F494762

General Info

Members Datasets Scaffolds Average Seq Length
1561 434 1561 175

Family's Representative Sequence

Representative Sequence 3300005344|Ga0070661_100481031|Ga0070661_1004810312
Length 196
Sequence VPRIDLRTRIRDVPNFPKPGIVFKDIMPLLADANALHQAVDDLADWAQPRNVDIVVGAEARGFILGAAVAYRLGCGFAAARKPGKLPFLTVGAKYALEYGFDALEMHVDVLIKGARVLIHDDLLATGGTASAMCELVEQAGAEVVGCGFVIELAFLNGRERLGGRDVRSLVMYDTASGPATRPAEPGSADGPEANA

Samples

Sample ID Description Type Environment
1 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
2 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
3 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
4 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
5 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
21 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
34 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
35 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
36 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
37 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
38 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
39 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
40 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
41 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
42 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
43 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
44 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
45 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
46 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
47 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
48 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
49 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
50 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
51 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
52 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
53 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
54 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
55 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
56 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
57 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
58 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
59 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
60 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
61 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
62 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
63 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
64 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
65 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
66 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
67 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
68 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
69 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
70 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
71 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
72 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
73 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
74 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
75 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
76 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
77 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
78 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
79 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
80 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
81 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
82 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
83 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
84 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
85 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
86 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
87 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
88 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
89 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
90 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
91 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
92 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
93 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
94 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
95 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
96 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
97 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
98 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
99 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
100 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
101 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
102 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
103 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
104 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
105 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
106 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
107 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
108 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
109 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
110 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
111 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
112 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
113 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
114 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
115 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
116 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
117 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
118 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
119 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
120 3300012478 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.9.old.080610 Metagenome Rhizosphere
121 3300012487 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.old.130510 Metagenome Rhizosphere
122 3300012491 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.8.old.040610 Metagenome Rhizosphere
123 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
124 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
125 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
126 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
127 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
128 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
129 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
130 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
131 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
132 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
133 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
134 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
135 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
136 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
137 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
138 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
139 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
140 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
141 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
209 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
210 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
211 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
215 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
216 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
217 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
218 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
219 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
220 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
221 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
222 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
223 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
224 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
225 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
226 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
227 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
228 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
229 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
230 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
231 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
232 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
233 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
234 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
235 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
236 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
237 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
238 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
239 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
240 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
241 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
242 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
243 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
244 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
245 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
246 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
247 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
248 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
249 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
250 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
251 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
252 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
253 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
254 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
255 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
256 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
257 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
258 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
259 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
260 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
261 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
262 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
263 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
264 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
265 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
266 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
267 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
268 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
269 3300042132 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 Metagenome Rhizosphere
270 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
271 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
272 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
273 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
274 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
275 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
276 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
277 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
278 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
279 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
280 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
281 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
282 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
283 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
284 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
285 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
286 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
287 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
288 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
