10154413
2210 Ga0207686_10278449
2211 Ga0207686_10384300
2212 Ga0207686_10642320
2213 Ga0207709_10041105
2214 Ga0207670_11012724
2215 Ga0207669_10338668
2216 Ga0207704_10072413
2217 Ga0207704_11443764
2218 Ga0207704_11941060
2219 Ga0207665_10043153
2220 Ga0207665_10308420
2221 Ga0207665_10522360
2222 Ga0207665_11426895
2223 Ga0207691_10327447
2224 Ga0207691_10909320
2225 Ga0207711_10258186
2226 Ga0207711_10314043
2227 Ga0207711_10338085
2228 Ga0207661_10020944
2229 Ga0207661_10070838
2230 Ga0207661_10098620
2231 Ga0207661_10393406
2232 Ga0207661_10474490
2233 Ga0207661_10689500
2234 Ga0207679_10368007
2235 Ga0207667_10071922
2236 Ga0207667_10082068
2237 Ga0207667_10115354
2238 Ga0207667_10174403
2239 Ga0207667_10181179
2240 Ga0207667_10332376
2241 Ga0207667_10656266
2242 Ga0207667_10666747
2243 Ga0207651_10594431
2244 Ga0207651_11897747
2245 Ga0207712_10472788
2246 Ga0207712_10530238
2247 Ga0207712_11034823
2248 Ga0207668_10342835
2249 Ga0207668_10343335
2250 Ga0207640_10709786
2251 Ga0207640_11175220
2252 Ga0207658_10014581
2253 Ga0207658_11314677
2254 Ga0207677_10031103
2255 Ga0207677_10039990
2256 Ga0207677_10509867
2257 Ga0207677_10687369
2258 Ga0207703_10100530
2259 Ga0207703_10333854
2260 Ga0207703_10887266
2261 Ga0207639_10062603
2262 Ga0207639_10170303
2263 Ga0207639_10219301
2264 Ga0207639_10666463
2265 Ga0207678_10053177
2266 Ga0207678_10505585
2267 Ga0207708_10196226
2268 Ga0207708_10331811
2269 Ga0207702_10002160
2270 Ga0207702_10130604
2271 Ga0207702_10207597
2272 Ga0207702_10403860
2273 Ga0207702_10538565
2274 Ga0207702_10609433
2275 Ga0207702_10857581
2276 Ga0207641_10440004
2277 Ga0207641_10507237
2278 Ga0207648_10152368
2279 Ga0207648_10718940
2280 Ga0207676_10211131
2281 Ga0207674_10053698
2282 Ga0207674_10159297
2283 Ga0207674_10167092
2284 Ga0207674_11187893
2285 Ga0207674_11707950
2286 Ga0207683_10055645
2287 Ga0207683_10104344
2288 Ga0207698_10058341
2289 Ga0207698_10307404
2290 Ga0207698_10457648
2291 Ga0207698_10506287
2292 Ga0207698_11162584
2293 Ga0207698_11485780
2294 Ga0207698_12372150
2295 Ga0207428_10002365
2296 Ga0268266_10059309
2297 Ga0268266_10081241
2298 Ga0268266_10774543
2299 Ga0268265_11261046
2300 Ga0268264_10171684
2301 Ga0265337_1090596
2302 Ga0265326_10257653
2303 Ga0265319_1020126
2304 Ga0265319_1050512
2305 Ga0265319_1117124
2306 Ga0265319_1145256
2307 Ga0265319_1163791
2308 Ga0265334_10073313
2309 Ga0265334_10232894
2310 Ga0265318_10006408
2311 Ga0265318_10067811
2312 Ga0265318_10081795
2313 Ga0265318_10199626
2314 Ga0265318_10309750
2315 Ga0265323_10068454
2316 Ga0265336_10001147
2317 Ga0265338_10005100
2318 Ga0265338_10007755
2319 Ga0265338_10020589
2320 Ga0265338_10026919
2321 Ga0265338_10081701
2322 Ga0265338_10123267
2323 Ga0265338_10131371
2324 Ga0265338_10142381
2325 Ga0265324_10008358
2326 Ga0265332_10141529
2327 Ga0265320_10093432
2328 Ga0265320_10119407
2329 Ga0265320_10342665
