F494796
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1567 | 421 | 3134 | 82 |
Family's Representative Sequence
| Representative Sequence | 3300005548|Ga0070665_101648752|Ga0070665_1016487521 |
| Length | 98 |
| Sequence | VLREPAERTAAVSTERTRVEPLPDLGKLSDDELKKLIDDLTHEEQEVSYRRRLLHGKIDILRAELVARLQKSGGKSVLEQVDMDALTDILAGKAAPPG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 2 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 3 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 4 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 5 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 6 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 7 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 8 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 13 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 15 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 17 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 44 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 45 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 51 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 53 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 54 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 60 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 62 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 63 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 64 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 66 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 67 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 68 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 69 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 70 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 71 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 72 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 73 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 74 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 75 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 76 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 77 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 79 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 80 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 81 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 82 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 83 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 84 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 85 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 87 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 88 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 89 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 90 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 91 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 92 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 93 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 94 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 95 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 97 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300012502 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 | Metagenome | Rhizosphere |
| 112 | 3300012507 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 | Metagenome | Rhizosphere |
| 113 | 3300012512 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 | Metagenome | Rhizosphere |
| 114 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 126 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 130 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 132 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 133 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 134 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 135 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 136 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 137 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 138 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 139 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 140 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 141 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 142 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 143 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 144 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 206 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 210 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 211 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 212 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 213 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 214 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 215 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 216 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 217 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 218 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 219 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 220 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 221 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 222 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 223 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 224 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 225 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 226 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 227 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 228 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 229 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 230 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 231 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 232 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 233 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 234 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 235 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 236 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 237 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 238 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 239 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 240 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 241 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 242 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 243 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 244 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 245 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 246 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 247 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 248 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 249 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 250 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 251 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 252 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 253 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 254 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 255 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 256 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 257 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 258 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 259 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 260 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 261 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 262 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 263 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 264 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 265 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 266 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 267 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 268 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 269 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 270 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 271 | 3300042126 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 | Metagenome | Rhizosphere |
| 272 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 273 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 274 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 275 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 276 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 277 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 278 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 279 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 280 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 281 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 282 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 283 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 284 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 285 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 286 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 287 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 288 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 289 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 290 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 291 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 292 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 363 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 364 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 365 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 366 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 367 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 368 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 369 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 370 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 371 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 372 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 373 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 374 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 375 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 376 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 377 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 378 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 379 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 380 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 381 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 382 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 383 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 384 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 385 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 386 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 387 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 388 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 389 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 390 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 391 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 392 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 393 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 394 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 395 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 396 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 397 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 398 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 399 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 400 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 401 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 402 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 403 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 409 | 3300053728 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 endosphere | Metagenome | Endosphere |
| 410 | 3300059478 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 411 | 3300059490 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 412 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 413 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 414 | 3300059507 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 415 | 3300059513 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 416 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 417 | 3300059646 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 418 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 419 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 420 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 421 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.49 |
| Metatranscriptomes | 3.51 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.77 |
| Nodule | 0 |
| Rhizoplane | 8.23 |
| Rhizosphere | 90.17 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 7.47 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070665_101648752 | 3300005548 | Bacteria | 649 |
| 2 | JGI24745J21846_1044921 | 3300002073 | Unclassified | 552 |
| 3 | JGI24751J29686_10093367 | 3300002459 | Bacteria | 626 |
| 4 | JGI25406J46586_10074125 | 3300003203 | Bacteria | 1060 |
| 5 | JGI25407J50210_10001838 | 3300003373 | Bacteria | 4908 |
| 6 | JGI25407J50210_10050282 | 3300003373 | Bacteria | 1057 |
| 7 | Ga0058860_11557948 | 3300004801 | Bacteria | 641 |
| 8 | Ga0058862_12802645 | 3300004803 | Bacteria | 524 |
| 9 | Ga0070658_10028387 | 3300005327 | Bacteria | 4491 |
| 10 | Ga0070658_10055724 | 3300005327 | Bacteria | 3212 |
| 11 | Ga0070658_10241315 | 3300005327 | Bacteria | 1532 |
| 12 | Ga0070658_10874173 | 3300005327 | Bacteria | 781 |
| 13 | Ga0070658_10928036 | 3300005327 | Bacteria | 757 |
| 14 | Ga0070658_11669185 | 3300005327 | Bacteria | 552 |
| 15 | Ga0070676_10329984 | 3300005328 | Bacteria | 1043 |
| 16 | Ga0070683_100001516 | 3300005329 | Bacteria | 17949 |
| 17 | Ga0070683_100029653 | 3300005329 | Bacteria | 4957 |
| 18 | Ga0070683_100035623 | 3300005329 | Bacteria | 4549 |
| 19 | Ga0070683_100111966 | 3300005329 | Bacteria | 2575 |
| 20 | Ga0070683_100171298 | 3300005329 | Unclassified | 2061 |
| 21 | Ga0070683_100376993 | 3300005329 | Bacteria | 1352 |
| 22 | Ga0070683_100380765 | 3300005329 | Bacteria | 1344 |
| 23 | Ga0070683_100634376 | 3300005329 | Bacteria | 1023 |
| 24 | Ga0070683_101285424 | 3300005329 | Bacteria | 703 |
| 25 | Ga0070690_100122327 | 3300005330 | Bacteria | 1748 |
| 26 | Ga0068869_100207731 | 3300005334 | Bacteria | 1547 |
| 27 | Ga0070666_10345719 | 3300005335 | Bacteria | 1064 |
| 28 | Ga0070680_100039688 | 3300005336 | Bacteria | 3808 |
| 29 | Ga0070680_100045740 | 3300005336 | Bacteria | 3559 |
| 30 | Ga0070680_100076876 | 3300005336 | Bacteria | 2749 |
| 31 | Ga0070680_100308652 | 3300005336 | Bacteria | 1342 |
| 32 | Ga0070680_100354486 | 3300005336 | Bacteria | 1248 |
| 33 | Ga0070680_100444143 | 3300005336 | Bacteria | 1108 |
| 34 | Ga0070680_100814745 | 3300005336 | Bacteria | 805 |
| 35 | Ga0070682_100030117 | 3300005337 | Bacteria | 3273 |
| 36 | Ga0070682_100039818 | 3300005337 | Bacteria | 2889 |
| 37 | Ga0070682_100161528 | 3300005337 | Bacteria | 1548 |
| 38 | Ga0070682_100412646 | 3300005337 | Unclassified | 1024 |
| 39 | Ga0070682_100691774 | 3300005337 | Unclassified | 816 |
| 40 | Ga0068868_100029603 | 3300005338 | Bacteria | 4194 |
| 41 | Ga0068868_100196838 | 3300005338 | Bacteria | 1678 |
| 42 | Ga0068868_100647292 | 3300005338 | Bacteria | 941 |
| 43 | Ga0068868_100817442 | 3300005338 | Unclassified | 842 |
| 44 | Ga0070660_100004468 | 3300005339 | Bacteria | 9669 |
| 45 | Ga0070660_100012056 | 3300005339 | Bacteria | 6168 |
| 46 | Ga0070660_100015792 | 3300005339 | Bacteria | 5462 |
| 47 | Ga0070660_100152860 | 3300005339 | Bacteria | 1856 |
| 48 | Ga0070660_100240780 | 3300005339 | Bacteria | 1474 |
| 49 | Ga0070660_100257799 | 3300005339 | Unclassified | 1423 |
| 50 | Ga0070660_100282045 | 3300005339 | Bacteria | 1359 |
| 51 | Ga0070660_101007098 | 3300005339 | Bacteria | 704 |
| 52 | Ga0070660_101724037 | 3300005339 | Unclassified | 533 |
| 53 | Ga0070660_101892336 | 3300005339 | Bacteria | 508 |
| 54 | Ga0070691_10372336 | 3300005341 | Bacteria | 798 |
| 55 | Ga0070687_100218855 | 3300005343 | Bacteria | 1165 |
| 56 | Ga0070661_100028090 | 3300005344 | Bacteria | 4056 |
| 57 | Ga0070661_100070321 | 3300005344 | Bacteria | 2574 |
| 58 | Ga0070661_100083059 | 3300005344 | Unclassified | 2366 |
| 59 | Ga0070661_100349907 | 3300005344 | Bacteria | 1159 |
| 60 | Ga0070661_100371690 | 3300005344 | Bacteria | 1125 |
| 61 | Ga0070692_10044626 | 3300005345 | Bacteria | 2284 |
| 62 | Ga0070692_10415147 | 3300005345 | Bacteria | 853 |
| 63 | Ga0070692_10514878 | 3300005345 | Bacteria | 778 |
| 64 | Ga0070668_101012507 | 3300005347 | Bacteria | 747 |
| 65 | Ga0070668_101268023 | 3300005347 | Bacteria | 669 |
| 66 | Ga0070669_100489098 | 3300005353 | Bacteria | 1019 |
| 67 | Ga0070669_101436324 | 3300005353 | Bacteria | 599 |
| 68 | Ga0070675_100552983 | 3300005354 | Bacteria | 1041 |
| 69 | Ga0070671_100124421 | 3300005355 | Bacteria | 2170 |
| 70 | Ga0070671_100298766 | 3300005355 | Bacteria | 1371 |
| 71 | Ga0070671_101544417 | 3300005355 | Bacteria | 588 |
| 72 | Ga0070674_100514219 | 3300005356 | Unclassified | 999 |
| 73 | Ga0070674_100631193 | 3300005356 | Bacteria | 909 |
| 74 | Ga0070674_100838163 | 3300005356 | Unclassified | 797 |
| 75 | Ga0070674_101022002 | 3300005356 | Bacteria | 726 |
| 76 | Ga0070673_100152090 | 3300005364 | Bacteria | 1961 |
| 77 | Ga0070673_100457354 | 3300005364 | Bacteria | 1149 |
| 78 | Ga0070659_100011172 | 3300005366 | Bacteria | 6635 |
| 79 | Ga0070659_100059278 | 3300005366 | Bacteria | 3022 |
| 80 | Ga0070659_100101278 | 3300005366 | Bacteria | 2319 |
| 81 | Ga0070659_100472951 | 3300005366 | Bacteria | 1065 |
| 82 | Ga0070659_100537230 | 3300005366 | Bacteria | 1000 |
| 83 | Ga0070659_100773535 | 3300005366 | Bacteria | 834 |
| 84 | Ga0070659_101336304 | 3300005366 | Unclassified | 636 |
| 85 | Ga0070667_100053537 | 3300005367 | Bacteria | 3406 |
| 86 | Ga0070667_100753195 | 3300005367 | Bacteria | 903 |
| 87 | Ga0070667_101743527 | 3300005367 | Bacteria | 586 |
| 88 | Ga0070703_10152108 | 3300005406 | Bacteria | 870 |
| 89 | Ga0070709_10154889 | 3300005434 | Bacteria | 1587 |
| 90 | Ga0070709_10446823 | 3300005434 | Bacteria | 973 |
| 91 | Ga0070709_10915842 | 3300005434 | Unclassified | 694 |
| 92 | Ga0070714_100065808 | 3300005435 | Bacteria | 3122 |
| 93 | Ga0070714_100156636 | 3300005435 | Bacteria | 2057 |
| 94 | Ga0070714_100211025 | 3300005435 | Bacteria | 1780 |
| 95 | Ga0070714_100296920 | 3300005435 | Bacteria | 1505 |
| 96 | Ga0070714_100440365 | 3300005435 | Bacteria | 1237 |
| 97 | Ga0070714_100586619 | 3300005435 | Bacteria | 1069 |
| 98 | Ga0070714_100701066 | 3300005435 | Bacteria | 977 |
| 99 | Ga0070714_100846378 | 3300005435 | Bacteria | 887 |
| 100 | Ga0070714_102441497 | 3300005435 | Bacteria | 508 |
| 101 | Ga0070713_100146523 | 3300005436 | Bacteria | 2096 |
| 102 | Ga0070713_100466365 | 3300005436 | Bacteria | 1188 |
| 103 | Ga0070713_100610162 | 3300005436 | Bacteria | 1037 |
| 104 | Ga0070713_100618289 | 3300005436 | Bacteria | 1030 |
| 105 | Ga0070713_100629333 | 3300005436 | Bacteria | 1021 |
| 106 | Ga0070713_101019495 | 3300005436 | Bacteria | 799 |
| 107 | Ga0070713_101202094 | 3300005436 | Bacteria | 734 |
| 108 | Ga0070710_10220109 | 3300005437 | Bacteria | 1207 |
| 109 | Ga0070710_10309292 | 3300005437 | Bacteria | 1034 |
| 110 | Ga0070710_10334452 | 3300005437 | Bacteria | 998 |
| 111 | Ga0070710_10862529 | 3300005437 | Bacteria | 651 |
| 112 | Ga0070711_100117659 | 3300005439 | Bacteria | 1960 |
| 113 | Ga0070711_100914177 | 3300005439 | Bacteria | 749 |
| 114 | Ga0070705_100292153 | 3300005440 | Bacteria | 1164 |
| 115 | Ga0070705_100703648 | 3300005440 | Bacteria | 794 |
| 116 | Ga0070700_100053755 | 3300005441 | Bacteria | 2515 |
| 117 | Ga0070694_100692249 | 3300005444 | Bacteria | 828 |
| 118 | Ga0070708_100350711 | 3300005445 | Bacteria | 1391 |
| 119 | Ga0070708_100465996 | 3300005445 | Unclassified | 1192 |
| 120 | Ga0070663_100348312 | 3300005455 | Bacteria | 1199 |
| 121 | Ga0070663_100631146 | 3300005455 | Bacteria | 904 |
| 122 | Ga0070678_100357970 | 3300005456 | Bacteria | 1257 |
| 123 | Ga0070678_100531188 | 3300005456 | Bacteria | 1042 |