289 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
290 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
291 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
292 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
293 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
294 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
295 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
296 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
297 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
298 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
299 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
300 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
301 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
302 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
303 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
304 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
305 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
306 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
307 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
308 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
309 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
310 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
311 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
312 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
313 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
314 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
315 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
316 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
317 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
318 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
319 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
320 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
321 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
322 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
323 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
324 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
325 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
326 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
327 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
328 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
329 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
330 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
331 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
332 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
333 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
334 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
335 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
336 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
337 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
338 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
339 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
340 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
341 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
342 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
343 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
344 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
345 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
346 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
347 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
348 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
349 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
350 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
351 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
352 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
353 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
354 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
355 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
356 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
357 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
358 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
359 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
360 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
361 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
362 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
363 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
364 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
365 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
366 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
367 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
368 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
369 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
370 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
371 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
372 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
373 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
374 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
375 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
376 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
377 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
378 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
379 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
380 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
381 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
382 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
383 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
384 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
385 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
386 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
387 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
388 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
389 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
390 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
391 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
392 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
393 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
394 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
395 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
396 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
397 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
398 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
399 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
400 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
401 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
402 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
403 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
404 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
405 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
406 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
407 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
408 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
409 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
410 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
411 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
412 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
413 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
414 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
415 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
416 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
417 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
418 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
419 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
420 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
421 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
422 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
423 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
424 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
425 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
426 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
427 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
428 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
429 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
430 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
431 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
432 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
433 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
434 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.94
Metatranscriptomes 0.06
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.9
Nodule 0
Rhizoplane 9.29
Rhizosphere 89.69
Stem 0
Stem Tuber 0
Unclassified 0.13

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24737J22298_10037973 3300001990 Bacteria 1483
2 JGI24743J22301_10016894 3300001991 Bacteria 1366
3 JGI24749J21850_1006737 3300002076 Bacteria 1597
4 JGI24034J26672_10017726 3300002239 Bacteria 1103
5 JGI25407J50210_10003696 3300003373 Bacteria 3686
6 JGI25407J50210_10012536 3300003373 Bacteria 2174
7 Ga0065707_10279534 3300005295 Unclassified 1051
8 Ga0070658_10000148 3300005327 Bacteria 62109
9 Ga0070658_10013564 3300005327 Bacteria 6538
10 Ga0070676_10002170 3300005328 Bacteria 10008
11 Ga0070676_10061055 3300005328 Bacteria 2240
12 Ga0070683_100003232 3300005329 Bacteria 13160
13 Ga0070683_100009682 3300005329 Bacteria 8249
14 Ga0070683_100041707 3300005329 Bacteria 4224
15 Ga0070683_100047057 3300005329 Bacteria 3985
16 Ga0070683_100072321 3300005329 Bacteria 3218
17 Ga0070683_100145696 3300005329 Bacteria 2244
18 Ga0070683_100896093 3300005329 Bacteria 851
19 Ga0070683_101216916 3300005329 Bacteria 724
20 Ga0070683_101607043 3300005329 Bacteria 625
21 Ga0070690_100000880 3300005330 Bacteria 15287
22 Ga0070690_100030426 3300005330 Bacteria 3354
23 Ga0070690_100075974 3300005330 Bacteria 2191
24 Ga0070670_100005367 3300005331 Bacteria 10819
25 Ga0070670_100805416 3300005331 Bacteria 848
26 Ga0070677_10000593 3300005333 Bacteria 12210
27 Ga0068869_100005923 3300005334 Bacteria 7723
28 Ga0068869_100065671 3300005334 Bacteria 2672
29 Ga0068869_100115018 3300005334 Bacteria 2051
30 Ga0068869_100171527 3300005334 Bacteria 1695
31 Ga0068869_100237428 3300005334 Bacteria 1451
32 Ga0068869_100293960 3300005334 Bacteria 1310
33 Ga0068869_100347890 3300005334 Bacteria 1208
34 Ga0070666_10018715 3300005335 Bacteria 4459
35 Ga0070666_10095153 3300005335 Bacteria 2050
36 Ga0070666_11064517 3300005335 Bacteria 601
37 Ga0070680_100118054 3300005336 Bacteria 2212
38 Ga0070680_100131314 3300005336 Bacteria 2096
39 Ga0070682_100351863 3300005337 Bacteria 1098
40 Ga0068868_100029603 3300005338 Bacteria 4194
41 Ga0068868_100051182 3300005338 Bacteria 3247
42 Ga0068868_100113827 3300005338 Bacteria 2200
43 Ga0068868_100286811 3300005338 Bacteria 1395
44 Ga0068868_100807503 3300005338 Bacteria 847
45 Ga0068868_101049775 3300005338 Bacteria 748
46 Ga0068868_101101452 3300005338 Bacteria 731
47 Ga0070660_100001289 3300005339 Bacteria 17076
48 Ga0070689_100113525 3300005340 Bacteria 2157
49 Ga0070689_100234803 3300005340 Bacteria 1509
50 Ga0070689_100300290 3300005340 Bacteria 1336
51 Ga0070689_100342354 3300005340 Bacteria 1252
52 Ga0070691_10039783 3300005341 Bacteria 2222
53 Ga0070691_10043891 3300005341 Bacteria 2119
54 Ga0070691_10134306 3300005341 Bacteria 1256
55 Ga0070687_100000032 3300005343 Bacteria 43649
56 Ga0070687_100189213 3300005343 Bacteria 1239
57 Ga0070661_100000412 3300005344 Bacteria 33114
58 Ga0070661_100021656 3300005344 Bacteria 4595
59 Ga0070661_100481031 3300005344 Bacteria 992
60 Ga0070661_100524915 3300005344 Bacteria 950
61 Ga0070692_10004960 3300005345 Bacteria 5616