2330 Ga0265325_10276032
2331 Ga0265340_10042361
2332 Ga0265340_10269992
2333 Ga0265339_10162809
2334 Ga0265316_10589057
2335 Ga0265316_10714300
2336 Ga0307408_102053960
2337 Ga0265313_10004487
2338 Ga0265313_10206493
2339 Ga0265314_10013102
2340 Ga0265314_10416319
2341 Ga0265314_10567123
2342 Ga0265342_10284431
2343 Ga0307409_102113783
2344 Ga0307416_100966122
2345 Ga0307415_100499327
2346 Ga0373938_0161036
2347 Ga0373926_0027594
2348 Ga0373926_0041034
2349 Ga0373934_0066375
2350 Ga0373944_0003405
2351 Ga0373944_0017421
2352 Ga0373944_0034813
2353 Ga0373944_0072422
2354 Ga0373949_0102209
2355 Ga0373923_0009617
2356 Ga0373923_0112107
2357 Ga0373936_0012158
2358 Ga0373936_0031292
2359 Ga0373936_0034868
2360 Ga0373945_0003331
2361 Ga0373945_0008817
2362 Ga0373945_0021731
2363 Ga0373945_0033306
2364 Ga0373953_0080481
2365 Ga0373953_0213009
2366 Ga0373954_0008966
2367 Ga0373954_0086516
2368 Ga0373954_0594280
2369 Ga0373956_0073808
2370 Ga0373957_0038874
2371 Ga0373943_0000693
2372 Ga0373943_0001040
2373 Ga0373943_0001343
2374 Ga0373943_0006737
2375 Ga0373946_0031421
2376 Ga0373946_0050342
2377 Ga0373946_0120483
2378 Ga0373946_0559320
2379 Ga0373955_0012109
2380 Ga0373955_0195877
2381 Ga0373955_0209553
2382 Ga0373924_0024092
2383 Ga0373924_0045859
2384 Ga0373924_0160201
2385 Ga0373924_0196163
2386 Ga0373924_0304719
2387 Ga0373935_0016894
2388 Ga0373935_0017594
2389 Ga0373935_0027291
2390 Ga0373935_0558880
2391 Ga0373935_0690893
2392 Ga0373927_0028499
2393 Ga0373927_0133645
2394 Ga0373927_0135003
2395 Ga0373927_0304447
2396 Ga0373933_0050952
2397 Ga0373933_0113076
2398 Ga0373933_0383579
2399 Ga0373947_0001170
2400 Ga0373947_0099387
2401 Ga0373947_0104473
2402 Ga0373947_0106346
2403 Ga0373947_0583399
2404 Ga0373937_0012607
2405 Ga0373937_0168279
2406 Ga0373937_0301151
2407 Ga0373937_0402272
2408 Ga0373925_0002413
2409 Ga0373925_0002841
2410 Ga0373925_0005888
2411 Ga0373925_0101668
2412 Ga0373925_0745852
2413 Ga0395899_0046455
2414 Ga0395899_0119121
2415 Ga0395899_0135136
2416 Ga0395899_0135739
2417 Ga0395899_0218398
2418 Ga0395899_0289200
2419 Ga0395900_0034383
2420 Ga0395900_0042427
2421 Ga0395900_0048345
2422 Ga0395900_0068352
2423 Ga0395900_0084734
2424 Ga0395900_0184594
2425 Ga0395900_0224573
2426 Ga0395900_0229982
2427 Ga0395900_0261756
2428 Ga0395900_0262135
2429 Ga0395900_0342073
2430 Ga0395900_0901850
2431 Ga0395900_1385357
2432 Ga0395900_1424650
2433 Ga0395898_0002613
2434 Ga0395898_0013164
2435 Ga0395898_0020929
2436 Ga0395898_0029711
2437 Ga0395898_0030941
2438 Ga0395898_0082415
2439 Ga0395898_0083641
2440 Ga0395898_0094034
2441 Ga0395898_0214966
2442 Ga0395898_0264555
2443 Ga0395898_0342707
2444 Ga0395898_0387390
2445 Ga0395898_0448942
2446 Ga0395898_0514803
2447 Ga0395898_0544788
2448 Ga0395898_0617722
2449 Ga0395898_0894398
2450 Ga0395898_1548123
2451 Ga0395898_1723376
2452 Ga0395905_0039611
2453 Ga0395905_0060677