| 124 | Ga0070678_100658671 | 3300005456 | Bacteria | 940 |
| 125 | Ga0070662_100175470 | 3300005457 | Bacteria | 1686 |
| 126 | Ga0070662_100393289 | 3300005457 | Bacteria | 1143 |
| 127 | Ga0070681_10001211 | 3300005458 | Bacteria | 22450 |
| 128 | Ga0070681_10005563 | 3300005458 | Bacteria | 12170 |
| 129 | Ga0070681_10015890 | 3300005458 | Bacteria | 7505 |
| 130 | Ga0070681_10055397 | 3300005458 | Bacteria | 3948 |
| 131 | Ga0070681_10095959 | 3300005458 | Bacteria | 2913 |
| 132 | Ga0070681_10098288 | 3300005458 | Bacteria | 2873 |
| 133 | Ga0070681_10103113 | 3300005458 | Bacteria | 2797 |
| 134 | Ga0070681_10236761 | 3300005458 | Bacteria | 1739 |
| 135 | Ga0070681_10262891 | 3300005458 | Bacteria | 1637 |
| 136 | Ga0070681_10702216 | 3300005458 | Bacteria | 927 |
| 137 | Ga0068867_100244821 | 3300005459 | Bacteria | 1456 |
| 138 | Ga0068867_100412508 | 3300005459 | Bacteria | 1142 |
| 139 | Ga0068867_101334033 | 3300005459 | Bacteria | 663 |
| 140 | Ga0070685_10462594 | 3300005466 | Bacteria | 891 |
| 141 | Ga0070706_100454381 | 3300005467 | Bacteria | 1192 |
| 142 | Ga0070706_100981740 | 3300005467 | Bacteria | 779 |
| 143 | Ga0070707_100013228 | 3300005468 | Bacteria | 7716 |
| 144 | Ga0070707_100234246 | 3300005468 | Bacteria | 1787 |
| 145 | Ga0070707_100256792 | 3300005468 | Bacteria | 1701 |
| 146 | Ga0070707_101299773 | 3300005468 | Bacteria | 694 |
| 147 | Ga0070698_100393156 | 3300005471 | Bacteria | 1319 |
| 148 | Ga0070698_100824819 | 3300005471 | Bacteria | 872 |
| 149 | Ga0070698_100946414 | 3300005471 | Unclassified | 808 |
| 150 | Ga0070699_100960595 | 3300005518 | Bacteria | 783 |
| 151 | Ga0070699_101054283 | 3300005518 | Bacteria | 746 |
| 152 | Ga0070679_100023485 | 3300005530 | Bacteria | 6036 |
| 153 | Ga0070679_100028786 | 3300005530 | Bacteria | 5479 |
| 154 | Ga0070679_100044117 | 3300005530 | Bacteria | 4442 |
| 155 | Ga0070679_100074158 | 3300005530 | Bacteria | 3394 |
| 156 | Ga0070679_100078979 | 3300005530 | Bacteria | 3280 |
| 157 | Ga0070679_100097560 | 3300005530 | Bacteria | 2926 |
| 158 | Ga0070679_100144665 | 3300005530 | Bacteria | 2356 |
| 159 | Ga0070679_100439485 | 3300005530 | Bacteria | 1249 |
| 160 | Ga0070679_100449217 | 3300005530 | Bacteria | 1234 |
| 161 | Ga0070679_100704477 | 3300005530 | Bacteria | 952 |
| 162 | Ga0070679_101380529 | 3300005530 | Bacteria | 651 |
| 163 | Ga0070684_100073692 | 3300005535 | Bacteria | 3009 |
| 164 | Ga0070684_100076788 | 3300005535 | Bacteria | 2949 |
| 165 | Ga0070684_100088473 | 3300005535 | Bacteria | 2751 |
| 166 | Ga0070684_100100256 | 3300005535 | Bacteria | 2586 |
| 167 | Ga0070684_100145817 | 3300005535 | Bacteria | 2143 |
| 168 | Ga0070684_100185966 | 3300005535 | Bacteria | 1889 |
| 169 | Ga0070684_100233221 | 3300005535 | Bacteria | 1680 |
| 170 | Ga0070684_100257576 | 3300005535 | Bacteria | 1595 |
| 171 | Ga0070684_100295381 | 3300005535 | Bacteria | 1486 |
| 172 | Ga0070684_100651207 | 3300005535 | Bacteria | 981 |
| 173 | Ga0070684_100735393 | 3300005535 | Bacteria | 921 |
| 174 | Ga0070684_101696973 | 3300005535 | Bacteria | 596 |
| 175 | Ga0070697_100668972 | 3300005536 | Unclassified | 915 |
| 176 | Ga0070697_101343215 | 3300005536 | Bacteria | 638 |
| 177 | Ga0068853_100092361 | 3300005539 | Bacteria | 2663 |
| 178 | Ga0068853_100153614 | 3300005539 | Bacteria | 2073 |
| 179 | Ga0068853_100345781 | 3300005539 | Bacteria | 1382 |
| 180 | Ga0068853_100633656 | 3300005539 | Bacteria | 1017 |
| 181 | Ga0068853_100775610 | 3300005539 | Bacteria | 917 |
| 182 | Ga0068853_101955753 | 3300005539 | Bacteria | 569 |
| 183 | Ga0070686_100025331 | 3300005544 | Bacteria | 3569 |
| 184 | Ga0070686_101059878 | 3300005544 | Bacteria | 668 |
| 185 | Ga0070695_101822495 | 3300005545 | Bacteria | 511 |
| 186 | Ga0070696_100023949 | 3300005546 | Bacteria | 4149 |
| 187 | Ga0070696_100411062 | 3300005546 | Bacteria | 1061 |
| 188 | Ga0070693_100038554 | 3300005547 | Bacteria | 2671 |
| 189 | Ga0070693_101205163 | 3300005547 | Bacteria | 582 |
| 190 | Ga0070665_100138441 | 3300005548 | Bacteria | 2437 |
| 191 | Ga0070665_101059052 | 3300005548 | Bacteria | 823 |
| 192 | Ga0070704_100299843 | 3300005549 | Bacteria | 1338 |
| 193 | Ga0070704_100574204 | 3300005549 | Bacteria | 988 |
| 194 | Ga0068855_100004804 | 3300005563 | Bacteria | 16497 |
| 195 | Ga0068855_100008572 | 3300005563 | Bacteria | 12362 |
| 196 | Ga0068855_100058196 | 3300005563 | Bacteria | 4527 |
| 197 | Ga0068855_100065367 | 3300005563 | Bacteria | 4240 |
| 198 | Ga0068855_100206562 | 3300005563 | Bacteria | 2209 |
| 199 | Ga0068855_100735769 | 3300005563 | Bacteria | 1053 |
| 200 | Ga0068855_101002323 | 3300005563 | Bacteria | 877 |
| 201 | Ga0068855_101254480 | 3300005563 | Bacteria | 769 |
| 202 | Ga0068855_102177613 | 3300005563 | Bacteria | 557 |
| 203 | Ga0070664_100619862 | 3300005564 | Bacteria | 1004 |
| 204 | Ga0070664_100906309 | 3300005564 | Unclassified | 827 |
| 205 | Ga0068857_100150005 | 3300005577 | Unclassified | 2111 |
| 206 | Ga0068857_100153277 | 3300005577 | Bacteria | 2089 |
| 207 | Ga0068857_100213181 | 3300005577 | Bacteria | 1762 |
| 208 | Ga0068857_101962732 | 3300005577 | Bacteria | 574 |
| 209 | Ga0068857_102282732 | 3300005577 | Unclassified | 531 |
| 210 | Ga0068854_100025573 | 3300005578 | Bacteria | 4051 |
| 211 | Ga0068854_100286661 | 3300005578 | Bacteria | 1328 |
| 212 | Ga0068854_100419470 | 3300005578 | Bacteria | 1111 |
| 213 | Ga0068854_100483671 | 3300005578 | Bacteria | 1040 |
| 214 | Ga0068856_100009219 | 3300005614 | Bacteria | 9595 |
| 215 | Ga0068856_100085826 | 3300005614 | Bacteria | 3127 |
| 216 | Ga0068856_100150263 | 3300005614 | Bacteria | 2338 |
| 217 | Ga0068856_100212757 | 3300005614 | Bacteria | 1948 |
| 218 | Ga0068856_100362727 | 3300005614 | Bacteria | 1467 |
| 219 | Ga0068856_100369909 | 3300005614 | Unclassified | 1452 |
| 220 | Ga0068856_100846343 | 3300005614 | Bacteria | 934 |
| 221 | Ga0068856_100944227 | 3300005614 | Bacteria | 881 |
| 222 | Ga0068856_101832812 | 3300005614 | Unclassified | 618 |
| 223 | Ga0070702_100022737 | 3300005615 | Bacteria | 3321 |
| 224 | Ga0070702_100182944 | 3300005615 | Unclassified | 1373 |
| 225 | Ga0070702_100684676 | 3300005615 | Bacteria | 780 |
| 226 | Ga0068852_100042747 | 3300005616 | Bacteria | 3838 |
| 227 | Ga0068852_100149182 | 3300005616 | Bacteria | 2173 |
| 228 | Ga0068852_100248987 | 3300005616 | Unclassified | 1701 |
| 229 | Ga0068852_100308947 | 3300005616 | Bacteria | 1532 |
| 230 | Ga0068852_100401410 | 3300005616 | Bacteria | 1348 |
| 231 | Ga0068852_100807201 | 3300005616 | Bacteria | 952 |
| 232 | Ga0068852_101121458 | 3300005616 | Bacteria | 807 |
| 233 | Ga0068852_101276914 | 3300005616 | Bacteria | 756 |
| 234 | Ga0068859_100109888 | 3300005617 | Bacteria | 2819 |
| 235 | Ga0068859_101913362 | 3300005617 | Bacteria | 655 |
| 236 | Ga0068864_100053294 | 3300005618 | Bacteria | 3489 |
| 237 | Ga0068851_10847368 | 3300005834 | Bacteria | 570 |
| 238 | Ga0068870_10111205 | 3300005840 | Bacteria | 1564 |
| 239 | Ga0068863_100100332 | 3300005841 | Bacteria | 2751 |
| 240 | Ga0068863_100364443 | 3300005841 | Bacteria | 1409 |
| 241 | Ga0068858_100063116 | 3300005842 | Bacteria | 3427 |
| 242 | Ga0068858_100579812 | 3300005842 | Bacteria | 1087 |
| 243 | Ga0068858_100725042 | 3300005842 | Bacteria | 968 |
| 244 | Ga0068858_101789113 | 3300005842 | Bacteria | 607 |
| 245 | Ga0068860_100260411 | 3300005843 | Bacteria | 1690 |
| 246 | Ga0068862_100333315 | 3300005844 | Bacteria | 1403 |
| 247 | Ga0081455_10007900 | 3300005937 | Bacteria | 11133 |
| 248 | Ga0081455_10021298 | 3300005937 | Bacteria | 6083 |
| 249 | Ga0081455_10025744 | 3300005937 | Bacteria | 5425 |
| 250 | Ga0081455_10045022 | 3300005937 | Bacteria | 3843 |
| 251 | Ga0081455_10083659 | 3300005937 | Bacteria | 2607 |
| 252 | Ga0081538_10000231 | 3300005981 | Bacteria | 62826 |
| 253 | Ga0081538_10000286 | 3300005981 | Bacteria | 57937 |
| 254 | Ga0081538_10000667 | 3300005981 | Bacteria | 37780 |
| 255 | Ga0081538_10003199 | 3300005981 | Bacteria | 15559 |
| 256 | Ga0081538_10019178 | 3300005981 | Bacteria | 5099 |
| 257 | Ga0081538_10146137 | 3300005981 | Bacteria | 1080 |
| 258 | Ga0081538_10186440 | 3300005981 | Bacteria | 878 |
| 259 | Ga0081539_10002640 | 3300005985 | Bacteria | 24492 |
| 260 | Ga0081539_10007140 | 3300005985 | Bacteria | 10309 |
| 261 | Ga0070717_10138093 | 3300006028 | Bacteria | 2100 |
| 262 | Ga0070717_10162415 | 3300006028 | Bacteria | 1938 |
| 263 | Ga0070717_10187047 | 3300006028 | Bacteria | 1808 |
| 264 | Ga0070717_10197165 | 3300006028 | Bacteria | 1762 |
| 265 | Ga0070717_10246830 | 3300006028 | Bacteria | 1576 |
| 266 | Ga0070717_10423215 | 3300006028 | Bacteria | 1198 |
| 267 | Ga0070717_10886661 | 3300006028 | Bacteria | 812 |
| 268 | Ga0070717_11067375 | 3300006028 | Bacteria | 735 |
| 269 | Ga0070717_12044071 | 3300006028 | Bacteria | 516 |
| 270 | Ga0075365_10003335 | 3300006038 | Bacteria | 8250 |
| 271 | Ga0075365_10172134 | 3300006038 | Bacteria | 1512 |
| 272 | Ga0075364_10005953 | 3300006051 | Bacteria | 7131 |
| 273 | Ga0075364_10193774 | 3300006051 | Bacteria | 1377 |
| 274 | Ga0075432_10005425 | 3300006058 | Bacteria | 4347 |
| 275 | Ga0070715_10398117 | 3300006163 | Bacteria | 765 |
| 276 | Ga0070716_100095303 | 3300006173 | Bacteria | 1811 |
| 277 | Ga0070716_100197571 | 3300006173 | Bacteria | 1334 |
| 278 | Ga0070716_100821040 | 3300006173 | Bacteria | 721 |
| 279 | Ga0070716_101239129 | 3300006173 | Unclassified | 601 |
| 280 | Ga0070716_101252303 | 3300006173 | Unclassified | 598 |
| 281 | Ga0070712_100064422 | 3300006175 | Bacteria | 2599 |
| 282 | Ga0070712_100341536 | 3300006175 | Bacteria | 1223 |
| 283 | Ga0070712_100487553 | 3300006175 | Bacteria | 1031 |
| 284 | Ga0070712_101212035 | 3300006175 | Unclassified | 657 |
| 285 | Ga0070712_101843277 | 3300006175 | Bacteria | 530 |
| 286 | Ga0075362_10037347 | 3300006177 | Bacteria | 2129 |
| 287 | Ga0097621_100248969 | 3300006237 | Bacteria | 1555 |
| 288 | Ga0097621_100590075 | 3300006237 | Bacteria | 1015 |
| 289 | Ga0068871_100082631 | 3300006358 | Bacteria | 2664 |
| 290 | Ga0068871_100394802 | 3300006358 | Bacteria | 1231 |
| 291 | Ga0075428_100018520 | 3300006844 | Bacteria | 7699 |
| 292 | Ga0075428_101221317 | 3300006844 | Bacteria | 792 |
| 293 | Ga0075428_101264870 | 3300006844 | Bacteria | 777 |
| 294 | Ga0075430_100008779 | 3300006846 | Bacteria | 8528 |
| 295 | Ga0075430_100204470 | 3300006846 | Bacteria | 1639 |
| 296 | Ga0075431_100052006 | 3300006847 | Bacteria | 4224 |
| 297 | Ga0075433_10070060 | 3300006852 | Bacteria | 3081 |
| 298 | Ga0075433_10236764 | 3300006852 | Bacteria | 1621 |
| 299 | Ga0075433_10495187 | 3300006852 | Bacteria | 1076 |
| 300 | Ga0075434_100004007 | 3300006871 | Bacteria | 13191 |
| 301 | Ga0075434_100004302 | 3300006871 | Bacteria | 12793 |
| 302 | Ga0075434_100519808 | 3300006871 | Bacteria | 1211 |
| 303 | Ga0075434_100878070 | 3300006871 | Bacteria | 912 |
| 304 | Ga0075434_100972858 | 3300006871 | Bacteria | 863 |
| 305 | Ga0075429_100007741 | 3300006880 | Bacteria | 9328 |
| 306 | Ga0075429_100104603 | 3300006880 | Bacteria | 2473 |
| 307 | Ga0075429_100571160 | 3300006880 | Bacteria | 991 |
| 308 | Ga0068865_100291903 | 3300006881 | Unclassified | 1302 |
| 309 | Ga0068865_100372099 | 3300006881 | Bacteria | 1163 |
| 310 | Ga0068865_101000769 | 3300006881 | Bacteria | 732 |
| 311 | Ga0075436_100002762 | 3300006914 | Bacteria | 12054 |
| 312 | Ga0075436_100487400 | 3300006914 | Bacteria | 901 |
| 313 | Ga0097620_100109888 | 3300006931 | Bacteria | 2819 |
| 314 | Ga0097620_101913508 | 3300006931 | Bacteria | 655 |
| 315 | Ga0075435_100003383 | 3300007076 | Bacteria | 10817 |
| 316 | Ga0075435_100022089 | 3300007076 | Bacteria | 4906 |
| 317 | Ga0075435_100148659 | 3300007076 | Unclassified | 1969 |
| 318 | Ga0075435_100955641 | 3300007076 | Bacteria | 748 |
| 319 | Ga0105240_10014640 | 3300009093 | Bacteria | 10702 |
| 320 | Ga0105240_10086768 | 3300009093 | Bacteria | 3833 |
| 321 | Ga0105240_10169048 | 3300009093 | Bacteria | 2591 |
| 322 | Ga0105240_10590980 | 3300009093 | Bacteria | 1223 |
| 323 | Ga0105240_11331915 | 3300009093 | Bacteria | 756 |
| 324 | Ga0111539_10019934 | 3300009094 | Bacteria | 8260 |
| 325 | Ga0111539_10585994 | 3300009094 | Bacteria | 1299 |
| 326 | Ga0105245_10021132 | 3300009098 | Bacteria | 5708 |
| 327 | Ga0105245_10047644 | 3300009098 | Bacteria | 3832 |
| 328 | Ga0105245_10079582 | 3300009098 | Bacteria | 2993 |
| 329 | Ga0105245_10264161 | 3300009098 | Bacteria | 1676 |
| 330 | Ga0105245_10407871 | 3300009098 | Bacteria | 1359 |
| 331 | Ga0105245_10531070 | 3300009098 | Bacteria | 1196 |
| 332 | Ga0105245_10579126 | 3300009098 | Bacteria | 1147 |
| 333 | Ga0105245_10599399 | 3300009098 | Bacteria | 1128 |
| 334 | Ga0105247_10067308 | 3300009101 | Bacteria | 2231 |
| 335 | Ga0105247_10783842 | 3300009101 | Bacteria | 726 |
| 336 | Ga0114129_10037464 | 3300009147 | Bacteria | 6845 |
| 337 | Ga0114129_10117145 | 3300009147 | Bacteria | 3671 |
| 338 | Ga0114129_10311272 | 3300009147 | Bacteria | 2096 |
| 339 | Ga0114129_10546064 | 3300009147 | Bacteria | 1508 |
| 340 | Ga0114129_12786665 | 3300009147 | Unclassified | 581 |
| 341 | Ga0105243_10016260 | 3300009148 | Bacteria | 5630 |
| 342 | Ga0105243_10293294 | 3300009148 | Bacteria | 1471 |
| 343 | Ga0105243_10502910 | 3300009148 | Bacteria | 1149 |
| 344 | Ga0105241_10060131 | 3300009174 | Bacteria | 2922 |
| 345 | Ga0105241_10264074 | 3300009174 | Bacteria | 1464 |
| 346 | Ga0105241_10267207 | 3300009174 | Bacteria | 1456 |
| 347 | Ga0105241_10948701 | 3300009174 | Bacteria | 802 |
| 348 | Ga0105242_10042065 | 3300009176 | Bacteria | 3687 |
| 349 | Ga0105242_10064698 | 3300009176 | Bacteria | 3015 |
| 350 | Ga0105242_10237248 | 3300009176 | Bacteria | 1637 |
| 351 | Ga0105242_10274951 | 3300009176 | Bacteria | 1527 |
| 352 | Ga0105242_10950816 | 3300009176 | Bacteria | 863 |
| 353 | Ga0105242_12198722 | 3300009176 | Bacteria | 597 |
| 354 | Ga0105242_13325727 | 3300009176 | Bacteria | 500 |
| 355 | Ga0105248_10525512 | 3300009177 | Bacteria | 1334 |
| 356 | Ga0105248_10540665 | 3300009177 | Bacteria | 1314 |
| 357 | Ga0105237_10340697 | 3300009545 | Bacteria | 1504 |
| 358 | Ga0105237_10500624 | 3300009545 | Bacteria | 1221 |
| 359 | Ga0105237_10640573 | 3300009545 | Bacteria | 1070 |
| 360 | Ga0105237_10830905 | 3300009545 | Bacteria | 930 |
| 361 | Ga0105237_11104865 | 3300009545 | Bacteria | 800 |
| 362 | Ga0105237_12124720 | 3300009545 | Bacteria | 571 |
| 363 | Ga0105238_10028919 | 3300009551 | Bacteria | 5646 |
| 364 | Ga0105238_10033949 | 3300009551 | Bacteria | 5191 |
| 365 | Ga0105238_10063726 | 3300009551 | Bacteria | 3686 |
| 366 | Ga0105238_10193973 | 3300009551 | Bacteria | 2007 |
| 367 | Ga0105238_10721690 | 3300009551 | Bacteria | 1009 |
| 368 | Ga0105238_11796335 | 3300009551 | Bacteria | 645 |
| 369 | Ga0105238_11910224 | 3300009551 | Bacteria | 627 |
| 370 | Ga0105238_12636660 | 3300009551 | Bacteria | 539 |
| 371 | Ga0105249_10027388 | 3300009553 | Bacteria | 5142 |
| 372 | Ga0105249_10440212 | 3300009553 | Bacteria | 1340 |
| 373 | Ga0105249_10533235 | 3300009553 | Bacteria | 1223 |
| 374 | Ga0105239_10277631 | 3300010375 | Bacteria | 1886 |
| 375 | Ga0105239_10520460 | 3300010375 | Bacteria | 1353 |
| 376 | Ga0105239_10756551 | 3300010375 | Bacteria | 1112 |
| 377 | Ga0105239_11314594 | 3300010375 | Bacteria | 834 |
| 378 | Ga0105239_11503789 | 3300010375 | Bacteria | 778 |
| 379 | Ga0105239_13332306 | 3300010375 | Bacteria | 523 |
| 380 | Ga0105239_13400597 | 3300010375 | Unclassified | 518 |
| 381 | Ga0105246_10013171 | 3300011119 | Bacteria | 5178 |
| 382 | Ga0105246_10422846 | 3300011119 | Bacteria | 1112 |
| 383 | Ga0105246_10573465 | 3300011119 | Bacteria | 971 |
| 384 | Ga0105246_10736920 | 3300011119 | Bacteria | 868 |
| 385 | Ga0157347_1020588 | 3300012502 | Bacteria | 769 |
| 386 | Ga0157342_1024066 | 3300012507 | Bacteria | 727 |
| 387 | Ga0157327_1008019 | 3300012512 | Bacteria | 936 |
| 388 | Ga0157373_10053326 | 3300013100 | Bacteria | 2876 |
| 389 | Ga0157373_10206232 | 3300013100 | Unclassified | 1386 |
| 390 | Ga0157373_10328744 | 3300013100 | Bacteria | 1088 |
| 391 | Ga0157373_10517687 | 3300013100 | Bacteria | 863 |
| 392 | Ga0157373_11021732 | 3300013100 | Bacteria | 618 |
| 393 | Ga0157371_10224898 | 3300013102 | Bacteria | 1348 |
| 394 | Ga0157371_10277009 | 3300013102 | Bacteria | 1211 |
| 395 | Ga0157371_10868707 | 3300013102 | Bacteria | 683 |
| 396 | Ga0157371_11536489 | 3300013102 | Bacteria | 520 |
| 397 | Ga0157370_10022109 | 3300013104 | Bacteria | 6331 |
| 398 | Ga0157370_10032325 | 3300013104 | Bacteria | 5110 |
| 399 | Ga0157370_10046103 | 3300013104 | Bacteria | 4180 |
| 400 | Ga0157370_10287230 | 3300013104 | Bacteria | 1520 |
| 401 | Ga0157370_10772719 | 3300013104 | Archaea | 875 |
| 402 | Ga0157369_10002320 | 3300013105 | Bacteria | 22898 |
| 403 | Ga0157369_10271581 | 3300013105 | Bacteria | 1767 |
| 404 | Ga0157369_10335773 | 3300013105 | Bacteria | 1570 |
| 405 | Ga0157369_10454011 | 3300013105 | Bacteria | 1327 |
| 406 | Ga0157369_10532527 | 3300013105 | Bacteria | 1215 |
| 407 | Ga0157369_10714610 | 3300013105 | Bacteria | 1032 |
| 408 | Ga0157369_10733318 | 3300013105 | Bacteria | 1017 |
| 409 | Ga0157374_10019586 | 3300013296 | Bacteria | 5990 |
| 410 | Ga0157374_10102876 | 3300013296 | Bacteria | 2740 |
| 411 | Ga0157374_10153005 | 3300013296 | Bacteria | 2244 |
| 412 | Ga0157374_10257725 | 3300013296 | Unclassified | 1717 |
| 413 | Ga0157374_10379637 | 3300013296 | Bacteria | 1408 |
| 414 | Ga0157374_10579426 | 3300013296 | Bacteria | 1131 |
| 415 | Ga0157374_10795959 | 3300013296 | Unclassified | 961 |
| 416 | Ga0157374_11447036 | 3300013296 | Bacteria | 710 |
| 417 | Ga0157374_11880393 | 3300013296 | Bacteria | 624 |
| 418 | Ga0157378_10763788 | 3300013297 | Bacteria | 990 |
| 419 | Ga0157378_10880663 | 3300013297 | Bacteria | 925 |
| 420 | Ga0157378_11277356 | 3300013297 | Bacteria | 775 |
| 421 | Ga0157378_11325178 | 3300013297 | Bacteria | 761 |
| 422 | Ga0157378_11862405 | 3300013297 | Bacteria | 650 |
| 423 | Ga0157378_12024738 | 3300013297 | Bacteria | 626 |
| 424 | Ga0163162_10138016 | 3300013306 | Bacteria | 2550 |
| 425 | Ga0163162_10830844 | 3300013306 | Bacteria | 1040 |
| 426 | Ga0163162_11052929 | 3300013306 | Bacteria | 921 |
| 427 | Ga0163162_13189683 | 3300013306 | Bacteria | 526 |
| 428 | Ga0157372_10037624 | 3300013307 | Bacteria | 5339 |
| 429 | Ga0157372_10060489 | 3300013307 | Bacteria | 4239 |
| 430 | Ga0157372_10120458 | 3300013307 | Bacteria | 3013 |
| 431 | Ga0157372_10273028 | 3300013307 | Bacteria | 1965 |
| 432 | Ga0157372_10372016 | 3300013307 | Bacteria | 1665 |
| 433 | Ga0157372_11489667 | 3300013307 | Bacteria | 780 |
| 434 | Ga0157375_10118405 | 3300013308 | Bacteria | 2755 |
| 435 | Ga0157375_10283717 | 3300013308 | Unclassified | 1819 |
| 436 | Ga0157375_10284443 | 3300013308 | Bacteria | 1817 |
| 437 | Ga0163163_10009378 | 3300014325 | Bacteria | 8736 |
| 438 | Ga0163163_12410620 | 3300014325 | Unclassified | 584 |
| 439 | Ga0157380_13156933 | 3300014326 | Unclassified | 526 |
| 440 | Ga0182008_10040176 | 3300014497 | Bacteria | 2336 |
| 441 | Ga0182008_10089928 | 3300014497 | Bacteria | 1513 |
| 442 | Ga0182008_10213276 | 3300014497 | Bacteria | 986 |
| 443 | Ga0157377_10008185 | 3300014745 | Bacteria | 5087 |
| 444 | Ga0157377_10138887 | 3300014745 | Unclassified | 1491 |
| 445 | Ga0157379_10208168 | 3300014968 | Unclassified | 1770 |
| 446 | Ga0157379_11655921 | 3300014968 | Bacteria | 626 |
| 447 | Ga0157379_11932211 | 3300014968 | Bacteria | 582 |
| 448 | Ga0157379_12318350 | 3300014968 | Bacteria | 535 |
| 449 | Ga0157376_10027031 | 3300014969 | Bacteria | 4543 |
| 450 | Ga0157376_10308200 | 3300014969 | Bacteria | 1501 |
| 451 | Ga0157376_10377624 | 3300014969 | Bacteria | 1364 |
| 452 | Ga0157376_10395260 | 3300014969 | Bacteria | 1335 |
| 453 | Ga0182007_10120785 | 3300015262 | Bacteria | 877 |
| 454 | Ga0182007_10258024 | 3300015262 | Unclassified | 627 |
| 455 | Ga0163161_10627152 | 3300017792 | Bacteria | 889 |
| 456 | Ga0197907_10557898 | 3300020069 | Archaea | 535 |
| 457 | Ga0197907_10788161 | 3300020069 | Bacteria | 1938 |