62 Ga0070692_10146161 3300005345 Bacteria 1343
63 Ga0070692_10526698 3300005345 Bacteria 770
64 Ga0070668_100000345 3300005347 Bacteria 30655
65 Ga0070668_100001897 3300005347 Bacteria 15288
66 Ga0070668_100046541 3300005347 Bacteria 3332
67 Ga0070668_100049552 3300005347 Bacteria 3232
68 Ga0070668_100772215 3300005347 Bacteria 852
69 Ga0070669_100000307 3300005353 Bacteria 38485
70 Ga0070675_100004496 3300005354 Bacteria 10650
71 Ga0070675_100051540 3300005354 Bacteria 3382
72 Ga0070675_100135821 3300005354 Bacteria 2099
73 Ga0070675_100220962 3300005354 Bacteria 1650
74 Ga0070675_100325641 3300005354 Bacteria 1358
75 Ga0070675_101781559 3300005354 Bacteria 568
76 Ga0070671_100013455 3300005355 Bacteria 6596
77 Ga0070671_100599287 3300005355 Bacteria 952
78 Ga0070674_100071027 3300005356 Bacteria 2461
79 Ga0070674_100137282 3300005356 Bacteria 1831
80 Ga0070674_100532753 3300005356 Bacteria 983
81 Ga0070674_100979066 3300005356 Bacteria 741
82 Ga0070673_100000724 3300005364 Bacteria 18238
83 Ga0070673_100061685 3300005364 Bacteria 2975
84 Ga0070673_100139018 3300005364 Bacteria 2047
85 Ga0070673_100166475 3300005364 Bacteria 1879
86 Ga0070673_100357059 3300005364 Unclassified 1298
87 Ga0070673_100922492 3300005364 Bacteria 810
88 Ga0070688_100000122 3300005365 Bacteria 41175
89 Ga0070688_100001291 3300005365 Bacteria 12481
90 Ga0070688_100107992 3300005365 Bacteria 1846
91 Ga0070688_100228172 3300005365 Bacteria 1316
92 Ga0070659_100008431 3300005366 Bacteria 7529
93 Ga0070659_100011172 3300005366 Bacteria 6635
94 Ga0070659_100061128 3300005366 Bacteria 2977
95 Ga0070659_100078874 3300005366 Bacteria 2628
96 Ga0070667_100051255 3300005367 Bacteria 3479
97 Ga0070703_10014288 3300005406 Bacteria 2261
98 Ga0070703_10056139 3300005406 Bacteria 1274
99 Ga0070709_10235711 3300005434 Bacteria 1312
100 Ga0070714_100015487 3300005435 Bacteria 6132
101 Ga0070714_100038774 3300005435 Bacteria 4007
102 Ga0070714_100065808 3300005435 Bacteria 3122
103 Ga0070713_100034429 3300005436 Bacteria 4069
104 Ga0070713_100176043 3300005436 Bacteria 1920
105 Ga0070713_100363709 3300005436 Bacteria 1345
106 Ga0070713_100744182 3300005436 Bacteria 938
107 Ga0070710_10033928 3300005437 Bacteria 2773
108 Ga0070701_10067011 3300005438 Bacteria 1909
109 Ga0070701_10067435 3300005438 Bacteria 1904
110 Ga0070711_100012787 3300005439 Bacteria 5255
111 Ga0070711_100208352 3300005439 Bacteria 1512
112 Ga0070705_100000837 3300005440 Bacteria 17307
113 Ga0070705_100123097 3300005440 Bacteria 1678
114 Ga0070705_100235955 3300005440 Bacteria 1275
115 Ga0070700_100034468 3300005441 Bacteria 3058
116 Ga0070700_100153189 3300005441 Bacteria 1579
117 Ga0070694_100088830 3300005444 Bacteria 2164
118 Ga0070694_100146334 3300005444 Bacteria 1721
119 Ga0070694_100339912 3300005444 Bacteria 1160
120 Ga0070708_100003372 3300005445 Bacteria 12516
121 Ga0070708_100136961 3300005445 Bacteria 2269
122 Ga0070708_100218826 3300005445 Bacteria 1786
123 Ga0070663_100003529 3300005455 Bacteria 9027
124 Ga0070663_100184098 3300005455 Bacteria 1622
125 Ga0070663_100309035 3300005455 Bacteria 1268
126 Ga0070663_100522301 3300005455 Unclassified 989
127 Ga0070678_100019909 3300005456 Bacteria 4390
128 Ga0070678_100040773 3300005456 Bacteria 3287
129 Ga0070678_100061997 3300005456 Bacteria 2759
130 Ga0070678_100088238 3300005456 Bacteria 2370
131 Ga0070678_100096591 3300005456 Bacteria 2280
132 Ga0070678_100097991 3300005456 Bacteria 2266
133 Ga0070678_100117617 3300005456 Bacteria 2090
134 Ga0070678_100194207 3300005456 Bacteria 1671
135 Ga0070678_100837980 3300005456 Bacteria 837
136 Ga0070678_101160816 3300005456 Bacteria 715
137 Ga0070662_100000190 3300005457 Bacteria 35766
138 Ga0070662_100127607 3300005457 Bacteria 1957
139 Ga0070662_100232070 3300005457 Bacteria 1476
140 Ga0070681_10116951 3300005458 Bacteria 2603
141 Ga0070681_10277713 3300005458 Bacteria 1586
142 Ga0070681_10492057 3300005458 Bacteria 1139
143 Ga0070681_10752782 3300005458 Bacteria 891
144 Ga0070681_10761679 3300005458 Bacteria 885
145 Ga0070681_10848792 3300005458 Bacteria 831
146 Ga0068867_100003036 3300005459 Bacteria 11838
147 Ga0068867_100189693 3300005459 Bacteria 1639
148 Ga0068867_100270724 3300005459 Bacteria 1389
149 Ga0070685_10009316 3300005466 Bacteria 5067
150 Ga0070685_10013428 3300005466 Bacteria 4319
151 Ga0070685_10203862 3300005466 Bacteria 1287
152 Ga0070685_10230203 3300005466 Bacteria 1218
153 Ga0070685_10369098 3300005466 Bacteria 986
154 Ga0070685_10393544 3300005466 Bacteria 958
155 Ga0070706_100004922 3300005467 Bacteria 12783
156 Ga0070706_100439338 3300005467 Bacteria 1214
157 Ga0070706_101602945 3300005467 Bacteria 594
158 Ga0070698_100221234 3300005471 Bacteria 1827
159 Ga0070699_100190316 3300005518 Bacteria 1822
160 Ga0070679_100002455 3300005530 Bacteria 16802
161 Ga0070679_100006333 3300005530 Bacteria 11019
162 Ga0070679_100530107 3300005530 Bacteria 1121
163 Ga0070679_100678943 3300005530 Bacteria 973
164 Ga0070684_100003023 3300005535 Bacteria 12534
165 Ga0070684_100008834 3300005535 Bacteria 7900
166 Ga0070684_100024095 3300005535 Bacteria 5102
167 Ga0070684_100069572 3300005535 Bacteria 3095
168 Ga0070684_100073692 3300005535 Bacteria 3009
169 Ga0070684_100076274 3300005535 Bacteria 2958
170 Ga0070684_100079394 3300005535 Bacteria 2901
171 Ga0070684_100155075 3300005535 Bacteria 2076
172 Ga0070684_100177495 3300005535 Bacteria 1936
173 Ga0070684_100208069 3300005535 Bacteria 1783
174 Ga0070684_101203293 3300005535 Bacteria 713
175 Ga0068853_100000259 3300005539 Bacteria 37244
176 Ga0068853_100452548 3300005539 Bacteria 1208
177 Ga0070672_100001842 3300005543 Bacteria 13231
178 Ga0070672_100836494 3300005543 Bacteria 811
179 Ga0070672_101736281 3300005543 Bacteria 561
180 Ga0070686_100000081 3300005544 Bacteria 69623
181 Ga0070686_100049268 3300005544 Bacteria 2671
182 Ga0070686_100057915 3300005544 Bacteria 2491
183 Ga0070686_100064132 3300005544 Bacteria 2382
184 Ga0070686_100078490 3300005544 Bacteria 2180
185 Ga0070686_100609865 3300005544 Bacteria 861
186 Ga0070695_100075759 3300005545 Bacteria 2214
187 Ga0070695_100168584 3300005545 Bacteria 1543
188 Ga0070695_100313506 3300005545 Bacteria 1164
189 Ga0070695_100346542 3300005545 Bacteria 1112
190 Ga0070695_100647753 3300005545 Bacteria 834
191 Ga0070695_100802624 3300005545 Bacteria 754
192 Ga0070695_100905479 3300005545 Bacteria 713
193 Ga0070696_100034196 3300005546 Bacteria 3496
194 Ga0070696_100168506 3300005546 Bacteria 1618
195 Ga0070696_100433376 3300005546 Bacteria 1034
196 Ga0070696_100562646 3300005546 Bacteria 915
197 Ga0070693_100001141 3300005547 Bacteria 11908
198 Ga0070693_100010410 3300005547 Bacteria 4659
199 Ga0070693_100037050 3300005547 Bacteria 2716
200 Ga0070693_100428161 3300005547 Bacteria 924
201 Ga0070665_100027976 3300005548 Bacteria 5678
202 Ga0070665_100044114 3300005548 Bacteria 4479
203 Ga0070665_100048573 3300005548 Bacteria 4260
204 Ga0070665_100547070 3300005548 Bacteria 1170
205 Ga0070665_101000174 3300005548 Bacteria 848
206 Ga0068855_100008572 3300005563 Bacteria 12362
207 Ga0068855_100023755 3300005563 Bacteria 7343
208 Ga0068855_100218159 3300005563 Bacteria 2140
209 Ga0070664_100001682 3300005564 Bacteria 17711
210 Ga0070664_100033897 3300005564 Bacteria 4280
211 Ga0070664_100206813 3300005564 Bacteria 1753
212 Ga0070664_100591133 3300005564 Bacteria 1029
213 Ga0070664_100725240 3300005564 Bacteria 927
214 Ga0070664_100815412 3300005564 Bacteria 873
215 Ga0070664_101198903 3300005564 Bacteria 716
216 Ga0068857_100000447 3300005577 Bacteria 29347
217 Ga0068857_100007066 3300005577 Bacteria 9670
218 Ga0068857_100020822 3300005577 Bacteria 5770
219 Ga0068857_100026664 3300005577 Bacteria 5093
220 Ga0068857_100044578 3300005577 Bacteria 3934
221 Ga0068857_100059948 3300005577 Bacteria 3381
222 Ga0068857_100113007 3300005577 Bacteria 2442
223 Ga0068857_100224002 3300005577 Bacteria 1718
224 Ga0068854_100000223 3300005578 Bacteria 38461
225 Ga0068854_100012985 3300005578 Bacteria 5457
226 Ga0068854_100025573 3300005578 Bacteria 4051
227 Ga0068854_100408156 3300005578 Bacteria 1125
228 Ga0068854_100497488 3300005578 Bacteria 1026
229 Ga0068854_101622971 3300005578 Bacteria 590
230 Ga0068856_100009219 3300005614 Bacteria 9595
231 Ga0068856_100009373 3300005614 Bacteria 9508
232 Ga0068856_100026249 3300005614 Bacteria 5680
233 Ga0068856_100045085 3300005614 Bacteria 4340
234 Ga0068856_100126640 3300005614 Bacteria 2557
235 Ga0068856_100131278 3300005614 Bacteria 2509
236 Ga0068856_100141095 3300005614 Bacteria 2417
237 Ga0068856_100274713 3300005614 Bacteria 1701
238 Ga0068856_100309502 3300005614 Bacteria 1597
239 Ga0068856_100333868 3300005614 Bacteria 1534
240 Ga0070702_100004814 3300005615 Bacteria 6204
241 Ga0070702_100022737 3300005615 Bacteria 3321
242 Ga0070702_100027098 3300005615 Bacteria 3088
243 Ga0070702_100585510 3300005615 Bacteria 834
244 Ga0068852_100003535 3300005616 Bacteria 10938
245 Ga0068852_100026783 3300005616 Bacteria 4692
246 Ga0068852_100247772 3300005616 Bacteria 1706
247 Ga0068852_100283604 3300005616 Bacteria 1598
248 Ga0068852_100324583 3300005616 Bacteria 1496
249 Ga0068852_100427970 3300005616 Bacteria 1307
250 Ga0068852_101012546 3300005616 Bacteria 849
251 Ga0068859_100034014 3300005617 Bacteria 5117
252 Ga0068859_100245662 3300005617 Bacteria 1879
253 Ga0068859_100376781 3300005617 Bacteria 1515
254 Ga0068859_100451380 3300005617 Bacteria 1382
255 Ga0068859_100754918 3300005617 Bacteria 1062
256 Ga0068864_100001363 3300005618 Bacteria 20303
257 Ga0068864_100213706 3300005618 Bacteria 1777
258 Ga0068864_100388021 3300005618 Bacteria 1325
259 Ga0068866_10000018 3300005718 Bacteria 65387
260 Ga0068866_10043808 3300005718 Bacteria 2235
261 Ga0068866_10090021 3300005718 Bacteria 1669
262 Ga0068861_100000047 3300005719 Bacteria 56183
263 Ga0068861_100002424 3300005719 Bacteria 12151
264 Ga0068861_100364609 3300005719 Bacteria 1272
265 Ga0068851_10003415 3300005834 Bacteria 7074
266 Ga0068870_10000033 3300005840 Bacteria 44161
267 Ga0068863_100016901 3300005841 Bacteria 6998
268 Ga0068858_100063116 3300005842 Bacteria 3427
269 Ga0068858_100353047 3300005842 Bacteria 1409
270 Ga0068858_100567252 3300005842 Bacteria 1099
271 Ga0068858_100839237 3300005842 Bacteria 897
272 Ga0068860_100040808 3300005843 Bacteria 4434
273 Ga0068860_100443033 3300005843 Bacteria 1290
274 Ga0068860_100470533 3300005843 Bacteria 1252
275 Ga0068860_101188183 3300005843 Bacteria 783
276 Ga0068862_100000659 3300005844 Bacteria 35380
277 Ga0068862_100452969 3300005844 Bacteria 1210
278 Ga0068862_100538650 3300005844 Bacteria 1113
279 Ga0068862_100811797 3300005844 Bacteria 914
280 Ga0081455_10010933 3300005937 Bacteria 9153
281 Ga0081455_10012924 3300005937 Bacteria 8282
282 Ga0081455_10026114 3300005937 Bacteria 5380
283 Ga0081455_10037900 3300005937 Bacteria 4272
284 Ga0081455_10045237 3300005937 Bacteria 3831
285 Ga0081455_10056874 3300005937 Bacteria 3318
286 Ga0081455_10069231 3300005937 Bacteria 2935
287 Ga0081538_10000059 3300005981 Bacteria 101468
288 Ga0081538_10001038 3300005981 Bacteria 29617
289 Ga0081538_10003925 3300005981 Bacteria 13872
290 Ga0081538_10004092 3300005981 Bacteria 13560
291 Ga0081538_10004995 3300005981 Bacteria 12075
292 Ga0081538_10052043 3300005981 Bacteria 2451
293 Ga0081538_10192945 3300005981 Unclassified 851
294 Ga0081540_1000258 3300005983 Bacteria 55927
295 Ga0081540_1012281 3300005983 Bacteria 5654
296 Ga0081539_10006784 3300005985 Bacteria 10742
297 Ga0081539_10007140 3300005985 Bacteria 10309
298 Ga0070717_10303936 3300006028 Bacteria 1419
299 Ga0070717_10311175 3300006028 Bacteria 1402
300 Ga0075365_10204495 3300006038 Bacteria 1384