2454 Ga0395905_0081507
2455 Ga0395905_0106658
2456 Ga0395905_0116059
2457 Ga0395905_0252809
2458 Ga0395905_0384153
2459 Ga0395905_0941404
2460 Ga0395901_0001850
2461 Ga0395901_0005193
2462 Ga0395901_0023082
2463 Ga0395901_0045262
2464 Ga0395901_0046896
2465 Ga0395901_0048579
2466 Ga0395901_0075489
2467 Ga0395901_0076133
2468 Ga0395901_0081065
2469 Ga0395901_0109361
2470 Ga0395901_0598475
2471 Ga0395901_0684837
2472 Ga0395901_0701527
2473 Ga0395901_0852269
2474 Ga0395901_1280683
2475 Ga0395901_2080522
2476 Ga0436365_1173242
2477 Ga0436363_0218384
2478 Ga0451793_0437514
2479 Ga0451804_0573671
2480 Ga0451835_1263189
2481 Ga0451837_0215669
2482 Ga0451839_0131976
2483 Ga0451845_0298016
2484 Ga0451853_1676111
2485 Ga0451853_3292590
2486 Ga0439443_085973
2487 Ga0439451_075188
2488 Ga0439455_0220570
2489 Ga0439463_077933
2490 Ga0450888_009755
2491 Ga0439444_0023645
2492 Ga0439464_0134370
2493 Ga0439460_0020566
2494 Ga0439460_0374627
2495 Ga0439440_0157209
2496 Ga0466969_0001239
2497 Ga0466969_0086127
2498 Ga0466969_0229652
2499 Ga0466969_0436385
2500 Ga0466972_0016657
2501 Ga0466965_0015721
2502 Ga0466965_0109866
2503 Ga0466966_0081999
2504 Ga0466966_0095148
2505 Ga0466966_0177618
2506 Ga0466966_0216994
2507 Ga0466966_0252379
2508 Ga0466966_0275536
2509 Ga0466966_0329691
2510 Ga0466961_0019216
2511 Ga0466961_0027794
2512 Ga0466961_0136405
2513 Ga0466961_0181480
2514 Ga0466961_0189684
2515 Ga0466961_0461676
2516 Ga0466961_0610459
2517 Ga0466961_0624433
2518 Ga0466963_0012694
2519 Ga0466963_0026856
2520 Ga0466963_0029064
2521 Ga0466963_0032315
2522 Ga0466963_0051866
2523 Ga0466963_0063868
2524 Ga0466963_0074337
2525 Ga0466963_0083780
2526 Ga0466963_0398754
2527 Ga0466963_0466099
2528 Ga0466963_0576306
2529 Ga0466963_0806392
2530 Ga0466964_0009210
2531 Ga0466964_0036923
2532 Ga0466964_0055404
2533 Ga0466964_0084912
2534 Ga0466964_0085815
2535 Ga0466964_0128566
2536 Ga0466964_0213666
2537 Ga0466964_0572286
2538 Ga0466971_0000146
2539 Ga0466971_0020229
2540 Ga0466971_0104248
2541 Ga0466971_0114361
2542 Ga0466971_0302490
2543 Ga0466971_0643349
2544 Ga0466968_0002981
2545 Ga0466968_0003980
2546 Ga0466968_0129042
2547 Ga0466968_0174426
2548 Ga0466968_0282069
2549 Ga0466968_0485114
2550 Ga0466968_0726008
2551 Ga0466970_0007704
2552 Ga0466970_0024506
2553 Ga0466970_0126304
2554 Ga0466957_0007245
2555 Ga0466957_0011691
2556 Ga0466957_0038873
2557 Ga0466957_0144937
2558 Ga0466957_1002484
2559 Ga0466957_1350381
2560 Ga0466960_0119058
2561 Ga0466960_0168032
2562 Ga0466960_0185119
2563 Ga0466960_0725852
2564 Ga0466960_1043453
2565 Ga0466959_0043199
2566 Ga0466959_0062730
2567 Ga0466959_0075226
2568 Ga0466959_0245574
2569 Ga0466959_0472047
2570 Ga0451576_0228034
2571 Ga0451576_1046881
2572 Ga0466958_0005202
2573 Ga0466958_0008076
2574 Ga0466958_0065001
2575 Ga0466967_0001223
2576 Ga0466967_0004614
2577 Ga0466967_0008381
2578 Ga0466967_0011834