| 458 | Ga0197907_10852630 | 3300020069 | Bacteria | 1069 |
| 459 | Ga0197907_11239336 | 3300020069 | Bacteria | 1654 |
| 460 | Ga0206356_10159383 | 3300020070 | Bacteria | 852 |
| 461 | Ga0206356_10378944 | 3300020070 | Bacteria | 996 |
| 462 | Ga0206356_10708941 | 3300020070 | Bacteria | 3064 |
| 463 | Ga0206356_10916098 | 3300020070 | Bacteria | 857 |
| 464 | Ga0206356_11582479 | 3300020070 | Bacteria | 1543 |
| 465 | Ga0206356_11610073 | 3300020070 | Bacteria | 1367 |
| 466 | Ga0206356_11635300 | 3300020070 | Bacteria | 2820 |
| 467 | Ga0206349_1178519 | 3300020075 | Bacteria | 742 |
| 468 | Ga0206355_1050139 | 3300020076 | Bacteria | 608 |
| 469 | Ga0206355_1276088 | 3300020076 | Bacteria | 622 |
| 470 | Ga0206355_1376991 | 3300020076 | Bacteria | 634 |
| 471 | Ga0206355_1471482 | 3300020076 | Unclassified | 538 |
| 472 | Ga0206351_10377887 | 3300020077 | Bacteria | 635 |
| 473 | Ga0206351_10656248 | 3300020077 | Bacteria | 640 |
| 474 | Ga0206351_10859689 | 3300020077 | Bacteria | 521 |
| 475 | Ga0206352_10369212 | 3300020078 | Bacteria | 706 |
| 476 | Ga0206352_10610482 | 3300020078 | Bacteria | 602 |
| 477 | Ga0206350_10244322 | 3300020080 | Bacteria | 532 |
| 478 | Ga0206350_10755670 | 3300020080 | Bacteria | 1212 |
| 479 | Ga0206350_11166980 | 3300020080 | Bacteria | 787 |
| 480 | Ga0206354_10231726 | 3300020081 | Bacteria | 2060 |
| 481 | Ga0206354_10481326 | 3300020081 | Bacteria | 905 |
| 482 | Ga0206354_11187472 | 3300020081 | Bacteria | 681 |
| 483 | Ga0206354_11421046 | 3300020081 | Bacteria | 1571 |
| 484 | Ga0206354_11537208 | 3300020081 | Bacteria | 525 |
| 485 | Ga0206353_10017982 | 3300020082 | Bacteria | 1183 |
| 486 | Ga0206353_10446025 | 3300020082 | Bacteria | 693 |
| 487 | Ga0206353_10612272 | 3300020082 | Bacteria | 1311 |
| 488 | Ga0206353_10781712 | 3300020082 | Bacteria | 3429 |
| 489 | Ga0206353_10919416 | 3300020082 | Bacteria | 5082 |
| 490 | Ga0206353_11166285 | 3300020082 | Bacteria | 922 |
| 491 | Ga0206353_11739036 | 3300020082 | Bacteria | 803 |
| 492 | Ga0213874_10095634 | 3300021377 | Unclassified | 982 |
| 493 | Ga0213874_10121219 | 3300021377 | Bacteria | 889 |
| 494 | Ga0213876_10023437 | 3300021384 | Bacteria | 3262 |
| 495 | Ga0213875_10178370 | 3300021388 | Unclassified | 998 |
| 496 | Ga0224712_10011301 | 3300022467 | Bacteria | 2765 |
| 497 | Ga0224712_10022451 | 3300022467 | Bacteria | 2175 |
| 498 | Ga0224712_10089695 | 3300022467 | Unclassified | 1286 |
| 499 | Ga0224712_10259405 | 3300022467 | Bacteria | 805 |
| 500 | Ga0224712_10292080 | 3300022467 | Bacteria | 761 |
| 501 | Ga0224712_10319429 | 3300022467 | Bacteria | 729 |
| 502 | Ga0224712_10638585 | 3300022467 | Unclassified | 521 |
| 503 | Ga0224712_10657853 | 3300022467 | Bacteria | 514 |
| 504 | Ga0207656_10594374 | 3300025321 | Bacteria | 565 |
| 505 | Ga0207653_10037151 | 3300025885 | Bacteria | 1588 |
| 506 | Ga0207692_10168848 | 3300025898 | Bacteria | 1266 |
| 507 | Ga0207692_10444391 | 3300025898 | Bacteria | 815 |
| 508 | Ga0207692_10543385 | 3300025898 | Unclassified | 742 |
| 509 | Ga0207692_11035061 | 3300025898 | Bacteria | 543 |
| 510 | Ga0207642_10344023 | 3300025899 | Bacteria | 878 |
| 511 | Ga0207710_10055540 | 3300025900 | Bacteria | 1785 |
| 512 | Ga0207710_10463359 | 3300025900 | Bacteria | 655 |
| 513 | Ga0207688_10038649 | 3300025901 | Bacteria | 2649 |
| 514 | Ga0207688_10155143 | 3300025901 | Bacteria | 1355 |
| 515 | Ga0207688_10836296 | 3300025901 | Bacteria | 583 |
| 516 | Ga0207680_10035015 | 3300025903 | Bacteria | 2878 |
| 517 | Ga0207647_10064947 | 3300025904 | Bacteria | 2216 |
| 518 | Ga0207647_10307419 | 3300025904 | Bacteria | 902 |
| 519 | Ga0207685_10259461 | 3300025905 | Bacteria | 844 |
| 520 | Ga0207699_10356280 | 3300025906 | Bacteria | 1034 |
| 521 | Ga0207699_10742399 | 3300025906 | Bacteria | 720 |
| 522 | Ga0207645_10258926 | 3300025907 | Bacteria | 1152 |
| 523 | Ga0207643_10439397 | 3300025908 | Bacteria | 829 |
| 524 | Ga0207705_10014835 | 3300025909 | Bacteria | 5602 |
| 525 | Ga0207705_10047609 | 3300025909 | Bacteria | 3083 |
| 526 | Ga0207705_10087228 | 3300025909 | Bacteria | 2281 |
| 527 | Ga0207705_10098696 | 3300025909 | Bacteria | 2146 |
| 528 | Ga0207705_10772421 | 3300025909 | Bacteria | 746 |
| 529 | Ga0207705_10793554 | 3300025909 | Bacteria | 735 |
| 530 | Ga0207705_10863536 | 3300025909 | Bacteria | 701 |
| 531 | Ga0207705_11248379 | 3300025909 | Bacteria | 569 |
| 532 | Ga0207654_10038145 | 3300025911 | Bacteria | 2694 |
| 533 | Ga0207654_10046709 | 3300025911 | Bacteria | 2470 |
| 534 | Ga0207654_10168255 | 3300025911 | Bacteria | 1421 |
| 535 | Ga0207654_11276280 | 3300025911 | Bacteria | 535 |
| 536 | Ga0207707_10012220 | 3300025912 | Bacteria | 7464 |
| 537 | Ga0207707_10012425 | 3300025912 | Bacteria | 7402 |
| 538 | Ga0207707_10062306 | 3300025912 | Bacteria | 3245 |
| 539 | Ga0207707_10122204 | 3300025912 | Bacteria | 2277 |
| 540 | Ga0207707_10257344 | 3300025912 | Bacteria | 1515 |
| 541 | Ga0207707_10351324 | 3300025912 | Bacteria | 1270 |
| 542 | Ga0207707_10353367 | 3300025912 | Bacteria | 1266 |
| 543 | Ga0207707_10662960 | 3300025912 | Bacteria | 879 |
| 544 | Ga0207695_10148932 | 3300025913 | Bacteria | 2281 |
| 545 | Ga0207695_10426091 | 3300025913 | Bacteria | 1211 |
| 546 | Ga0207695_10579951 | 3300025913 | Bacteria | 1003 |
| 547 | Ga0207695_10709007 | 3300025913 | Bacteria | 887 |
| 548 | Ga0207695_10946595 | 3300025913 | Bacteria | 741 |
| 549 | Ga0207695_11078072 | 3300025913 | Bacteria | 683 |
| 550 | Ga0207671_10136721 | 3300025914 | Bacteria | 1885 |
| 551 | Ga0207671_10191442 | 3300025914 | Bacteria | 1595 |
| 552 | Ga0207671_11578931 | 3300025914 | Unclassified | 505 |
| 553 | Ga0207693_10033503 | 3300025915 | Bacteria | 4054 |
| 554 | Ga0207693_10042789 | 3300025915 | Bacteria | 3565 |
| 555 | Ga0207693_10052457 | 3300025915 | Bacteria | 3199 |
| 556 | Ga0207693_10112890 | 3300025915 | Bacteria | 2132 |
| 557 | Ga0207693_10456362 | 3300025915 | Bacteria | 998 |
| 558 | Ga0207693_10682311 | 3300025915 | Bacteria | 797 |
| 559 | Ga0207663_10308049 | 3300025916 | Bacteria | 1186 |
| 560 | Ga0207663_10418927 | 3300025916 | Bacteria | 1028 |
| 561 | Ga0207663_10754221 | 3300025916 | Bacteria | 773 |
| 562 | Ga0207663_11213707 | 3300025916 | Bacteria | 607 |
| 563 | Ga0207660_10042937 | 3300025917 | Bacteria | 3176 |
| 564 | Ga0207660_10083496 | 3300025917 | Bacteria | 2352 |
| 565 | Ga0207660_10348710 | 3300025917 | Bacteria | 1186 |
| 566 | Ga0207660_10373504 | 3300025917 | Bacteria | 1145 |
| 567 | Ga0207660_10471223 | 3300025917 | Bacteria | 1017 |
| 568 | Ga0207660_10803429 | 3300025917 | Bacteria | 768 |
| 569 | Ga0207660_11333072 | 3300025917 | Bacteria | 582 |
| 570 | Ga0207660_11485197 | 3300025917 | Bacteria | 548 |
| 571 | Ga0207660_11538452 | 3300025917 | Bacteria | 537 |
| 572 | Ga0207662_10044516 | 3300025918 | Bacteria | 2620 |
| 573 | Ga0207662_10377752 | 3300025918 | Unclassified | 957 |
| 574 | Ga0207657_10000054 | 3300025919 | Bacteria | 106767 |
| 575 | Ga0207657_10001075 | 3300025919 | Bacteria | 28931 |
| 576 | Ga0207657_10001255 | 3300025919 | Bacteria | 27138 |
| 577 | Ga0207657_10007381 | 3300025919 | Bacteria | 11277 |
| 578 | Ga0207657_10008257 | 3300025919 | Bacteria | 10599 |
| 579 | Ga0207657_10051326 | 3300025919 | Bacteria | 3585 |
| 580 | Ga0207657_10222148 | 3300025919 | Bacteria | 1513 |
| 581 | Ga0207657_10452555 | 3300025919 | Bacteria | 1007 |
| 582 | Ga0207657_10458850 | 3300025919 | Bacteria | 999 |
| 583 | Ga0207657_10579824 | 3300025919 | Bacteria | 876 |
| 584 | Ga0207649_10078373 | 3300025920 | Bacteria | 2132 |
| 585 | Ga0207649_10121488 | 3300025920 | Bacteria | 1761 |
| 586 | Ga0207649_10218778 | 3300025920 | Bacteria | 1355 |
| 587 | Ga0207652_10053360 | 3300025921 | Bacteria | 3472 |
| 588 | Ga0207652_10058771 | 3300025921 | Bacteria | 3313 |
| 589 | Ga0207652_10074054 | 3300025921 | Bacteria | 2964 |
| 590 | Ga0207652_10074769 | 3300025921 | Bacteria | 2951 |
| 591 | Ga0207652_10098968 | 3300025921 | Bacteria | 2573 |
| 592 | Ga0207652_10169975 | 3300025921 | Bacteria | 1956 |
| 593 | Ga0207652_10173903 | 3300025921 | Bacteria | 1933 |
| 594 | Ga0207652_10212704 | 3300025921 | Bacteria | 1741 |
| 595 | Ga0207652_10775809 | 3300025921 | Bacteria | 852 |
| 596 | Ga0207652_10932454 | 3300025921 | Bacteria | 766 |
| 597 | Ga0207652_11416136 | 3300025921 | Bacteria | 598 |
| 598 | Ga0207646_10001441 | 3300025922 | Bacteria | 29529 |
| 599 | Ga0207646_10118695 | 3300025922 | Bacteria | 2376 |
| 600 | Ga0207646_10176404 | 3300025922 | Bacteria | 1930 |
| 601 | Ga0207646_10375212 | 3300025922 | Bacteria | 1285 |
| 602 | Ga0207694_10033295 | 3300025924 | Bacteria | 3948 |
| 603 | Ga0207694_10058043 | 3300025924 | Bacteria | 3010 |
| 604 | Ga0207694_10107410 | 3300025924 | Bacteria | 2217 |
| 605 | Ga0207694_10603668 | 3300025924 | Bacteria | 923 |
| 606 | Ga0207659_10444250 | 3300025926 | Bacteria | 1091 |
| 607 | Ga0207687_10015379 | 3300025927 | Bacteria | 5016 |
| 608 | Ga0207687_10042209 | 3300025927 | Bacteria | 3136 |
| 609 | Ga0207687_10080429 | 3300025927 | Bacteria | 2352 |
| 610 | Ga0207687_10109199 | 3300025927 | Bacteria | 2049 |
| 611 | Ga0207687_10227911 | 3300025927 | Bacteria | 1471 |
| 612 | Ga0207687_10236458 | 3300025927 | Bacteria | 1446 |
| 613 | Ga0207687_10851679 | 3300025927 | Bacteria | 779 |
| 614 | Ga0207687_11329517 | 3300025927 | Bacteria | 618 |
| 615 | Ga0207687_11411295 | 3300025927 | Bacteria | 598 |
| 616 | Ga0207700_10198685 | 3300025928 | Bacteria | 1689 |
| 617 | Ga0207700_10424560 | 3300025928 | Bacteria | 1168 |
| 618 | Ga0207700_10455036 | 3300025928 | Bacteria | 1129 |
| 619 | Ga0207700_10562975 | 3300025928 | Bacteria | 1012 |
| 620 | Ga0207700_10635225 | 3300025928 | Bacteria | 951 |
| 621 | Ga0207700_10849679 | 3300025928 | Bacteria | 817 |
| 622 | Ga0207700_11158495 | 3300025928 | Bacteria | 691 |
| 623 | Ga0207700_11581610 | 3300025928 | Bacteria | 580 |
| 624 | Ga0207664_10412519 | 3300025929 | Bacteria | 1202 |
| 625 | Ga0207664_10431611 | 3300025929 | Unclassified | 1174 |
| 626 | Ga0207664_10662908 | 3300025929 | Bacteria | 938 |
| 627 | Ga0207664_10808620 | 3300025929 | Bacteria | 843 |
| 628 | Ga0207664_10884949 | 3300025929 | Bacteria | 802 |
| 629 | Ga0207664_11402492 | 3300025929 | Unclassified | 619 |
| 630 | Ga0207664_11434657 | 3300025929 | Bacteria | 611 |
| 631 | Ga0207664_11541722 | 3300025929 | Bacteria | 586 |
| 632 | Ga0207664_11865241 | 3300025929 | Unclassified | 524 |
| 633 | Ga0207644_10089503 | 3300025931 | Bacteria | 2291 |
| 634 | Ga0207644_10139439 | 3300025931 | Bacteria | 1866 |
| 635 | Ga0207690_10002378 | 3300025932 | Bacteria | 11401 |
| 636 | Ga0207690_10040448 | 3300025932 | Bacteria | 3048 |
| 637 | Ga0207690_10163381 | 3300025932 | Bacteria | 1662 |
| 638 | Ga0207690_10324374 | 3300025932 | Bacteria | 1211 |
| 639 | Ga0207706_10054711 | 3300025933 | Bacteria | 3521 |
| 640 | Ga0207706_10203018 | 3300025933 | Bacteria | 1738 |
| 641 | Ga0207686_10052028 | 3300025934 | Bacteria | 2554 |
| 642 | Ga0207686_10154413 | 3300025934 | Bacteria | 1602 |
| 643 | Ga0207686_10278449 | 3300025934 | Bacteria | 1234 |
| 644 | Ga0207686_10384300 | 3300025934 | Bacteria | 1065 |
| 645 | Ga0207686_10642320 | 3300025934 | Bacteria | 839 |
| 646 | Ga0207709_10041105 | 3300025935 | Bacteria | 2773 |
| 647 | Ga0207670_11012724 | 3300025936 | Bacteria | 699 |
| 648 | Ga0207669_10338668 | 3300025937 | Unclassified | 1158 |
| 649 | Ga0207704_10072413 | 3300025938 | Bacteria | 2190 |
| 650 | Ga0207704_11443764 | 3300025938 | Bacteria | 590 |
| 651 | Ga0207704_11941060 | 3300025938 | Bacteria | 506 |
| 652 | Ga0207665_10043153 | 3300025939 | Bacteria | 3015 |
| 653 | Ga0207665_10308420 | 3300025939 | Bacteria | 1185 |
| 654 | Ga0207665_10522360 | 3300025939 | Bacteria | 919 |
| 655 | Ga0207665_11426895 | 3300025939 | Bacteria | 551 |
| 656 | Ga0207691_10327447 | 3300025940 | Bacteria | 1313 |
| 657 | Ga0207691_10909320 | 3300025940 | Bacteria | 737 |
| 658 | Ga0207711_10258186 | 3300025941 | Bacteria | 1601 |
| 659 | Ga0207711_10314043 | 3300025941 | Bacteria | 1447 |
| 660 | Ga0207711_10338085 | 3300025941 | Bacteria | 1393 |
| 661 | Ga0207661_10020944 | 3300025944 | Bacteria | 4896 |
| 662 | Ga0207661_10070838 | 3300025944 | Bacteria | 2847 |
| 663 | Ga0207661_10098620 | 3300025944 | Bacteria | 2449 |
| 664 | Ga0207661_10393406 | 3300025944 | Bacteria | 1256 |
| 665 | Ga0207661_10474490 | 3300025944 | Bacteria | 1141 |
| 666 | Ga0207661_10689500 | 3300025944 | Bacteria | 939 |
| 667 | Ga0207679_10368007 | 3300025945 | Unclassified | 1257 |
| 668 | Ga0207667_10071922 | 3300025949 | Bacteria | 3595 |
| 669 | Ga0207667_10082068 | 3300025949 | Bacteria | 3340 |
| 670 | Ga0207667_10115354 | 3300025949 | Bacteria | 2768 |
| 671 | Ga0207667_10174403 | 3300025949 | Bacteria | 2209 |
| 672 | Ga0207667_10181179 | 3300025949 | Bacteria | 2163 |
| 673 | Ga0207667_10332376 | 3300025949 | Bacteria | 1551 |
| 674 | Ga0207667_10656266 | 3300025949 | Bacteria | 1054 |
| 675 | Ga0207667_10666747 | 3300025949 | Bacteria | 1044 |
| 676 | Ga0207651_10594431 | 3300025960 | Bacteria | 967 |
| 677 | Ga0207651_11897747 | 3300025960 | Bacteria | 536 |
| 678 | Ga0207712_10472788 | 3300025961 | Bacteria | 1067 |
| 679 | Ga0207712_10530238 | 3300025961 | Bacteria | 1010 |
| 680 | Ga0207712_11034823 | 3300025961 | Bacteria | 729 |
| 681 | Ga0207668_10342835 | 3300025972 | Bacteria | 1247 |
| 682 | Ga0207668_10343335 | 3300025972 | Bacteria | 1246 |
| 683 | Ga0207640_10709786 | 3300025981 | Bacteria | 863 |
| 684 | Ga0207640_11175220 | 3300025981 | Bacteria | 681 |
| 685 | Ga0207658_10014581 | 3300025986 | Bacteria | 5382 |
| 686 | Ga0207658_11314677 | 3300025986 | Bacteria | 661 |
| 687 | Ga0207677_10031103 | 3300026023 | Bacteria | 3416 |
| 688 | Ga0207677_10039990 | 3300026023 | Bacteria | 3087 |
| 689 | Ga0207677_10509867 | 3300026023 | Bacteria | 1042 |
| 690 | Ga0207677_10687369 | 3300026023 | Unclassified | 906 |
| 691 | Ga0207703_10100530 | 3300026035 | Bacteria | 2450 |
| 692 | Ga0207703_10333854 | 3300026035 | Bacteria | 1391 |
| 693 | Ga0207703_10887266 | 3300026035 | Bacteria | 854 |
| 694 | Ga0207639_10062603 | 3300026041 | Bacteria | 2878 |
| 695 | Ga0207639_10170303 | 3300026041 | Bacteria | 1844 |
| 696 | Ga0207639_10219301 | 3300026041 | Bacteria | 1642 |
| 697 | Ga0207639_10666463 | 3300026041 | Bacteria | 963 |
| 698 | Ga0207678_10053177 | 3300026067 | Bacteria | 3491 |
| 699 | Ga0207678_10505585 | 3300026067 | Bacteria | 1054 |
| 700 | Ga0207708_10196226 | 3300026075 | Bacteria | 1609 |
| 701 | Ga0207708_10331811 | 3300026075 | Bacteria | 1244 |
| 702 | Ga0207702_10002160 | 3300026078 | Bacteria | 18887 |
| 703 | Ga0207702_10130604 | 3300026078 | Bacteria | 2260 |
| 704 | Ga0207702_10207597 | 3300026078 | Bacteria | 1819 |
| 705 | Ga0207702_10403860 | 3300026078 | Bacteria | 1318 |
| 706 | Ga0207702_10538565 | 3300026078 | Bacteria | 1141 |
| 707 | Ga0207702_10609433 | 3300026078 | Bacteria | 1072 |
| 708 | Ga0207702_10857581 | 3300026078 | Bacteria | 899 |
| 709 | Ga0207641_10440004 | 3300026088 | Bacteria | 1258 |
| 710 | Ga0207641_10507237 | 3300026088 | Bacteria | 1172 |
| 711 | Ga0207648_10152368 | 3300026089 | Bacteria | 2040 |
| 712 | Ga0207648_10718940 | 3300026089 | Bacteria | 926 |
| 713 | Ga0207676_10211131 | 3300026095 | Bacteria | 1722 |
| 714 | Ga0207674_10053698 | 3300026116 | Bacteria | 4106 |
| 715 | Ga0207674_10159297 | 3300026116 | Bacteria | 2212 |
| 716 | Ga0207674_10167092 | 3300026116 | Bacteria | 2154 |
| 717 | Ga0207674_11187893 | 3300026116 | Unclassified | 732 |
| 718 | Ga0207674_11707950 | 3300026116 | Bacteria | 598 |
| 719 | Ga0207683_10055645 | 3300026121 | Bacteria | 3469 |
| 720 | Ga0207683_10104344 | 3300026121 | Bacteria | 2533 |
| 721 | Ga0207698_10058341 | 3300026142 | Bacteria | 2991 |
| 722 | Ga0207698_10307404 | 3300026142 | Bacteria | 1479 |
| 723 | Ga0207698_10457648 | 3300026142 | Bacteria | 1233 |
| 724 | Ga0207698_10506287 | 3300026142 | Bacteria | 1176 |
| 725 | Ga0207698_11162584 | 3300026142 | Bacteria | 785 |
| 726 | Ga0207698_11485780 | 3300026142 | Bacteria | 693 |
| 727 | Ga0207698_12372150 | 3300026142 | Unclassified | 542 |
| 728 | Ga0207428_10002365 | 3300027907 | Bacteria | 18835 |
| 729 | Ga0268266_10059309 | 3300028379 | Bacteria | 3297 |
| 730 | Ga0268266_10081241 | 3300028379 | Bacteria | 2826 |
| 731 | Ga0268266_10774543 | 3300028379 | Bacteria | 926 |
| 732 | Ga0268265_11261046 | 3300028380 | Bacteria | 738 |
| 733 | Ga0268264_10171684 | 3300028381 | Bacteria | 1962 |
| 734 | Ga0265337_1090596 | 3300028556 | Bacteria | 834 |
| 735 | Ga0265326_10257653 | 3300028558 | Bacteria | 504 |
| 736 | Ga0265319_1020126 | 3300028563 | Bacteria | 2481 |
| 737 | Ga0265319_1050512 | 3300028563 | Bacteria | 1373 |
| 738 | Ga0265319_1117124 | 3300028563 | Bacteria | 831 |
| 739 | Ga0265319_1145256 | 3300028563 | Bacteria | 735 |
| 740 | Ga0265319_1163791 | 3300028563 | Unclassified | 687 |
| 741 | Ga0265334_10073313 | 3300028573 | Bacteria | 1271 |
| 742 | Ga0265334_10232894 | 3300028573 | Bacteria | 636 |
| 743 | Ga0265318_10006408 | 3300028577 | Bacteria | 5419 |
| 744 | Ga0265318_10067811 | 3300028577 | Bacteria | 1324 |
| 745 | Ga0265318_10081795 | 3300028577 | Bacteria | 1193 |
| 746 | Ga0265318_10199626 | 3300028577 | Bacteria | 731 |
| 747 | Ga0265318_10309750 | 3300028577 | Bacteria | 576 |
| 748 | Ga0265323_10068454 | 3300028653 | Bacteria | 1219 |
| 749 | Ga0265336_10001147 | 3300028666 | Bacteria | 12675 |
| 750 | Ga0265338_10005100 | 3300028800 | Bacteria | 17325 |
| 751 | Ga0265338_10007755 | 3300028800 | Bacteria | 13209 |
| 752 | Ga0265338_10020589 | 3300028800 | Bacteria | 6931 |
| 753 | Ga0265338_10026919 | 3300028800 | Bacteria | 5785 |
| 754 | Ga0265338_10081701 | 3300028800 | Bacteria | 2708 |
| 755 | Ga0265338_10123267 | 3300028800 | Bacteria | 2061 |
| 756 | Ga0265338_10131371 | 3300028800 | Bacteria | 1976 |
| 757 | Ga0265338_10142381 | 3300028800 | Bacteria | 1876 |
| 758 | Ga0265324_10008358 | 3300029957 | Bacteria | 4115 |
| 759 | Ga0265332_10141529 | 3300031238 | Bacteria | 1008 |
| 760 | Ga0265320_10093432 | 3300031240 | Bacteria | 1392 |
| 761 | Ga0265320_10119407 | 3300031240 | Bacteria | 1203 |
| 762 | Ga0265320_10342665 | 3300031240 | Bacteria | 660 |
| 763 | Ga0265325_10276032 | 3300031241 | Bacteria | 755 |
| 764 | Ga0265340_10042361 | 3300031247 | Bacteria | 2235 |
| 765 | Ga0265340_10269992 | 3300031247 | Bacteria | 756 |
| 766 | Ga0265339_10162809 | 3300031249 | Bacteria | 1122 |
| 767 | Ga0265316_10589057 | 3300031344 | Bacteria | 789 |
| 768 | Ga0265316_10714300 | 3300031344 | Bacteria | 706 |
| 769 | Ga0307408_102053960 | 3300031548 | Bacteria | 550 |
| 770 | Ga0265313_10004487 | 3300031595 | Bacteria | 10683 |
| 771 | Ga0265313_10206493 | 3300031595 | Unclassified | 815 |
| 772 | Ga0265314_10013102 | 3300031711 | Bacteria | 6718 |
| 773 | Ga0265314_10416319 | 3300031711 | Bacteria | 723 |
| 774 | Ga0265314_10567123 | 3300031711 | Unclassified | 589 |
| 775 | Ga0265342_10284431 | 3300031712 | Bacteria | 874 |
| 776 | Ga0307409_102113783 | 3300031995 | Bacteria | 593 |
| 777 | Ga0307416_100966122 | 3300032002 | Bacteria | 954 |
| 778 | Ga0307415_100499327 | 3300032126 | Bacteria | 1063 |
| 779 | Ga0373938_0161036 | 3300034957 | Bacteria | 603 |
| 780 | Ga0373926_0027594 | 3300035083 | Bacteria | 1990 |
| 781 | Ga0373926_0041034 | 3300035083 | Bacteria | 1653 |
| 782 | Ga0373934_0066375 | 3300035086 | Bacteria | 1441 |
| 783 | Ga0373944_0003405 | 3300035089 | Bacteria | 4100 |
| 784 | Ga0373944_0017421 | 3300035089 | Bacteria | 2039 |
| 785 | Ga0373944_0034813 | 3300035089 | Bacteria | 1532 |
| 786 | Ga0373944_0072422 | 3300035089 | Unclassified | 1125 |
| 787 | Ga0373949_0102209 | 3300035090 | Bacteria | 787 |
| 788 | Ga0373923_0009617 | 3300035111 | Bacteria | 3495 |
| 789 | Ga0373923_0112107 | 3300035111 | Bacteria | 1212 |
| 790 | Ga0373936_0012158 | 3300035113 | Bacteria | 3270 |
| 791 | Ga0373936_0031292 | 3300035113 | Bacteria | 2101 |
| 792 | Ga0373936_0034868 | 3300035113 | Bacteria | 2001 |
| 793 | Ga0373945_0003331 | 3300035116 | Bacteria | 5047 |
| 794 | Ga0373945_0008817 | 3300035116 | Bacteria | 3294 |