301 Ga0075365_10277440 3300006038 Bacteria 1179
302 Ga0075363_100114638 3300006048 Bacteria 1501
303 Ga0075364_10124175 3300006051 Bacteria 1729
304 Ga0075432_10006518 3300006058 Bacteria 3975
305 Ga0075432_10136732 3300006058 Bacteria 932
306 Ga0070715_10021794 3300006163 Bacteria 2490
307 Ga0070715_10064900 3300006163 Bacteria 1614
308 Ga0070716_100191068 3300006173 Bacteria 1353
309 Ga0070716_101103349 3300006173 Bacteria 633
310 Ga0070712_100029637 3300006175 Bacteria 3671
311 Ga0070712_100029726 3300006175 Bacteria 3665
312 Ga0070712_100041213 3300006175 Bacteria 3169
313 Ga0070712_100259254 3300006175 Bacteria 1392
314 Ga0070712_100470149 3300006175 Bacteria 1050
315 Ga0070712_100535922 3300006175 Bacteria 985
316 Ga0075367_10022708 3300006178 Bacteria 3522
317 Ga0075366_10009259 3300006195 Bacteria 5498
318 Ga0097621_100004326 3300006237 Bacteria 9865
319 Ga0097621_100177381 3300006237 Bacteria 1840
320 Ga0097621_100349566 3300006237 Bacteria 1314
321 Ga0068871_100000098 3300006358 Bacteria 51943
322 Ga0068871_100082631 3300006358 Bacteria 2664
323 Ga0068871_100102265 3300006358 Bacteria 2402
324 Ga0068871_100488259 3300006358 Bacteria 1109
325 Ga0075428_100005458 3300006844 Bacteria 14138
326 Ga0075428_100111253 3300006844 Bacteria 2984
327 Ga0075428_100138696 3300006844 Bacteria 2644
328 Ga0075430_100024628 3300006846 Bacteria 5120
329 Ga0075430_100395765 3300006846 Bacteria 1140
330 Ga0075430_100461322 3300006846 Bacteria 1048
331 Ga0075430_100569942 3300006846 Bacteria 934
332 Ga0075431_100283699 3300006847 Bacteria 1677
333 Ga0075431_100963738 3300006847 Bacteria 821
334 Ga0075433_10116251 3300006852 Bacteria 2373
335 Ga0075433_10206884 3300006852 Bacteria 1745
336 Ga0075433_10292703 3300006852 Bacteria 1442
337 Ga0075433_10554021 3300006852 Bacteria 1011
338 Ga0075434_100004091 3300006871 Bacteria 13080
339 Ga0075434_100004302 3300006871 Bacteria 12793
340 Ga0075434_100013572 3300006871 Bacteria 7761
341 Ga0075434_100187823 3300006871 Bacteria 2087
342 Ga0075434_100219450 3300006871 Bacteria 1921
343 Ga0075434_100287566 3300006871 Bacteria 1664
344 Ga0075434_100429268 3300006871 Bacteria 1343
345 Ga0075434_100829070 3300006871 Bacteria 941
346 Ga0075434_101082225 3300006871 Bacteria 815
347 Ga0075429_100040651 3300006880 Bacteria 4049
348 Ga0075429_100129439 3300006880 Bacteria 2208
349 Ga0068865_100112413 3300006881 Bacteria 2012
350 Ga0068865_100144097 3300006881 Bacteria 1800
351 Ga0068865_100243968 3300006881 Bacteria 1415
352 Ga0068865_100319979 3300006881 Bacteria 1247
353 Ga0068865_100411660 3300006881 Bacteria 1110
354 Ga0068865_100462453 3300006881 Bacteria 1051
355 Ga0068865_100598356 3300006881 Bacteria 932
356 Ga0075436_100001611 3300006914 Bacteria 15434
357 Ga0075436_100002762 3300006914 Bacteria 12054
358 Ga0075436_100014628 3300006914 Bacteria 5378
359 Ga0075436_100259068 3300006914 Bacteria 1240
360 Ga0097620_100034013 3300006931 Bacteria 5117
361 Ga0097620_100245666 3300006931 Bacteria 1879
362 Ga0097620_100376792 3300006931 Bacteria 1515
363 Ga0097620_100451349 3300006931 Bacteria 1382
364 Ga0097620_100755004 3300006931 Bacteria 1062
365 Ga0075435_100003383 3300007076 Bacteria 10817
366 Ga0075435_100008638 3300007076 Bacteria 7322
367 Ga0075435_100011180 3300007076 Bacteria 6586
368 Ga0075435_100086158 3300007076 Bacteria 2586
369 Ga0075435_100101240 3300007076 Bacteria 2387
370 Ga0075435_100432123 3300007076 Bacteria 1134
371 Ga0105250_10015032 3300009092 Bacteria 3172
372 Ga0105240_10015234 3300009093 Bacteria 10461
373 Ga0105240_10170198 3300009093 Bacteria 2581
374 Ga0105240_10238496 3300009093 Bacteria 2109
375 Ga0105240_10289334 3300009093 Bacteria 1879
376 Ga0111539_10004483 3300009094 Bacteria 18262
377 Ga0111539_10015915 3300009094 Bacteria 9341
378 Ga0111539_10016073 3300009094 Bacteria 9288
379 Ga0111539_10033880 3300009094 Bacteria 6197
380 Ga0111539_10212514 3300009094 Bacteria 2254
381 Ga0111539_10476252 3300009094 Bacteria 1454
382 Ga0105245_10000849 3300009098 Bacteria 27700
383 Ga0105245_10014895 3300009098 Bacteria 6773
384 Ga0105245_10021132 3300009098 Bacteria 5708
385 Ga0105245_10094899 3300009098 Bacteria 2750
386 Ga0105245_10113502 3300009098 Bacteria 2523
387 Ga0105245_10172767 3300009098 Bacteria 2059
388 Ga0105245_10249285 3300009098 Bacteria 1724
389 Ga0105245_10362526 3300009098 Bacteria 1439
390 Ga0105245_10393290 3300009098 Bacteria 1384
391 Ga0105245_10520023 3300009098 Bacteria 1208
392 Ga0105245_10772006 3300009098 Bacteria 998
393 Ga0105245_10866365 3300009098 Bacteria 944
394 Ga0105247_10000104 3300009101 Bacteria 90342
395 Ga0105247_10051571 3300009101 Bacteria 2534
396 Ga0114129_10049600 3300009147 Bacteria 5897
397 Ga0114129_10085007 3300009147 Bacteria 4390
398 Ga0114129_10204091 3300009147 Bacteria 2675
399 Ga0114129_11154630 3300009147 Bacteria 967
400 Ga0114129_11676300 3300009147 Bacteria 776
401 Ga0105243_10001938 3300009148 Bacteria 17625
402 Ga0105243_10013014 3300009148 Bacteria 6286
403 Ga0105243_10165890 3300009148 Bacteria 1908
404 Ga0105243_10186336 3300009148 Bacteria 1809
405 Ga0105243_10349557 3300009148 Bacteria 1357
406 Ga0105243_10526722 3300009148 Bacteria 1125
407 Ga0105243_10570177 3300009148 Bacteria 1085
408 Ga0105243_10594212 3300009148 Bacteria 1065
409 Ga0105243_10713136 3300009148 Bacteria 979
410 Ga0105243_11439924 3300009148 Bacteria 711
411 Ga0105243_11540731 3300009148 Bacteria 690
412 Ga0105241_10001545 3300009174 Bacteria 17642
413 Ga0105241_10044583 3300009174 Bacteria 3361
414 Ga0105241_10121293 3300009174 Bacteria 2105
415 Ga0105241_10144058 3300009174 Bacteria 1943
416 Ga0105241_11362001 3300009174 Bacteria 678
417 Ga0105242_10025418 3300009176 Bacteria 4687
418 Ga0105242_10026845 3300009176 Bacteria 4567
419 Ga0105242_10053221 3300009176 Bacteria 3305
420 Ga0105242_10064698 3300009176 Bacteria 3015
421 Ga0105242_10273755 3300009176 Bacteria 1530
422 Ga0105242_11178556 3300009176 Bacteria 784
423 Ga0105248_10020173 3300009177 Bacteria 7384
424 Ga0105248_10199689 3300009177 Bacteria 2253
425 Ga0105248_10288796 3300009177 Bacteria 1847
426 Ga0105248_10306725 3300009177 Bacteria 1788
427 Ga0105248_10515333 3300009177 Bacteria 1348
428 Ga0105248_10544370 3300009177 Bacteria 1309
429 Ga0105248_10616511 3300009177 Bacteria 1224
430 Ga0105237_10000477 3300009545 Bacteria 56910
431 Ga0105237_10038264 3300009545 Bacteria 4844
432 Ga0105237_10275733 3300009545 Bacteria 1684
433 Ga0105237_10389096 3300009545 Bacteria 1399
434 Ga0105237_10620848 3300009545 Bacteria 1088
435 Ga0105238_10003296 3300009551 Bacteria 16122
436 Ga0105238_10028919 3300009551 Bacteria 5646
437 Ga0105238_10082598 3300009551 Bacteria 3202
438 Ga0105249_10000482 3300009553 Bacteria 37079
439 Ga0105249_10013812 3300009553 Bacteria 7136
440 Ga0105249_10027388 3300009553 Bacteria 5142
441 Ga0105249_10117370 3300009553 Bacteria 2524
442 Ga0105249_10119279 3300009553 Bacteria 2505
443 Ga0105249_10172754 3300009553 Bacteria 2097
444 Ga0105249_10393711 3300009553 Bacteria 1414
445 Ga0105249_10787344 3300009553 Bacteria 1014
446 Ga0105239_10002042 3300010375 Bacteria 26177
447 Ga0105239_10153954 3300010375 Bacteria 2567
448 Ga0105239_10166621 3300010375 Bacteria 2464
449 Ga0105239_10212834 3300010375 Bacteria 2167
450 Ga0105239_10221068 3300010375 Bacteria 2124
451 Ga0105239_10426427 3300010375 Bacteria 1503
452 Ga0105239_10772623 3300010375 Bacteria 1100
453 Ga0105239_10826452 3300010375 Bacteria 1062
454 Ga0105239_10886529 3300010375 Bacteria 1024
455 Ga0105239_11545387 3300010375 Bacteria 767
456 Ga0105246_10000541 3300011119 Bacteria 20751
457 Ga0105246_10013171 3300011119 Bacteria 5178
458 Ga0105246_10119238 3300011119 Bacteria 1952
459 Ga0105246_10190082 3300011119 Bacteria 1589
460 Ga0157328_1012736 3300012478 Bacteria 615
461 Ga0157321_1002465 3300012487 Bacteria 1034
462 Ga0157329_1010813 3300012491 Bacteria 721
463 Ga0157342_1026908 3300012507 Bacteria 703
464 Ga0157373_10000785 3300013100 Bacteria 24448
465 Ga0157373_10408270 3300013100 Bacteria 974
466 Ga0157371_10000392 3300013102 Bacteria 55061
467 Ga0157371_10104947 3300013102 Bacteria 2005
468 Ga0157371_10456271 3300013102 Bacteria 940
469 Ga0157370_10100783 3300013104 Bacteria 2706
470 Ga0157370_10403256 3300013104 Bacteria 1258
471 Ga0157370_10655170 3300013104 Bacteria 960
472 Ga0157369_10000538 3300013105 Bacteria 50087
473 Ga0157369_10011849 3300013105 Bacteria 9904
474 Ga0157369_10226764 3300013105 Bacteria 1954
475 Ga0157369_10331436 3300013105 Bacteria 1581
476 Ga0157369_10712832 3300013105 Bacteria 1033
477 Ga0157374_10000442 3300013296 Bacteria 37639
478 Ga0157374_10019586 3300013296 Bacteria 5990
479 Ga0157374_10031749 3300013296 Bacteria 4804
480 Ga0157374_10065260 3300013296 Bacteria 3418
481 Ga0157374_10550561 3300013296 Bacteria 1161
482 Ga0157378_10000974 3300013297 Bacteria 26210
483 Ga0157378_10037769 3300013297 Bacteria 4280
484 Ga0157378_10077747 3300013297 Bacteria 2992
485 Ga0157378_10440496 3300013297 Bacteria 1291
486 Ga0157378_10743843 3300013297 Bacteria 1003
487 Ga0157378_10837217 3300013297 Bacteria 948
488 Ga0157378_11263573 3300013297 Bacteria 779
489 Ga0163162_10000521 3300013306 Bacteria 35677
490 Ga0163162_10018138 3300013306 Bacteria 6890
491 Ga0163162_10028521 3300013306 Bacteria 5524
492 Ga0163162_10122773 3300013306 Bacteria 2702
493 Ga0163162_10312379 3300013306 Bacteria 1704
494 Ga0163162_10655684 3300013306 Bacteria 1173
495 Ga0163162_12167155 3300013306 Bacteria 638
496 Ga0157372_10000634 3300013307 Bacteria 38527
497 Ga0157372_10012974 3300013307 Bacteria 8888
498 Ga0157372_10084223 3300013307 Bacteria 3603
499 Ga0157372_10120458 3300013307 Bacteria 3013
500 Ga0157372_10345920 3300013307 Bacteria 1732
501 Ga0157375_10000441 3300013308 Bacteria 37587
502 Ga0157375_10081109 3300013308 Bacteria 3284
503 Ga0157375_10294437 3300013308 Bacteria 1786
504 Ga0157375_10939616 3300013308 Bacteria 1007
505 Ga0157375_11019559 3300013308 Bacteria 967
506 Ga0163163_10001584 3300014325 Bacteria 19127
507 Ga0163163_10009378 3300014325 Bacteria 8736
508 Ga0163163_10270577 3300014325 Bacteria 1750
509 Ga0163163_10338406 3300014325 Bacteria 1560
510 Ga0163163_10384180 3300014325 Bacteria 1462
511 Ga0163163_10694992 3300014325 Bacteria 1081
512 Ga0157380_10074228 3300014326 Bacteria 2760
513 Ga0157380_10092789 3300014326 Bacteria 2496
514 Ga0157380_10782167 3300014326 Bacteria 969
515 Ga0182008_10214597 3300014497 Bacteria 983
516 Ga0182008_10344866 3300014497 Bacteria 789
517 Ga0157377_10000187 3300014745 Bacteria 35834
518 Ga0157377_10008185 3300014745 Bacteria 5087
519 Ga0157377_10035073 3300014745 Bacteria 2749
520 Ga0157377_10046413 3300014745 Bacteria 2430
521 Ga0157377_10116265 3300014745 Bacteria 1615
522 Ga0157377_10131718 3300014745 Bacteria 1528
523 Ga0157377_10619585 3300014745 Bacteria 774
524 Ga0157379_10000098 3300014968 Bacteria 59060
525 Ga0157379_10449395 3300014968 Bacteria 1189
526 Ga0157379_10550758 3300014968 Bacteria 1073
527 Ga0157379_10737352 3300014968 Bacteria 927
528 Ga0157379_11164608 3300014968 Bacteria 740
529 Ga0157376_10000379 3300014969 Bacteria 29029
530 Ga0157376_10027031 3300014969 Bacteria 4543
531 Ga0157376_10149254 3300014969 Bacteria 2106
532 Ga0157376_10227182 3300014969 Bacteria 1732
533 Ga0157376_10239553 3300014969 Bacteria 1690
534 Ga0157376_10247852 3300014969 Bacteria 1662
535 Ga0157376_10357952 3300014969 Bacteria 1399
536 Ga0157376_10602461 3300014969 Bacteria 1094
537 Ga0157376_11240889 3300014969 Bacteria 774
538 Ga0157376_12481369 3300014969 Bacteria 558
539 Ga0163161_10008814 3300017792 Bacteria 6973
540 Ga0163161_10033749 3300017792 Bacteria 3657
541 Ga0163161_10161760 3300017792 Bacteria 1707
542 Ga0224712_10006500 3300022467 Bacteria 3339