2579 Ga0466967_0013205
2580 Ga0466967_0028771
2581 Ga0466967_0032874
2582 Ga0466967_0038514
2583 Ga0466967_0045188
2584 Ga0466967_0050959
2585 Ga0466967_0053989
2586 Ga0466967_0059430
2587 Ga0466967_0107548
2588 Ga0466967_0141347
2589 Ga0466967_0141755
2590 Ga0466967_0285519
2591 Ga0466967_0441151
2592 Ga0466967_0645628
2593 Ga0466967_1238436
2594 Ga0466967_1366007
2595 Ga0466967_1591840
2596 Ga0466967_1705295
2597 Ga0466967_2314368
2598 Ga0466967_2445211
2599 Ga0495592_0035738
2600 Ga0495592_0158712
2601 Ga0495592_0173325
2602 Ga0495592_0203643
2603 Ga0495592_0511420
2604 Ga0495592_0650144
2605 Ga0495592_0713994
2606 Ga0495592_0792038
2607 Ga0495592_0829635
2608 Ga0495603_0079558
2609 Ga0495603_0096109
2610 Ga0495603_0415376
2611 Ga0495603_0562591
2612 Ga0495603_0835772
2613 Ga0495629_0000319
2614 Ga0495629_0020444
2615 Ga0495629_0046949
2616 Ga0495629_0155073
2617 Ga0495629_0201724
2618 Ga0495629_0380482
2619 Ga0495641_0005764
2620 Ga0495641_0016039
2621 Ga0495641_0019178
2622 Ga0495641_0044455
2623 Ga0495641_0044716
2624 Ga0495641_0105938
2625 Ga0495641_0445532
2626 Ga0495641_0459922
2627 Ga0495651_0017133
2628 Ga0495651_0039212
2629 Ga0495651_0053665
2630 Ga0495651_0057032
2631 Ga0495651_0088314
2632 Ga0495651_0101621
2633 Ga0495651_0135760
2634 Ga0495651_0400102
2635 Ga0495651_0483789
2636 Ga0495651_0992152
2637 Ga0495653_0012965
2638 Ga0495653_0013190
2639 Ga0495653_0041082
2640 Ga0495653_0087151
2641 Ga0495653_0093433
2642 Ga0495653_0095777
2643 Ga0495653_0222237
2644 Ga0495653_0539593
2645 Ga0495653_0981299
2646 Ga0495580_0025973
2647 Ga0495580_0248207
2648 Ga0495580_0663506
2649 Ga0495582_0000358
2650 Ga0495582_0029168
2651 Ga0495582_0049271
2652 Ga0495582_0140278
2653 Ga0495582_0265089
2654 Ga0495639_0002626
2655 Ga0495639_0008199
2656 Ga0495662_0002647
2657 Ga0495662_0004470
2658 Ga0495662_0014253
2659 Ga0495664_0047907
2660 Ga0495664_0080526
2661 Ga0495664_0234406
2662 Ga0495664_0340953
2663 Ga0495664_0406201
2664 Ga0495664_0504518
2665 Ga0495664_0536658
2666 Ga0495584_0008227
2667 Ga0495585_0024932
2668 Ga0495594_0008671
2669 Ga0495594_0041557
2670 Ga0495594_0446089
2671 Ga0495594_0674514
2672 Ga0495596_0034089
2673 Ga0495607_0026956
2674 Ga0495608_0003300
2675 Ga0495608_0011142
2676 Ga0495608_0015297
2677 Ga0495608_0148817
2678 Ga0495608_0163932
2679 Ga0495608_0165641
2680 Ga0495608_0377992
2681 Ga0495608_0567253
2682 Ga0495618_0027070
2683 Ga0495618_0230659
2684 Ga0495618_0306520
2685 Ga0495618_0538243
2686 Ga0495628_0003751
2687 Ga0495628_0040215
2688 Ga0495628_0042846
2689 Ga0495628_0107147
2690 Ga0495628_0221382
2691 Ga0495628_0233378
2692 Ga0495630_0020826
2693 Ga0495630_0020828
2694 Ga0495630_0026489
2695 Ga0495630_0038705
2696 Ga0495630_0043068
2697 Ga0495630_0053585
2698 Ga0495630_0203386
2699 Ga0495630_0307374
2700 Ga0495630_0729887
2701 Ga0495630_0961931
2702 Ga0495631_0039597
2703 Ga0495631_0067783