| 795 | Ga0373945_0021731 | 3300035116 | Bacteria | 2207 |
| 796 | Ga0373945_0033306 | 3300035116 | Bacteria | 1830 |
| 797 | Ga0373953_0080481 | 3300035117 | Bacteria | 1354 |
| 798 | Ga0373953_0213009 | 3300035117 | Bacteria | 836 |
| 799 | Ga0373954_0008966 | 3300035118 | Bacteria | 4404 |
| 800 | Ga0373954_0086516 | 3300035118 | Bacteria | 1502 |
| 801 | Ga0373954_0594280 | 3300035118 | Bacteria | 549 |
| 802 | Ga0373956_0073808 | 3300035119 | Bacteria | 1559 |
| 803 | Ga0373957_0038874 | 3300035120 | Bacteria | 1783 |
| 804 | Ga0373943_0000693 | 3300035170 | Bacteria | 14694 |
| 805 | Ga0373943_0001040 | 3300035170 | Bacteria | 12335 |
| 806 | Ga0373943_0001343 | 3300035170 | Bacteria | 11085 |
| 807 | Ga0373943_0006737 | 3300035170 | Bacteria | 5157 |
| 808 | Ga0373946_0031421 | 3300035171 | Bacteria | 2126 |
| 809 | Ga0373946_0050342 | 3300035171 | Bacteria | 1740 |
| 810 | Ga0373946_0120483 | 3300035171 | Unclassified | 1197 |
| 811 | Ga0373946_0559320 | 3300035171 | Bacteria | 591 |
| 812 | Ga0373955_0012109 | 3300035172 | Bacteria | 4138 |
| 813 | Ga0373955_0195877 | 3300035172 | Bacteria | 1202 |
| 814 | Ga0373955_0209553 | 3300035172 | Bacteria | 1162 |
| 815 | Ga0373924_0024092 | 3300035410 | Bacteria | 2395 |
| 816 | Ga0373924_0045859 | 3300035410 | Bacteria | 1799 |
| 817 | Ga0373924_0160201 | 3300035410 | Bacteria | 987 |
| 818 | Ga0373924_0196163 | 3300035410 | Bacteria | 890 |
| 819 | Ga0373924_0304719 | 3300035410 | Bacteria | 708 |
| 820 | Ga0373935_0016894 | 3300035692 | Bacteria | 4419 |
| 821 | Ga0373935_0017594 | 3300035692 | Bacteria | 4340 |
| 822 | Ga0373935_0027291 | 3300035692 | Bacteria | 3529 |
| 823 | Ga0373935_0558880 | 3300035692 | Bacteria | 834 |
| 824 | Ga0373935_0690893 | 3300035692 | Bacteria | 750 |
| 825 | Ga0373927_0028499 | 3300035695 | Bacteria | 3643 |
| 826 | Ga0373927_0133645 | 3300035695 | Bacteria | 1621 |
| 827 | Ga0373927_0135003 | 3300035695 | Bacteria | 1612 |
| 828 | Ga0373927_0304447 | 3300035695 | Unclassified | 1049 |
| 829 | Ga0373933_0050952 | 3300035724 | Bacteria | 2473 |
| 830 | Ga0373933_0113076 | 3300035724 | Bacteria | 1695 |
| 831 | Ga0373933_0383579 | 3300035724 | Bacteria | 915 |
| 832 | Ga0373947_0001170 | 3300035725 | Bacteria | 16135 |
| 833 | Ga0373947_0099387 | 3300035725 | Bacteria | 1826 |
| 834 | Ga0373947_0104473 | 3300035725 | Bacteria | 1783 |
| 835 | Ga0373947_0106346 | 3300035725 | Unclassified | 1768 |
| 836 | Ga0373947_0583399 | 3300035725 | Bacteria | 762 |
| 837 | Ga0373937_0012607 | 3300036401 | Bacteria | 7439 |
| 838 | Ga0373937_0168279 | 3300036401 | Bacteria | 2056 |
| 839 | Ga0373937_0301151 | 3300036401 | Bacteria | 1515 |
| 840 | Ga0373937_0402272 | 3300036401 | Bacteria | 1299 |
| 841 | Ga0373925_0002413 | 3300037068 | Bacteria | 14989 |
| 842 | Ga0373925_0002841 | 3300037068 | Bacteria | 13667 |
| 843 | Ga0373925_0005888 | 3300037068 | Bacteria | 9086 |
| 844 | Ga0373925_0101668 | 3300037068 | Bacteria | 2210 |
| 845 | Ga0373925_0745852 | 3300037068 | Unclassified | 807 |
| 846 | Ga0395899_0046455 | 3300037312 | Bacteria | 3234 |
| 847 | Ga0395899_0119121 | 3300037312 | Bacteria | 1893 |
| 848 | Ga0395899_0135136 | 3300037312 | Bacteria | 1758 |
| 849 | Ga0395899_0135739 | 3300037312 | Bacteria | 1754 |
| 850 | Ga0395899_0218398 | 3300037312 | Bacteria | 1321 |
| 851 | Ga0395899_0289200 | 3300037312 | Bacteria | 1112 |
| 852 | Ga0395900_0034383 | 3300037418 | Bacteria | 5219 |
| 853 | Ga0395900_0042427 | 3300037418 | Bacteria | 4688 |
| 854 | Ga0395900_0048345 | 3300037418 | Bacteria | 4382 |
| 855 | Ga0395900_0068352 | 3300037418 | Bacteria | 3651 |
| 856 | Ga0395900_0084734 | 3300037418 | Bacteria | 3257 |
| 857 | Ga0395900_0184594 | 3300037418 | Bacteria | 2117 |
| 858 | Ga0395900_0224573 | 3300037418 | Bacteria | 1891 |
| 859 | Ga0395900_0229982 | 3300037418 | Bacteria | 1865 |
| 860 | Ga0395900_0261756 | 3300037418 | Bacteria | 1727 |
| 861 | Ga0395900_0262135 | 3300037418 | Unclassified | 1725 |
| 862 | Ga0395900_0342073 | 3300037418 | Bacteria | 1471 |
| 863 | Ga0395900_0901850 | 3300037418 | Bacteria | 807 |
| 864 | Ga0395900_1385357 | 3300037418 | Bacteria | 616 |
| 865 | Ga0395900_1424650 | 3300037418 | Bacteria | 606 |
| 866 | Ga0395898_0002613 | 3300037466 | Bacteria | 20969 |
| 867 | Ga0395898_0013164 | 3300037466 | Bacteria | 8524 |
| 868 | Ga0395898_0020929 | 3300037466 | Bacteria | 6639 |
| 869 | Ga0395898_0029711 | 3300037466 | Bacteria | 5471 |
| 870 | Ga0395898_0030941 | 3300037466 | Bacteria | 5352 |
| 871 | Ga0395898_0082415 | 3300037466 | Bacteria | 3100 |
| 872 | Ga0395898_0083641 | 3300037466 | Bacteria | 3076 |
| 873 | Ga0395898_0094034 | 3300037466 | Bacteria | 2881 |
| 874 | Ga0395898_0214966 | 3300037466 | Bacteria | 1834 |
| 875 | Ga0395898_0264555 | 3300037466 | Bacteria | 1640 |
| 876 | Ga0395898_0342707 | 3300037466 | Bacteria | 1425 |
| 877 | Ga0395898_0387390 | 3300037466 | Bacteria | 1333 |
| 878 | Ga0395898_0448942 | 3300037466 | Bacteria | 1228 |
| 879 | Ga0395898_0514803 | 3300037466 | Bacteria | 1138 |
| 880 | Ga0395898_0544788 | 3300037466 | Bacteria | 1102 |
| 881 | Ga0395898_0617722 | 3300037466 | Unclassified | 1026 |
| 882 | Ga0395898_0894398 | 3300037466 | Bacteria | 826 |
| 883 | Ga0395898_1548123 | 3300037466 | Unclassified | 588 |
| 884 | Ga0395898_1723376 | 3300037466 | Unclassified | 549 |
| 885 | Ga0395905_0039611 | 3300037471 | Bacteria | 4421 |
| 886 | Ga0395905_0060677 | 3300037471 | Bacteria | 3536 |
| 887 | Ga0395905_0081507 | 3300037471 | Bacteria | 3032 |
| 888 | Ga0395905_0106658 | 3300037471 | Bacteria | 2630 |
| 889 | Ga0395905_0116059 | 3300037471 | Bacteria | 2516 |
| 890 | Ga0395905_0252809 | 3300037471 | Bacteria | 1646 |
| 891 | Ga0395905_0384153 | 3300037471 | Bacteria | 1298 |
| 892 | Ga0395905_0941404 | 3300037471 | Bacteria | 767 |
| 893 | Ga0395901_0001850 | 3300038443 | Bacteria | 21884 |
| 894 | Ga0395901_0005193 | 3300038443 | Bacteria | 13144 |
| 895 | Ga0395901_0023082 | 3300038443 | Bacteria | 6376 |
| 896 | Ga0395901_0045262 | 3300038443 | Bacteria | 4566 |
| 897 | Ga0395901_0046896 | 3300038443 | Bacteria | 4489 |
| 898 | Ga0395901_0048579 | 3300038443 | Bacteria | 4407 |
| 899 | Ga0395901_0075489 | 3300038443 | Bacteria | 3516 |
| 900 | Ga0395901_0076133 | 3300038443 | Bacteria | 3500 |
| 901 | Ga0395901_0081065 | 3300038443 | Bacteria | 3389 |
| 902 | Ga0395901_0109361 | 3300038443 | Bacteria | 2902 |
| 903 | Ga0395901_0598475 | 3300038443 | Bacteria | 1112 |
| 904 | Ga0395901_0684837 | 3300038443 | Unclassified | 1024 |
| 905 | Ga0395901_0701527 | 3300038443 | Bacteria | 1009 |
| 906 | Ga0395901_0852269 | 3300038443 | Bacteria | 896 |
| 907 | Ga0395901_1280683 | 3300038443 | Bacteria | 696 |
| 908 | Ga0395901_2080522 | 3300038443 | Unclassified | 513 |
| 909 | Ga0436365_1173242 | 3300039437 | Bacteria | 578 |
| 910 | Ga0436363_0218384 | 3300039450 | Bacteria | 1625 |
| 911 | Ga0451793_0437514 | 3300041452 | Bacteria | 954 |
| 912 | Ga0451804_0573671 | 3300041463 | Unclassified | 564 |
| 913 | Ga0451835_1263189 | 3300041492 | Bacteria | 980 |
| 914 | Ga0451837_0215669 | 3300041494 | Bacteria | 515 |
| 915 | Ga0451839_0131976 | 3300041496 | Bacteria | 617 |
| 916 | Ga0451845_0298016 | 3300041501 | Bacteria | 712 |
| 917 | Ga0451853_1676111 | 3300041512 | Unclassified | 830 |
| 918 | Ga0451853_3292590 | 3300041512 | Bacteria | 594 |
| 919 | Ga0439443_085973 | 3300042003 | Unclassified | 589 |
| 920 | Ga0439451_075188 | 3300042009 | Bacteria | 677 |
| 921 | Ga0439455_0220570 | 3300042012 | Bacteria | 551 |
| 922 | Ga0439463_077933 | 3300042016 | Bacteria | 851 |
| 923 | Ga0450888_009755 | 3300042126 | Bacteria | 1102 |
| 924 | Ga0439444_0023645 | 3300042437 | Bacteria | 1105 |
| 925 | Ga0439464_0134370 | 3300042439 | Bacteria | 767 |
| 926 | Ga0439460_0020566 | 3300042461 | Bacteria | 1795 |
| 927 | Ga0439460_0374627 | 3300042461 | Bacteria | 504 |
| 928 | Ga0439440_0157209 | 3300042993 | Bacteria | 654 |
| 929 | Ga0466969_0001239 | 3300044656 | Bacteria | 13785 |
| 930 | Ga0466969_0086127 | 3300044656 | Bacteria | 1493 |
| 931 | Ga0466969_0229652 | 3300044656 | Bacteria | 843 |
| 932 | Ga0466969_0436385 | 3300044656 | Bacteria | 595 |
| 933 | Ga0466972_0016657 | 3300044658 | Bacteria | 3675 |
| 934 | Ga0466965_0015721 | 3300044683 | Bacteria | 3596 |
| 935 | Ga0466965_0109866 | 3300044683 | Bacteria | 1416 |
| 936 | Ga0466966_0081999 | 3300044684 | Bacteria | 2007 |
| 937 | Ga0466966_0095148 | 3300044684 | Bacteria | 1846 |
| 938 | Ga0466966_0177618 | 3300044684 | Bacteria | 1292 |
| 939 | Ga0466966_0216994 | 3300044684 | Bacteria | 1155 |
| 940 | Ga0466966_0252379 | 3300044684 | Bacteria | 1062 |
| 941 | Ga0466966_0275536 | 3300044684 | Bacteria | 1012 |
| 942 | Ga0466966_0329691 | 3300044684 | Bacteria | 917 |
| 943 | Ga0466961_0019216 | 3300044693 | Bacteria | 4398 |
| 944 | Ga0466961_0027794 | 3300044693 | Bacteria | 3637 |
| 945 | Ga0466961_0136405 | 3300044693 | Bacteria | 1537 |
| 946 | Ga0466961_0181480 | 3300044693 | Bacteria | 1307 |
| 947 | Ga0466961_0189684 | 3300044693 | Bacteria | 1274 |
| 948 | Ga0466961_0461676 | 3300044693 | Bacteria | 768 |
| 949 | Ga0466961_0610459 | 3300044693 | Bacteria | 656 |
| 950 | Ga0466961_0624433 | 3300044693 | Bacteria | 647 |
| 951 | Ga0466963_0012694 | 3300044694 | Bacteria | 5159 |
| 952 | Ga0466963_0026856 | 3300044694 | Bacteria | 3683 |
| 953 | Ga0466963_0029064 | 3300044694 | Bacteria | 3554 |
| 954 | Ga0466963_0032315 | 3300044694 | Bacteria | 3388 |
| 955 | Ga0466963_0051866 | 3300044694 | Bacteria | 2720 |
| 956 | Ga0466963_0063868 | 3300044694 | Bacteria | 2465 |
| 957 | Ga0466963_0074337 | 3300044694 | Bacteria | 2292 |
| 958 | Ga0466963_0083780 | 3300044694 | Bacteria | 2163 |
| 959 | Ga0466963_0398754 | 3300044694 | Bacteria | 970 |
| 960 | Ga0466963_0466099 | 3300044694 | Bacteria | 891 |
| 961 | Ga0466963_0576306 | 3300044694 | Unclassified | 795 |
| 962 | Ga0466963_0806392 | 3300044694 | Unclassified | 662 |
| 963 | Ga0466964_0009210 | 3300044706 | Bacteria | 3713 |
| 964 | Ga0466964_0036923 | 3300044706 | Bacteria | 1961 |
| 965 | Ga0466964_0055404 | 3300044706 | Bacteria | 1637 |
| 966 | Ga0466964_0084912 | 3300044706 | Bacteria | 1366 |
| 967 | Ga0466964_0085815 | 3300044706 | Bacteria | 1360 |
| 968 | Ga0466964_0128566 | 3300044706 | Bacteria | 1151 |
| 969 | Ga0466964_0213666 | 3300044706 | Bacteria | 933 |
| 970 | Ga0466964_0572286 | 3300044706 | Bacteria | 616 |
| 971 | Ga0466971_0000146 | 3300044719 | Bacteria | 26422 |
| 972 | Ga0466971_0020229 | 3300044719 | Bacteria | 2959 |
| 973 | Ga0466971_0104248 | 3300044719 | Bacteria | 1305 |
| 974 | Ga0466971_0114361 | 3300044719 | Bacteria | 1247 |
| 975 | Ga0466971_0302490 | 3300044719 | Bacteria | 768 |
| 976 | Ga0466971_0643349 | 3300044719 | Unclassified | 531 |
| 977 | Ga0466968_0002981 | 3300044735 | Bacteria | 6250 |
| 978 | Ga0466968_0003980 | 3300044735 | Bacteria | 5488 |
| 979 | Ga0466968_0129042 | 3300044735 | Bacteria | 1149 |
| 980 | Ga0466968_0174426 | 3300044735 | Bacteria | 997 |
| 981 | Ga0466968_0282069 | 3300044735 | Bacteria | 795 |
| 982 | Ga0466968_0485114 | 3300044735 | Bacteria | 614 |
| 983 | Ga0466968_0726008 | 3300044735 | Bacteria | 508 |
| 984 | Ga0466970_0007704 | 3300044765 | Bacteria | 5403 |
| 985 | Ga0466970_0024506 | 3300044765 | Bacteria | 3155 |
| 986 | Ga0466970_0126304 | 3300044765 | Bacteria | 1403 |
| 987 | Ga0466957_0007245 | 3300044842 | Bacteria | 6270 |
| 988 | Ga0466957_0011691 | 3300044842 | Bacteria | 5074 |
| 989 | Ga0466957_0038873 | 3300044842 | Bacteria | 2869 |
| 990 | Ga0466957_0144937 | 3300044842 | Bacteria | 1532 |
| 991 | Ga0466957_1002484 | 3300044842 | Bacteria | 600 |
| 992 | Ga0466957_1350381 | 3300044842 | Bacteria | 518 |
| 993 | Ga0466960_0119058 | 3300044901 | Bacteria | 1381 |
| 994 | Ga0466960_0168032 | 3300044901 | Bacteria | 1182 |
| 995 | Ga0466960_0185119 | 3300044901 | Bacteria | 1131 |
| 996 | Ga0466960_0725852 | 3300044901 | Archaea | 597 |
| 997 | Ga0466960_1043453 | 3300044901 | Bacteria | 503 |
| 998 | Ga0466959_0043199 | 3300045049 | Bacteria | 3324 |
| 999 | Ga0466959_0062730 | 3300045049 | Bacteria | 2700 |
| 1000 | Ga0466959_0075226 | 3300045049 | Bacteria | 2440 |
| 1001 | Ga0466959_0245574 | 3300045049 | Bacteria | 1235 |
| 1002 | Ga0466959_0472047 | 3300045049 | Bacteria | 849 |
| 1003 | Ga0451576_0228034 | 3300045051 | Bacteria | 1945 |
| 1004 | Ga0451576_1046881 | 3300045051 | Bacteria | 855 |
| 1005 | Ga0466958_0005202 | 3300045836 | Bacteria | 6970 |
| 1006 | Ga0466958_0008076 | 3300045836 | Bacteria | 5822 |
| 1007 | Ga0466958_0065001 | 3300045836 | Bacteria | 2226 |
| 1008 | Ga0466967_0001223 | 3300045976 | Bacteria | 14490 |
| 1009 | Ga0466967_0004614 | 3300045976 | Bacteria | 9336 |
| 1010 | Ga0466967_0008381 | 3300045976 | Bacteria | 7566 |
| 1011 | Ga0466967_0011834 | 3300045976 | Bacteria | 6636 |
| 1012 | Ga0466967_0013205 | 3300045976 | Bacteria | 6369 |
| 1013 | Ga0466967_0028771 | 3300045976 | Bacteria | 4644 |
| 1014 | Ga0466967_0032874 | 3300045976 | Bacteria | 4385 |
| 1015 | Ga0466967_0038514 | 3300045976 | Bacteria | 4101 |
| 1016 | Ga0466967_0045188 | 3300045976 | Bacteria | 3825 |
| 1017 | Ga0466967_0050959 | 3300045976 | Bacteria | 3626 |
| 1018 | Ga0466967_0053989 | 3300045976 | Bacteria | 3534 |
| 1019 | Ga0466967_0059430 | 3300045976 | Bacteria | 3384 |
| 1020 | Ga0466967_0107548 | 3300045976 | Bacteria | 2558 |
| 1021 | Ga0466967_0141347 | 3300045976 | Bacteria | 2242 |
| 1022 | Ga0466967_0141755 | 3300045976 | Bacteria | 2239 |
| 1023 | Ga0466967_0285519 | 3300045976 | Unclassified | 1584 |
| 1024 | Ga0466967_0441151 | 3300045976 | Unclassified | 1271 |
| 1025 | Ga0466967_0645628 | 3300045976 | Bacteria | 1046 |
| 1026 | Ga0466967_1238436 | 3300045976 | Bacteria | 743 |
| 1027 | Ga0466967_1366007 | 3300045976 | Bacteria | 706 |
| 1028 | Ga0466967_1591840 | 3300045976 | Bacteria | 651 |
| 1029 | Ga0466967_1705295 | 3300045976 | Archaea | 627 |
| 1030 | Ga0466967_2314368 | 3300045976 | Bacteria | 533 |
| 1031 | Ga0466967_2445211 | 3300045976 | Bacteria | 517 |
| 1032 | Ga0495592_0035738 | 3300046454 | Bacteria | 3743 |
| 1033 | Ga0495592_0158712 | 3300046454 | Bacteria | 1558 |
| 1034 | Ga0495592_0173325 | 3300046454 | Bacteria | 1475 |
| 1035 | Ga0495592_0203643 | 3300046454 | Unclassified | 1334 |
| 1036 | Ga0495592_0511420 | 3300046454 | Bacteria | 744 |
| 1037 | Ga0495592_0650144 | 3300046454 | Bacteria | 639 |
| 1038 | Ga0495592_0713994 | 3300046454 | Bacteria | 602 |
| 1039 | Ga0495592_0792038 | 3300046454 | Bacteria | 564 |
| 1040 | Ga0495592_0829635 | 3300046454 | Bacteria | 547 |
| 1041 | Ga0495603_0079558 | 3300046455 | Bacteria | 1921 |
| 1042 | Ga0495603_0096109 | 3300046455 | Bacteria | 1731 |
| 1043 | Ga0495603_0415376 | 3300046455 | Bacteria | 771 |
| 1044 | Ga0495603_0562591 | 3300046455 | Bacteria | 653 |
| 1045 | Ga0495603_0835772 | 3300046455 | Bacteria | 524 |
| 1046 | Ga0495629_0000319 | 3300046459 | Bacteria | 41153 |
| 1047 | Ga0495629_0020444 | 3300046459 | Bacteria | 4728 |
| 1048 | Ga0495629_0046949 | 3300046459 | Bacteria | 3028 |
| 1049 | Ga0495629_0155073 | 3300046459 | Bacteria | 1591 |
| 1050 | Ga0495629_0201724 | 3300046459 | Bacteria | 1375 |
| 1051 | Ga0495629_0380482 | 3300046459 | Bacteria | 960 |
| 1052 | Ga0495641_0005764 | 3300046461 | Bacteria | 8229 |
| 1053 | Ga0495641_0016039 | 3300046461 | Bacteria | 3962 |
| 1054 | Ga0495641_0019178 | 3300046461 | Bacteria | 3509 |
| 1055 | Ga0495641_0044455 | 3300046461 | Bacteria | 2049 |
| 1056 | Ga0495641_0044716 | 3300046461 | Bacteria | 2041 |
| 1057 | Ga0495641_0105938 | 3300046461 | Bacteria | 1254 |
| 1058 | Ga0495641_0445532 | 3300046461 | Bacteria | 589 |
| 1059 | Ga0495641_0459922 | 3300046461 | Bacteria | 579 |
| 1060 | Ga0495651_0017133 | 3300046462 | Bacteria | 5614 |
| 1061 | Ga0495651_0039212 | 3300046462 | Bacteria | 3688 |
| 1062 | Ga0495651_0053665 | 3300046462 | Bacteria | 3102 |
| 1063 | Ga0495651_0057032 | 3300046462 | Bacteria | 2999 |
| 1064 | Ga0495651_0088314 | 3300046462 | Bacteria | 2330 |
| 1065 | Ga0495651_0101621 | 3300046462 | Bacteria | 2139 |
| 1066 | Ga0495651_0135760 | 3300046462 | Bacteria | 1790 |
| 1067 | Ga0495651_0400102 | 3300046462 | Bacteria | 897 |
| 1068 | Ga0495651_0483789 | 3300046462 | Bacteria | 795 |
| 1069 | Ga0495651_0992152 | 3300046462 | Bacteria | 510 |
| 1070 | Ga0495653_0012965 | 3300046463 | Bacteria | 6800 |
| 1071 | Ga0495653_0013190 | 3300046463 | Bacteria | 6738 |
| 1072 | Ga0495653_0041082 | 3300046463 | Bacteria | 3612 |
| 1073 | Ga0495653_0087151 | 3300046463 | Bacteria | 2293 |
| 1074 | Ga0495653_0093433 | 3300046463 | Bacteria | 2194 |
| 1075 | Ga0495653_0095777 | 3300046463 | Bacteria | 2160 |
| 1076 | Ga0495653_0222237 | 3300046463 | Bacteria | 1269 |
| 1077 | Ga0495653_0539593 | 3300046463 | Bacteria | 723 |
| 1078 | Ga0495653_0981299 | 3300046463 | Unclassified | 500 |
| 1079 | Ga0495580_0025973 | 3300046472 | Bacteria | 4274 |
| 1080 | Ga0495580_0248207 | 3300046472 | Bacteria | 1219 |
| 1081 | Ga0495580_0663506 | 3300046472 | Bacteria | 685 |
| 1082 | Ga0495582_0000358 | 3300046473 | Bacteria | 24948 |
| 1083 | Ga0495582_0029168 | 3300046473 | Bacteria | 3028 |
| 1084 | Ga0495582_0049271 | 3300046473 | Bacteria | 2319 |
| 1085 | Ga0495582_0140278 | 3300046473 | Bacteria | 1369 |
| 1086 | Ga0495582_0265089 | 3300046473 | Bacteria | 985 |
| 1087 | Ga0495639_0002626 | 3300046475 | Bacteria | 7825 |
| 1088 | Ga0495639_0008199 | 3300046475 | Bacteria | 4488 |
| 1089 | Ga0495662_0002647 | 3300046476 | Bacteria | 9048 |
| 1090 | Ga0495662_0004470 | 3300046476 | Bacteria | 7022 |
| 1091 | Ga0495662_0014253 | 3300046476 | Bacteria | 3866 |
| 1092 | Ga0495664_0047907 | 3300046477 | Bacteria | 2537 |
| 1093 | Ga0495664_0080526 | 3300046477 | Bacteria | 1952 |
| 1094 | Ga0495664_0234406 | 3300046477 | Bacteria | 1110 |
| 1095 | Ga0495664_0340953 | 3300046477 | Bacteria | 903 |
| 1096 | Ga0495664_0406201 | 3300046477 | Bacteria | 818 |
| 1097 | Ga0495664_0504518 | 3300046477 | Unclassified | 722 |
| 1098 | Ga0495664_0536658 | 3300046477 | Bacteria | 698 |
| 1099 | Ga0495584_0008227 | 3300046491 | Bacteria | 5407 |
| 1100 | Ga0495585_0024932 | 3300046492 | Bacteria | 3428 |
| 1101 | Ga0495594_0008671 | 3300046499 | Bacteria | 5240 |
| 1102 | Ga0495594_0041557 | 3300046499 | Bacteria | 2518 |
| 1103 | Ga0495594_0446089 | 3300046499 | Bacteria | 736 |
| 1104 | Ga0495594_0674514 | 3300046499 | Bacteria | 585 |
| 1105 | Ga0495596_0034089 | 3300046500 | Bacteria | 2024 |
| 1106 | Ga0495607_0026956 | 3300046501 | Bacteria | 3560 |
| 1107 | Ga0495608_0003300 | 3300046511 | Bacteria | 11537 |
| 1108 | Ga0495608_0011142 | 3300046511 | Bacteria | 6260 |
| 1109 | Ga0495608_0015297 | 3300046511 | Bacteria | 5323 |
| 1110 | Ga0495608_0148817 | 3300046511 | Bacteria | 1493 |
| 1111 | Ga0495608_0163932 | 3300046511 | Bacteria | 1412 |
| 1112 | Ga0495608_0165641 | 3300046511 | Unclassified | 1404 |
| 1113 | Ga0495608_0377992 | 3300046511 | Bacteria | 869 |
| 1114 | Ga0495608_0567253 | 3300046511 | Bacteria | 683 |
| 1115 | Ga0495618_0027070 | 3300046514 | Bacteria | 3569 |
| 1116 | Ga0495618_0230659 | 3300046514 | Bacteria | 1166 |
| 1117 | Ga0495618_0306520 | 3300046514 | Bacteria | 986 |
| 1118 | Ga0495618_0538243 | 3300046514 | Unclassified | 700 |
| 1119 | Ga0495628_0003751 | 3300046516 | Bacteria | 13525 |
| 1120 | Ga0495628_0040215 | 3300046516 | Bacteria | 3737 |
| 1121 | Ga0495628_0042846 | 3300046516 | Bacteria | 3608 |
| 1122 | Ga0495628_0107147 | 3300046516 | Unclassified | 2152 |
| 1123 | Ga0495628_0221382 | 3300046516 | Bacteria | 1421 |
| 1124 | Ga0495628_0233378 | 3300046516 | Bacteria | 1378 |
| 1125 | Ga0495630_0020826 | 3300046517 | Bacteria | 4839 |
| 1126 | Ga0495630_0020828 | 3300046517 | Bacteria | 4839 |
| 1127 | Ga0495630_0026489 | 3300046517 | Bacteria | 4292 |
| 1128 | Ga0495630_0038705 | 3300046517 | Bacteria | 3568 |
| 1129 | Ga0495630_0043068 | 3300046517 | Bacteria | 3372 |
| 1130 | Ga0495630_0053585 | 3300046517 | Bacteria | 3021 |
| 1131 | Ga0495630_0203386 | 3300046517 | Bacteria | 1511 |
| 1132 | Ga0495630_0307374 | 3300046517 | Bacteria | 1212 |
| 1133 | Ga0495630_0729887 | 3300046517 | Bacteria | 757 |