543 Ga0207697_10004773 3300025315 Bacteria 6414
544 Ga0207697_10145097 3300025315 Bacteria 1031
545 Ga0207697_10267863 3300025315 Bacteria 757
546 Ga0207656_10114321 3300025321 Bacteria 1250
547 Ga0207656_10163562 3300025321 Bacteria 1060
548 Ga0207682_10003048 3300025893 Bacteria 7354
549 Ga0207692_10035754 3300025898 Bacteria 2416
550 Ga0207642_10003181 3300025899 Bacteria 5154
551 Ga0207642_10023382 3300025899 Bacteria 2468
552 Ga0207642_10344990 3300025899 Bacteria 877
553 Ga0207710_10021697 3300025900 Bacteria 2754
554 Ga0207710_10271541 3300025900 Bacteria 852
555 Ga0207688_10000100 3300025901 Bacteria 34208
556 Ga0207688_10073986 3300025901 Bacteria 1937
557 Ga0207688_10208345 3300025901 Bacteria 1174
558 Ga0207680_10050256 3300025903 Bacteria 2486
559 Ga0207647_10004487 3300025904 Bacteria 10341
560 Ga0207685_10088473 3300025905 Bacteria 1298
561 Ga0207699_10134473 3300025906 Bacteria 1617
562 Ga0207645_10007893 3300025907 Bacteria 7483
563 Ga0207645_10077687 3300025907 Bacteria 2127
564 Ga0207643_10000002 3300025908 Bacteria 224909
565 Ga0207643_10244368 3300025908 Bacteria 1104
566 Ga0207705_10052380 3300025909 Bacteria 2938
567 Ga0207684_10218921 3300025910 Bacteria 1643
568 Ga0207684_10739094 3300025910 Bacteria 834
569 Ga0207684_11140060 3300025910 Bacteria 648
570 Ga0207654_10016967 3300025911 Bacteria 3800
571 Ga0207654_10287002 3300025911 Bacteria 1115
572 Ga0207654_10365878 3300025911 Bacteria 996
573 Ga0207707_10186544 3300025912 Bacteria 1810
574 Ga0207707_10240565 3300025912 Bacteria 1574
575 Ga0207695_10017662 3300025913 Bacteria 8288
576 Ga0207695_10150956 3300025913 Bacteria 2263
577 Ga0207695_10815178 3300025913 Bacteria 813
578 Ga0207671_10000756 3300025914 Bacteria 41002
579 Ga0207671_10092126 3300025914 Bacteria 2285
580 Ga0207671_10258728 3300025914 Bacteria 1369
581 Ga0207693_10007894 3300025915 Bacteria 8740
582 Ga0207693_10014148 3300025915 Bacteria 6426
583 Ga0207693_10217170 3300025915 Bacteria 1502
584 Ga0207693_10302739 3300025915 Bacteria 1252
585 Ga0207663_10009042 3300025916 Bacteria 5246
586 Ga0207663_10016959 3300025916 Bacteria 4049
587 Ga0207660_10011918 3300025917 Bacteria 5673
588 Ga0207660_10041554 3300025917 Bacteria 3223
589 Ga0207660_10416144 3300025917 Bacteria 1084
590 Ga0207662_10000011 3300025918 Bacteria 90777
591 Ga0207662_10187678 3300025918 Bacteria 1333
592 Ga0207662_10225226 3300025918 Bacteria 1223
593 Ga0207657_10000323 3300025919 Bacteria 50878
594 Ga0207657_10007381 3300025919 Bacteria 11277
595 Ga0207657_10150928 3300025919 Bacteria 1893
596 Ga0207649_10004231 3300025920 Bacteria 7820
597 Ga0207649_10034225 3300025920 Bacteria 3042
598 Ga0207652_10031128 3300025921 Bacteria 4478
599 Ga0207652_10186785 3300025921 Bacteria 1864
600 Ga0207652_10321993 3300025921 Bacteria 1396
601 Ga0207652_10677548 3300025921 Bacteria 921
602 Ga0207652_10854772 3300025921 Bacteria 805
603 Ga0207646_10398511 3300025922 Bacteria 1243
604 Ga0207681_10000108 3300025923 Bacteria 71434
605 Ga0207694_10002995 3300025924 Bacteria 13544
606 Ga0207694_10058043 3300025924 Bacteria 3010
607 Ga0207650_10000349 3300025925 Bacteria 44570
608 Ga0207650_10007816 3300025925 Bacteria 7285
609 Ga0207659_10000123 3300025926 Bacteria 45421
610 Ga0207659_10000241 3300025926 Bacteria 33277
611 Ga0207659_10186685 3300025926 Bacteria 1647
612 Ga0207659_10256197 3300025926 Bacteria 1422
613 Ga0207659_10332571 3300025926 Bacteria 1256
614 Ga0207687_10003500 3300025927 Bacteria 10561
615 Ga0207687_10006344 3300025927 Bacteria 7816
616 Ga0207687_10015379 3300025927 Bacteria 5016
617 Ga0207687_10152675 3300025927 Bacteria 1764
618 Ga0207687_10158482 3300025927 Bacteria 1734
619 Ga0207687_10244862 3300025927 Bacteria 1423
620 Ga0207687_10303368 3300025927 Bacteria 1287
621 Ga0207687_10515905 3300025927 Bacteria 999
622 Ga0207700_10041931 3300025928 Bacteria 3352
623 Ga0207700_10155720 3300025928 Bacteria 1893
624 Ga0207700_10379969 3300025928 Bacteria 1235
625 Ga0207664_10002473 3300025929 Bacteria 12235
626 Ga0207664_10327935 3300025929 Bacteria 1351
627 Ga0207664_10896791 3300025929 Bacteria 796
628 Ga0207664_11074045 3300025929 Bacteria 720
629 Ga0207644_10002199 3300025931 Bacteria 12647
630 Ga0207644_10681245 3300025931 Bacteria 857
631 Ga0207690_10001018 3300025932 Bacteria 17940
632 Ga0207690_10002378 3300025932 Bacteria 11401
633 Ga0207690_10077677 3300025932 Bacteria 2308
634 Ga0207690_10124969 3300025932 Bacteria 1874
635 Ga0207690_10215928 3300025932 Bacteria 1465
636 Ga0207706_10000078 3300025933 Bacteria 100847
637 Ga0207706_10008012 3300025933 Bacteria 9751
638 Ga0207706_10021316 3300025933 Bacteria 5822
639 Ga0207706_10054711 3300025933 Bacteria 3521
640 Ga0207706_10358730 3300025933 Bacteria 1266
641 Ga0207686_10044632 3300025934 Bacteria 2723
642 Ga0207686_10057304 3300025934 Bacteria 2452
643 Ga0207686_10101386 3300025934 Bacteria 1923
644 Ga0207686_10201471 3300025934 Bacteria 1426
645 Ga0207686_10667105 3300025934 Bacteria 824
646 Ga0207709_10003349 3300025935 Bacteria 9587
647 Ga0207709_10041105 3300025935 Bacteria 2773
648 Ga0207709_10123285 3300025935 Bacteria 1754
649 Ga0207709_10144666 3300025935 Bacteria 1639
650 Ga0207709_10233448 3300025935 Bacteria 1334
651 Ga0207709_10252863 3300025935 Bacteria 1288
652 Ga0207709_10325377 3300025935 Bacteria 1152
653 Ga0207670_10000399 3300025936 Bacteria 25002
654 Ga0207670_10052217 3300025936 Bacteria 2748
655 Ga0207670_10188671 3300025936 Bacteria 1558
656 Ga0207669_10021798 3300025937 Bacteria 3389
657 Ga0207704_10000264 3300025938 Bacteria 25198
658 Ga0207704_10010376 3300025938 Bacteria 4542
659 Ga0207704_10069954 3300025938 Bacteria 2220
660 Ga0207704_10072413 3300025938 Bacteria 2190
661 Ga0207704_10082832 3300025938 Bacteria 2080
662 Ga0207704_10273109 3300025938 Bacteria 1281
663 Ga0207665_10043153 3300025939 Bacteria 3015
664 Ga0207665_10184889 3300025939 Bacteria 1511
665 Ga0207691_10000389 3300025940 Bacteria 43983
666 Ga0207691_10108646 3300025940 Bacteria 2468
667 Ga0207691_10407097 3300025940 Bacteria 1160
668 Ga0207711_10000261 3300025941 Bacteria 57333
669 Ga0207711_10148212 3300025941 Bacteria 2115
670 Ga0207711_10170695 3300025941 Bacteria 1973
671 Ga0207711_10215632 3300025941 Bacteria 1754
672 Ga0207689_10011980 3300025942 Bacteria 7433
673 Ga0207689_10085658 3300025942 Bacteria 2590
674 Ga0207689_10396616 3300025942 Bacteria 1150
675 Ga0207689_10721332 3300025942 Bacteria 841
676 Ga0207661_10003584 3300025944 Bacteria 10801
677 Ga0207661_10016225 3300025944 Bacteria 5493
678 Ga0207661_10020944 3300025944 Bacteria 4896
679 Ga0207661_10042739 3300025944 Bacteria 3574
680 Ga0207661_10056126 3300025944 Bacteria 3161
681 Ga0207661_10090151 3300025944 Bacteria 2552
682 Ga0207661_10247823 3300025944 Bacteria 1582
683 Ga0207661_10253727 3300025944 Bacteria 1564
684 Ga0207661_10364887 3300025944 Bacteria 1305
685 Ga0207661_10955460 3300025944 Bacteria 789
686 Ga0207661_11548362 3300025944 Bacteria 607
687 Ga0207679_10000445 3300025945 Bacteria 29158
688 Ga0207679_10012745 3300025945 Bacteria 5492
689 Ga0207679_10034514 3300025945 Bacteria 3570
690 Ga0207679_10129309 3300025945 Bacteria 2024
691 Ga0207679_10516589 3300025945 Bacteria 1068
692 Ga0207679_10845596 3300025945 Bacteria 836
693 Ga0207667_10017984 3300025949 Bacteria 7939
694 Ga0207667_10048059 3300025949 Bacteria 4513
695 Ga0207667_10107721 3300025949 Bacteria 2875
696 Ga0207667_10158173 3300025949 Bacteria 2331
697 Ga0207667_11252481 3300025949 Bacteria 720
698 Ga0207651_10000020 3300025960 Bacteria 83049
699 Ga0207651_10000299 3300025960 Bacteria 21268
700 Ga0207651_10352547 3300025960 Bacteria 1240
701 Ga0207651_10500548 3300025960 Bacteria 1050
702 Ga0207712_10001949 3300025961 Bacteria 13547
703 Ga0207712_10089073 3300025961 Bacteria 2268
704 Ga0207712_10293861 3300025961 Bacteria 1331
705 Ga0207712_10309093 3300025961 Bacteria 1300
706 Ga0207712_10690146 3300025961 Bacteria 890
707 Ga0207712_10918192 3300025961 Bacteria 774
708 Ga0207668_10004402 3300025972 Bacteria 8274
709 Ga0207668_10020561 3300025972 Bacteria 4196
710 Ga0207668_10213466 3300025972 Bacteria 1545
711 Ga0207668_10650131 3300025972 Bacteria 923
712 Ga0207668_10828457 3300025972 Bacteria 820
713 Ga0207668_10886534 3300025972 Bacteria 793
714 Ga0207640_10000302 3300025981 Bacteria 32782
715 Ga0207640_10066202 3300025981 Bacteria 2413
716 Ga0207640_10473582 3300025981 Bacteria 1037
717 Ga0207640_10771839 3300025981 Unclassified 830
718 Ga0207658_10000437 3300025986 Bacteria 39386
719 Ga0207677_10000079 3300026023 Bacteria 79753
720 Ga0207677_10036202 3300026023 Bacteria 3214
721 Ga0207677_10046113 3300026023 Bacteria 2916
722 Ga0207677_10069828 3300026023 Bacteria 2472
723 Ga0207677_10133478 3300026023 Bacteria 1889
724 Ga0207677_10315266 3300026023 Bacteria 1297
725 Ga0207677_10531098 3300026023 Bacteria 1022
726 Ga0207703_10000148 3300026035 Bacteria 81341
727 Ga0207703_10000236 3300026035 Bacteria 62877
728 Ga0207703_10338889 3300026035 Bacteria 1381
729 Ga0207639_10007421 3300026041 Bacteria 7477
730 Ga0207639_10148963 3300026041 Bacteria 1958
731 Ga0207678_10013591 3300026067 Bacteria 7151
732 Ga0207678_10077494 3300026067 Bacteria 2847
733 Ga0207678_10124500 3300026067 Bacteria 2199
734 Ga0207678_10157217 3300026067 Bacteria 1941
735 Ga0207678_10282643 3300026067 Bacteria 1424
736 Ga0207678_10404937 3300026067 Bacteria 1181
737 Ga0207708_10004867 3300026075 Bacteria 9902
738 Ga0207708_10004939 3300026075 Bacteria 9829
739 Ga0207708_10004986 3300026075 Bacteria 9775
740 Ga0207708_10178169 3300026075 Bacteria 1687
741 Ga0207708_10296808 3300026075 Bacteria 1313
742 Ga0207708_10344007 3300026075 Bacteria 1222
743 Ga0207708_10462649 3300026075 Bacteria 1058
744 Ga0207708_10752383 3300026075 Bacteria 836
745 Ga0207702_10002160 3300026078 Bacteria 18887
746 Ga0207702_10017281 3300026078 Bacteria 5969
747 Ga0207702_10042912 3300026078 Bacteria 3795
748 Ga0207702_10066413 3300026078 Bacteria 3091
749 Ga0207702_10075193 3300026078 Bacteria 2917
750 Ga0207702_10325588 3300026078 Bacteria 1465
751 Ga0207702_10453594 3300026078 Bacteria 1244
752 Ga0207702_10499025 3300026078 Bacteria 1186
753 Ga0207641_10001330 3300026088 Bacteria 24463
754 Ga0207641_10725696 3300026088 Bacteria 980
755 Ga0207648_10000497 3300026089 Bacteria 43780
756 Ga0207648_10029813 3300026089 Bacteria 4837
757 Ga0207648_10053203 3300026089 Bacteria 3539
758 Ga0207648_10377428 3300026089 Bacteria 1282
759 Ga0207676_10000341 3300026095 Bacteria 40111
760 Ga0207676_10179816 3300026095 Bacteria 1851
761 Ga0207676_10289914 3300026095 Bacteria 1490
762 Ga0207674_10000427 3300026116 Bacteria 54893
763 Ga0207674_10006518 3300026116 Bacteria 13720
764 Ga0207674_10010865 3300026116 Bacteria 10261
765 Ga0207674_10017099 3300026116 Bacteria 7917
766 Ga0207674_10051126 3300026116 Bacteria 4218
767 Ga0207674_10057175 3300026116 Bacteria 3955
768 Ga0207674_10086643 3300026116 Bacteria 3126
769 Ga0207674_10693155 3300026116 Bacteria 983
770 Ga0207675_100000006 3300026118 Bacteria 189749
771 Ga0207675_100000913 3300026118 Bacteria 29474
772 Ga0207675_100019453 3300026118 Bacteria 6335
773 Ga0207675_100257467 3300026118 Bacteria 1690
774 Ga0207675_100420993 3300026118 Bacteria 1319
775 Ga0207683_10000933 3300026121 Bacteria 26889
776 Ga0207683_10055645 3300026121 Bacteria 3469
777 Ga0207683_10088971 3300026121 Bacteria 2748
778 Ga0207683_10275573 3300026121 Bacteria 1537
779 Ga0207683_10314418 3300026121 Bacteria 1434
780 Ga0207683_10384397 3300026121 Bacteria 1290
781 Ga0207698_10000914 3300026142 Bacteria 17166
782 Ga0207698_10069122 3300026142 Bacteria 2791
783 Ga0207698_10187928 3300026142 Bacteria 1837
784 Ga0207698_10572108 3300026142 Bacteria 1110