2704 Ga0495644_0000819
2705 Ga0495644_0084747
2706 Ga0495663_0200780
2707 Ga0495666_0003469
2708 Ga0495666_0015670
2709 Ga0495666_0108113
2710 Ga0495666_0309813
2711 Ga0495666_0478711
2712 Ga0495642_0016114
2713 Ga0495652_0017796
2714 Ga0495652_0026148
2715 Ga0495652_0068899
2716 Ga0495652_0157109
2717 Ga0495652_0165410
2718 Ga0495652_0179986
2719 Ga0495652_0429953
2720 Ga0495654_0451184
2721 Ga0495665_0012337
2722 Ga0495665_0022839
2723 Ga0495665_0612094
2724 Ga0495640_0010306
2725 Ga0495640_0039198
2726 Ga0495640_0118474
2727 Ga0495640_0132953
2728 Ga0495640_0598584
2729 Ga0495586_0009166
2730 Ga0495586_0013906
2731 Ga0495586_0076673
2732 Ga0495587_0047960
2733 Ga0495587_0156001
2734 Ga0495587_0212471
2735 Ga0495587_0225081
2736 Ga0495587_0647488
2737 Ga0495587_0708540
2738 Ga0495598_0052258
2739 Ga0495609_0079067
2740 Ga0495645_0012470
2741 Ga0495645_0179639
2742 Ga0495645_0200208
2743 Ga0495645_0212942
2744 Ga0495645_0250567
2745 Ga0495645_0402189
2746 Ga0495645_0678808
2747 Ga0495645_0741696
2748 Ga0495622_0532799
2749 Ga0495667_0015868
2750 Ga0495667_0019234
2751 Ga0495667_0028003
2752 Ga0495667_0070896
2753 Ga0495667_0130580
2754 Ga0495667_0134022
2755 Ga0495667_0529840
2756 Ga0495667_0719244
2757 Ga0495656_0000621
2758 Ga0495668_0149722
2759 Ga0495634_0003395
2760 Ga0495634_0028964
2761 Ga0495634_0610370
2762 Ga0495634_0673166
2763 Ga0495611_0069496
2764 Ga0495635_0021997
2765 Ga0495635_0050625
2766 Ga0495635_0067003
2767 Ga0495635_0166290
2768 Ga0495635_0654962
2769 Ga0495659_0053108
2770 Ga0495661_0124357
2771 Ga0495588_0017973
2772 Ga0495657_0041962
2773 Ga0495657_0066345
2774 Ga0495657_0118277
2775 Ga0495657_0135637
2776 Ga0495657_0138910
2777 Ga0495657_0270660
2778 Ga0495657_0670295
2779 Ga0495599_0020210
2780 Ga0495599_0066938
2781 Ga0495599_0130034
2782 Ga0495599_0138294
2783 Ga0495599_0613570
2784 Ga0495623_0026708
2785 Ga0495623_0077461
2786 Ga0495623_0129369
2787 Ga0495623_0396815
2788 Ga0495646_0091022
2789 Ga0495646_0118989
2790 Ga0495646_0178606
2791 Ga0495646_0269118
2792 Ga0495646_0302686
2793 Ga0495647_0002047
2794 Ga0495647_0107647
2795 Ga0495658_0000384
2796 Ga0495658_0000524
2797 Ga0495658_0009679
2798 Ga0495658_0023104
2799 Ga0495658_0039216
2800 Ga0495658_0422204
2801 Ga0495658_0524731
2802 Ga0495658_0952835
2803 Ga0495669_0270881
2804 Ga0495613_0012745
2805 Ga0495613_0047516
2806 Ga0495613_0049317
2807 Ga0495613_0131009
2808 Ga0495613_0213620
2809 Ga0495613_0330458
2810 Ga0495613_0422686
2811 Ga0495613_0632479
2812 Ga0495613_0727805
2813 Ga0495624_0023590
2814 Ga0495624_0025679
2815 Ga0495624_0116212
2816 Ga0495624_0138164
2817 Ga0495624_0668369
2818 Ga0495670_0029338
2819 Ga0495671_0139557
2820 Ga0495589_0030160
2821 Ga0495589_0050413
2822 Ga0495600_0043381
2823 Ga0495600_0048692
2824 Ga0495600_0094000
2825 Ga0495600_0131471
2826 Ga0495600_0163468
2827 Ga0495600_0223988
2828 Ga0495600_0365700