| 1134 | Ga0495630_0961931 | 3300046517 | Bacteria | 649 |
| 1135 | Ga0495631_0039597 | 3300046518 | Bacteria | 2091 |
| 1136 | Ga0495631_0067783 | 3300046518 | Unclassified | 1544 |
| 1137 | Ga0495644_0000819 | 3300046523 | Bacteria | 12808 |
| 1138 | Ga0495644_0084747 | 3300046523 | Unclassified | 1195 |
| 1139 | Ga0495663_0200780 | 3300046525 | Bacteria | 696 |
| 1140 | Ga0495666_0003469 | 3300046526 | Bacteria | 7961 |
| 1141 | Ga0495666_0015670 | 3300046526 | Bacteria | 3775 |
| 1142 | Ga0495666_0108113 | 3300046526 | Bacteria | 1307 |
| 1143 | Ga0495666_0309813 | 3300046526 | Unclassified | 713 |
| 1144 | Ga0495666_0478711 | 3300046526 | Bacteria | 557 |
| 1145 | Ga0495642_0016114 | 3300046528 | Bacteria | 2911 |
| 1146 | Ga0495652_0017796 | 3300046529 | Bacteria | 6342 |
| 1147 | Ga0495652_0026148 | 3300046529 | Bacteria | 5158 |
| 1148 | Ga0495652_0068899 | 3300046529 | Bacteria | 2962 |
| 1149 | Ga0495652_0157109 | 3300046529 | Bacteria | 1770 |
| 1150 | Ga0495652_0165410 | 3300046529 | Bacteria | 1712 |
| 1151 | Ga0495652_0179986 | 3300046529 | Bacteria | 1623 |
| 1152 | Ga0495652_0429953 | 3300046529 | Bacteria | 928 |
| 1153 | Ga0495654_0451184 | 3300046530 | Bacteria | 506 |
| 1154 | Ga0495665_0012337 | 3300046531 | Bacteria | 4623 |
| 1155 | Ga0495665_0022839 | 3300046531 | Bacteria | 3359 |
| 1156 | Ga0495665_0612094 | 3300046531 | Bacteria | 544 |
| 1157 | Ga0495640_0010306 | 3300046533 | Bacteria | 7227 |
| 1158 | Ga0495640_0039198 | 3300046533 | Bacteria | 3326 |
| 1159 | Ga0495640_0118474 | 3300046533 | Bacteria | 1723 |
| 1160 | Ga0495640_0132953 | 3300046533 | Bacteria | 1609 |
| 1161 | Ga0495640_0598584 | 3300046533 | Bacteria | 666 |
| 1162 | Ga0495586_0009166 | 3300046535 | Bacteria | 5266 |
| 1163 | Ga0495586_0013906 | 3300046535 | Bacteria | 4271 |
| 1164 | Ga0495586_0076673 | 3300046535 | Bacteria | 1832 |
| 1165 | Ga0495587_0047960 | 3300046536 | Unclassified | 2531 |
| 1166 | Ga0495587_0156001 | 3300046536 | Bacteria | 1300 |
| 1167 | Ga0495587_0212471 | 3300046536 | Bacteria | 1092 |
| 1168 | Ga0495587_0225081 | 3300046536 | Bacteria | 1057 |
| 1169 | Ga0495587_0647488 | 3300046536 | Bacteria | 581 |
| 1170 | Ga0495587_0708540 | 3300046536 | Bacteria | 552 |
| 1171 | Ga0495598_0052258 | 3300046537 | Unclassified | 1234 |
| 1172 | Ga0495609_0079067 | 3300046538 | Bacteria | 1439 |
| 1173 | Ga0495645_0012470 | 3300046543 | Bacteria | 5988 |
| 1174 | Ga0495645_0179639 | 3300046543 | Bacteria | 1451 |
| 1175 | Ga0495645_0200208 | 3300046543 | Bacteria | 1355 |
| 1176 | Ga0495645_0212942 | 3300046543 | Bacteria | 1304 |
| 1177 | Ga0495645_0250567 | 3300046543 | Archaea | 1177 |
| 1178 | Ga0495645_0402189 | 3300046543 | Bacteria | 872 |
| 1179 | Ga0495645_0678808 | 3300046543 | Unclassified | 627 |
| 1180 | Ga0495645_0741696 | 3300046543 | Bacteria | 593 |
| 1181 | Ga0495622_0532799 | 3300046557 | Bacteria | 501 |
| 1182 | Ga0495667_0015868 | 3300046559 | Bacteria | 5092 |
| 1183 | Ga0495667_0019234 | 3300046559 | Bacteria | 4608 |
| 1184 | Ga0495667_0028003 | 3300046559 | Bacteria | 3794 |
| 1185 | Ga0495667_0070896 | 3300046559 | Bacteria | 2273 |
| 1186 | Ga0495667_0130580 | 3300046559 | Bacteria | 1620 |
| 1187 | Ga0495667_0134022 | 3300046559 | Bacteria | 1597 |
| 1188 | Ga0495667_0529840 | 3300046559 | Bacteria | 737 |
| 1189 | Ga0495667_0719244 | 3300046559 | Bacteria | 618 |
| 1190 | Ga0495656_0000621 | 3300046615 | Bacteria | 11326 |
| 1191 | Ga0495668_0149722 | 3300046616 | Unclassified | 1278 |
| 1192 | Ga0495634_0003395 | 3300046642 | Bacteria | 12784 |
| 1193 | Ga0495634_0028964 | 3300046642 | Bacteria | 3838 |
| 1194 | Ga0495634_0610370 | 3300046642 | Bacteria | 632 |
| 1195 | Ga0495634_0673166 | 3300046642 | Bacteria | 596 |
| 1196 | Ga0495611_0069496 | 3300046648 | Bacteria | 1609 |
| 1197 | Ga0495635_0021997 | 3300046663 | Bacteria | 4443 |
| 1198 | Ga0495635_0050625 | 3300046663 | Bacteria | 2863 |
| 1199 | Ga0495635_0067003 | 3300046663 | Bacteria | 2462 |
| 1200 | Ga0495635_0166290 | 3300046663 | Bacteria | 1501 |
| 1201 | Ga0495635_0654962 | 3300046663 | Bacteria | 683 |
| 1202 | Ga0495659_0053108 | 3300046664 | Unclassified | 1480 |
| 1203 | Ga0495661_0124357 | 3300046665 | Unclassified | 1421 |
| 1204 | Ga0495588_0017973 | 3300046674 | Bacteria | 3443 |
| 1205 | Ga0495657_0041962 | 3300046675 | Bacteria | 3127 |
| 1206 | Ga0495657_0066345 | 3300046675 | Bacteria | 2371 |
| 1207 | Ga0495657_0118277 | 3300046675 | Bacteria | 1671 |
| 1208 | Ga0495657_0135637 | 3300046675 | Unclassified | 1538 |
| 1209 | Ga0495657_0138910 | 3300046675 | Bacteria | 1516 |
| 1210 | Ga0495657_0270660 | 3300046675 | Bacteria | 1018 |
| 1211 | Ga0495657_0670295 | 3300046675 | Bacteria | 597 |
| 1212 | Ga0495599_0020210 | 3300046678 | Bacteria | 4148 |
| 1213 | Ga0495599_0066938 | 3300046678 | Bacteria | 2244 |
| 1214 | Ga0495599_0130034 | 3300046678 | Bacteria | 1564 |
| 1215 | Ga0495599_0138294 | 3300046678 | Bacteria | 1511 |
| 1216 | Ga0495599_0613570 | 3300046678 | Bacteria | 633 |
| 1217 | Ga0495623_0026708 | 3300046679 | Bacteria | 3715 |
| 1218 | Ga0495623_0077461 | 3300046679 | Bacteria | 2061 |
| 1219 | Ga0495623_0129369 | 3300046679 | Bacteria | 1513 |
| 1220 | Ga0495623_0396815 | 3300046679 | Bacteria | 743 |
| 1221 | Ga0495646_0091022 | 3300046680 | Bacteria | 1761 |
| 1222 | Ga0495646_0118989 | 3300046680 | Bacteria | 1496 |
| 1223 | Ga0495646_0178606 | 3300046680 | Bacteria | 1166 |
| 1224 | Ga0495646_0269118 | 3300046680 | Bacteria | 908 |
| 1225 | Ga0495646_0302686 | 3300046680 | Bacteria | 845 |
| 1226 | Ga0495647_0002047 | 3300046681 | Bacteria | 6312 |
| 1227 | Ga0495647_0107647 | 3300046681 | Bacteria | 1160 |
| 1228 | Ga0495658_0000384 | 3300046683 | Bacteria | 24849 |
| 1229 | Ga0495658_0000524 | 3300046683 | Bacteria | 20922 |
| 1230 | Ga0495658_0009679 | 3300046683 | Bacteria | 4806 |
| 1231 | Ga0495658_0023104 | 3300046683 | Bacteria | 3298 |
| 1232 | Ga0495658_0039216 | 3300046683 | Bacteria | 2627 |
| 1233 | Ga0495658_0422204 | 3300046683 | Bacteria | 851 |
| 1234 | Ga0495658_0524731 | 3300046683 | Bacteria | 758 |
| 1235 | Ga0495658_0952835 | 3300046683 | Bacteria | 548 |
| 1236 | Ga0495669_0270881 | 3300046684 | Bacteria | 816 |
| 1237 | Ga0495613_0012745 | 3300046689 | Bacteria | 6250 |
| 1238 | Ga0495613_0047516 | 3300046689 | Bacteria | 3171 |
| 1239 | Ga0495613_0049317 | 3300046689 | Bacteria | 3107 |
| 1240 | Ga0495613_0131009 | 3300046689 | Unclassified | 1796 |
| 1241 | Ga0495613_0213620 | 3300046689 | Bacteria | 1356 |
| 1242 | Ga0495613_0330458 | 3300046689 | Bacteria | 1051 |
| 1243 | Ga0495613_0422686 | 3300046689 | Bacteria | 906 |
| 1244 | Ga0495613_0632479 | 3300046689 | Bacteria | 709 |
| 1245 | Ga0495613_0727805 | 3300046689 | Unclassified | 651 |
| 1246 | Ga0495624_0023590 | 3300046690 | Bacteria | 4056 |
| 1247 | Ga0495624_0025679 | 3300046690 | Bacteria | 3866 |
| 1248 | Ga0495624_0116212 | 3300046690 | Bacteria | 1644 |
| 1249 | Ga0495624_0138164 | 3300046690 | Bacteria | 1493 |
| 1250 | Ga0495624_0668369 | 3300046690 | Bacteria | 617 |
| 1251 | Ga0495670_0029338 | 3300046691 | Unclassified | 2730 |
| 1252 | Ga0495671_0139557 | 3300046692 | Bacteria | 1181 |
| 1253 | Ga0495589_0030160 | 3300046794 | Bacteria | 2732 |
| 1254 | Ga0495589_0050413 | 3300046794 | Bacteria | 2059 |
| 1255 | Ga0495600_0043381 | 3300046809 | Bacteria | 2933 |
| 1256 | Ga0495600_0048692 | 3300046809 | Bacteria | 2764 |
| 1257 | Ga0495600_0094000 | 3300046809 | Bacteria | 1955 |
| 1258 | Ga0495600_0131471 | 3300046809 | Bacteria | 1627 |
| 1259 | Ga0495600_0163468 | 3300046809 | Bacteria | 1438 |
| 1260 | Ga0495600_0223988 | 3300046809 | Bacteria | 1202 |
| 1261 | Ga0495600_0365700 | 3300046809 | Bacteria | 902 |
| 1262 | Ga0495581_0001964 | 3300047315 | Bacteria | 11525 |
| 1263 | Ga0495581_0003702 | 3300047315 | Bacteria | 8805 |
| 1264 | Ga0495581_0006490 | 3300047315 | Bacteria | 6784 |
| 1265 | Ga0495581_0120733 | 3300047315 | Bacteria | 1525 |
| 1266 | Ga0495581_0769062 | 3300047315 | Bacteria | 553 |
| 1267 | Ga0495604_0016942 | 3300047317 | Bacteria | 5827 |
| 1268 | Ga0495604_0078805 | 3300047317 | Bacteria | 2472 |
| 1269 | Ga0495604_0144390 | 3300047317 | Bacteria | 1697 |
| 1270 | Ga0495604_0184191 | 3300047317 | Bacteria | 1459 |
| 1271 | Ga0495604_0836230 | 3300047317 | Bacteria | 578 |
| 1272 | Ga0495604_0869029 | 3300047317 | Bacteria | 565 |
| 1273 | Ga0495636_0124034 | 3300047318 | Unclassified | 1145 |
| 1274 | Ga0495674_0001135 | 3300047319 | Bacteria | 25640 |
| 1275 | Ga0495674_0075986 | 3300047319 | Bacteria | 2889 |
| 1276 | Ga0495674_0078674 | 3300047319 | Bacteria | 2833 |
| 1277 | Ga0495674_0082781 | 3300047319 | Bacteria | 2751 |
| 1278 | Ga0495674_0110059 | 3300047319 | Bacteria | 2336 |
| 1279 | Ga0495674_0403700 | 3300047319 | Bacteria | 1103 |
| 1280 | Ga0495674_0411608 | 3300047319 | Unclassified | 1090 |
| 1281 | Ga0495674_0481669 | 3300047319 | Bacteria | 994 |
| 1282 | Ga0495674_0621061 | 3300047319 | Bacteria | 854 |
| 1283 | Ga0495674_0794857 | 3300047319 | Bacteria | 736 |
| 1284 | Ga0495676_0005182 | 3300047321 | Bacteria | 11930 |
| 1285 | Ga0495676_0028449 | 3300047321 | Bacteria | 4771 |
| 1286 | Ga0495676_0074178 | 3300047321 | Bacteria | 2606 |
| 1287 | Ga0495676_0130524 | 3300047321 | Bacteria | 1814 |
| 1288 | Ga0495676_0287725 | 3300047321 | Unclassified | 1111 |
| 1289 | Ga0495676_0531132 | 3300047321 | Bacteria | 770 |
| 1290 | Ga0495676_0705796 | 3300047321 | Bacteria | 652 |
| 1291 | Ga0495680_0006719 | 3300047322 | Bacteria | 10637 |
| 1292 | Ga0495680_0007716 | 3300047322 | Bacteria | 9827 |
| 1293 | Ga0495680_0028462 | 3300047322 | Bacteria | 4581 |
| 1294 | Ga0495680_0043380 | 3300047322 | Bacteria | 3561 |
| 1295 | Ga0495680_0074473 | 3300047322 | Bacteria | 2578 |
| 1296 | Ga0495680_0179393 | 3300047322 | Bacteria | 1529 |
| 1297 | Ga0495680_0239931 | 3300047322 | Bacteria | 1288 |
| 1298 | Ga0495680_0264061 | 3300047322 | Bacteria | 1217 |
| 1299 | Ga0495680_0336184 | 3300047322 | Bacteria | 1054 |
| 1300 | Ga0495680_0337949 | 3300047322 | Bacteria | 1051 |
| 1301 | Ga0495675_0093658 | 3300047444 | Bacteria | 1884 |
| 1302 | Ga0495675_0221340 | 3300047444 | Bacteria | 1145 |
| 1303 | Ga0495675_0316570 | 3300047444 | Bacteria | 924 |
| 1304 | Ga0495675_0353554 | 3300047444 | Bacteria | 864 |
| 1305 | Ga0495677_0046016 | 3300047445 | Unclassified | 1601 |
| 1306 | Ga0495677_0336518 | 3300047445 | Unclassified | 595 |
| 1307 | Ga0495679_017240 | 3300047446 | Bacteria | 2589 |
| 1308 | Ga0495684_0004315 | 3300047471 | Bacteria | 11107 |
| 1309 | Ga0495684_0004656 | 3300047471 | Bacteria | 10704 |
| 1310 | Ga0495684_0020981 | 3300047471 | Bacteria | 5032 |
| 1311 | Ga0495684_0041920 | 3300047471 | Bacteria | 3507 |
| 1312 | Ga0495684_0077843 | 3300047471 | Bacteria | 2516 |
| 1313 | Ga0495684_0214846 | 3300047471 | Bacteria | 1412 |
| 1314 | Ga0495684_0272699 | 3300047471 | Bacteria | 1223 |
| 1315 | Ga0495684_0344121 | 3300047471 | Bacteria | 1060 |
| 1316 | Ga0495684_0455250 | 3300047471 | Bacteria | 888 |
| 1317 | Ga0495684_0937321 | 3300047471 | Bacteria | 555 |
| 1318 | Ga0495593_0005983 | 3300047673 | Bacteria | 7167 |
| 1319 | Ga0495593_0011644 | 3300047673 | Bacteria | 5047 |
| 1320 | Ga0495593_0022099 | 3300047673 | Bacteria | 3549 |
| 1321 | Ga0495593_0113318 | 3300047673 | Bacteria | 1384 |
| 1322 | Ga0495593_0161965 | 3300047673 | Unclassified | 1129 |
| 1323 | Ga0495602_0028615 | 3300048088 | Bacteria | 5328 |
| 1324 | Ga0495602_0031949 | 3300048088 | Bacteria | 4965 |
| 1325 | Ga0495602_0056851 | 3300048088 | Bacteria | 3437 |
| 1326 | Ga0495602_0060318 | 3300048088 | Bacteria | 3306 |
| 1327 | Ga0495602_0120423 | 3300048088 | Bacteria | 2112 |
| 1328 | Ga0495602_0132534 | 3300048088 | Bacteria | 1985 |
| 1329 | Ga0495614_0000691 | 3300048089 | Bacteria | 14197 |
| 1330 | Ga0495614_0006789 | 3300048089 | Bacteria | 5121 |
| 1331 | Ga0495614_0018916 | 3300048089 | Bacteria | 2982 |
| 1332 | Ga0495614_0158272 | 3300048089 | Bacteria | 1013 |
| 1333 | Ga0496100_0005889 | 3300048903 | Bacteria | 6639 |
| 1334 | Ga0496100_0021727 | 3300048903 | Bacteria | 3871 |
| 1335 | Ga0496100_0034383 | 3300048903 | Bacteria | 3180 |
| 1336 | Ga0496100_0065983 | 3300048903 | Bacteria | 2400 |
| 1337 | Ga0496100_0118634 | 3300048903 | Bacteria | 1848 |
| 1338 | Ga0496100_0188443 | 3300048903 | Bacteria | 1496 |
| 1339 | Ga0496100_0641605 | 3300048903 | Bacteria | 826 |
| 1340 | Ga0496100_0847498 | 3300048903 | Bacteria | 717 |
| 1341 | Ga0496101_0004773 | 3300048904 | Bacteria | 8596 |
| 1342 | Ga0496101_0010082 | 3300048904 | Bacteria | 6228 |
| 1343 | Ga0496101_0017360 | 3300048904 | Bacteria | 4883 |
| 1344 | Ga0496101_0113060 | 3300048904 | Bacteria | 2046 |
| 1345 | Ga0496101_0164776 | 3300048904 | Bacteria | 1701 |
| 1346 | Ga0496101_0173111 | 3300048904 | Bacteria | 1660 |
| 1347 | Ga0496101_0316791 | 3300048904 | Bacteria | 1223 |
| 1348 | Ga0496101_0602657 | 3300048904 | Bacteria | 868 |
| 1349 | Ga0496101_0790314 | 3300048904 | Bacteria | 748 |
| 1350 | Ga0496102_0009192 | 3300048905 | Bacteria | 8479 |
| 1351 | Ga0496102_0030938 | 3300048905 | Bacteria | 4794 |
| 1352 | Ga0496102_0048111 | 3300048905 | Bacteria | 3877 |
| 1353 | Ga0496102_0102048 | 3300048905 | Bacteria | 2666 |
| 1354 | Ga0496102_0135068 | 3300048905 | Bacteria | 2311 |
| 1355 | Ga0496102_0526804 | 3300048905 | Bacteria | 1104 |
| 1356 | Ga0496102_0636690 | 3300048905 | Bacteria | 989 |
| 1357 | Ga0496102_1175197 | 3300048905 | Bacteria | 687 |
| 1358 | Ga0496102_1497545 | 3300048905 | Bacteria | 593 |
| 1359 | Ga0496103_0030622 | 3300048906 | Bacteria | 3275 |
| 1360 | Ga0496103_0047524 | 3300048906 | Bacteria | 2652 |
| 1361 | Ga0496103_0115083 | 3300048906 | Bacteria | 1710 |
| 1362 | Ga0496103_0327252 | 3300048906 | Unclassified | 986 |
| 1363 | Ga0496103_0440962 | 3300048906 | Bacteria | 835 |
| 1364 | Ga0496103_0496524 | 3300048906 | Bacteria | 781 |
| 1365 | Ga0496104_0056464 | 3300048907 | Bacteria | 3713 |
| 1366 | Ga0496104_0108756 | 3300048907 | Bacteria | 2657 |
| 1367 | Ga0496104_0332452 | 3300048907 | Bacteria | 1432 |
| 1368 | Ga0496104_0344961 | 3300048907 | Bacteria | 1402 |
| 1369 | Ga0496104_0760558 | 3300048907 | Bacteria | 876 |
| 1370 | Ga0496104_1032935 | 3300048907 | Bacteria | 726 |
| 1371 | Ga0496104_1267007 | 3300048907 | Bacteria | 640 |
| 1372 | Ga0496105_0001696 | 3300048908 | Bacteria | 15709 |
| 1373 | Ga0496105_0010820 | 3300048908 | Bacteria | 7185 |
| 1374 | Ga0496105_0030988 | 3300048908 | Bacteria | 4384 |
| 1375 | Ga0496105_0048434 | 3300048908 | Bacteria | 3508 |
| 1376 | Ga0496106_0001537 | 3300048909 | Bacteria | 17362 |
| 1377 | Ga0496106_0019337 | 3300048909 | Bacteria | 5050 |
| 1378 | Ga0496106_0020948 | 3300048909 | Bacteria | 4851 |
| 1379 | Ga0496106_0065848 | 3300048909 | Bacteria | 2758 |
| 1380 | Ga0496106_0123701 | 3300048909 | Unclassified | 2024 |
| 1381 | Ga0496106_0131775 | 3300048909 | Bacteria | 1961 |
| 1382 | Ga0496106_0546781 | 3300048909 | Bacteria | 929 |
| 1383 | Ga0496106_1221713 | 3300048909 | Unclassified | 586 |
| 1384 | Ga0496106_1361551 | 3300048909 | Bacteria | 549 |
| 1385 | Ga0496106_1531462 | 3300048909 | Bacteria | 512 |
| 1386 | Ga0496107_0003573 | 3300048910 | Bacteria | 10418 |
| 1387 | Ga0496107_0003674 | 3300048910 | Bacteria | 10313 |
| 1388 | Ga0496107_0013371 | 3300048910 | Bacteria | 5735 |
| 1389 | Ga0496107_0052027 | 3300048910 | Bacteria | 2955 |
| 1390 | Ga0496107_0122346 | 3300048910 | Bacteria | 1917 |
| 1391 | Ga0496107_0229417 | 3300048910 | Bacteria | 1381 |
| 1392 | Ga0496107_0908368 | 3300048910 | Bacteria | 642 |
| 1393 | Ga0496107_0920011 | 3300048910 | Bacteria | 637 |
| 1394 | Ga0496107_0959269 | 3300048910 | Bacteria | 622 |
| 1395 | Ga0496108_0006227 | 3300048911 | Bacteria | 9662 |
| 1396 | Ga0496108_0018620 | 3300048911 | Bacteria | 5689 |
| 1397 | Ga0496108_0055610 | 3300048911 | Bacteria | 3323 |
| 1398 | Ga0496108_0080618 | 3300048911 | Bacteria | 2757 |
| 1399 | Ga0496108_0081016 | 3300048911 | Bacteria | 2751 |
| 1400 | Ga0496108_0113016 | 3300048911 | Bacteria | 2324 |
| 1401 | Ga0496108_0331971 | 3300048911 | Bacteria | 1326 |
| 1402 | Ga0496108_0778285 | 3300048911 | Unclassified | 826 |
| 1403 | Ga0496108_1262390 | 3300048911 | Bacteria | 623 |
| 1404 | Ga0496109_0002950 | 3300048912 | Bacteria | 14231 |
| 1405 | Ga0496109_0004692 | 3300048912 | Bacteria | 11405 |
| 1406 | Ga0496109_0011347 | 3300048912 | Bacteria | 7656 |
| 1407 | Ga0496109_0032736 | 3300048912 | Bacteria | 4675 |
| 1408 | Ga0496109_0086639 | 3300048912 | Bacteria | 2892 |
| 1409 | Ga0496109_0098361 | 3300048912 | Bacteria | 2712 |
| 1410 | Ga0496109_0160980 | 3300048912 | Bacteria | 2103 |
| 1411 | Ga0496109_0301307 | 3300048912 | Bacteria | 1511 |
| 1412 | Ga0496109_0429484 | 3300048912 | Bacteria | 1248 |
| 1413 | Ga0496110_0002127 | 3300048913 | Bacteria | 14790 |
| 1414 | Ga0496110_0037596 | 3300048913 | Bacteria | 4208 |
| 1415 | Ga0496110_0041284 | 3300048913 | Bacteria | 4025 |
| 1416 | Ga0496110_0053559 | 3300048913 | Bacteria | 3548 |
| 1417 | Ga0496110_0472601 | 3300048913 | Bacteria | 1142 |
| 1418 | Ga0496110_0613109 | 3300048913 | Bacteria | 987 |
| 1419 | Ga0496110_1098716 | 3300048913 | Bacteria | 703 |
| 1420 | Ga0496110_1519316 | 3300048913 | Bacteria | 579 |
| 1421 | Ga0496110_1555457 | 3300048913 | Bacteria | 571 |
| 1422 | Ga0496111_0007535 | 3300048914 | Bacteria | 7139 |
| 1423 | Ga0496111_0036550 | 3300048914 | Bacteria | 3512 |
| 1424 | Ga0496111_0036562 | 3300048914 | Bacteria | 3512 |
| 1425 | Ga0496111_0092384 | 3300048914 | Bacteria | 2218 |
| 1426 | Ga0496111_0354599 | 3300048914 | Unclassified | 1086 |
| 1427 | Ga0496111_0428138 | 3300048914 | Unclassified | 977 |
| 1428 | Ga0496111_0460682 | 3300048914 | Bacteria | 938 |
| 1429 | Ga0496111_0512502 | 3300048914 | Bacteria | 882 |
| 1430 | Ga0496112_0025388 | 3300048915 | Bacteria | 5689 |
| 1431 | Ga0496112_0026036 | 3300048915 | Bacteria | 5623 |
| 1432 | Ga0496112_0038757 | 3300048915 | Bacteria | 4655 |
| 1433 | Ga0496112_0041236 | 3300048915 | Bacteria | 4516 |
| 1434 | Ga0496112_0059478 | 3300048915 | Bacteria | 3765 |
| 1435 | Ga0496112_0089385 | 3300048915 | Bacteria | 3048 |
| 1436 | Ga0496112_0137906 | 3300048915 | Bacteria | 2409 |
| 1437 | Ga0496112_0497010 | 3300048915 | Bacteria | 1155 |
| 1438 | Ga0496112_0805827 | 3300048915 | Bacteria | 864 |
| 1439 | Ga0496112_0825980 | 3300048915 | Bacteria | 851 |
| 1440 | Ga0496112_1490299 | 3300048915 | Bacteria | 590 |
| 1441 | Ga0496113_0001497 | 3300048916 | Bacteria | 13072 |
| 1442 | Ga0496113_0006676 | 3300048916 | Bacteria | 7341 |
| 1443 | Ga0496113_0077158 | 3300048916 | Bacteria | 2547 |
| 1444 | Ga0496113_0094321 | 3300048916 | Bacteria | 2312 |
| 1445 | Ga0496113_0103619 | 3300048916 | Bacteria | 2207 |
| 1446 | Ga0496113_0292209 | 3300048916 | Bacteria | 1304 |
| 1447 | Ga0496113_0521227 | 3300048916 | Bacteria | 954 |
| 1448 | Ga0496113_0870526 | 3300048916 | Bacteria | 714 |
| 1449 | Ga0496114_0013258 | 3300048917 | Bacteria | 6607 |
| 1450 | Ga0496114_0022160 | 3300048917 | Bacteria | 5174 |
| 1451 | Ga0496114_0071029 | 3300048917 | Bacteria | 2925 |
| 1452 | Ga0496114_0216049 | 3300048917 | Bacteria | 1682 |
| 1453 | Ga0496114_0340987 | 3300048917 | Bacteria | 1325 |
| 1454 | Ga0496115_0001529 | 3300048918 | Bacteria | 16618 |
| 1455 | Ga0496115_0007349 | 3300048918 | Bacteria | 8105 |
| 1456 | Ga0496115_0058429 | 3300048918 | Bacteria | 3103 |
| 1457 | Ga0496115_0075125 | 3300048918 | Bacteria | 2745 |
| 1458 | Ga0496115_0077920 | 3300048918 | Bacteria | 2696 |
| 1459 | Ga0496115_0783067 | 3300048918 | Bacteria | 743 |
| 1460 | Ga0501037_0419028 | 3300049573 | Unclassified | 917 |
| 1461 | Ga0501041_0365965 | 3300049577 | Bacteria | 912 |
| 1462 | Ga0501043_0977394 | 3300049579 | Bacteria | 604 |
| 1463 | Ga0501046_0257850 | 3300049580 | Bacteria | 1282 |
| 1464 | Ga0501047_0080204 | 3300049581 | Bacteria | 3137 |
| 1465 | Ga0501047_0087698 | 3300049581 | Bacteria | 2989 |
| 1466 | Ga0501047_1190645 | 3300049581 | Bacteria | 575 |
| 1467 | Ga0501069_0056205 | 3300049585 | Bacteria | 2192 |
| 1468 | Ga0501069_0478991 | 3300049585 | Unclassified | 741 |