785 Ga0207698_10651531 3300026142 Bacteria 1043
786 Ga0207698_11412476 3300026142 Unclassified 711
787 Ga0207698_11521014 3300026142 Bacteria 685
788 Ga0209998_10015633 3300027717 Bacteria 1591
789 Ga0209813_10036894 3300027866 Bacteria 1470
790 Ga0207428_10003755 3300027907 Bacteria 14580
791 Ga0207428_10034447 3300027907 Bacteria 4149
792 Ga0207428_10062017 3300027907 Bacteria 2957
793 Ga0207428_10101461 3300027907 Bacteria 2223
794 Ga0268266_10000687 3300028379 Bacteria 45601
795 Ga0268266_10191032 3300028379 Bacteria 1870
796 Ga0268266_10276433 3300028379 Bacteria 1560
797 Ga0268266_10306923 3300028379 Bacteria 1482
798 Ga0268265_10000340 3300028380 Bacteria 50814
799 Ga0268265_10060726 3300028380 Bacteria 2898
800 Ga0268265_10111584 3300028380 Bacteria 2234
801 Ga0268265_10495546 3300028380 Bacteria 1150
802 Ga0268264_10000705 3300028381 Bacteria 38562
803 Ga0268264_10303553 3300028381 Bacteria 1504
804 Ga0265338_10125319 3300028800 Bacteria 2039
805 Ga0265328_10172822 3300031239 Bacteria 816
806 Ga0265325_10118906 3300031241 Bacteria 1276
807 Ga0265339_10409453 3300031249 Bacteria 633
808 Ga0265331_10235257 3300031250 Unclassified 822
809 Ga0265327_10000388 3300031251 Bacteria 82847
810 Ga0265327_10002718 3300031251 Bacteria 18093
811 Ga0265327_10019109 3300031251 Bacteria 4225
812 Ga0265327_10168001 3300031251 Bacteria 1009
813 Ga0265316_10002997 3300031344 Bacteria 17268
814 Ga0307408_100018577 3300031548 Bacteria 4670
815 Ga0307408_100057959 3300031548 Bacteria 2814
816 Ga0307408_100066364 3300031548 Bacteria 2650
817 Ga0307408_100259321 3300031548 Bacteria 1438
818 Ga0265314_10227853 3300031711 Unclassified 1083
819 Ga0307405_10007364 3300031731 Bacteria 5497
820 Ga0307405_10066382 3300031731 Bacteria 2300
821 Ga0307405_10147644 3300031731 Bacteria 1649
822 Ga0307413_10006153 3300031824 Bacteria 5449
823 Ga0307413_10325996 3300031824 Bacteria 1175
824 Ga0307413_11424262 3300031824 Bacteria 610
825 Ga0307410_10001018 3300031852 Bacteria 12147
826 Ga0307410_10039370 3300031852 Bacteria 3103
827 Ga0307406_10013626 3300031901 Bacteria 4661
828 Ga0307406_10028069 3300031901 Bacteria 3397
829 Ga0307406_10130643 3300031901 Bacteria 1762
830 Ga0307406_10382217 3300031901 Bacteria 1110
831 Ga0307406_11084648 3300031901 Bacteria 691
832 Ga0307407_10032545 3300031903 Bacteria 2836
833 Ga0307407_10055570 3300031903 Bacteria 2288
834 Ga0307407_10181384 3300031903 Bacteria 1396
835 Ga0307412_10008538 3300031911 Bacteria 5852
836 Ga0307412_10027022 3300031911 Bacteria 3574
837 Ga0307412_10159099 3300031911 Bacteria 1676
838 Ga0307409_100027617 3300031995 Bacteria 4026
839 Ga0307409_100207385 3300031995 Bacteria 1758
840 Ga0307409_100301192 3300031995 Bacteria 1491
841 Ga0307409_100628401 3300031995 Bacteria 1065
842 Ga0307416_100015861 3300032002 Bacteria 5218
843 Ga0307416_100021279 3300032002 Bacteria 4652
844 Ga0307416_100099034 3300032002 Bacteria 2530
845 Ga0307416_100385979 3300032002 Bacteria 1432
846 Ga0307414_10105005 3300032004 Bacteria 2135
847 Ga0307411_10031761 3300032005 Bacteria 3254
848 Ga0307411_10513613 3300032005 Bacteria 1015
849 Ga0307411_10617531 3300032005 Bacteria 934
850 Ga0307415_100000172 3300032126 Bacteria 28799
851 Ga0307415_100011216 3300032126 Bacteria 5116
852 Ga0307415_100217280 3300032126 Bacteria 1530
853 Ga0307415_100348511 3300032126 Bacteria 1245
854 Ga0307415_100375053 3300032126 Bacteria 1206
855 Ga0307415_101254367 3300032126 Bacteria 700
856 Ga0373958_0035826 3300034819 Bacteria 995
857 Ga0373934_0273160 3300035086 Bacteria 700
858 Ga0373949_0119686 3300035090 Bacteria 738
859 Ga0373923_0190597 3300035111 Bacteria 945
860 Ga0373945_0031758 3300035116 Bacteria 1867
861 Ga0373953_0077814 3300035117 Bacteria 1375
862 Ga0373954_0034072 3300035118 Bacteria 2357
863 Ga0373956_0007002 3300035119 Bacteria 4531
864 Ga0373956_0060070 3300035119 Bacteria 1721
865 Ga0373960_0074633 3300035121 Bacteria 1056
866 Ga0373960_0118361 3300035121 Bacteria 877
867 Ga0373943_0006737 3300035170 Bacteria 5157
868 Ga0373943_0104588 3300035170 Bacteria 1485
869 Ga0373946_0001734 3300035171 Bacteria 7605
870 Ga0373946_0568611 3300035171 Bacteria 586
871 Ga0373955_0012109 3300035172 Bacteria 4138
872 Ga0373955_0087630 3300035172 Bacteria 1770
873 Ga0373961_0082494 3300035241 Bacteria 1014
874 Ga0316574_0011134 3300035398 Bacteria 5103
875 Ga0373924_0285466 3300035410 Bacteria 732
876 Ga0373931_0143126 3300035691 Bacteria 1387
877 Ga0373931_0217052 3300035691 Bacteria 1150
878 Ga0373935_0016894 3300035692 Bacteria 4419
879 Ga0373927_0028499 3300035695 Bacteria 3643
880 Ga0373933_0102482 3300035724 Bacteria 1777
881 Ga0373947_0012589 3300035725 Bacteria 4849
882 Ga0373947_0076631 3300035725 Bacteria 2061
883 Ga0373937_0004887 3300036401 Bacteria 11394
884 Ga0373937_0012607 3300036401 Bacteria 7439
885 Ga0373937_0306824 3300036401 Bacteria 1501
886 Ga0373937_0336722 3300036401 Bacteria 1429
887 Ga0373937_0462300 3300036401 Bacteria 1205
888 Ga0373925_0115453 3300037068 Bacteria 2079
889 Ga0373925_1157749 3300037068 Bacteria 636
890 Ga0395899_0002123 3300037312 Bacteria 16292
891 Ga0395899_0045080 3300037312 Bacteria 3285
892 Ga0395899_0086100 3300037312 Bacteria 2283
893 Ga0395899_0132351 3300037312 Bacteria 1780
894 Ga0395899_0407213 3300037312 Bacteria 899
895 Ga0395899_0525442 3300037312 Bacteria 764
896 Ga0395900_0003185 3300037418 Bacteria 17778
897 Ga0395900_0021555 3300037418 Bacteria 6588
898 Ga0395900_0044991 3300037418 Bacteria 4546
899 Ga0395900_0062293 3300037418 Bacteria 3834
900 Ga0395900_0076257 3300037418 Bacteria 3446
901 Ga0395900_0183897 3300037418 Bacteria 2122
902 Ga0395900_0189658 3300037418 Bacteria 2086
903 Ga0395900_0222887 3300037418 Bacteria 1900
904 Ga0395900_0437074 3300037418 Bacteria 1267
905 Ga0395900_0457855 3300037418 Bacteria 1231
906 Ga0395900_0634219 3300037418 Bacteria 1006
907 Ga0395898_0002613 3300037466 Bacteria 20969
908 Ga0395898_0005219 3300037466 Bacteria 14045
909 Ga0395898_0025363 3300037466 Bacteria 5974
910 Ga0395898_0031725 3300037466 Bacteria 5277
911 Ga0395898_0230719 3300037466 Bacteria 1765
912 Ga0395898_0237782 3300037466 Bacteria 1737
913 Ga0395898_0266177 3300037466 Bacteria 1635
914 Ga0395898_0286919 3300037466 Bacteria 1570
915 Ga0395898_0404140 3300037466 Bacteria 1302
916 Ga0395898_0491938 3300037466 Bacteria 1167
917 Ga0395898_0732663 3300037466 Unclassified 930
918 Ga0395898_1164516 3300037466 Bacteria 703
919 Ga0395905_0001212 3300037471 Bacteria 32180
920 Ga0395905_0013225 3300037471 Bacteria 7919
921 Ga0395905_0023832 3300037471 Bacteria 5778
922 Ga0395905_0039611 3300037471 Bacteria 4421
923 Ga0395905_0054704 3300037471 Bacteria 3735
924 Ga0395905_0057239 3300037471 Bacteria 3647
925 Ga0395905_0156721 3300037471 Bacteria 2142
926 Ga0395905_0226200 3300037471 Bacteria 1750
927 Ga0395905_0391383 3300037471 Bacteria 1284
928 Ga0395901_0001100 3300038443 Bacteria 28754
929 Ga0395901_0001850 3300038443 Bacteria 21884
930 Ga0395901_0017959 3300038443 Bacteria 7221
931 Ga0395901_0028844 3300038443 Bacteria 5708
932 Ga0395901_0049465 3300038443 Bacteria 4367
933 Ga0395901_0061814 3300038443 Bacteria 3897
934 Ga0395901_0083391 3300038443 Bacteria 3341
935 Ga0395901_0086190 3300038443 Bacteria 3284
936 Ga0395901_0395695 3300038443 Bacteria 1420
937 Ga0395901_0442172 3300038443 Bacteria 1331
938 Ga0395901_0714664 3300038443 Bacteria 998
939 Ga0395901_0745556 3300038443 Bacteria 973
940 Ga0395901_0761923 3300038443 Bacteria 960
941 Ga0395901_1044316 3300038443 Bacteria 790
942 Ga0436363_1083023 3300039450 Bacteria 2863
943 Ga0436363_1085457 3300039450 Bacteria 651
944 Ga0439465_0279201 3300041413 Bacteria 622
945 Ga0451800_0192217 3300041459 Bacteria 1236
946 Ga0439448_0023196 3300042005 Bacteria 1934
947 Ga0439448_0047820 3300042005 Bacteria 1396
948 Ga0439448_0048922 3300042005 Bacteria 1381
949 Ga0439455_0001365 3300042012 Bacteria 4043
950 Ga0439455_0062903 3300042012 Bacteria 987
951 Ga0439456_078650 3300042013 Bacteria 735
952 Ga0450920_024494 3300042122 Bacteria 1173
953 Ga0450894_004432 3300042131 Bacteria 1822
954 Ga0450895_001970 3300042132 Bacteria 1484
955 Ga0450899_005271 3300042135 Bacteria 1389
956 Ga0439434_0016609 3300042435 Bacteria 2200
957 Ga0439464_0037283 3300042439 Bacteria 1379
958 Ga0439460_0072659 3300042461 Bacteria 1068
959 Ga0451577_0011117 3300042876 Bacteria 8542
960 Ga0451577_0021578 3300042876 Bacteria 5891
961 Ga0451577_0034759 3300042876 Bacteria 4542
962 Ga0451577_0048491 3300042876 Bacteria 3794
963 Ga0451577_0054384 3300042876 Bacteria 3573
964 Ga0451577_0127446 3300042876 Bacteria 2281
965 Ga0451577_0250384 3300042876 Bacteria 1603
966 Ga0451577_0337570 3300042876 Bacteria 1367
967 Ga0453683_0012839 3300044673 Bacteria 5481
968 Ga0453683_0143204 3300044673 Bacteria 1509
969 Ga0453683_0145343 3300044673 Bacteria 1497
970 Ga0453683_0480166 3300044673 Bacteria 806
971 Ga0453683_0728694 3300044673 Bacteria 650
972 Ga0466965_0509512 3300044683 Bacteria 676
973 Ga0466963_0135750 3300044694 Bacteria 1702
974 Ga0466964_0079183 3300044706 Bacteria 1407
975 Ga0466964_0287204 3300044706 Bacteria 824
976 Ga0453684_0002243 3300044712 Bacteria 47957
977 Ga0453684_0002411 3300044712 Bacteria 45566
978 Ga0453684_0005904 3300044712 Bacteria 23738
979 Ga0453684_0006913 3300044712 Bacteria 21271
980 Ga0453684_0006931 3300044712 Bacteria 21230
981 Ga0453684_0046007 3300044712 Bacteria 5812
982 Ga0453684_0049727 3300044712 Bacteria 5523
983 Ga0453684_0210021 3300044712 Bacteria 2263
984 Ga0453684_0559665 3300044712 Bacteria 1258
985 Ga0453684_0637014 3300044712 Bacteria 1164
986 Ga0453684_0998711 3300044712 Bacteria 890
987 Ga0466971_0098329 3300044719 Bacteria 1343
988 Ga0466968_0053600 3300044735 Bacteria 1728
989 Ga0466957_0046701 3300044842 Bacteria 2630
990 Ga0466957_0238345 3300044842 Bacteria 1206
991 Ga0466960_0006810 3300044901 Bacteria 4605
992 Ga0466960_0021378 3300044901 Bacteria 2880
993 Ga0466960_0022238 3300044901 Bacteria 2833
994 Ga0451576_0002250 3300045051 Bacteria 29531
995 Ga0451576_0041854 3300045051 Bacteria 4840
996 Ga0451576_0050107 3300045051 Bacteria 4381
997 Ga0451576_0155631 3300045051 Bacteria 2384
998 Ga0451576_0246482 3300045051 Bacteria 1867
999 Ga0451576_0309559 3300045051 Bacteria 1652
1000 Ga0451576_0521466 3300045051 Bacteria 1248
1001 Ga0451576_0586319 3300045051 Bacteria 1172
1002 Ga0451576_0971392 3300045051 Bacteria 890
1003 Ga0451576_1194182 3300045051 Bacteria 794
1004 Ga0466958_0132761 3300045836 Bacteria 1564
1005 Ga0466958_0223549 3300045836 Bacteria 1201
1006 Ga0466958_0428894 3300045836 Bacteria 855
1007 Ga0466967_0020607 3300045976 Bacteria 5334
1008 Ga0466967_0238546 3300045976 Bacteria 1733
1009 Ga0466967_0251176 3300045976 Bacteria 1689
1010 Ga0466967_0307391 3300045976 Bacteria 1526
1011 Ga0495617_036421 3300046452 Bacteria 1650
1012 Ga0495627_140710 3300046453 Bacteria 676
1013 Ga0495603_0015080 3300046455 Bacteria 4674
1014 Ga0495603_0071163 3300046455 Bacteria 2044
1015 Ga0495603_0072656 3300046455 Bacteria 2021
1016 Ga0495603_0088530 3300046455 Bacteria 1812
1017 Ga0495603_0196648 3300046455 Bacteria 1165
1018 Ga0495591_028520 3300046458 Bacteria 1706
1019 Ga0495629_0010124 3300046459 Bacteria 6876
1020 Ga0495629_0034171 3300046459 Bacteria 3594
1021 Ga0495629_0132258 3300046459 Bacteria 1738
1022 Ga0495641_0026985 3300046461 Bacteria 2797
1023 Ga0495641_0030587 3300046461 Bacteria 2580
1024 Ga0495653_0012965 3300046463 Bacteria 6800
1025 Ga0495580_0025973 3300046472 Bacteria 4274
1026 Ga0495580_0648493 3300046472 Bacteria 694
1027 Ga0495582_0099919 3300046473 Bacteria 1624
1028 Ga0495582_0235181 3300046473 Bacteria 1049
1029 Ga0495582_0261920 3300046473 Bacteria 992