2829 Ga0495581_0001964
2830 Ga0495581_0003702
2831 Ga0495581_0006490
2832 Ga0495581_0120733
2833 Ga0495581_0769062
2834 Ga0495604_0016942
2835 Ga0495604_0078805
2836 Ga0495604_0144390
2837 Ga0495604_0184191
2838 Ga0495604_0836230
2839 Ga0495604_0869029
2840 Ga0495636_0124034
2841 Ga0495674_0001135
2842 Ga0495674_0075986
2843 Ga0495674_0078674
2844 Ga0495674_0082781
2845 Ga0495674_0110059
2846 Ga0495674_0403700
2847 Ga0495674_0411608
2848 Ga0495674_0481669
2849 Ga0495674_0621061
2850 Ga0495674_0794857
2851 Ga0495676_0005182
2852 Ga0495676_0028449
2853 Ga0495676_0074178
2854 Ga0495676_0130524
2855 Ga0495676_0287725
2856 Ga0495676_0531132
2857 Ga0495676_0705796
2858 Ga0495680_0006719
2859 Ga0495680_0007716
2860 Ga0495680_0028462
2861 Ga0495680_0043380
2862 Ga0495680_0074473
2863 Ga0495680_0179393
2864 Ga0495680_0239931
2865 Ga0495680_0264061
2866 Ga0495680_0336184
2867 Ga0495680_0337949
2868 Ga0495675_0093658
2869 Ga0495675_0221340
2870 Ga0495675_0316570
2871 Ga0495675_0353554
2872 Ga0495677_0046016
2873 Ga0495677_0336518
2874 Ga0495679_017240
2875 Ga0495684_0004315
2876 Ga0495684_0004656
2877 Ga0495684_0020981
2878 Ga0495684_0041920
2879 Ga0495684_0077843
2880 Ga0495684_0214846
2881 Ga0495684_0272699
2882 Ga0495684_0344121
2883 Ga0495684_0455250
2884 Ga0495684_0937321
2885 Ga0495593_0005983
2886 Ga0495593_0011644
2887 Ga0495593_0022099
2888 Ga0495593_0113318
2889 Ga0495593_0161965
2890 Ga0495602_0028615
2891 Ga0495602_0031949
2892 Ga0495602_0056851
2893 Ga0495602_0060318
2894 Ga0495602_0120423
2895 Ga0495602_0132534
2896 Ga0495614_0000691
2897 Ga0495614_0006789
2898 Ga0495614_0018916
2899 Ga0495614_0158272
2900 Ga0496100_0005889
2901 Ga0496100_0021727
2902 Ga0496100_0034383
2903 Ga0496100_0065983
2904 Ga0496100_0118634
2905 Ga0496100_0188443
2906 Ga0496100_0641605
2907 Ga0496100_0847498
2908 Ga0496101_0004773
2909 Ga0496101_0010082
2910 Ga0496101_0017360
2911 Ga0496101_0113060
2912 Ga0496101_0164776
2913 Ga0496101_0173111
2914 Ga0496101_0316791
2915 Ga0496101_0602657
2916 Ga0496101_0790314
2917 Ga0496102_0009192
2918 Ga0496102_0030938
2919 Ga0496102_0048111
2920 Ga0496102_0102048
2921 Ga0496102_0135068
2922 Ga0496102_0526804
2923 Ga0496102_0636690
2924 Ga0496102_1175197
2925 Ga0496102_1497545
2926 Ga0496103_0030622
2927 Ga0496103_0047524
2928 Ga0496103_0115083
2929 Ga0496103_0327252
2930 Ga0496103_0440962
2931 Ga0496103_0496524
2932 Ga0496104_0056464
2933 Ga0496104_0108756
2934 Ga0496104_0332452
2935 Ga0496104_0344961
2936 Ga0496104_0760558
2937 Ga0496104_1032935
2938 Ga0496104_1267007
2939 Ga0496105_0001696
2940 Ga0496105_0010820
2941 Ga0496105_0030988
2942 Ga0496105_0048434
2943 Ga0496106_0001537
2944 Ga0496106_0019337
2945 Ga0496106_0020948
2946 Ga0496106_0065848
2947 Ga0496106_0123701
2948 Ga0496106_0131775
2949 Ga0496106_0546781
2950 Ga0496106_1221713
2951 Ga0496106_1361551
2952 Ga0496106_1531462
2953 Ga0496107_0003573