| 1469 | Ga0501069_0660168 | 3300049585 | Unclassified | 630 |
| 1470 | Ga0501070_0057784 | 3300049586 | Bacteria | 3216 |
| 1471 | Ga0501070_0130602 | 3300049586 | Unclassified | 2075 |
| 1472 | Ga0501070_0355886 | 3300049586 | Bacteria | 1188 |
| 1473 | Ga0501070_0986885 | 3300049586 | Unclassified | 654 |
| 1474 | Ga0501073_0738806 | 3300049589 | Archaea | 679 |
| 1475 | Ga0501074_0027630 | 3300049590 | Bacteria | 4114 |
| 1476 | Ga0501074_0087495 | 3300049590 | Bacteria | 2231 |
| 1477 | Ga0501074_0217452 | 3300049590 | Bacteria | 1361 |
| 1478 | Ga0501074_0991744 | 3300049590 | Bacteria | 591 |
| 1479 | Ga0501075_1384021 | 3300049591 | Unclassified | 533 |
| 1480 | Ga0501079_0833461 | 3300049741 | Unclassified | 726 |
| 1481 | Ga0501080_0173707 | 3300049742 | Bacteria | 1986 |
| 1482 | Ga0501080_0204460 | 3300049742 | Bacteria | 1812 |
| 1483 | Ga0501080_0435972 | 3300049742 | Bacteria | 1176 |
| 1484 | Ga0501080_0602270 | 3300049742 | Bacteria | 975 |
| 1485 | Ga0501080_1026315 | 3300049742 | Bacteria | 714 |
| 1486 | Ga0501044_0153939 | 3300049823 | Bacteria | 2280 |
| 1487 | Ga0501044_0356336 | 3300049823 | Unclassified | 1382 |
| 1488 | nmdc:mga03683_4155_c1 | 3300050489 | Bacteria | 4764 |
| 1489 | nmdc:mga00v17_2661_c1 | 3300050491 | Bacteria | 9158 |
| 1490 | nmdc:mga00v17_539352_c1 | 3300050491 | Bacteria | 755 |
| 1491 | nmdc:mga0yw44_2792_c1 | 3300050492 | Bacteria | 7562 |
| 1492 | nmdc:mga0yw44_66374_c1 | 3300050492 | Bacteria | 2226 |
| 1493 | nmdc:mga05p37_16425_c1 | 3300050507 | Bacteria | 8920 |
| 1494 | nmdc:mga05p37_308233_c1 | 3300050507 | Bacteria | 1878 |
| 1495 | nmdc:mga05p37_377420_c1 | 3300050507 | Bacteria | 1662 |
| 1496 | nmdc:mga05p37_75954_c1 | 3300050507 | Bacteria | 4136 |
| 1497 | nmdc:mga09592_10288_c1 | 3300050508 | Bacteria | 7614 |
| 1498 | nmdc:mga09592_131509_c1 | 3300050508 | Bacteria | 2153 |
| 1499 | nmdc:mga0qj67_105438_c1 | 3300050509 | Bacteria | 2274 |
| 1500 | nmdc:mga0qj67_11246_c1 | 3300050509 | Bacteria | 6705 |
| 1501 | nmdc:mga06r32_32372_c1 | 3300050510 | Bacteria | 4919 |
| 1502 | nmdc:mga08y16_2037963_c1 | 3300050511 | Bacteria | 522 |
| 1503 | nmdc:mga08y16_221705_c1 | 3300050511 | Bacteria | 1957 |
| 1504 | nmdc:mga08y16_6427_c1 | 3300050511 | Bacteria | 12320 |
| 1505 | nmdc:mga0n895_12158_c1 | 3300050512 | Bacteria | 7706 |
| 1506 | nmdc:mga0n895_17465_c1 | 3300050512 | Bacteria | 6611 |
| 1507 | nmdc:mga0n895_1973348_c1 | 3300050512 | Bacteria | 542 |
| 1508 | nmdc:mga0n895_742320_c1 | 3300050512 | Bacteria | 975 |
| 1509 | nmdc:mga0rr50_1486_c1 | 3300050513 | Bacteria | 12869 |
| 1510 | nmdc:mga0rr50_177413_c1 | 3300050513 | Unclassified | 1740 |
| 1511 | nmdc:mga0rr50_789695_c1 | 3300050513 | Bacteria | 810 |
| 1512 | nmdc:mga08x19_23986_c1 | 3300050514 | Bacteria | 3787 |
| 1513 | nmdc:mga0a205_216343_c1 | 3300050515 | Bacteria | 1803 |
| 1514 | nmdc:mga0a205_572458_c1 | 3300050515 | Bacteria | 984 |
| 1515 | nmdc:mga0a205_99370_c2 | 3300050515 | Bacteria | 1778 |
| 1516 | Ga0495601_0005905 | 3300053077 | Bacteria | 7137 |
| 1517 | Ga0495601_0024199 | 3300053077 | Bacteria | 3739 |
| 1518 | Ga0495601_0025101 | 3300053077 | Bacteria | 3674 |
| 1519 | Ga0495601_0032047 | 3300053077 | Bacteria | 3269 |
| 1520 | Ga0495601_0033861 | 3300053077 | Bacteria | 3184 |
| 1521 | Ga0495601_0072282 | 3300053077 | Bacteria | 2203 |
| 1522 | Ga0495601_0126065 | 3300053077 | Bacteria | 1666 |
| 1523 | Ga0495601_0147281 | 3300053077 | Bacteria | 1537 |
| 1524 | Ga0495601_0228999 | 3300053077 | Bacteria | 1214 |
| 1525 | Ga0495601_0263034 | 3300053077 | Archaea | 1126 |
| 1526 | Ga0495601_0526895 | 3300053077 | Bacteria | 761 |
| 1527 | Ga0495612_0001993 | 3300053078 | Bacteria | 8410 |
| 1528 | Ga0495612_0004267 | 3300053078 | Bacteria | 5938 |
| 1529 | Ga0495612_0034396 | 3300053078 | Bacteria | 2052 |
| 1530 | Ga0495612_0092270 | 3300053078 | Bacteria | 1283 |
| 1531 | Ga0495612_0159110 | 3300053078 | Bacteria | 985 |
| 1532 | Ga0495612_0182099 | 3300053078 | Unclassified | 923 |
| 1533 | Ga0495612_0371877 | 3300053078 | Bacteria | 647 |
| 1534 | Ga0495655_0002920 | 3300053083 | Bacteria | 2763 |
| 1535 | Ga0495655_0044265 | 3300053083 | Bacteria | 1151 |
| 1536 | Ga0495595_0034469 | 3300053084 | Bacteria | 2289 |
| 1537 | Ga0495595_0072720 | 3300053084 | Bacteria | 1627 |
| 1538 | Ga0495595_0239949 | 3300053084 | Bacteria | 906 |
| 1539 | Ga0495595_0363342 | 3300053084 | Bacteria | 731 |
| 1540 | Ga0495619_0002851 | 3300053085 | Bacteria | 11265 |
| 1541 | Ga0495619_0011960 | 3300053085 | Bacteria | 5467 |
| 1542 | Ga0495619_0015294 | 3300053085 | Bacteria | 4853 |
| 1543 | Ga0495619_0149861 | 3300053085 | Bacteria | 1609 |
| 1544 | Ga0495619_0155557 | 3300053085 | Bacteria | 1577 |
| 1545 | Ga0495619_0213204 | 3300053085 | Bacteria | 1337 |
| 1546 | Ga0495619_0237608 | 3300053085 | Bacteria | 1263 |
| 1547 | Ga0495619_0281800 | 3300053085 | Bacteria | 1152 |
| 1548 | Ga0495619_0348624 | 3300053085 | Bacteria | 1024 |
| 1549 | Ga0495619_0736827 | 3300053085 | Bacteria | 669 |
| 1550 | Ga0495619_0923709 | 3300053085 | Bacteria | 586 |
| 1551 | Ga0500566_0035762 | 3300053094 | Bacteria | 2885 |
| 1552 | Ga0500657_152291 | 3300053728 | Bacteria | 856 |
| 1553 | Ga0587093_086003 | 3300059478 | Bacteria | 549 |
| 1554 | Ga0587066_031106 | 3300059490 | Bacteria | 952 |
| 1555 | Ga0587073_0227976 | 3300059492 | Bacteria | 573 |
| 1556 | Ga0587082_176197 | 3300059504 | Bacteria | 521 |
| 1557 | Ga0587086_101637 | 3300059507 | Bacteria | 530 |
| 1558 | Ga0587094_077601 | 3300059513 | Bacteria | 609 |
| 1559 | Ga0587076_176811 | 3300059645 | Bacteria | 535 |
| 1560 | Ga0587078_046469 | 3300059646 | Bacteria | 627 |
| 1561 | Ga0587111_0259867 | 3300060346 | Bacteria | 517 |
| 1562 | Ga0501082_1259361 | 3300060353 | Bacteria | 646 |
| 1563 | Ga0466962_0000557 | 3300061719 | Bacteria | 16369 |
| 1564 | Ga0466962_0010989 | 3300061719 | Bacteria | 4357 |
| 1565 | Ga0466962_0089495 | 3300061719 | Bacteria | 1474 |
| 1566 | Ga0466962_0143270 | 3300061719 | Bacteria | 1158 |
| 1567 | Ga0530510_0665322 | 3300061734 | Bacteria | 793 |
| 1568 | Ga0070665_101648752 | |||
| 1569 | JGI24745J21846_1044921 | |||
| 1570 | JGI24751J29686_10093367 | |||
| 1571 | JGI25406J46586_10074125 | |||
| 1572 | JGI25407J50210_10001838 | |||
| 1573 | JGI25407J50210_10050282 | |||
| 1574 | Ga0058860_11557948 | |||
| 1575 | Ga0058862_12802645 | |||
| 1576 | Ga0070658_10028387 | |||
| 1577 | Ga0070658_10055724 | |||
| 1578 | Ga0070658_10241315 | |||
| 1579 | Ga0070658_10874173 | |||
| 1580 | Ga0070658_10928036 | |||
| 1581 | Ga0070658_11669185 | |||
| 1582 | Ga0070676_10329984 | |||
| 1583 | Ga0070683_100001516 | |||
| 1584 | Ga0070683_100029653 | |||
| 1585 | Ga0070683_100035623 | |||
| 1586 | Ga0070683_100111966 | |||
| 1587 | Ga0070683_100171298 | |||
| 1588 | Ga0070683_100376993 | |||
| 1589 | Ga0070683_100380765 | |||
| 1590 | Ga0070683_100634376 | |||
| 1591 | Ga0070683_101285424 | |||
| 1592 | Ga0070690_100122327 | |||
| 1593 | Ga0068869_100207731 | |||
| 1594 | Ga0070666_10345719 | |||
| 1595 | Ga0070680_100039688 | |||
| 1596 | Ga0070680_100045740 | |||
| 1597 | Ga0070680_100076876 | |||
| 1598 | Ga0070680_100308652 | |||
| 1599 | Ga0070680_100354486 | |||
| 1600 | Ga0070680_100444143 | |||
| 1601 | Ga0070680_100814745 | |||
| 1602 | Ga0070682_100030117 | |||
| 1603 | Ga0070682_100039818 | |||
| 1604 | Ga0070682_100161528 | |||
| 1605 | Ga0070682_100412646 | |||
| 1606 | Ga0070682_100691774 | |||
| 1607 | Ga0068868_100029603 | |||
| 1608 | Ga0068868_100196838 | |||
| 1609 | Ga0068868_100647292 | |||
| 1610 | Ga0068868_100817442 | |||
| 1611 | Ga0070660_100004468 | |||
| 1612 | Ga0070660_100012056 | |||
| 1613 | Ga0070660_100015792 | |||
| 1614 | Ga0070660_100152860 | |||
| 1615 | Ga0070660_100240780 | |||
| 1616 | Ga0070660_100257799 | |||
| 1617 | Ga0070660_100282045 | |||
| 1618 | Ga0070660_101007098 | |||
| 1619 | Ga0070660_101724037 | |||
| 1620 | Ga0070660_101892336 | |||
| 1621 | Ga0070691_10372336 | |||
| 1622 | Ga0070687_100218855 | |||
| 1623 | Ga0070661_100028090 | |||
| 1624 | Ga0070661_100070321 | |||
| 1625 | Ga0070661_100083059 | |||
| 1626 | Ga0070661_100349907 | |||
| 1627 | Ga0070661_100371690 | |||
| 1628 | Ga0070692_10044626 | |||
| 1629 | Ga0070692_10415147 | |||
| 1630 | Ga0070692_10514878 | |||
| 1631 | Ga0070668_101012507 | |||
| 1632 | Ga0070668_101268023 | |||
| 1633 | Ga0070669_100489098 | |||
| 1634 | Ga0070669_101436324 | |||
| 1635 | Ga0070675_100552983 | |||
| 1636 | Ga0070671_100124421 | |||
| 1637 | Ga0070671_100298766 | |||
| 1638 | Ga0070671_101544417 | |||
| 1639 | Ga0070674_100514219 | |||
| 1640 | Ga0070674_100631193 | |||
| 1641 | Ga0070674_100838163 | |||
| 1642 | Ga0070674_101022002 | |||
| 1643 | Ga0070673_100152090 | |||
| 1644 | Ga0070673_100457354 | |||
| 1645 | Ga0070659_100011172 | |||
| 1646 | Ga0070659_100059278 | |||
| 1647 | Ga0070659_100101278 | |||
| 1648 | Ga0070659_100472951 | |||
| 1649 | Ga0070659_100537230 | |||
| 1650 | Ga0070659_100773535 | |||
| 1651 | Ga0070659_101336304 | |||
| 1652 | Ga0070667_100053537 | |||
| 1653 | Ga0070667_100753195 | |||
| 1654 | Ga0070667_101743527 | |||
| 1655 | Ga0070703_10152108 | |||
| 1656 | Ga0070709_10154889 | |||
| 1657 | Ga0070709_10446823 | |||
| 1658 | Ga0070709_10915842 | |||
| 1659 | Ga0070714_100065808 | |||
| 1660 | Ga0070714_100156636 | |||
| 1661 | Ga0070714_100211025 | |||
| 1662 | Ga0070714_100296920 | |||
| 1663 | Ga0070714_100440365 | |||
| 1664 | Ga0070714_100586619 | |||
| 1665 | Ga0070714_100701066 | |||
| 1666 | Ga0070714_100846378 | |||
| 1667 | Ga0070714_102441497 | |||
| 1668 | Ga0070713_100146523 | |||
| 1669 | Ga0070713_100466365 | |||
| 1670 | Ga0070713_100610162 | |||
| 1671 | Ga0070713_100618289 | |||
| 1672 | Ga0070713_100629333 | |||
| 1673 | Ga0070713_101019495 | |||
| 1674 | Ga0070713_101202094 | |||
| 1675 | Ga0070710_10220109 | |||
| 1676 | Ga0070710_10309292 | |||
| 1677 | Ga0070710_10334452 | |||
| 1678 | Ga0070710_10862529 | |||
| 1679 | Ga0070711_100117659 | |||
| 1680 | Ga0070711_100914177 | |||
| 1681 | Ga0070705_100292153 | |||
| 1682 | Ga0070705_100703648 | |||
| 1683 | Ga0070700_100053755 | |||
| 1684 | Ga0070694_100692249 | |||
| 1685 | Ga0070708_100350711 | |||
| 1686 | Ga0070708_100465996 | |||
| 1687 | Ga0070663_100348312 | |||
| 1688 | Ga0070663_100631146 | |||
| 1689 | Ga0070678_100357970 | |||
| 1690 | Ga0070678_100531188 | |||
| 1691 | Ga0070678_100658671 | |||
| 1692 | Ga0070662_100175470 | |||
| 1693 | Ga0070662_100393289 | |||
| 1694 | Ga0070681_10001211 | |||
| 1695 | Ga0070681_10005563 | |||
| 1696 | Ga0070681_10015890 | |||
| 1697 | Ga0070681_10055397 | |||
| 1698 | Ga0070681_10095959 | |||
| 1699 | Ga0070681_10098288 | |||
| 1700 | Ga0070681_10103113 | |||
| 1701 | Ga0070681_10236761 | |||
| 1702 | Ga0070681_10262891 | |||
| 1703 | Ga0070681_10702216 | |||
| 1704 | Ga0068867_100244821 | |||
| 1705 | Ga0068867_100412508 | |||
| 1706 | Ga0068867_101334033 | |||
| 1707 | Ga0070685_10462594 | |||
| 1708 | Ga0070706_100454381 | |||
| 1709 | Ga0070706_100981740 | |||
| 1710 | Ga0070707_100013228 | |||
| 1711 | Ga0070707_100234246 | |||
| 1712 | Ga0070707_100256792 | |||
| 1713 | Ga0070707_101299773 | |||
| 1714 | Ga0070698_100393156 | |||
| 1715 | Ga0070698_100824819 | |||
| 1716 | Ga0070698_100946414 | |||
| 1717 | Ga0070699_100960595 | |||
| 1718 | Ga0070699_101054283 | |||
| 1719 | Ga0070679_100023485 | |||
| 1720 | Ga0070679_100028786 | |||
| 1721 | Ga0070679_100044117 | |||
| 1722 | Ga0070679_100074158 | |||
| 1723 | Ga0070679_100078979 | |||
| 1724 | Ga0070679_100097560 | |||
| 1725 | Ga0070679_100144665 | |||
| 1726 | Ga0070679_100439485 | |||
| 1727 | Ga0070679_100449217 | |||
| 1728 | Ga0070679_100704477 | |||
| 1729 | Ga0070679_101380529 | |||
| 1730 | Ga0070684_100073692 | |||
| 1731 | Ga0070684_100076788 | |||
| 1732 | Ga0070684_100088473 | |||
| 1733 | Ga0070684_100100256 | |||
| 1734 | Ga0070684_100145817 | |||
| 1735 | Ga0070684_100185966 | |||
| 1736 | Ga0070684_100233221 | |||
| 1737 | Ga0070684_100257576 | |||
| 1738 | Ga0070684_100295381 | |||
| 1739 | Ga0070684_100651207 | |||
| 1740 | Ga0070684_100735393 | |||
| 1741 | Ga0070684_101696973 | |||
| 1742 | Ga0070697_100668972 | |||
| 1743 | Ga0070697_101343215 | |||
| 1744 | Ga0068853_100092361 | |||
| 1745 | Ga0068853_100153614 | |||
| 1746 | Ga0068853_100345781 | |||
| 1747 | Ga0068853_100633656 | |||
| 1748 | Ga0068853_100775610 | |||
| 1749 | Ga0068853_101955753 | |||
| 1750 | Ga0070686_100025331 | |||
| 1751 | Ga0070686_101059878 | |||
| 1752 | Ga0070695_101822495 | |||
| 1753 | Ga0070696_100023949 | |||
| 1754 | Ga0070696_100411062 | |||
| 1755 | Ga0070693_100038554 | |||
| 1756 | Ga0070693_101205163 | |||
| 1757 | Ga0070665_100138441 | |||
| 1758 | Ga0070665_101059052 | |||
| 1759 | Ga0070704_100299843 | |||
| 1760 | Ga0070704_100574204 | |||
| 1761 | Ga0068855_100004804 | |||
| 1762 | Ga0068855_100008572 | |||
| 1763 | Ga0068855_100058196 | |||
| 1764 | Ga0068855_100065367 | |||
| 1765 | Ga0068855_100206562 | |||
| 1766 | Ga0068855_100735769 | |||
| 1767 | Ga0068855_101002323 | |||
| 1768 | Ga0068855_101254480 | |||
| 1769 | Ga0068855_102177613 | |||
| 1770 | Ga0070664_100619862 | |||
| 1771 | Ga0070664_100906309 | |||
| 1772 | Ga0068857_100150005 | |||
| 1773 | Ga0068857_100153277 | |||
| 1774 | Ga0068857_100213181 | |||
| 1775 | Ga0068857_101962732 | |||
| 1776 | Ga0068857_102282732 | |||
| 1777 | Ga0068854_100025573 | |||
| 1778 | Ga0068854_100286661 | |||
| 1779 | Ga0068854_100419470 | |||
| 1780 | Ga0068854_100483671 | |||
| 1781 | Ga0068856_100009219 | |||
| 1782 | Ga0068856_100085826 | |||
| 1783 | Ga0068856_100150263 | |||
| 1784 | Ga0068856_100212757 | |||
| 1785 | Ga0068856_100362727 | |||
| 1786 | Ga0068856_100369909 | |||
| 1787 | Ga0068856_100846343 | |||
| 1788 | Ga0068856_100944227 | |||
| 1789 | Ga0068856_101832812 | |||
| 1790 | Ga0070702_100022737 | |||
| 1791 | Ga0070702_100182944 | |||
| 1792 | Ga0070702_100684676 | |||
| 1793 | Ga0068852_100042747 | |||
| 1794 | Ga0068852_100149182 | |||
| 1795 | Ga0068852_100248987 | |||
| 1796 | Ga0068852_100308947 | |||
| 1797 | Ga0068852_100401410 | |||
| 1798 | Ga0068852_100807201 | |||
| 1799 | Ga0068852_101121458 | |||
| 1800 | Ga0068852_101276914 | |||
| 1801 | Ga0068859_100109888 | |||
| 1802 | Ga0068859_101913362 | |||
| 1803 | Ga0068864_100053294 | |||
| 1804 | Ga0068851_10847368 | |||
| 1805 | Ga0068870_10111205 | |||
| 1806 | Ga0068863_100100332 | |||
| 1807 | Ga0068863_100364443 | |||
| 1808 | Ga0068858_100063116 | |||
| 1809 | Ga0068858_100579812 | |||
| 1810 | Ga0068858_100725042 | |||
| 1811 | Ga0068858_101789113 | |||
| 1812 | Ga0068860_100260411 | |||
| 1813 | Ga0068862_100333315 | |||
| 1814 | Ga0081455_10007900 | |||
| 1815 | Ga0081455_10021298 | |||
| 1816 | Ga0081455_10025744 | |||
| 1817 | Ga0081455_10045022 | |||
| 1818 | Ga0081455_10083659 | |||
| 1819 | Ga0081538_10000231 | |||
| 1820 | Ga0081538_10000286 | |||
| 1821 | Ga0081538_10000667 | |||
| 1822 | Ga0081538_10003199 | |||
| 1823 | Ga0081538_10019178 | |||
| 1824 | Ga0081538_10146137 | |||
| 1825 | Ga0081538_10186440 | |||
| 1826 | Ga0081539_10002640 | |||
| 1827 | Ga0081539_10007140 | |||
| 1828 | Ga0070717_10138093 | |||
| 1829 | Ga0070717_10162415 | |||
| 1830 | Ga0070717_10187047 | |||
| 1831 | Ga0070717_10197165 | |||
| 1832 | Ga0070717_10246830 | |||
| 1833 | Ga0070717_10423215 | |||
| 1834 | Ga0070717_10886661 | |||
| 1835 | Ga0070717_11067375 | |||
| 1836 | Ga0070717_12044071 | |||
| 1837 | Ga0075365_10003335 | |||
| 1838 | Ga0075365_10172134 | |||
| 1839 | Ga0075364_10005953 | |||
| 1840 | Ga0075364_10193774 | |||
| 1841 | Ga0075432_10005425 | |||
| 1842 | Ga0070715_10398117 | |||
| 1843 | Ga0070716_100095303 | |||
| 1844 | Ga0070716_100197571 | |||
| 1845 | Ga0070716_100821040 | |||
| 1846 | Ga0070716_101239129 | |||
| 1847 | Ga0070716_101252303 | |||
| 1848 | Ga0070712_100064422 | |||
| 1849 | Ga0070712_100341536 | |||
| 1850 | Ga0070712_100487553 | |||
| 1851 | Ga0070712_101212035 | |||
| 1852 | Ga0070712_101843277 | |||
| 1853 | Ga0075362_10037347 | |||
| 1854 | Ga0097621_100248969 | |||
| 1855 | Ga0097621_100590075 | |||
| 1856 | Ga0068871_100082631 | |||
| 1857 | Ga0068871_100394802 | |||
| 1858 | Ga0075428_100018520 | |||
| 1859 | Ga0075428_101221317 | |||
| 1860 | Ga0075428_101264870 | |||
| 1861 | Ga0075430_100008779 | |||
| 1862 | Ga0075430_100204470 | |||
| 1863 | Ga0075431_100052006 | |||
| 1864 | Ga0075433_10070060 | |||
| 1865 | Ga0075433_10236764 | |||
| 1866 | Ga0075433_10495187 | |||
| 1867 | Ga0075434_100004007 | |||
| 1868 | Ga0075434_100004302 | |||
| 1869 | Ga0075434_100519808 | |||
| 1870 | Ga0075434_100878070 | |||
| 1871 | Ga0075434_100972858 | |||
| 1872 | Ga0075429_100007741 | |||
| 1873 | Ga0075429_100104603 | |||
| 1874 | Ga0075429_100571160 | |||
| 1875 | Ga0068865_100291903 | |||
| 1876 | Ga0068865_100372099 | |||
| 1877 | Ga0068865_101000769 | |||
| 1878 | Ga0075436_100002762 | |||
| 1879 | Ga0075436_100487400 | |||
| 1880 | Ga0097620_100109888 | |||
| 1881 | Ga0097620_101913508 | |||
| 1882 | Ga0075435_100003383 | |||
| 1883 | Ga0075435_100022089 | |||
| 1884 | Ga0075435_100148659 | |||
| 1885 | Ga0075435_100955641 | |||
| 1886 | Ga0105240_10014640 | |||
| 1887 | Ga0105240_10086768 | |||
| 1888 | Ga0105240_10169048 | |||
| 1889 | Ga0105240_10590980 | |||
| 1890 | Ga0105240_11331915 | |||
| 1891 | Ga0111539_10019934 | |||
| 1892 | Ga0111539_10585994 | |||
| 1893 | Ga0105245_10021132 | |||
| 1894 | Ga0105245_10047644 | |||
| 1895 | Ga0105245_10079582 | |||
| 1896 | Ga0105245_10264161 | |||
| 1897 | Ga0105245_10407871 | |||
| 1898 | Ga0105245_10531070 | |||
| 1899 | Ga0105245_10579126 | |||
| 1900 | Ga0105245_10599399 | |||
| 1901 | Ga0105247_10067308 | |||
| 1902 | Ga0105247_10783842 | |||
| 1903 | Ga0114129_10037464 | |||
| 1904 | Ga0114129_10117145 | |||
| 1905 | Ga0114129_10311272 | |||
| 1906 | Ga0114129_10546064 | |||
| 1907 | Ga0114129_12786665 | |||
| 1908 | Ga0105243_10016260 | |||
| 1909 | Ga0105243_10293294 | |||
| 1910 | Ga0105243_10502910 | |||
| 1911 | Ga0105241_10060131 | |||
| 1912 | Ga0105241_10264074 | |||
| 1913 | Ga0105241_10267207 | |||
| 1914 | Ga0105241_10948701 | |||
| 1915 | Ga0105242_10042065 | |||
| 1916 | Ga0105242_10064698 | |||
| 1917 | Ga0105242_10237248 | |||
| 1918 | Ga0105242_10274951 | |||
| 1919 | Ga0105242_10950816 | |||
| 1920 | Ga0105242_12198722 | |||
| 1921 | Ga0105242_13325727 | |||
| 1922 | Ga0105248_10525512 | |||
| 1923 | Ga0105248_10540665 | |||
| 1924 | Ga0105237_10340697 | |||
| 1925 | Ga0105237_10500624 | |||
| 1926 | Ga0105237_10640573 | |||
| 1927 | Ga0105237_10830905 | |||
| 1928 | Ga0105237_11104865 | |||
| 1929 | Ga0105237_12124720 | |||
| 1930 | Ga0105238_10028919 | |||
| 1931 | Ga0105238_10033949 | |||
| 1932 | Ga0105238_10063726 | |||
| 1933 | Ga0105238_10193973 | |||
| 1934 | Ga0105238_10721690 | |||
| 1935 | Ga0105238_11796335 | |||
| 1936 | Ga0105238_11910224 | |||
| 1937 | Ga0105238_12636660 | |||
| 1938 | Ga0105249_10027388 | |||
| 1939 | Ga0105249_10440212 | |||
| 1940 | Ga0105249_10533235 | |||
| 1941 | Ga0105239_10277631 | |||
| 1942 | Ga0105239_10520460 | |||
| 1943 | Ga0105239_10756551 | |||
| 1944 | Ga0105239_11314594 | |||
| 1945 | Ga0105239_11503789 | |||
| 1946 | Ga0105239_13332306 | |||
| 1947 | Ga0105239_13400597 | |||
| 1948 | Ga0105246_10013171 | |||
| 1949 | Ga0105246_10422846 | |||
| 1950 | Ga0105246_10573465 | |||
| 1951 | Ga0105246_10736920 | |||
| 1952 | Ga0157347_1020588 | |||
| 1953 | Ga0157342_1024066 | |||
| 1954 | Ga0157327_1008019 | |||
| 1955 | Ga0157373_10053326 | |||
| 1956 | Ga0157373_10206232 | |||
| 1957 | Ga0157373_10328744 | |||
| 1958 | Ga0157373_10517687 | |||
| 1959 | Ga0157373_11021732 | |||
| 1960 | Ga0157371_10224898 | |||
| 1961 | Ga0157371_10277009 | |||
| 1962 | Ga0157371_10868707 | |||
| 1963 | Ga0157371_11536489 | |||
| 1964 | Ga0157370_10022109 | |||
| 1965 | Ga0157370_10032325 | |||
| 1966 | Ga0157370_10046103 | |||
| 1967 | Ga0157370_10287230 | |||
| 1968 | Ga0157370_10772719 | |||
| 1969 | Ga0157369_10002320 | |||
| 1970 | Ga0157369_10271581 | |||
| 1971 | Ga0157369_10335773 | |||
| 1972 | Ga0157369_10454011 | |||
| 1973 | Ga0157369_10532527 | |||
| 1974 | Ga0157369_10714610 | |||