1030 Ga0495605_0058579 3300046474 Bacteria 1851
1031 Ga0495605_0087421 3300046474 Bacteria 1449
1032 Ga0495639_0002626 3300046475 Bacteria 7825
1033 Ga0495639_0241962 3300046475 Bacteria 891
1034 Ga0495662_0020694 3300046476 Bacteria 3182
1035 Ga0495662_0265890 3300046476 Bacteria 844
1036 Ga0495584_0025064 3300046491 Bacteria 3024
1037 Ga0495584_0065661 3300046491 Bacteria 1825
1038 Ga0495584_0225306 3300046491 Unclassified 953
1039 Ga0495585_0053537 3300046492 Bacteria 2233
1040 Ga0495594_0008671 3300046499 Bacteria 5240
1041 Ga0495594_0074352 3300046499 Bacteria 1893
1042 Ga0495594_0174705 3300046499 Bacteria 1222
1043 Ga0495594_0283467 3300046499 Bacteria 944
1044 Ga0495594_0380816 3300046499 Bacteria 803
1045 Ga0495596_0048503 3300046500 Bacteria 1665
1046 Ga0495607_0047580 3300046501 Bacteria 2512
1047 Ga0495607_0381401 3300046501 Bacteria 645
1048 Ga0495608_0216707 3300046511 Bacteria 1202
1049 Ga0495616_0035386 3300046513 Bacteria 2585
1050 Ga0495616_0035556 3300046513 Bacteria 2577
1051 Ga0495618_0027070 3300046514 Bacteria 3569
1052 Ga0495620_0083889 3300046515 Bacteria 1286
1053 Ga0495630_0020828 3300046517 Bacteria 4839
1054 Ga0495630_0186553 3300046517 Bacteria 1582
1055 Ga0495630_0691113 3300046517 Bacteria 781
1056 Ga0495631_0030018 3300046518 Bacteria 2469
1057 Ga0495632_0100313 3300046519 Bacteria 1365
1058 Ga0495637_0020977 3300046520 Bacteria 2997
1059 Ga0495637_0038044 3300046520 Bacteria 2085
1060 Ga0495644_0015286 3300046523 Bacteria 2939
1061 Ga0495663_0018369 3300046525 Bacteria 1991
1062 Ga0495666_0069858 3300046526 Bacteria 1670
1063 Ga0495666_0230391 3300046526 Bacteria 847
1064 Ga0495666_0307588 3300046526 Bacteria 716
1065 Ga0495666_0310401 3300046526 Bacteria 712
1066 Ga0495642_0054398 3300046528 Bacteria 1650
1067 Ga0495642_0076354 3300046528 Bacteria 1406
1068 Ga0495665_0012337 3300046531 Bacteria 4623
1069 Ga0495665_0030829 3300046531 Bacteria 2869
1070 Ga0495640_0737296 3300046533 Bacteria 590
1071 Ga0495586_0009166 3300046535 Bacteria 5266
1072 Ga0495598_0016978 3300046537 Bacteria 1868
1073 Ga0495609_0013389 3300046538 Bacteria 3875
1074 Ga0495609_0099557 3300046538 Bacteria 1260
1075 Ga0495597_0325935 3300046542 Bacteria 592
1076 Ga0495645_0177869 3300046543 Bacteria 1460
1077 Ga0495633_0123275 3300046558 Bacteria 1200
1078 Ga0495667_0015868 3300046559 Bacteria 5092
1079 Ga0495667_0535462 3300046559 Bacteria 732
1080 Ga0495656_0022492 3300046615 Bacteria 2469
1081 Ga0495656_0032082 3300046615 Bacteria 2135
1082 Ga0495656_0129371 3300046615 Bacteria 1200
1083 Ga0495668_0046919 3300046616 Bacteria 2399
1084 Ga0495668_0090581 3300046616 Bacteria 1676
1085 Ga0495634_0003395 3300046642 Bacteria 12784
1086 Ga0495634_0078629 3300046642 Bacteria 2160
1087 Ga0495634_0276716 3300046642 Bacteria 1020
1088 Ga0495611_0303632 3300046648 Bacteria 736
1089 Ga0495625_0241822 3300046660 Bacteria 1175
1090 Ga0495659_0008584 3300046664 Bacteria 3252
1091 Ga0495659_0048070 3300046664 Bacteria 1544
1092 Ga0495659_0106410 3300046664 Bacteria 1091
1093 Ga0495661_0041451 3300046665 Bacteria 2848
1094 Ga0495661_0082060 3300046665 Bacteria 1857
1095 Ga0495588_0005580 3300046674 Bacteria 5607
1096 Ga0495588_0017973 3300046674 Bacteria 3443
1097 Ga0495657_0048394 3300046675 Bacteria 2868
1098 Ga0495599_0105089 3300046678 Bacteria 1759
1099 Ga0495623_0100084 3300046679 Bacteria 1767
1100 Ga0495646_0263675 3300046680 Bacteria 920
1101 Ga0495646_0342619 3300046680 Bacteria 784
1102 Ga0495647_0092151 3300046681 Bacteria 1244
1103 Ga0495647_0134114 3300046681 Bacteria 1051
1104 Ga0495647_0185029 3300046681 Bacteria 908
1105 Ga0495658_0007869 3300046683 Bacteria 5278
1106 Ga0495658_0010122 3300046683 Bacteria 4712
1107 Ga0495658_0206261 3300046683 Bacteria 1226
1108 Ga0495658_0593707 3300046683 Bacteria 709
1109 Ga0495669_0057692 3300046684 Bacteria 1752
1110 Ga0495613_0004692 3300046689 Bacteria 10254
1111 Ga0495613_0027711 3300046689 Bacteria 4217
1112 Ga0495613_0049317 3300046689 Bacteria 3107
1113 Ga0495613_0486533 3300046689 Bacteria 832
1114 Ga0495624_0009055 3300046690 Bacteria 6909
1115 Ga0495624_0096157 3300046690 Bacteria 1825
1116 Ga0495670_0103313 3300046691 Bacteria 1469
1117 Ga0495670_0167111 3300046691 Bacteria 1158
1118 Ga0495671_0029803 3300046692 Bacteria 2799
1119 Ga0495649_0282345 3300046694 Bacteria 848
1120 Ga0495589_0017749 3300046794 Bacteria 3651
1121 Ga0495600_0044805 3300046809 Bacteria 2885
1122 Ga0495660_0173046 3300046810 Bacteria 1050
1123 Ga0495581_0002157 3300047315 Bacteria 11106
1124 Ga0495581_0006490 3300047315 Bacteria 6784
1125 Ga0495581_0162642 3300047315 Bacteria 1305
1126 Ga0495636_0045566 3300047318 Bacteria 1828
1127 Ga0495636_0104283 3300047318 Bacteria 1243
1128 Ga0495674_0071942 3300047319 Bacteria 2983
1129 Ga0495674_0117622 3300047319 Bacteria 2248
1130 Ga0495674_0177342 3300047319 Bacteria 1775
1131 Ga0495674_0239553 3300047319 Bacteria 1495
1132 Ga0495674_0311221 3300047319 Bacteria 1285
1133 Ga0495676_0028449 3300047321 Bacteria 4771
1134 Ga0495676_0048973 3300047321 Bacteria 3402
1135 Ga0495676_0062120 3300047321 Bacteria 2918
1136 Ga0495676_0108914 3300047321 Bacteria 2037
1137 Ga0495676_0214944 3300047321 Bacteria 1328
1138 Ga0495676_0406066 3300047321 Bacteria 903
1139 Ga0495680_0043380 3300047322 Bacteria 3561
1140 Ga0495680_0045354 3300047322 Bacteria 3471
1141 Ga0495683_0044129 3300047323 Bacteria 2242
1142 Ga0495675_0025370 3300047444 Bacteria 3779
1143 Ga0495677_0028600 3300047445 Bacteria 2025
1144 Ga0495677_0046872 3300047445 Bacteria 1586
1145 Ga0495685_038111 3300047447 Bacteria 1647
1146 Ga0495673_0157462 3300047469 Bacteria 874
1147 Ga0495684_0136882 3300047471 Bacteria 1838
1148 Ga0495686_0282842 3300047472 Bacteria 921
1149 Ga0495686_0352949 3300047472 Bacteria 799
1150 Ga0495602_0273079 3300048088 Bacteria 1249
1151 Ga0495602_0396781 3300048088 Bacteria 985
1152 Ga0495602_0486920 3300048088 Bacteria 864
1153 Ga0495614_0018916 3300048089 Bacteria 2982
1154 Ga0495614_0027239 3300048089 Bacteria 2465
1155 Ga0495626_0033876 3300048091 Bacteria 2446
1156 Ga0496100_0011221 3300048903 Bacteria 5095
1157 Ga0496100_0015073 3300048903 Bacteria 4508
1158 Ga0496100_0021727 3300048903 Bacteria 3871
1159 Ga0496100_0110690 3300048903 Bacteria 1907
1160 Ga0496100_0139117 3300048903 Bacteria 1718
1161 Ga0496100_0798384 3300048903 Bacteria 739
1162 Ga0496101_0004366 3300048904 Bacteria 8883
1163 Ga0496101_0010082 3300048904 Bacteria 6228
1164 Ga0496101_0093951 3300048904 Bacteria 2234
1165 Ga0496101_0100417 3300048904 Bacteria 2165
1166 Ga0496101_0123032 3300048904 Bacteria 1963
1167 Ga0496101_0170542 3300048904 Bacteria 1672
1168 Ga0496101_0173951 3300048904 Bacteria 1655
1169 Ga0496101_0376686 3300048904 Bacteria 1116
1170 Ga0496101_0801616 3300048904 Bacteria 743
1171 Ga0496101_1131222 3300048904 Bacteria 614
1172 Ga0496102_0007946 3300048905 Bacteria 9066
1173 Ga0496102_0030938 3300048905 Bacteria 4794
1174 Ga0496102_0058991 3300048905 Bacteria 3508
1175 Ga0496102_0073441 3300048905 Bacteria 3143
1176 Ga0496102_0135068 3300048905 Bacteria 2311
1177 Ga0496102_0142566 3300048905 Bacteria 2247
1178 Ga0496102_0182787 3300048905 Bacteria 1975
1179 Ga0496102_0793439 3300048905 Bacteria 869
1180 Ga0496103_0006194 3300048906 Bacteria 7147
1181 Ga0496103_0012040 3300048906 Bacteria 5137
1182 Ga0496103_0060786 3300048906 Bacteria 2349
1183 Ga0496103_0147380 3300048906 Bacteria 1507
1184 Ga0496103_0150603 3300048906 Bacteria 1490
1185 Ga0496103_0177060 3300048906 Bacteria 1370
1186 Ga0496103_0429251 3300048906 Bacteria 848
1187 Ga0496104_0009978 3300048907 Bacteria 8478
1188 Ga0496104_0016700 3300048907 Bacteria 6672
1189 Ga0496104_0056464 3300048907 Bacteria 3713
1190 Ga0496104_0062449 3300048907 Bacteria 3532
1191 Ga0496104_0090679 3300048907 Bacteria 2921
1192 Ga0496104_0281818 3300048907 Bacteria 1575
1193 Ga0496104_0865496 3300048907 Bacteria 809
1194 Ga0496105_0012501 3300048908 Bacteria 6721
1195 Ga0496105_0019775 3300048908 Bacteria 5433
1196 Ga0496105_0030988 3300048908 Bacteria 4384
1197 Ga0496105_0128108 3300048908 Bacteria 2093
1198 Ga0496105_0131713 3300048908 Bacteria 2061
1199 Ga0496105_0148134 3300048908 Bacteria 1930
1200 Ga0496105_0218572 3300048908 Bacteria 1552
1201 Ga0496106_0000648 3300048909 Bacteria 24888
1202 Ga0496106_0003471 3300048909 Bacteria 11745
1203 Ga0496106_0017548 3300048909 Bacteria 5296
1204 Ga0496106_0065848 3300048909 Bacteria 2758
1205 Ga0496106_0100420 3300048909 Bacteria 2244
1206 Ga0496106_0154625 3300048909 Bacteria 1810
1207 Ga0496106_0166182 3300048909 Bacteria 1747
1208 Ga0496106_0194467 3300048909 Bacteria 1613
1209 Ga0496106_0319803 3300048909 Bacteria 1245
1210 Ga0496106_0936206 3300048909 Bacteria 683
1211 Ga0496107_0001575 3300048910 Bacteria 14189
1212 Ga0496107_0003573 3300048910 Bacteria 10418
1213 Ga0496107_0013371 3300048910 Bacteria 5735
1214 Ga0496107_0016532 3300048910 Bacteria 5183
1215 Ga0496107_0028310 3300048910 Bacteria 3981
1216 Ga0496107_0029102 3300048910 Bacteria 3928
1217 Ga0496107_0060631 3300048910 Bacteria 2738
1218 Ga0496107_0064175 3300048910 Bacteria 2662
1219 Ga0496107_0088315 3300048910 Bacteria 2263
1220 Ga0496107_0291251 3300048910 Bacteria 1215
1221 Ga0496108_0018620 3300048911 Bacteria 5689
1222 Ga0496108_0020845 3300048911 Bacteria 5391
1223 Ga0496108_0020926 3300048911 Bacteria 5379
1224 Ga0496108_0021148 3300048911 Bacteria 5346
1225 Ga0496108_0021388 3300048911 Bacteria 5316
1226 Ga0496108_0022262 3300048911 Bacteria 5211
1227 Ga0496108_0029910 3300048911 Bacteria 4514
1228 Ga0496108_0040952 3300048911 Bacteria 3865
1229 Ga0496108_0067823 3300048911 Bacteria 3009
1230 Ga0496108_0081016 3300048911 Bacteria 2751
1231 Ga0496108_0259129 3300048911 Bacteria 1513
1232 Ga0496108_0660014 3300048911 Bacteria 909
1233 Ga0496108_0666862 3300048911 Bacteria 903
1234 Ga0496109_0002950 3300048912 Bacteria 14231
1235 Ga0496109_0008103 3300048912 Bacteria 8907
1236 Ga0496109_0009875 3300048912 Bacteria 8148
1237 Ga0496109_0010242 3300048912 Bacteria 8007
1238 Ga0496109_0014398 3300048912 Bacteria 6883
1239 Ga0496109_0033881 3300048912 Bacteria 4597
1240 Ga0496109_0055339 3300048912 Bacteria 3619
1241 Ga0496109_0070748 3300048912 Bacteria 3202
1242 Ga0496109_0086639 3300048912 Bacteria 2892
1243 Ga0496109_0157183 3300048912 Bacteria 2130
1244 Ga0496109_0364800 3300048912 Bacteria 1364
1245 Ga0496109_0409790 3300048912 Bacteria 1281
1246 Ga0496109_0439461 3300048912 Bacteria 1232
1247 Ga0496109_0481138 3300048912 Bacteria 1172
1248 Ga0496110_0000989 3300048913 Bacteria 19934
1249 Ga0496110_0002127 3300048913 Bacteria 14790
1250 Ga0496110_0011692 3300048913 Bacteria 7199
1251 Ga0496110_0014010 3300048913 Bacteria 6646
1252 Ga0496110_0029152 3300048913 Bacteria 4747
1253 Ga0496110_0037596 3300048913 Bacteria 4208
1254 Ga0496110_0053559 3300048913 Bacteria 3548
1255 Ga0496110_0089087 3300048913 Bacteria 2757
1256 Ga0496110_0219272 3300048913 Bacteria 1730
1257 Ga0496110_0368799 3300048913 Bacteria 1308
1258 Ga0496110_0418414 3300048913 Bacteria 1222
1259 Ga0496110_0661403 3300048913 Bacteria 945
1260 Ga0496111_0000061 3300048914 Bacteria 44168
1261 Ga0496111_0026745 3300048914 Bacteria 4075
1262 Ga0496111_0036550 3300048914 Bacteria 3512
1263 Ga0496111_0040100 3300048914 Bacteria 3358
1264 Ga0496111_0219952 3300048914 Bacteria 1411
1265 Ga0496111_0303562 3300048914 Bacteria 1183
1266 Ga0496111_0307938 3300048914 Bacteria 1174
1267 Ga0496111_0622324 3300048914 Bacteria 789
1268 Ga0496111_0847654 3300048914 Bacteria 660
1269 Ga0496112_0000580 3300048915 Bacteria 25100
1270 Ga0496112_0015002 3300048915 Bacteria 7212
1271 Ga0496112_0025388 3300048915 Bacteria 5689
1272 Ga0496112_0059478 3300048915 Bacteria 3765