2954 Ga0496107_0003674
2955 Ga0496107_0013371
2956 Ga0496107_0052027
2957 Ga0496107_0122346
2958 Ga0496107_0229417
2959 Ga0496107_0908368
2960 Ga0496107_0920011
2961 Ga0496107_0959269
2962 Ga0496108_0006227
2963 Ga0496108_0018620
2964 Ga0496108_0055610
2965 Ga0496108_0080618
2966 Ga0496108_0081016
2967 Ga0496108_0113016
2968 Ga0496108_0331971
2969 Ga0496108_0778285
2970 Ga0496108_1262390
2971 Ga0496109_0002950
2972 Ga0496109_0004692
2973 Ga0496109_0011347
2974 Ga0496109_0032736
2975 Ga0496109_0086639
2976 Ga0496109_0098361
2977 Ga0496109_0160980
2978 Ga0496109_0301307
2979 Ga0496109_0429484
2980 Ga0496110_0002127
2981 Ga0496110_0037596
2982 Ga0496110_0041284
2983 Ga0496110_0053559
2984 Ga0496110_0472601
2985 Ga0496110_0613109
2986 Ga0496110_1098716
2987 Ga0496110_1519316
2988 Ga0496110_1555457
2989 Ga0496111_0007535
2990 Ga0496111_0036550
2991 Ga0496111_0036562
2992 Ga0496111_0092384
2993 Ga0496111_0354599
2994 Ga0496111_0428138
2995 Ga0496111_0460682
2996 Ga0496111_0512502
2997 Ga0496112_0025388
2998 Ga0496112_0026036
2999 Ga0496112_0038757
3000 Ga0496112_0041236
3001 Ga0496112_0059478
3002 Ga0496112_0089385
3003 Ga0496112_0137906
3004 Ga0496112_0497010
3005 Ga0496112_0805827
3006 Ga0496112_0825980
3007 Ga0496112_1490299
3008 Ga0496113_0001497
3009 Ga0496113_0006676
3010 Ga0496113_0077158
3011 Ga0496113_0094321
3012 Ga0496113_0103619
3013 Ga0496113_0292209
3014 Ga0496113_0521227
3015 Ga0496113_0870526
3016 Ga0496114_0013258
3017 Ga0496114_0022160
3018 Ga0496114_0071029
3019 Ga0496114_0216049
3020 Ga0496114_0340987
3021 Ga0496115_0001529
3022 Ga0496115_0007349
3023 Ga0496115_0058429
3024 Ga0496115_0075125
3025 Ga0496115_0077920
3026 Ga0496115_0783067
3027 Ga0501037_0419028
3028 Ga0501041_0365965
3029 Ga0501043_0977394
3030 Ga0501046_0257850
3031 Ga0501047_0080204
3032 Ga0501047_0087698
3033 Ga0501047_1190645
3034 Ga0501069_0056205
3035 Ga0501069_0478991
3036 Ga0501069_0660168
3037 Ga0501070_0057784
3038 Ga0501070_0130602
3039 Ga0501070_0355886
3040 Ga0501070_0986885
3041 Ga0501073_0738806
3042 Ga0501074_0027630
3043 Ga0501074_0087495
3044 Ga0501074_0217452
3045 Ga0501074_0991744
3046 Ga0501075_1384021
3047 Ga0501079_0833461
3048 Ga0501080_0173707
3049 Ga0501080_0204460
3050 Ga0501080_0435972
3051 Ga0501080_0602270
3052 Ga0501080_1026315
3053 Ga0501044_0153939
3054 Ga0501044_0356336
3055 nmdc:mga03683_4155_c1
3056 nmdc:mga00v17_2661_c1
3057 nmdc:mga00v17_539352_c1
3058 nmdc:mga0yw44_2792_c1
3059 nmdc:mga0yw44_66374_c1
3060 nmdc:mga05p37_16425_c1
3061 nmdc:mga05p37_308233_c1
3062 nmdc:mga05p37_377420_c1
3063 nmdc:mga05p37_75954_c1
3064 nmdc:mga09592_10288_c1
3065 nmdc:mga09592_131509_c1
3066 nmdc:mga0qj67_105438_c1
3067 nmdc:mga0qj67_11246_c1
3068 nmdc:mga06r32_32372_c1
3069 nmdc:mga08y16_2037963_c1
3070 nmdc:mga08y16_221705_c1
3071 nmdc:mga08y16_6427_c1
3072 nmdc:mga0n895_12158_c1
3073 nmdc:mga0n895_17465_c1
3074 nmdc:mga0n895_1973348_c1