| 1975 | Ga0157369_10733318 | |||
| 1976 | Ga0157374_10019586 | |||
| 1977 | Ga0157374_10102876 | |||
| 1978 | Ga0157374_10153005 | |||
| 1979 | Ga0157374_10257725 | |||
| 1980 | Ga0157374_10379637 | |||
| 1981 | Ga0157374_10579426 | |||
| 1982 | Ga0157374_10795959 | |||
| 1983 | Ga0157374_11447036 | |||
| 1984 | Ga0157374_11880393 | |||
| 1985 | Ga0157378_10763788 | |||
| 1986 | Ga0157378_10880663 | |||
| 1987 | Ga0157378_11277356 | |||
| 1988 | Ga0157378_11325178 | |||
| 1989 | Ga0157378_11862405 | |||
| 1990 | Ga0157378_12024738 | |||
| 1991 | Ga0163162_10138016 | |||
| 1992 | Ga0163162_10830844 | |||
| 1993 | Ga0163162_11052929 | |||
| 1994 | Ga0163162_13189683 | |||
| 1995 | Ga0157372_10037624 | |||
| 1996 | Ga0157372_10060489 | |||
| 1997 | Ga0157372_10120458 | |||
| 1998 | Ga0157372_10273028 | |||
| 1999 | Ga0157372_10372016 | |||
| 2000 | Ga0157372_11489667 | |||
| 2001 | Ga0157375_10118405 | |||
| 2002 | Ga0157375_10283717 | |||
| 2003 | Ga0157375_10284443 | |||
| 2004 | Ga0163163_10009378 | |||
| 2005 | Ga0163163_12410620 | |||
| 2006 | Ga0157380_13156933 | |||
| 2007 | Ga0182008_10040176 | |||
| 2008 | Ga0182008_10089928 | |||
| 2009 | Ga0182008_10213276 | |||
| 2010 | Ga0157377_10008185 | |||
| 2011 | Ga0157377_10138887 | |||
| 2012 | Ga0157379_10208168 | |||
| 2013 | Ga0157379_11655921 | |||
| 2014 | Ga0157379_11932211 | |||
| 2015 | Ga0157379_12318350 | |||
| 2016 | Ga0157376_10027031 | |||
| 2017 | Ga0157376_10308200 | |||
| 2018 | Ga0157376_10377624 | |||
| 2019 | Ga0157376_10395260 | |||
| 2020 | Ga0182007_10120785 | |||
| 2021 | Ga0182007_10258024 | |||
| 2022 | Ga0163161_10627152 | |||
| 2023 | Ga0197907_10557898 | |||
| 2024 | Ga0197907_10788161 | |||
| 2025 | Ga0197907_10852630 | |||
| 2026 | Ga0197907_11239336 | |||
| 2027 | Ga0206356_10159383 | |||
| 2028 | Ga0206356_10378944 | |||
| 2029 | Ga0206356_10708941 | |||
| 2030 | Ga0206356_10916098 | |||
| 2031 | Ga0206356_11582479 | |||
| 2032 | Ga0206356_11610073 | |||
| 2033 | Ga0206356_11635300 | |||
| 2034 | Ga0206349_1178519 | |||
| 2035 | Ga0206355_1050139 | |||
| 2036 | Ga0206355_1276088 | |||
| 2037 | Ga0206355_1376991 | |||
| 2038 | Ga0206355_1471482 | |||
| 2039 | Ga0206351_10377887 | |||
| 2040 | Ga0206351_10656248 | |||
| 2041 | Ga0206351_10859689 | |||
| 2042 | Ga0206352_10369212 | |||
| 2043 | Ga0206352_10610482 | |||
| 2044 | Ga0206350_10244322 | |||
| 2045 | Ga0206350_10755670 | |||
| 2046 | Ga0206350_11166980 | |||
| 2047 | Ga0206354_10231726 | |||
| 2048 | Ga0206354_10481326 | |||
| 2049 | Ga0206354_11187472 | |||
| 2050 | Ga0206354_11421046 | |||
| 2051 | Ga0206354_11537208 | |||
| 2052 | Ga0206353_10017982 | |||
| 2053 | Ga0206353_10446025 | |||
| 2054 | Ga0206353_10612272 | |||
| 2055 | Ga0206353_10781712 | |||
| 2056 | Ga0206353_10919416 | |||
| 2057 | Ga0206353_11166285 | |||
| 2058 | Ga0206353_11739036 | |||
| 2059 | Ga0213874_10095634 | |||
| 2060 | Ga0213874_10121219 | |||
| 2061 | Ga0213876_10023437 | |||
| 2062 | Ga0213875_10178370 | |||
| 2063 | Ga0224712_10011301 | |||
| 2064 | Ga0224712_10022451 | |||
| 2065 | Ga0224712_10089695 | |||
| 2066 | Ga0224712_10259405 | |||
| 2067 | Ga0224712_10292080 | |||
| 2068 | Ga0224712_10319429 | |||
| 2069 | Ga0224712_10638585 | |||
| 2070 | Ga0224712_10657853 | |||
| 2071 | Ga0207656_10594374 | |||
| 2072 | Ga0207653_10037151 | |||
| 2073 | Ga0207692_10168848 | |||
| 2074 | Ga0207692_10444391 | |||
| 2075 | Ga0207692_10543385 | |||
| 2076 | Ga0207692_11035061 | |||
| 2077 | Ga0207642_10344023 | |||
| 2078 | Ga0207710_10055540 | |||
| 2079 | Ga0207710_10463359 | |||
| 2080 | Ga0207688_10038649 | |||
| 2081 | Ga0207688_10155143 | |||
| 2082 | Ga0207688_10836296 | |||
| 2083 | Ga0207680_10035015 | |||
| 2084 | Ga0207647_10064947 | |||
| 2085 | Ga0207647_10307419 | |||
| 2086 | Ga0207685_10259461 | |||
| 2087 | Ga0207699_10356280 | |||
| 2088 | Ga0207699_10742399 | |||
| 2089 | Ga0207645_10258926 | |||
| 2090 | Ga0207643_10439397 | |||
| 2091 | Ga0207705_10014835 | |||
| 2092 | Ga0207705_10047609 | |||
| 2093 | Ga0207705_10087228 | |||
| 2094 | Ga0207705_10098696 | |||
| 2095 | Ga0207705_10772421 | |||
| 2096 | Ga0207705_10793554 | |||
| 2097 | Ga0207705_10863536 | |||
| 2098 | Ga0207705_11248379 | |||
| 2099 | Ga0207654_10038145 | |||
| 2100 | Ga0207654_10046709 | |||
| 2101 | Ga0207654_10168255 | |||
| 2102 | Ga0207654_11276280 | |||
| 2103 | Ga0207707_10012220 | |||
| 2104 | Ga0207707_10012425 | |||
| 2105 | Ga0207707_10062306 | |||
| 2106 | Ga0207707_10122204 | |||
| 2107 | Ga0207707_10257344 | |||
| 2108 | Ga0207707_10351324 | |||
| 2109 | Ga0207707_10353367 | |||
| 2110 | Ga0207707_10662960 | |||
| 2111 | Ga0207695_10148932 | |||
| 2112 | Ga0207695_10426091 | |||
| 2113 | Ga0207695_10579951 | |||
| 2114 | Ga0207695_10709007 | |||
| 2115 | Ga0207695_10946595 | |||
| 2116 | Ga0207695_11078072 | |||
| 2117 | Ga0207671_10136721 | |||
| 2118 | Ga0207671_10191442 | |||
| 2119 | Ga0207671_11578931 | |||
| 2120 | Ga0207693_10033503 | |||
| 2121 | Ga0207693_10042789 | |||
| 2122 | Ga0207693_10052457 | |||
| 2123 | Ga0207693_10112890 | |||
| 2124 | Ga0207693_10456362 | |||
| 2125 | Ga0207693_10682311 | |||
| 2126 | Ga0207663_10308049 | |||
| 2127 | Ga0207663_10418927 | |||
| 2128 | Ga0207663_10754221 | |||
| 2129 | Ga0207663_11213707 | |||
| 2130 | Ga0207660_10042937 | |||
| 2131 | Ga0207660_10083496 | |||
| 2132 | Ga0207660_10348710 | |||
| 2133 | Ga0207660_10373504 | |||
| 2134 | Ga0207660_10471223 | |||
| 2135 | Ga0207660_10803429 | |||
| 2136 | Ga0207660_11333072 | |||
| 2137 | Ga0207660_11485197 | |||
| 2138 | Ga0207660_11538452 | |||
| 2139 | Ga0207662_10044516 | |||
| 2140 | Ga0207662_10377752 | |||
| 2141 | Ga0207657_10000054 | |||
| 2142 | Ga0207657_10001075 | |||
| 2143 | Ga0207657_10001255 | |||
| 2144 | Ga0207657_10007381 | |||
| 2145 | Ga0207657_10008257 | |||
| 2146 | Ga0207657_10051326 | |||
| 2147 | Ga0207657_10222148 | |||
| 2148 | Ga0207657_10452555 | |||
| 2149 | Ga0207657_10458850 | |||
| 2150 | Ga0207657_10579824 | |||
| 2151 | Ga0207649_10078373 | |||
| 2152 | Ga0207649_10121488 | |||
| 2153 | Ga0207649_10218778 | |||
| 2154 | Ga0207652_10053360 | |||
| 2155 | Ga0207652_10058771 | |||
| 2156 | Ga0207652_10074054 | |||
| 2157 | Ga0207652_10074769 | |||
| 2158 | Ga0207652_10098968 | |||
| 2159 | Ga0207652_10169975 | |||
| 2160 | Ga0207652_10173903 | |||
| 2161 | Ga0207652_10212704 | |||
| 2162 | Ga0207652_10775809 | |||
| 2163 | Ga0207652_10932454 | |||
| 2164 | Ga0207652_11416136 | |||
| 2165 | Ga0207646_10001441 | |||
| 2166 | Ga0207646_10118695 | |||
| 2167 | Ga0207646_10176404 | |||
| 2168 | Ga0207646_10375212 | |||
| 2169 | Ga0207694_10033295 | |||
| 2170 | Ga0207694_10058043 | |||
| 2171 | Ga0207694_10107410 | |||
| 2172 | Ga0207694_10603668 | |||
| 2173 | Ga0207659_10444250 | |||
| 2174 | Ga0207687_10015379 | |||
| 2175 | Ga0207687_10042209 | |||
| 2176 | Ga0207687_10080429 | |||
| 2177 | Ga0207687_10109199 | |||
| 2178 | Ga0207687_10227911 | |||
| 2179 | Ga0207687_10236458 | |||
| 2180 | Ga0207687_10851679 | |||
| 2181 | Ga0207687_11329517 | |||
| 2182 | Ga0207687_11411295 | |||
| 2183 | Ga0207700_10198685 | |||
| 2184 | Ga0207700_10424560 | |||
| 2185 | Ga0207700_10455036 | |||
| 2186 | Ga0207700_10562975 | |||
| 2187 | Ga0207700_10635225 | |||
| 2188 | Ga0207700_10849679 | |||
| 2189 | Ga0207700_11158495 | |||
| 2190 | Ga0207700_11581610 | |||
| 2191 | Ga0207664_10412519 | |||
| 2192 | Ga0207664_10431611 | |||
| 2193 | Ga0207664_10662908 | |||
| 2194 | Ga0207664_10808620 | |||
| 2195 | Ga0207664_10884949 | |||
| 2196 | Ga0207664_11402492 | |||
| 2197 | Ga0207664_11434657 | |||
| 2198 | Ga0207664_11541722 | |||
| 2199 | Ga0207664_11865241 | |||
| 2200 | Ga0207644_10089503 | |||
| 2201 | Ga0207644_10139439 | |||
| 2202 | Ga0207690_10002378 | |||
| 2203 | Ga0207690_10040448 | |||
| 2204 | Ga0207690_10163381 | |||
| 2205 | Ga0207690_10324374 | |||
| 2206 | Ga0207706_10054711 | |||
| 2207 | Ga0207706_10203018 | |||
| 2208 | Ga0207686_10052028 | |||
| 2209 | Ga0207686_10154413 | |||
| 2210 | Ga0207686_10278449 | |||
| 2211 | Ga0207686_10384300 | |||
| 2212 | Ga0207686_10642320 | |||
| 2213 | Ga0207709_10041105 | |||
| 2214 | Ga0207670_11012724 | |||
| 2215 | Ga0207669_10338668 | |||
| 2216 | Ga0207704_10072413 | |||
| 2217 | Ga0207704_11443764 | |||
| 2218 | Ga0207704_11941060 | |||
| 2219 | Ga0207665_10043153 | |||
| 2220 | Ga0207665_10308420 | |||
| 2221 | Ga0207665_10522360 | |||
| 2222 | Ga0207665_11426895 | |||
| 2223 | Ga0207691_10327447 | |||
| 2224 | Ga0207691_10909320 | |||
| 2225 | Ga0207711_10258186 | |||
| 2226 | Ga0207711_10314043 | |||
| 2227 | Ga0207711_10338085 | |||
| 2228 | Ga0207661_10020944 | |||
| 2229 | Ga0207661_10070838 | |||
| 2230 | Ga0207661_10098620 | |||
| 2231 | Ga0207661_10393406 | |||
| 2232 | Ga0207661_10474490 | |||
| 2233 | Ga0207661_10689500 | |||
| 2234 | Ga0207679_10368007 | |||
| 2235 | Ga0207667_10071922 | |||
| 2236 | Ga0207667_10082068 | |||
| 2237 | Ga0207667_10115354 | |||
| 2238 | Ga0207667_10174403 | |||
| 2239 | Ga0207667_10181179 | |||
| 2240 | Ga0207667_10332376 | |||
| 2241 | Ga0207667_10656266 | |||
| 2242 | Ga0207667_10666747 | |||
| 2243 | Ga0207651_10594431 | |||
| 2244 | Ga0207651_11897747 | |||
| 2245 | Ga0207712_10472788 | |||
| 2246 | Ga0207712_10530238 | |||
| 2247 | Ga0207712_11034823 | |||
| 2248 | Ga0207668_10342835 | |||
| 2249 | Ga0207668_10343335 | |||
| 2250 | Ga0207640_10709786 | |||
| 2251 | Ga0207640_11175220 | |||
| 2252 | Ga0207658_10014581 | |||
| 2253 | Ga0207658_11314677 | |||
| 2254 | Ga0207677_10031103 | |||
| 2255 | Ga0207677_10039990 | |||
| 2256 | Ga0207677_10509867 | |||
| 2257 | Ga0207677_10687369 | |||
| 2258 | Ga0207703_10100530 | |||
| 2259 | Ga0207703_10333854 | |||
| 2260 | Ga0207703_10887266 | |||
| 2261 | Ga0207639_10062603 | |||
| 2262 | Ga0207639_10170303 | |||
| 2263 | Ga0207639_10219301 | |||
| 2264 | Ga0207639_10666463 | |||
| 2265 | Ga0207678_10053177 | |||
| 2266 | Ga0207678_10505585 | |||
| 2267 | Ga0207708_10196226 | |||
| 2268 | Ga0207708_10331811 | |||
| 2269 | Ga0207702_10002160 | |||
| 2270 | Ga0207702_10130604 | |||
| 2271 | Ga0207702_10207597 | |||
| 2272 | Ga0207702_10403860 | |||
| 2273 | Ga0207702_10538565 | |||
| 2274 | Ga0207702_10609433 | |||
| 2275 | Ga0207702_10857581 | |||
| 2276 | Ga0207641_10440004 | |||
| 2277 | Ga0207641_10507237 | |||
| 2278 | Ga0207648_10152368 | |||
| 2279 | Ga0207648_10718940 | |||
| 2280 | Ga0207676_10211131 | |||
| 2281 | Ga0207674_10053698 | |||
| 2282 | Ga0207674_10159297 | |||
| 2283 | Ga0207674_10167092 | |||
| 2284 | Ga0207674_11187893 | |||
| 2285 | Ga0207674_11707950 | |||
| 2286 | Ga0207683_10055645 | |||
| 2287 | Ga0207683_10104344 | |||
| 2288 | Ga0207698_10058341 | |||
| 2289 | Ga0207698_10307404 | |||
| 2290 | Ga0207698_10457648 | |||
| 2291 | Ga0207698_10506287 | |||
| 2292 | Ga0207698_11162584 | |||
| 2293 | Ga0207698_11485780 | |||
| 2294 | Ga0207698_12372150 | |||
| 2295 | Ga0207428_10002365 | |||
| 2296 | Ga0268266_10059309 | |||
| 2297 | Ga0268266_10081241 | |||
| 2298 | Ga0268266_10774543 | |||
| 2299 | Ga0268265_11261046 | |||
| 2300 | Ga0268264_10171684 | |||
| 2301 | Ga0265337_1090596 | |||
| 2302 | Ga0265326_10257653 | |||
| 2303 | Ga0265319_1020126 | |||
| 2304 | Ga0265319_1050512 | |||
| 2305 | Ga0265319_1117124 | |||
| 2306 | Ga0265319_1145256 | |||
| 2307 | Ga0265319_1163791 | |||
| 2308 | Ga0265334_10073313 | |||
| 2309 | Ga0265334_10232894 | |||
| 2310 | Ga0265318_10006408 | |||
| 2311 | Ga0265318_10067811 | |||
| 2312 | Ga0265318_10081795 | |||
| 2313 | Ga0265318_10199626 | |||
| 2314 | Ga0265318_10309750 | |||
| 2315 | Ga0265323_10068454 | |||
| 2316 | Ga0265336_10001147 | |||
| 2317 | Ga0265338_10005100 | |||
| 2318 | Ga0265338_10007755 | |||
| 2319 | Ga0265338_10020589 | |||
| 2320 | Ga0265338_10026919 | |||
| 2321 | Ga0265338_10081701 | |||
| 2322 | Ga0265338_10123267 | |||
| 2323 | Ga0265338_10131371 | |||
| 2324 | Ga0265338_10142381 | |||
| 2325 | Ga0265324_10008358 | |||
| 2326 | Ga0265332_10141529 | |||
| 2327 | Ga0265320_10093432 | |||
| 2328 | Ga0265320_10119407 | |||
| 2329 | Ga0265320_10342665 | |||
| 2330 | Ga0265325_10276032 | |||
| 2331 | Ga0265340_10042361 | |||
| 2332 | Ga0265340_10269992 | |||
| 2333 | Ga0265339_10162809 | |||
| 2334 | Ga0265316_10589057 | |||
| 2335 | Ga0265316_10714300 | |||
| 2336 | Ga0307408_102053960 | |||
| 2337 | Ga0265313_10004487 | |||
| 2338 | Ga0265313_10206493 | |||
| 2339 | Ga0265314_10013102 | |||
| 2340 | Ga0265314_10416319 | |||
| 2341 | Ga0265314_10567123 | |||
| 2342 | Ga0265342_10284431 | |||
| 2343 | Ga0307409_102113783 | |||
| 2344 | Ga0307416_100966122 | |||
| 2345 | Ga0307415_100499327 | |||
| 2346 | Ga0373938_0161036 | |||
| 2347 | Ga0373926_0027594 | |||
| 2348 | Ga0373926_0041034 | |||
| 2349 | Ga0373934_0066375 | |||
| 2350 | Ga0373944_0003405 | |||
| 2351 | Ga0373944_0017421 | |||
| 2352 | Ga0373944_0034813 | |||
| 2353 | Ga0373944_0072422 | |||
| 2354 | Ga0373949_0102209 | |||
| 2355 | Ga0373923_0009617 | |||
| 2356 | Ga0373923_0112107 | |||
| 2357 | Ga0373936_0012158 | |||
| 2358 | Ga0373936_0031292 | |||
| 2359 | Ga0373936_0034868 | |||
| 2360 | Ga0373945_0003331 | |||
| 2361 | Ga0373945_0008817 | |||
| 2362 | Ga0373945_0021731 | |||
| 2363 | Ga0373945_0033306 | |||
| 2364 | Ga0373953_0080481 | |||
| 2365 | Ga0373953_0213009 | |||
| 2366 | Ga0373954_0008966 | |||
| 2367 | Ga0373954_0086516 | |||
| 2368 | Ga0373954_0594280 | |||
| 2369 | Ga0373956_0073808 | |||
| 2370 | Ga0373957_0038874 | |||
| 2371 | Ga0373943_0000693 | |||
| 2372 | Ga0373943_0001040 | |||
| 2373 | Ga0373943_0001343 | |||
| 2374 | Ga0373943_0006737 | |||
| 2375 | Ga0373946_0031421 | |||
| 2376 | Ga0373946_0050342 | |||
| 2377 | Ga0373946_0120483 | |||
| 2378 | Ga0373946_0559320 | |||
| 2379 | Ga0373955_0012109 | |||
| 2380 | Ga0373955_0195877 | |||
| 2381 | Ga0373955_0209553 | |||
| 2382 | Ga0373924_0024092 | |||
| 2383 | Ga0373924_0045859 | |||
| 2384 | Ga0373924_0160201 | |||
| 2385 | Ga0373924_0196163 | |||
| 2386 | Ga0373924_0304719 | |||
| 2387 | Ga0373935_0016894 | |||
| 2388 | Ga0373935_0017594 | |||
| 2389 | Ga0373935_0027291 | |||
| 2390 | Ga0373935_0558880 | |||
| 2391 | Ga0373935_0690893 | |||
| 2392 | Ga0373927_0028499 | |||
| 2393 | Ga0373927_0133645 | |||
| 2394 | Ga0373927_0135003 | |||
| 2395 | Ga0373927_0304447 | |||
| 2396 | Ga0373933_0050952 | |||
| 2397 | Ga0373933_0113076 | |||
| 2398 | Ga0373933_0383579 | |||
| 2399 | Ga0373947_0001170 | |||
| 2400 | Ga0373947_0099387 | |||
| 2401 | Ga0373947_0104473 | |||
| 2402 | Ga0373947_0106346 | |||
| 2403 | Ga0373947_0583399 | |||
| 2404 | Ga0373937_0012607 | |||
| 2405 | Ga0373937_0168279 | |||
| 2406 | Ga0373937_0301151 | |||
| 2407 | Ga0373937_0402272 | |||
| 2408 | Ga0373925_0002413 | |||
| 2409 | Ga0373925_0002841 | |||
| 2410 | Ga0373925_0005888 | |||
| 2411 | Ga0373925_0101668 | |||
| 2412 | Ga0373925_0745852 | |||
| 2413 | Ga0395899_0046455 | |||
| 2414 | Ga0395899_0119121 | |||
| 2415 | Ga0395899_0135136 | |||
| 2416 | Ga0395899_0135739 | |||
| 2417 | Ga0395899_0218398 | |||
| 2418 | Ga0395899_0289200 | |||
| 2419 | Ga0395900_0034383 | |||
| 2420 | Ga0395900_0042427 | |||
| 2421 | Ga0395900_0048345 | |||
| 2422 | Ga0395900_0068352 | |||
| 2423 | Ga0395900_0084734 | |||
| 2424 | Ga0395900_0184594 | |||
| 2425 | Ga0395900_0224573 | |||
| 2426 | Ga0395900_0229982 | |||
| 2427 | Ga0395900_0261756 | |||
| 2428 | Ga0395900_0262135 | |||
| 2429 | Ga0395900_0342073 | |||
| 2430 | Ga0395900_0901850 | |||
| 2431 | Ga0395900_1385357 | |||
| 2432 | Ga0395900_1424650 | |||
| 2433 | Ga0395898_0002613 | |||
| 2434 | Ga0395898_0013164 | |||
| 2435 | Ga0395898_0020929 | |||
| 2436 | Ga0395898_0029711 | |||
| 2437 | Ga0395898_0030941 | |||
| 2438 | Ga0395898_0082415 | |||
| 2439 | Ga0395898_0083641 | |||
| 2440 | Ga0395898_0094034 | |||
| 2441 | Ga0395898_0214966 | |||
| 2442 | Ga0395898_0264555 | |||
| 2443 | Ga0395898_0342707 | |||
| 2444 | Ga0395898_0387390 | |||
| 2445 | Ga0395898_0448942 | |||
| 2446 | Ga0395898_0514803 | |||
| 2447 | Ga0395898_0544788 | |||
| 2448 | Ga0395898_0617722 | |||
| 2449 | Ga0395898_0894398 | |||
| 2450 | Ga0395898_1548123 | |||
| 2451 | Ga0395898_1723376 | |||
| 2452 | Ga0395905_0039611 | |||
| 2453 | Ga0395905_0060677 | |||
| 2454 | Ga0395905_0081507 | |||
| 2455 | Ga0395905_0106658 | |||
| 2456 | Ga0395905_0116059 | |||
| 2457 | Ga0395905_0252809 | |||
| 2458 | Ga0395905_0384153 | |||
| 2459 | Ga0395905_0941404 | |||
| 2460 | Ga0395901_0001850 | |||
| 2461 | Ga0395901_0005193 | |||
| 2462 | Ga0395901_0023082 | |||
| 2463 | Ga0395901_0045262 | |||
| 2464 | Ga0395901_0046896 | |||
| 2465 | Ga0395901_0048579 | |||
| 2466 | Ga0395901_0075489 | |||
| 2467 | Ga0395901_0076133 | |||
| 2468 | Ga0395901_0081065 | |||
| 2469 | Ga0395901_0109361 | |||
| 2470 | Ga0395901_0598475 | |||
| 2471 | Ga0395901_0684837 | |||
| 2472 | Ga0395901_0701527 | |||
| 2473 | Ga0395901_0852269 | |||
| 2474 | Ga0395901_1280683 | |||
| 2475 | Ga0395901_2080522 | |||
| 2476 | Ga0436365_1173242 | |||
| 2477 | Ga0436363_0218384 | |||
| 2478 | Ga0451793_0437514 | |||
| 2479 | Ga0451804_0573671 | |||
| 2480 | Ga0451835_1263189 | |||
| 2481 | Ga0451837_0215669 | |||
| 2482 | Ga0451839_0131976 | |||
| 2483 | Ga0451845_0298016 | |||
| 2484 | Ga0451853_1676111 | |||
| 2485 | Ga0451853_3292590 | |||
| 2486 | Ga0439443_085973 | |||
| 2487 | Ga0439451_075188 | |||
| 2488 | Ga0439455_0220570 | |||
| 2489 | Ga0439463_077933 | |||
| 2490 | Ga0450888_009755 | |||
| 2491 | Ga0439444_0023645 | |||
| 2492 | Ga0439464_0134370 | |||
| 2493 | Ga0439460_0020566 | |||
| 2494 | Ga0439460_0374627 | |||
| 2495 | Ga0439440_0157209 | |||
| 2496 | Ga0466969_0001239 | |||
| 2497 | Ga0466969_0086127 | |||
| 2498 | Ga0466969_0229652 | |||
| 2499 | Ga0466969_0436385 | |||
| 2500 | Ga0466972_0016657 | |||
| 2501 | Ga0466965_0015721 | |||
| 2502 | Ga0466965_0109866 | |||
| 2503 | Ga0466966_0081999 | |||
| 2504 | Ga0466966_0095148 | |||
| 2505 | Ga0466966_0177618 | |||
| 2506 | Ga0466966_0216994 | |||
| 2507 | Ga0466966_0252379 | |||
| 2508 | Ga0466966_0275536 | |||
| 2509 | Ga0466966_0329691 | |||
| 2510 | Ga0466961_0019216 | |||
| 2511 | Ga0466961_0027794 | |||
| 2512 | Ga0466961_0136405 | |||
| 2513 | Ga0466961_0181480 | |||
| 2514 | Ga0466961_0189684 | |||
| 2515 | Ga0466961_0461676 | |||
| 2516 | Ga0466961_0610459 | |||
| 2517 | Ga0466961_0624433 | |||
| 2518 | Ga0466963_0012694 | |||
| 2519 | Ga0466963_0026856 | |||
| 2520 | Ga0466963_0029064 | |||
| 2521 | Ga0466963_0032315 | |||
| 2522 | Ga0466963_0051866 | |||
| 2523 | Ga0466963_0063868 | |||
| 2524 | Ga0466963_0074337 | |||
| 2525 | Ga0466963_0083780 | |||
| 2526 | Ga0466963_0398754 | |||
| 2527 | Ga0466963_0466099 | |||
| 2528 | Ga0466963_0576306 | |||
| 2529 | Ga0466963_0806392 | |||
| 2530 | Ga0466964_0009210 | |||
| 2531 | Ga0466964_0036923 | |||
| 2532 | Ga0466964_0055404 | |||
| 2533 | Ga0466964_0084912 | |||
| 2534 | Ga0466964_0085815 | |||
| 2535 | Ga0466964_0128566 | |||
| 2536 | Ga0466964_0213666 | |||
| 2537 | Ga0466964_0572286 | |||
| 2538 | Ga0466971_0000146 | |||
| 2539 | Ga0466971_0020229 | |||
| 2540 | Ga0466971_0104248 | |||
| 2541 | Ga0466971_0114361 | |||
| 2542 | Ga0466971_0302490 | |||
| 2543 | Ga0466971_0643349 | |||
| 2544 | Ga0466968_0002981 | |||
| 2545 | Ga0466968_0003980 | |||
| 2546 | Ga0466968_0129042 | |||
| 2547 | Ga0466968_0174426 | |||
| 2548 | Ga0466968_0282069 | |||
| 2549 | Ga0466968_0485114 | |||
| 2550 | Ga0466968_0726008 | |||
| 2551 | Ga0466970_0007704 | |||
| 2552 | Ga0466970_0024506 | |||
| 2553 | Ga0466970_0126304 | |||
| 2554 | Ga0466957_0007245 | |||
| 2555 | Ga0466957_0011691 | |||
| 2556 | Ga0466957_0038873 | |||
| 2557 | Ga0466957_0144937 | |||
| 2558 | Ga0466957_1002484 | |||
| 2559 | Ga0466957_1350381 | |||
| 2560 | Ga0466960_0119058 | |||
| 2561 | Ga0466960_0168032 | |||
| 2562 | Ga0466960_0185119 | |||
| 2563 | Ga0466960_0725852 | |||
| 2564 | Ga0466960_1043453 | |||
| 2565 | Ga0466959_0043199 | |||
| 2566 | Ga0466959_0062730 | |||
| 2567 | Ga0466959_0075226 | |||
| 2568 | Ga0466959_0245574 | |||
| 2569 | Ga0466959_0472047 | |||
| 2570 | Ga0451576_0228034 | |||
| 2571 | Ga0451576_1046881 | |||
| 2572 | Ga0466958_0005202 | |||
| 2573 | Ga0466958_0008076 | |||
| 2574 | Ga0466958_0065001 | |||
| 2575 | Ga0466967_0001223 | |||
| 2576 | Ga0466967_0004614 | |||
| 2577 | Ga0466967_0008381 | |||
| 2578 | Ga0466967_0011834 | |||
| 2579 | Ga0466967_0013205 | |||
| 2580 | Ga0466967_0028771 | |||
| 2581 | Ga0466967_0032874 | |||
| 2582 | Ga0466967_0038514 | |||
| 2583 | Ga0466967_0045188 | |||
| 2584 | Ga0466967_0050959 | |||
| 2585 | Ga0466967_0053989 | |||
| 2586 | Ga0466967_0059430 | |||
| 2587 | Ga0466967_0107548 | |||
| 2588 | Ga0466967_0141347 | |||
| 2589 | Ga0466967_0141755 | |||
| 2590 | Ga0466967_0285519 | |||
| 2591 | Ga0466967_0441151 | |||
| 2592 | Ga0466967_0645628 | |||
| 2593 | Ga0466967_1238436 | |||
| 2594 | Ga0466967_1366007 | |||
| 2595 | Ga0466967_1591840 | |||
| 2596 | Ga0466967_1705295 | |||
| 2597 | Ga0466967_2314368 | |||
| 2598 | Ga0466967_2445211 | |||
| 2599 | Ga0495592_0035738 | |||
| 2600 | Ga0495592_0158712 | |||
| 2601 | Ga0495592_0173325 | |||
| 2602 | Ga0495592_0203643 | |||
| 2603 | Ga0495592_0511420 | |||
| 2604 | Ga0495592_0650144 | |||
| 2605 | Ga0495592_0713994 | |||
| 2606 | Ga0495592_0792038 | |||
| 2607 | Ga0495592_0829635 | |||
| 2608 | Ga0495603_0079558 | |||
| 2609 | Ga0495603_0096109 | |||
| 2610 | Ga0495603_0415376 | |||
| 2611 | Ga0495603_0562591 | |||
| 2612 | Ga0495603_0835772 | |||
| 2613 | Ga0495629_0000319 | |||
| 2614 | Ga0495629_0020444 | |||
| 2615 | Ga0495629_0046949 | |||
| 2616 | Ga0495629_0155073 | |||
| 2617 | Ga0495629_0201724 | |||
| 2618 | Ga0495629_0380482 | |||
| 2619 | Ga0495641_0005764 | |||
| 2620 | Ga0495641_0016039 | |||
| 2621 | Ga0495641_0019178 | |||
| 2622 | Ga0495641_0044455 | |||
| 2623 | Ga0495641_0044716 | |||
| 2624 | Ga0495641_0105938 | |||
| 2625 | Ga0495641_0445532 | |||
| 2626 | Ga0495641_0459922 | |||
| 2627 | Ga0495651_0017133 | |||
| 2628 | Ga0495651_0039212 | |||
| 2629 | Ga0495651_0053665 | |||
| 2630 | Ga0495651_0057032 | |||
| 2631 | Ga0495651_0088314 | |||
| 2632 | Ga0495651_0101621 | |||
| 2633 | Ga0495651_0135760 | |||
| 2634 | Ga0495651_0400102 | |||
| 2635 | Ga0495651_0483789 | |||
| 2636 | Ga0495651_0992152 | |||
| 2637 | Ga0495653_0012965 | |||
| 2638 | Ga0495653_0013190 | |||
| 2639 | Ga0495653_0041082 | |||
| 2640 | Ga0495653_0087151 | |||
| 2641 | Ga0495653_0093433 | |||
| 2642 | Ga0495653_0095777 | |||
| 2643 | Ga0495653_0222237 | |||
| 2644 | Ga0495653_0539593 | |||
| 2645 | Ga0495653_0981299 | |||
| 2646 | Ga0495580_0025973 | |||
| 2647 | Ga0495580_0248207 | |||
| 2648 | Ga0495580_0663506 | |||
| 2649 | Ga0495582_0000358 | |||
| 2650 | Ga0495582_0029168 | |||
| 2651 | Ga0495582_0049271 | |||
| 2652 | Ga0495582_0140278 | |||
| 2653 | Ga0495582_0265089 | |||
| 2654 | Ga0495639_0002626 | |||
| 2655 | Ga0495639_0008199 | |||
| 2656 | Ga0495662_0002647 | |||
| 2657 | Ga0495662_0004470 | |||
| 2658 | Ga0495662_0014253 | |||
| 2659 | Ga0495664_0047907 | |||
| 2660 | Ga0495664_0080526 | |||
| 2661 | Ga0495664_0234406 | |||
| 2662 | Ga0495664_0340953 | |||
| 2663 | Ga0495664_0406201 | |||
| 2664 | Ga0495664_0504518 | |||
| 2665 | Ga0495664_0536658 | |||
| 2666 | Ga0495584_0008227 | |||
| 2667 | Ga0495585_0024932 | |||
| 2668 | Ga0495594_0008671 | |||
| 2669 | Ga0495594_0041557 | |||
| 2670 | Ga0495594_0446089 | |||
| 2671 | Ga0495594_0674514 | |||
| 2672 | Ga0495596_0034089 | |||
| 2673 | Ga0495607_0026956 | |||
| 2674 | Ga0495608_0003300 | |||
| 2675 | Ga0495608_0011142 | |||
| 2676 | Ga0495608_0015297 | |||
| 2677 | Ga0495608_0148817 | |||
| 2678 | Ga0495608_0163932 | |||
| 2679 | Ga0495608_0165641 | |||
| 2680 | Ga0495608_0377992 | |||
| 2681 | Ga0495608_0567253 | |||
| 2682 | Ga0495618_0027070 | |||
| 2683 | Ga0495618_0230659 | |||
| 2684 | Ga0495618_0306520 | |||
| 2685 | Ga0495618_0538243 | |||
| 2686 | Ga0495628_0003751 | |||
| 2687 | Ga0495628_0040215 | |||
| 2688 | Ga0495628_0042846 | |||
| 2689 | Ga0495628_0107147 | |||
| 2690 | Ga0495628_0221382 | |||
| 2691 | Ga0495628_0233378 | |||
| 2692 | Ga0495630_0020826 | |||
| 2693 | Ga0495630_0020828 | |||
| 2694 | Ga0495630_0026489 | |||
| 2695 | Ga0495630_0038705 | |||
| 2696 | Ga0495630_0043068 | |||
| 2697 | Ga0495630_0053585 | |||
| 2698 | Ga0495630_0203386 | |||
| 2699 | Ga0495630_0307374 | |||
| 2700 | Ga0495630_0729887 | |||
| 2701 | Ga0495630_0961931 | |||
| 2702 | Ga0495631_0039597 | |||
| 2703 | Ga0495631_0067783 | |||
| 2704 | Ga0495644_0000819 | |||
| 2705 | Ga0495644_0084747 | |||
| 2706 | Ga0495663_0200780 | |||
| 2707 | Ga0495666_0003469 | |||
| 2708 | Ga0495666_0015670 | |||
| 2709 | Ga0495666_0108113 | |||
| 2710 | Ga0495666_0309813 | |||
| 2711 | Ga0495666_0478711 | |||
| 2712 | Ga0495642_0016114 | |||
| 2713 | Ga0495652_0017796 | |||
| 2714 | Ga0495652_0026148 | |||
| 2715 | Ga0495652_0068899 | |||
| 2716 | Ga0495652_0157109 | |||
| 2717 | Ga0495652_0165410 | |||
| 2718 | Ga0495652_0179986 | |||
| 2719 | Ga0495652_0429953 | |||
| 2720 | Ga0495654_0451184 | |||
| 2721 | Ga0495665_0012337 | |||
| 2722 | Ga0495665_0022839 | |||
| 2723 | Ga0495665_0612094 | |||
| 2724 | Ga0495640_0010306 | |||
| 2725 | Ga0495640_0039198 | |||
| 2726 | Ga0495640_0118474 | |||
| 2727 | Ga0495640_0132953 | |||
| 2728 | Ga0495640_0598584 | |||
| 2729 | Ga0495586_0009166 | |||
| 2730 | Ga0495586_0013906 | |||
| 2731 | Ga0495586_0076673 | |||
| 2732 | Ga0495587_0047960 | |||
| 2733 | Ga0495587_0156001 | |||
| 2734 | Ga0495587_0212471 | |||
| 2735 | Ga0495587_0225081 | |||
| 2736 | Ga0495587_0647488 | |||
| 2737 | Ga0495587_0708540 | |||
| 2738 | Ga0495598_0052258 | |||
| 2739 | Ga0495609_0079067 | |||
| 2740 | Ga0495645_0012470 | |||
| 2741 | Ga0495645_0179639 | |||
| 2742 | Ga0495645_0200208 | |||
| 2743 | Ga0495645_0212942 | |||
| 2744 | Ga0495645_0250567 | |||
| 2745 | Ga0495645_0402189 | |||
| 2746 | Ga0495645_0678808 | |||
| 2747 | Ga0495645_0741696 | |||
| 2748 | Ga0495622_0532799 | |||
| 2749 | Ga0495667_0015868 | |||
| 2750 | Ga0495667_0019234 | |||
| 2751 | Ga0495667_0028003 | |||
| 2752 | Ga0495667_0070896 | |||
| 2753 | Ga0495667_0130580 | |||
| 2754 | Ga0495667_0134022 | |||
| 2755 | Ga0495667_0529840 | |||
| 2756 | Ga0495667_0719244 | |||
| 2757 | Ga0495656_0000621 | |||
| 2758 | Ga0495668_0149722 | |||
| 2759 | Ga0495634_0003395 | |||
| 2760 | Ga0495634_0028964 | |||
| 2761 | Ga0495634_0610370 | |||
| 2762 | Ga0495634_0673166 | |||
| 2763 | Ga0495611_0069496 | |||
| 2764 | Ga0495635_0021997 | |||
| 2765 | Ga0495635_0050625 | |||
| 2766 | Ga0495635_0067003 | |||
| 2767 | Ga0495635_0166290 | |||
| 2768 | Ga0495635_0654962 | |||
| 2769 | Ga0495659_0053108 | |||
| 2770 | Ga0495661_0124357 | |||
| 2771 | Ga0495588_0017973 | |||
| 2772 | Ga0495657_0041962 | |||
| 2773 | Ga0495657_0066345 | |||
| 2774 | Ga0495657_0118277 | |||
| 2775 | Ga0495657_0135637 | |||
| 2776 | Ga0495657_0138910 | |||
| 2777 | Ga0495657_0270660 | |||
| 2778 | Ga0495657_0670295 | |||
| 2779 | Ga0495599_0020210 | |||
| 2780 | Ga0495599_0066938 | |||
| 2781 | Ga0495599_0130034 | |||
| 2782 | Ga0495599_0138294 | |||
| 2783 | Ga0495599_0613570 | |||
| 2784 | Ga0495623_0026708 | |||
| 2785 | Ga0495623_0077461 | |||
| 2786 | Ga0495623_0129369 | |||
| 2787 | Ga0495623_0396815 | |||
| 2788 | Ga0495646_0091022 | |||
| 2789 | Ga0495646_0118989 | |||
| 2790 | Ga0495646_0178606 | |||
| 2791 | Ga0495646_0269118 | |||
| 2792 | Ga0495646_0302686 | |||
| 2793 | Ga0495647_0002047 | |||
| 2794 | Ga0495647_0107647 | |||
| 2795 | Ga0495658_0000384 | |||
| 2796 | Ga0495658_0000524 | |||
| 2797 | Ga0495658_0009679 | |||
| 2798 | Ga0495658_0023104 | |||
| 2799 | Ga0495658_0039216 | |||
| 2800 | Ga0495658_0422204 | |||
| 2801 | Ga0495658_0524731 | |||
| 2802 | Ga0495658_0952835 | |||
| 2803 | Ga0495669_0270881 | |||
| 2804 | Ga0495613_0012745 | |||
| 2805 | Ga0495613_0047516 | |||
| 2806 | Ga0495613_0049317 | |||
| 2807 | Ga0495613_0131009 | |||
| 2808 | Ga0495613_0213620 | |||
| 2809 | Ga0495613_0330458 | |||
| 2810 | Ga0495613_0422686 | |||
| 2811 | Ga0495613_0632479 | |||
| 2812 | Ga0495613_0727805 | |||
| 2813 | Ga0495624_0023590 | |||
| 2814 | Ga0495624_0025679 | |||
| 2815 | Ga0495624_0116212 | |||
| 2816 | Ga0495624_0138164 | |||
| 2817 | Ga0495624_0668369 | |||
| 2818 | Ga0495670_0029338 | |||
| 2819 | Ga0495671_0139557 | |||
| 2820 | Ga0495589_0030160 | |||
| 2821 | Ga0495589_0050413 | |||
| 2822 | Ga0495600_0043381 | |||
| 2823 | Ga0495600_0048692 | |||
| 2824 | Ga0495600_0094000 | |||
| 2825 | Ga0495600_0131471 | |||
| 2826 | Ga0495600_0163468 | |||
| 2827 | Ga0495600_0223988 | |||
| 2828 | Ga0495600_0365700 | |||
| 2829 | Ga0495581_0001964 | |||
| 2830 | Ga0495581_0003702 | |||
| 2831 | Ga0495581_0006490 | |||
| 2832 | Ga0495581_0120733 | |||
| 2833 | Ga0495581_0769062 | |||
| 2834 | Ga0495604_0016942 | |||
| 2835 | Ga0495604_0078805 | |||
| 2836 | Ga0495604_0144390 | |||
| 2837 | Ga0495604_0184191 | |||
| 2838 | Ga0495604_0836230 | |||
| 2839 | Ga0495604_0869029 | |||
| 2840 | Ga0495636_0124034 | |||
| 2841 | Ga0495674_0001135 | |||
| 2842 | Ga0495674_0075986 | |||
| 2843 | Ga0495674_0078674 | |||
| 2844 | Ga0495674_0082781 | |||
| 2845 | Ga0495674_0110059 | |||
| 2846 | Ga0495674_0403700 | |||
| 2847 | Ga0495674_0411608 | |||
| 2848 | Ga0495674_0481669 | |||
| 2849 | Ga0495674_0621061 | |||
| 2850 | Ga0495674_0794857 | |||
| 2851 | Ga0495676_0005182 | |||
| 2852 | Ga0495676_0028449 | |||
| 2853 | Ga0495676_0074178 | |||
| 2854 | Ga0495676_0130524 | |||
| 2855 | Ga0495676_0287725 | |||
| 2856 | Ga0495676_0531132 | |||
| 2857 | Ga0495676_0705796 | |||
| 2858 | Ga0495680_0006719 | |||
| 2859 | Ga0495680_0007716 | |||
| 2860 | Ga0495680_0028462 | |||
| 2861 | Ga0495680_0043380 | |||
| 2862 | Ga0495680_0074473 | |||
| 2863 | Ga0495680_0179393 | |||
| 2864 | Ga0495680_0239931 | |||
| 2865 | Ga0495680_0264061 | |||
| 2866 | Ga0495680_0336184 | |||
| 2867 | Ga0495680_0337949 | |||
| 2868 | Ga0495675_0093658 | |||
| 2869 | Ga0495675_0221340 | |||
| 2870 | Ga0495675_0316570 | |||
| 2871 | Ga0495675_0353554 | |||
| 2872 | Ga0495677_0046016 | |||
| 2873 | Ga0495677_0336518 | |||
| 2874 | Ga0495679_017240 | |||
| 2875 | Ga0495684_0004315 | |||
| 2876 | Ga0495684_0004656 | |||
| 2877 | Ga0495684_0020981 | |||
| 2878 | Ga0495684_0041920 | |||
| 2879 | Ga0495684_0077843 | |||
| 2880 | Ga0495684_0214846 | |||
| 2881 | Ga0495684_0272699 | |||
| 2882 | Ga0495684_0344121 | |||
| 2883 | Ga0495684_0455250 | |||
| 2884 | Ga0495684_0937321 | |||
| 2885 | Ga0495593_0005983 | |||
| 2886 | Ga0495593_0011644 | |||
| 2887 | Ga0495593_0022099 | |||
| 2888 | Ga0495593_0113318 | |||
| 2889 | Ga0495593_0161965 | |||
| 2890 | Ga0495602_0028615 | |||
| 2891 | Ga0495602_0031949 | |||
| 2892 | Ga0495602_0056851 | |||
| 2893 | Ga0495602_0060318 | |||
| 2894 | Ga0495602_0120423 | |||
| 2895 | Ga0495602_0132534 | |||
| 2896 | Ga0495614_0000691 | |||
| 2897 | Ga0495614_0006789 | |||
| 2898 | Ga0495614_0018916 | |||
| 2899 | Ga0495614_0158272 | |||
| 2900 | Ga0496100_0005889 | |||
| 2901 | Ga0496100_0021727 | |||
| 2902 | Ga0496100_0034383 | |||
| 2903 | Ga0496100_0065983 | |||
| 2904 | Ga0496100_0118634 | |||
| 2905 | Ga0496100_0188443 | |||
| 2906 | Ga0496100_0641605 | |||
| 2907 | Ga0496100_0847498 | |||
| 2908 | Ga0496101_0004773 | |||
| 2909 | Ga0496101_0010082 | |||
| 2910 | Ga0496101_0017360 | |||
| 2911 | Ga0496101_0113060 | |||
| 2912 | Ga0496101_0164776 | |||
| 2913 | Ga0496101_0173111 | |||
| 2914 | Ga0496101_0316791 | |||
| 2915 | Ga0496101_0602657 | |||
| 2916 | Ga0496101_0790314 | |||
| 2917 | Ga0496102_0009192 | |||
| 2918 | Ga0496102_0030938 | |||
| 2919 | Ga0496102_0048111 | |||
| 2920 | Ga0496102_0102048 | |||
| 2921 | Ga0496102_0135068 | |||
| 2922 | Ga0496102_0526804 | |||
| 2923 | Ga0496102_0636690 | |||
| 2924 | Ga0496102_1175197 | |||
| 2925 | Ga0496102_1497545 | |||
| 2926 | Ga0496103_0030622 | |||
| 2927 | Ga0496103_0047524 | |||
| 2928 | Ga0496103_0115083 | |||
| 2929 | Ga0496103_0327252 | |||
| 2930 | Ga0496103_0440962 | |||
| 2931 | Ga0496103_0496524 | |||
| 2932 | Ga0496104_0056464 | |||
| 2933 | Ga0496104_0108756 | |||
| 2934 | Ga0496104_0332452 | |||
| 2935 | Ga0496104_0344961 | |||
| 2936 | Ga0496104_0760558 | |||
| 2937 | Ga0496104_1032935 | |||
| 2938 | Ga0496104_1267007 | |||
| 2939 | Ga0496105_0001696 | |||
| 2940 | Ga0496105_0010820 | |||
| 2941 | Ga0496105_0030988 | |||
| 2942 | Ga0496105_0048434 | |||
| 2943 | Ga0496106_0001537 | |||
| 2944 | Ga0496106_0019337 | |||
| 2945 | Ga0496106_0020948 | |||
| 2946 | Ga0496106_0065848 | |||
| 2947 | Ga0496106_0123701 | |||
| 2948 | Ga0496106_0131775 | |||
| 2949 | Ga0496106_0546781 | |||
| 2950 | Ga0496106_1221713 | |||
| 2951 | Ga0496106_1361551 | |||
| 2952 | Ga0496106_1531462 | |||
| 2953 | Ga0496107_0003573 | |||
| 2954 | Ga0496107_0003674 | |||
| 2955 | Ga0496107_0013371 | |||
| 2956 | Ga0496107_0052027 | |||
| 2957 | Ga0496107_0122346 | |||
| 2958 | Ga0496107_0229417 | |||
| 2959 | Ga0496107_0908368 | |||
| 2960 | Ga0496107_0920011 | |||
| 2961 | Ga0496107_0959269 | |||
| 2962 | Ga0496108_0006227 | |||
| 2963 | Ga0496108_0018620 | |||
| 2964 | Ga0496108_0055610 | |||
| 2965 | Ga0496108_0080618 | |||
| 2966 | Ga0496108_0081016 | |||
| 2967 | Ga0496108_0113016 | |||
| 2968 | Ga0496108_0331971 | |||
| 2969 | Ga0496108_0778285 | |||
| 2970 | Ga0496108_1262390 | |||
| 2971 | Ga0496109_0002950 | |||
| 2972 | Ga0496109_0004692 | |||
| 2973 | Ga0496109_0011347 | |||
| 2974 | Ga0496109_0032736 | |||
| 2975 | Ga0496109_0086639 | |||
| 2976 | Ga0496109_0098361 | |||
| 2977 | Ga0496109_0160980 | |||
| 2978 | Ga0496109_0301307 | |||
| 2979 | Ga0496109_0429484 | |||
| 2980 | Ga0496110_0002127 | |||
| 2981 | Ga0496110_0037596 | |||
| 2982 | Ga0496110_0041284 | |||
| 2983 | Ga0496110_0053559 | |||
| 2984 | Ga0496110_0472601 | |||
| 2985 | Ga0496110_0613109 | |||
| 2986 | Ga0496110_1098716 | |||
| 2987 | Ga0496110_1519316 | |||
| 2988 | Ga0496110_1555457 | |||
| 2989 | Ga0496111_0007535 | |||
| 2990 | Ga0496111_0036550 | |||
| 2991 | Ga0496111_0036562 | |||
| 2992 | Ga0496111_0092384 | |||
| 2993 | Ga0496111_0354599 | |||
| 2994 | Ga0496111_0428138 | |||
| 2995 | Ga0496111_0460682 | |||
| 2996 | Ga0496111_0512502 | |||
| 2997 | Ga0496112_0025388 | |||
| 2998 | Ga0496112_0026036 | |||
| 2999 | Ga0496112_0038757 | |||
| 3000 | Ga0496112_0041236 | |||
| 3001 | Ga0496112_0059478 | |||
| 3002 | Ga0496112_0089385 | |||
| 3003 | Ga0496112_0137906 | |||
| 3004 | Ga0496112_0497010 | |||
| 3005 | Ga0496112_0805827 | |||
| 3006 | Ga0496112_0825980 | |||
| 3007 | Ga0496112_1490299 | |||
| 3008 | Ga0496113_0001497 | |||
| 3009 | Ga0496113_0006676 | |||
| 3010 | Ga0496113_0077158 | |||
| 3011 | Ga0496113_0094321 | |||
| 3012 | Ga0496113_0103619 | |||
| 3013 | Ga0496113_0292209 | |||
| 3014 | Ga0496113_0521227 | |||
| 3015 | Ga0496113_0870526 | |||
| 3016 | Ga0496114_0013258 | |||
| 3017 | Ga0496114_0022160 | |||
| 3018 | Ga0496114_0071029 | |||
| 3019 | Ga0496114_0216049 | |||
| 3020 | Ga0496114_0340987 | |||
| 3021 | Ga0496115_0001529 | |||
| 3022 | Ga0496115_0007349 | |||
| 3023 | Ga0496115_0058429 | |||
| 3024 | Ga0496115_0075125 | |||
| 3025 | Ga0496115_0077920 | |||
| 3026 | Ga0496115_0783067 | |||
| 3027 | Ga0501037_0419028 | |||
| 3028 | Ga0501041_0365965 | |||
| 3029 | Ga0501043_0977394 | |||
| 3030 | Ga0501046_0257850 | |||
| 3031 | Ga0501047_0080204 | |||
| 3032 | Ga0501047_0087698 | |||
| 3033 | Ga0501047_1190645 | |||
| 3034 | Ga0501069_0056205 | |||
| 3035 | Ga0501069_0478991 | |||
| 3036 | Ga0501069_0660168 | |||
| 3037 | Ga0501070_0057784 | |||
| 3038 | Ga0501070_0130602 | |||
| 3039 | Ga0501070_0355886 | |||
| 3040 | Ga0501070_0986885 | |||
| 3041 | Ga0501073_0738806 | |||
| 3042 | Ga0501074_0027630 | |||
| 3043 | Ga0501074_0087495 | |||
| 3044 | Ga0501074_0217452 | |||
| 3045 | Ga0501074_0991744 | |||
| 3046 | Ga0501075_1384021 | |||
| 3047 | Ga0501079_0833461 | |||
| 3048 | Ga0501080_0173707 | |||
| 3049 | Ga0501080_0204460 | |||
| 3050 | Ga0501080_0435972 | |||
| 3051 | Ga0501080_0602270 | |||
| 3052 | Ga0501080_1026315 | |||
| 3053 | Ga0501044_0153939 | |||
| 3054 | Ga0501044_0356336 | |||
| 3055 | nmdc:mga03683_4155_c1 | |||
| 3056 | nmdc:mga00v17_2661_c1 | |||
| 3057 | nmdc:mga00v17_539352_c1 | |||
| 3058 | nmdc:mga0yw44_2792_c1 | |||
| 3059 | nmdc:mga0yw44_66374_c1 | |||
| 3060 | nmdc:mga05p37_16425_c1 | |||
| 3061 | nmdc:mga05p37_308233_c1 | |||
| 3062 | nmdc:mga05p37_377420_c1 | |||
| 3063 | nmdc:mga05p37_75954_c1 | |||
| 3064 | nmdc:mga09592_10288_c1 | |||
| 3065 | nmdc:mga09592_131509_c1 | |||
| 3066 | nmdc:mga0qj67_105438_c1 | |||
| 3067 | nmdc:mga0qj67_11246_c1 | |||
| 3068 | nmdc:mga06r32_32372_c1 | |||
| 3069 | nmdc:mga08y16_2037963_c1 | |||
| 3070 | nmdc:mga08y16_221705_c1 | |||
| 3071 | nmdc:mga08y16_6427_c1 | |||
| 3072 | nmdc:mga0n895_12158_c1 | |||
| 3073 | nmdc:mga0n895_17465_c1 | |||
| 3074 | nmdc:mga0n895_1973348_c1 | |||
| 3075 | nmdc:mga0n895_742320_c1 | |||
| 3076 | nmdc:mga0rr50_1486_c1 | |||
| 3077 | nmdc:mga0rr50_177413_c1 | |||
| 3078 | nmdc:mga0rr50_789695_c1 | |||
| 3079 | nmdc:mga08x19_23986_c1 | |||
| 3080 | nmdc:mga0a205_216343_c1 | |||
| 3081 | nmdc:mga0a205_572458_c1 | |||
| 3082 | nmdc:mga0a205_99370_c2 | |||
| 3083 | Ga0495601_0005905 | |||
| 3084 | Ga0495601_0024199 | |||
| 3085 | Ga0495601_0025101 | |||
| 3086 | Ga0495601_0032047 | |||
| 3087 | Ga0495601_0033861 | |||
| 3088 | Ga0495601_0072282 | |||
| 3089 | Ga0495601_0126065 | |||
| 3090 | Ga0495601_0147281 | |||
| 3091 | Ga0495601_0228999 | |||
| 3092 | Ga0495601_0263034 | |||
| 3093 | Ga0495601_0526895 | |||
| 3094 | Ga0495612_0001993 | |||
| 3095 | Ga0495612_0004267 | |||
| 3096 | Ga0495612_0034396 | |||
| 3097 | Ga0495612_0092270 | |||
| 3098 | Ga0495612_0159110 | |||
| 3099 | Ga0495612_0182099 | |||
| 3100 | Ga0495612_0371877 | |||
| 3101 | Ga0495655_0002920 | |||
| 3102 | Ga0495655_0044265 | |||
| 3103 | Ga0495595_0034469 | |||
| 3104 | Ga0495595_0072720 | |||
| 3105 | Ga0495595_0239949 | |||
| 3106 | Ga0495595_0363342 | |||
| 3107 | Ga0495619_0002851 | |||
| 3108 | Ga0495619_0011960 | |||
| 3109 | Ga0495619_0015294 | |||
| 3110 | Ga0495619_0149861 | |||
| 3111 | Ga0495619_0155557 | |||
| 3112 | Ga0495619_0213204 | |||
| 3113 | Ga0495619_0237608 | |||
| 3114 | Ga0495619_0281800 | |||
| 3115 | Ga0495619_0348624 | |||
| 3116 | Ga0495619_0736827 | |||
| 3117 | Ga0495619_0923709 | |||
| 3118 | Ga0500566_0035762 | |||
| 3119 | Ga0500657_152291 | |||
| 3120 | Ga0587093_086003 | |||
| 3121 | Ga0587066_031106 | |||
| 3122 | Ga0587073_0227976 | |||
| 3123 | Ga0587082_176197 | |||
| 3124 | Ga0587086_101637 | |||
| 3125 | Ga0587094_077601 | |||
| 3126 | Ga0587076_176811 | |||
| 3127 | Ga0587078_046469 | |||
| 3128 | Ga0587111_0259867 | |||
| 3129 | Ga0501082_1259361 | |||
| 3130 | Ga0466962_0000557 | |||
| 3131 | Ga0466962_0010989 | |||
| 3132 | Ga0466962_0089495 | |||
| 3133 | Ga0466962_0143270 | |||
| 3134 | Ga0530510_0665322 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7lq4-assembly1.cif.gz_T | rr (rsig)2-(c-di-gmp)2-whig complex | 0.6561 | 6 | 73 |
| 8ebx-assembly1.cif.gz_H | xpa repositioning core7 of tfiih relative to xpc-dna lesion (ap) | 0.6446 | 14 | 77 |
| 7lq4-assembly1.cif.gz_T | rr (rsig)2-(c-di-gmp)2-whig complex | 0.5387 | 6 | 73 |
| 4biz-assembly2.cif.gz_C | crystal structure of cpxahdc (orthorhombic form 2) | 0.509 | 14 | 74 |
| 8ebx-assembly1.cif.gz_H | xpa repositioning core7 of tfiih relative to xpc-dna lesion (ap) | 0.4715 | 14 | 77 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1x3wA03 | Mainly Alpha;Orthogonal Bundle;Rna Polymerase Sigma Factor; Chain: A; | 0.5114 | 43 | 74 | 1.10.1740.90 |
| af_Q0JGJ6_15_112_1.10.246.140 | Mainly Alpha;Orthogonal Bundle;Serum Albumin; Chain A, Domain 1;ENY2/SUS1 | 0.3346 | 1 | 82 | 1.10.246.140 |
| af_Q0JGJ6_15_112_1.10.246.140 | Mainly Alpha;Orthogonal Bundle;Serum Albumin; Chain A, Domain 1;ENY2/SUS1 | 0.3086 | 1 | 82 | 1.10.246.140 |
| 1x3wA03 | Mainly Alpha;Orthogonal Bundle;Rna Polymerase Sigma Factor; Chain: A; | 0.251 | 43 | 74 | 1.10.1740.90 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7K9HWY3-F1-model_v4 | ELL factor | 0.4001 | 8 | 74 |
GO:0000987
GO:0008023 GO:0032968 GO:0042795 |
| AF-A0A7K9HWY3-F1-model_v4 | ELL factor | 0.3554 | 8 | 74 |
GO:0000987
GO:0008023 GO:0032968 GO:0042795 |
| AF-A0A2H0IXZ1-F1-model_v4 | WGR domain-containing protein | 0.2243 | 1 | 85 |
|
| AF-A0A2H0IXZ1-F1-model_v4 | WGR domain-containing protein | 0.1935 | 1 | 85 |
|