3075 nmdc:mga0n895_742320_c1
3076 nmdc:mga0rr50_1486_c1
3077 nmdc:mga0rr50_177413_c1
3078 nmdc:mga0rr50_789695_c1
3079 nmdc:mga08x19_23986_c1
3080 nmdc:mga0a205_216343_c1
3081 nmdc:mga0a205_572458_c1
3082 nmdc:mga0a205_99370_c2
3083 Ga0495601_0005905
3084 Ga0495601_0024199
3085 Ga0495601_0025101
3086 Ga0495601_0032047
3087 Ga0495601_0033861
3088 Ga0495601_0072282
3089 Ga0495601_0126065
3090 Ga0495601_0147281
3091 Ga0495601_0228999
3092 Ga0495601_0263034
3093 Ga0495601_0526895
3094 Ga0495612_0001993
3095 Ga0495612_0004267
3096 Ga0495612_0034396
3097 Ga0495612_0092270
3098 Ga0495612_0159110
3099 Ga0495612_0182099
3100 Ga0495612_0371877
3101 Ga0495655_0002920
3102 Ga0495655_0044265
3103 Ga0495595_0034469
3104 Ga0495595_0072720
3105 Ga0495595_0239949
3106 Ga0495595_0363342
3107 Ga0495619_0002851
3108 Ga0495619_0011960
3109 Ga0495619_0015294
3110 Ga0495619_0149861
3111 Ga0495619_0155557
3112 Ga0495619_0213204
3113 Ga0495619_0237608
3114 Ga0495619_0281800
3115 Ga0495619_0348624
3116 Ga0495619_0736827
3117 Ga0495619_0923709
3118 Ga0500566_0035762
3119 Ga0500657_152291
3120 Ga0587093_086003
3121 Ga0587066_031106
3122 Ga0587073_0227976
3123 Ga0587082_176197
3124 Ga0587086_101637
3125 Ga0587094_077601
3126 Ga0587076_176811
3127 Ga0587078_046469
3128 Ga0587111_0259867
3129 Ga0501082_1259361
3130 Ga0466962_0000557
3131 Ga0466962_0010989
3132 Ga0466962_0089495
3133 Ga0466962_0143270
3134 Ga0530510_0665322

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF22802

RsiG

RsiG-like

19

90

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
7lq4-assembly1.cif.gz_T rr (rsig)2-(c-di-gmp)2-whig complex 0.6561 6 73
8ebx-assembly1.cif.gz_H xpa repositioning core7 of tfiih relative to xpc-dna lesion (ap) 0.6446 14 77
7lq4-assembly1.cif.gz_T rr (rsig)2-(c-di-gmp)2-whig complex 0.5387 6 73
4biz-assembly2.cif.gz_C crystal structure of cpxahdc (orthorhombic form 2) 0.509 14 74
8ebx-assembly1.cif.gz_H xpa repositioning core7 of tfiih relative to xpc-dna lesion (ap) 0.4715 14 77
ID Description Score Start End Superfamily
1x3wA03 Mainly Alpha;Orthogonal Bundle;Rna Polymerase Sigma Factor; Chain: A; 0.5114 43 74 1.10.1740.90
af_Q0JGJ6_15_112_1.10.246.140 Mainly Alpha;Orthogonal Bundle;Serum Albumin; Chain A, Domain 1;ENY2/SUS1 0.3346 1 82 1.10.246.140
af_Q0JGJ6_15_112_1.10.246.140 Mainly Alpha;Orthogonal Bundle;Serum Albumin; Chain A, Domain 1;ENY2/SUS1 0.3086 1 82 1.10.246.140
1x3wA03 Mainly Alpha;Orthogonal Bundle;Rna Polymerase Sigma Factor; Chain: A; 0.251 43 74 1.10.1740.90
ID Description Score Start End GO Terms
AF-A0A7K9HWY3-F1-model_v4 ELL factor 0.4001 8 74 GO:0000987
GO:0008023
GO:0032968
GO:0042795
AF-A0A7K9HWY3-F1-model_v4 ELL factor 0.3554 8 74 GO:0000987
GO:0008023
GO:0032968
GO:0042795
AF-A0A2H0IXZ1-F1-model_v4 WGR domain-containing protein 0.2243 1 85
AF-A0A2H0IXZ1-F1-model_v4 WGR domain-containing protein 0.1935 1 85

Map