1273 Ga0496112_0085404 3300048915 Bacteria 3122
1274 Ga0496112_0094070 3300048915 Bacteria 2968
1275 Ga0496112_0260050 3300048915 Bacteria 1685
1276 Ga0496112_0514355 3300048915 Bacteria 1132
1277 Ga0496113_0001497 3300048916 Bacteria 13072
1278 Ga0496113_0005204 3300048916 Bacteria 8094
1279 Ga0496113_0006676 3300048916 Bacteria 7341
1280 Ga0496113_0230350 3300048916 Bacteria 1477
1281 Ga0496113_0347702 3300048916 Bacteria 1189
1282 Ga0496113_0935062 3300048916 Bacteria 685
1283 Ga0496113_1003086 3300048916 Bacteria 657
1284 Ga0496114_0000990 3300048917 Bacteria 21267
1285 Ga0496114_0004294 3300048917 Bacteria 11032
1286 Ga0496114_0032625 3300048917 Bacteria 4287
1287 Ga0496114_0053907 3300048917 Bacteria 3352
1288 Ga0496114_0059840 3300048917 Bacteria 3182
1289 Ga0496114_0062923 3300048917 Bacteria 3106
1290 Ga0496114_0120566 3300048917 Bacteria 2255
1291 Ga0496114_0314931 3300048917 Bacteria 1382
1292 Ga0496114_0411616 3300048917 Bacteria 1197
1293 Ga0496114_0611835 3300048917 Bacteria 960
1294 Ga0496115_0006389 3300048918 Bacteria 8637
1295 Ga0496115_0053777 3300048918 Bacteria 3232
1296 Ga0496115_0068354 3300048918 Bacteria 2876
1297 Ga0496115_0203713 3300048918 Bacteria 1634
1298 Ga0496115_0208828 3300048918 Bacteria 1613
1299 Ga0496115_0387038 3300048918 Bacteria 1136
1300 Ga0501031_0000961 3300049568 Bacteria 17461
1301 Ga0501031_0034384 3300049568 Bacteria 3307
1302 Ga0501031_0487727 3300049568 Bacteria 795
1303 Ga0501032_0005599 3300049569 Bacteria 9307
1304 Ga0501032_0562442 3300049569 Bacteria 727
1305 Ga0501033_0001359 3300049570 Bacteria 21806
1306 Ga0501033_0073160 3300049570 Bacteria 2516
1307 Ga0501033_0134465 3300049570 Bacteria 1790
1308 Ga0501033_0162155 3300049570 Bacteria 1609
1309 Ga0501034_1090225 3300049571 Bacteria 680
1310 Ga0501036_0000470 3300049572 Bacteria 28784
1311 Ga0501036_0205211 3300049572 Bacteria 1657
1312 Ga0501036_0251705 3300049572 Bacteria 1480
1313 Ga0501036_0269432 3300049572 Bacteria 1426
1314 Ga0501036_0978152 3300049572 Bacteria 693
1315 Ga0501036_1386209 3300049572 Bacteria 570
1316 Ga0501037_0000275 3300049573 Bacteria 43921
1317 Ga0501037_0001951 3300049573 Bacteria 14900
1318 Ga0501037_0011306 3300049573 Bacteria 6570
1319 Ga0501037_0237843 3300049573 Bacteria 1277
1320 Ga0501038_0003569 3300049574 Bacteria 14470
1321 Ga0501038_0018137 3300049574 Bacteria 6357
1322 Ga0501038_0050253 3300049574 Bacteria 3603
1323 Ga0501038_0134544 3300049574 Bacteria 2026
1324 Ga0501039_0000176 3300049575 Bacteria 45277
1325 Ga0501039_0009149 3300049575 Bacteria 7546
1326 Ga0501039_0121934 3300049575 Bacteria 2043
1327 Ga0501039_0250521 3300049575 Bacteria 1392
1328 Ga0501039_1104633 3300049575 Bacteria 614
1329 Ga0501040_0000327 3300049576 Bacteria 27920
1330 Ga0501040_0004612 3300049576 Bacteria 8937
1331 Ga0501040_0024949 3300049576 Bacteria 4017
1332 Ga0501040_0060781 3300049576 Bacteria 2597
1333 Ga0501040_0438790 3300049576 Bacteria 939
1334 Ga0501040_0917813 3300049576 Bacteria 634
1335 Ga0501041_0000736 3300049577 Bacteria 17495
1336 Ga0501041_0068525 3300049577 Bacteria 2175
1337 Ga0501041_0072939 3300049577 Bacteria 2109
1338 Ga0501041_0145714 3300049577 Bacteria 1477
1339 Ga0501042_0000738 3300049578 Bacteria 17760
1340 Ga0501042_0038212 3300049578 Bacteria 3409
1341 Ga0501042_0054934 3300049578 Bacteria 2841
1342 Ga0501042_0146931 3300049578 Bacteria 1700
1343 Ga0501042_0161737 3300049578 Bacteria 1615
1344 Ga0501042_0171522 3300049578 Bacteria 1565
1345 Ga0501042_0375166 3300049578 Bacteria 1029
1346 Ga0501042_0430463 3300049578 Bacteria 956
1347 Ga0501042_0542314 3300049578 Bacteria 845
1348 Ga0501042_0650648 3300049578 Bacteria 766
1349 Ga0501042_0786362 3300049578 Unclassified 692
1350 Ga0501042_0796807 3300049578 Bacteria 687
1351 Ga0501043_0000891 3300049579 Bacteria 26496
1352 Ga0501043_0378744 3300049579 Bacteria 1071
1353 Ga0501046_0005272 3300049580 Bacteria 11561
1354 Ga0501046_0053782 3300049580 Unclassified 3169
1355 Ga0501046_0098368 3300049580 Bacteria 2247
1356 Ga0501046_0114777 3300049580 Bacteria 2054
1357 Ga0501046_0199830 3300049580 Bacteria 1488
1358 Ga0501047_0001498 3300049581 Bacteria 22765
1359 Ga0501047_0133267 3300049581 Bacteria 2365
1360 Ga0501047_0556267 3300049581 Bacteria 971
1361 Ga0501047_1161488 3300049581 Bacteria 585
1362 Ga0501048_0003680 3300049582 Bacteria 11686
1363 Ga0501048_0033148 3300049582 Bacteria 3733
1364 Ga0501048_0066497 3300049582 Bacteria 2548
1365 Ga0501048_0160004 3300049582 Bacteria 1593
1366 Ga0501067_0000131 3300049583 Bacteria 40872
1367 Ga0501067_0002559 3300049583 Bacteria 10043
1368 Ga0501067_0014258 3300049583 Bacteria 4401
1369 Ga0501067_0046851 3300049583 Bacteria 2399
1370 Ga0501067_0093214 3300049583 Bacteria 1672
1371 Ga0501068_0000011 3300049584 Bacteria 65947
1372 Ga0501068_0000106 3300049584 Bacteria 35979
1373 Ga0501068_0009594 3300049584 Bacteria 5419
1374 Ga0501068_0257708 3300049584 Bacteria 1112
1375 Ga0501068_0287858 3300049584 Bacteria 1051
1376 Ga0501068_0876552 3300049584 Bacteria 590
1377 Ga0501069_0000029 3300049585 Bacteria 105687
1378 Ga0501069_0002478 3300049585 Bacteria 9427
1379 Ga0501069_0003014 3300049585 Bacteria 8661
1380 Ga0501069_0006339 3300049585 Bacteria 6183
1381 Ga0501069_0009450 3300049585 Bacteria 5145
1382 Ga0501069_0041416 3300049585 Bacteria 2546
1383 Ga0501069_0539739 3300049585 Bacteria 697
1384 Ga0501069_0605945 3300049585 Bacteria 657
1385 Ga0501070_0006265 3300049586 Bacteria 10123
1386 Ga0501070_0023391 3300049586 Bacteria 5176
1387 Ga0501070_0042240 3300049586 Bacteria 3798
1388 Ga0501070_0082845 3300049586 Bacteria 2655
1389 Ga0501070_0100033 3300049586 Bacteria 2399
1390 Ga0501070_0148420 3300049586 Bacteria 1935
1391 Ga0501070_0164269 3300049586 Bacteria 1830
1392 Ga0501070_0305585 3300049586 Bacteria 1295
1393 Ga0501070_0331602 3300049586 Bacteria 1237
1394 Ga0501070_0424481 3300049586 Bacteria 1074
1395 Ga0501071_0002227 3300049587 Bacteria 11663
1396 Ga0501071_0020595 3300049587 Bacteria 4584
1397 Ga0501071_0064226 3300049587 Bacteria 2663
1398 Ga0501071_0092530 3300049587 Bacteria 2222
1399 Ga0501071_0301351 3300049587 Bacteria 1215
1400 Ga0501071_0433143 3300049587 Bacteria 1006
1401 Ga0501071_0622363 3300049587 Bacteria 830
1402 Ga0501072_0003471 3300049588 Bacteria 11882
1403 Ga0501072_0003584 3300049588 Bacteria 11683
1404 Ga0501072_0019708 3300049588 Bacteria 5217
1405 Ga0501072_0049039 3300049588 Bacteria 3324
1406 Ga0501072_0087222 3300049588 Bacteria 2476
1407 Ga0501072_0379839 3300049588 Bacteria 1121
1408 Ga0501072_0404333 3300049588 Bacteria 1083
1409 Ga0501072_0570361 3300049588 Bacteria 893
1410 Ga0501072_0956339 3300049588 Bacteria 668
1411 Ga0501072_0975142 3300049588 Bacteria 661
1412 Ga0501073_0033899 3300049589 Bacteria 3634
1413 Ga0501073_0071097 3300049589 Bacteria 2425
1414 Ga0501073_0078812 3300049589 Bacteria 2293
1415 Ga0501073_0303149 3300049589 Bacteria 1102
1416 Ga0501073_0403824 3300049589 Bacteria 944
1417 Ga0501074_0000438 3300049590 Bacteria 24855
1418 Ga0501074_0000775 3300049590 Bacteria 20164
1419 Ga0501074_0145528 3300049590 Bacteria 1695
1420 Ga0501074_0383931 3300049590 Bacteria 996
1421 Ga0501075_0000040 3300049591 Bacteria 52221
1422 Ga0501075_0004055 3300049591 Bacteria 9885
1423 Ga0501075_0008849 3300049591 Bacteria 7020
1424 Ga0501075_0098145 3300049591 Bacteria 2224
1425 Ga0501075_0185336 3300049591 Bacteria 1587
1426 Ga0501075_0306460 3300049591 Bacteria 1210
1427 Ga0501075_0342998 3300049591 Unclassified 1138
1428 Ga0501076_0000089 3300049592 Bacteria 48333
1429 Ga0501076_0001453 3300049592 Bacteria 15933
1430 Ga0501076_0035621 3300049592 Bacteria 3894
1431 Ga0501076_0245874 3300049592 Bacteria 1463
1432 Ga0501076_0379342 3300049592 Bacteria 1162
1433 Ga0501076_0584132 3300049592 Bacteria 921
1434 Ga0501076_1076563 3300049592 Bacteria 662
1435 Ga0501077_0000172 3300049593 Bacteria 37130
1436 Ga0501077_0010213 3300049593 Bacteria 5846
1437 Ga0501077_0017902 3300049593 Bacteria 4478
1438 Ga0501077_0216903 3300049593 Bacteria 1216
1439 Ga0501079_0000399 3300049741 Bacteria 28004
1440 Ga0501079_0007902 3300049741 Bacteria 8061
1441 Ga0501079_0035805 3300049741 Bacteria 3822
1442 Ga0501079_0039486 3300049741 Bacteria 3640
1443 Ga0501079_0207795 3300049741 Bacteria 1529
1444 Ga0501079_0262201 3300049741 Bacteria 1351
1445 Ga0501079_0533386 3300049741 Bacteria 923
1446 Ga0501080_0019285 3300049742 Bacteria 6318
1447 Ga0501080_0052517 3300049742 Bacteria 3793
1448 Ga0501080_0378656 3300049742 Bacteria 1275
1449 Ga0501080_0404736 3300049742 Unclassified 1227
1450 Ga0501081_0000040 3300049743 Bacteria 48110
1451 Ga0501081_0005944 3300049743 Bacteria 7899
1452 Ga0501081_0078804 3300049743 Bacteria 2303
1453 Ga0501081_0119433 3300049743 Bacteria 1876
1454 Ga0501081_0151302 3300049743 Bacteria 1667
1455 Ga0501083_0005932 3300049744 Bacteria 8648
1456 Ga0501083_0030195 3300049744 Bacteria 3724
1457 Ga0501083_0065893 3300049744 Bacteria 2412
1458 Ga0501083_0098846 3300049744 Bacteria 1925
1459 Ga0501035_0005775 3300049822 Bacteria 11664
1460 Ga0501035_0137488 3300049822 Bacteria 2126
1461 Ga0501035_0184062 3300049822 Bacteria 1798
1462 Ga0501035_0354544 3300049822 Bacteria 1227
1463 Ga0501044_0042148 3300049823 Bacteria 4750
1464 Ga0501044_0115062 3300049823 Bacteria 2695
1465 Ga0501045_0000098 3300049824 Bacteria 42917
1466 Ga0501045_0007355 3300049824 Bacteria 7656
1467 Ga0501045_0019519 3300049824 Bacteria 4834
1468 Ga0501045_0062844 3300049824 Bacteria 2724
1469 Ga0501045_0119344 3300049824 Bacteria 1958
1470 Ga0501045_0202836 3300049824 Bacteria 1477
1471 Ga0501045_0481119 3300049824 Bacteria 922
1472 Ga0501212_016970 3300049851 Bacteria 1098
1473 nmdc:mga03n38_133685_c1 3300050490 Bacteria 1232
1474 nmdc:mga00v17_39763_c1 3300050491 Bacteria 2818
1475 nmdc:mga00v17_45198_c1 3300050491 Bacteria 2660
1476 nmdc:mga0k408_17201_c1 3300050493 Bacteria 4025
1477 nmdc:mga06z11_113551_c1 3300050494 Bacteria 1503
1478 nmdc:mga06z11_55359_c1 3300050494 Bacteria 2048
1479 nmdc:mga07m45_136312_c1 3300050496 Bacteria 1421
1480 nmdc:mga05p37_328162_c1 3300050507 Bacteria 1808
1481 nmdc:mga05p37_5169_c1 3300050507 Bacteria 15300
1482 nmdc:mga05p37_632795_c1 3300050507 Bacteria 1202
1483 nmdc:mga05p37_6410_c1 3300050507 Bacteria 9794
1484 nmdc:mga09592_151892_c1 3300050508 Bacteria 1998
1485 nmdc:mga09592_208855_c1 3300050508 Bacteria 1691
1486 nmdc:mga09592_36326_c1 3300050508 Bacteria 4126
1487 nmdc:mga0qj67_19561_c1 3300050509 Bacteria 5174
1488 nmdc:mga0qj67_228278_c1 3300050509 Bacteria 1511
1489 nmdc:mga0qj67_368024_c1 3300050509 Bacteria 1161
1490 nmdc:mga0qj67_41943_c1 3300050509 Bacteria 3601
1491 nmdc:mga0qj67_613674_c1 3300050509 Bacteria 869
1492 nmdc:mga06r32_1288371_c1 3300050510 Bacteria 675
1493 nmdc:mga06r32_347968_c1 3300050510 Bacteria 1467
1494 nmdc:mga06r32_580342_c1 3300050510 Bacteria 1093
1495 nmdc:mga06r32_967967_c1 3300050510 Bacteria 805
1496 nmdc:mga08y16_360556_c1 3300050511 Bacteria 1492
1497 nmdc:mga08y16_3967_c1 3300050511 Bacteria 15416
1498 nmdc:mga08y16_45566_c1 3300050511 Bacteria 4595
1499 nmdc:mga08y16_527898_c1 3300050511 Bacteria 1196
1500 nmdc:mga08y16_91270_c1 3300050511 Bacteria 3175
1501 nmdc:mga08y16_9596_c1 3300050511 Bacteria 10162
1502 nmdc:mga0n895_1140809_c1 3300050512 Bacteria 755
1503 nmdc:mga0n895_13708_c1 3300050512 Bacteria 7328
1504 nmdc:mga0n895_17465_c1 3300050512 Bacteria 6611
1505 nmdc:mga0n895_235227_c1 3300050512 Bacteria 1859
1506 nmdc:mga0n895_69449_c1 3300050512 Bacteria 3491
1507 nmdc:mga0n895_818065_c1 3300050512 Bacteria 921
1508 nmdc:mga0rr50_1486_c1 3300050513 Bacteria 12869
1509 nmdc:mga0rr50_17362_c1 3300050513 Bacteria 4803
1510 nmdc:mga0rr50_228395_c1 3300050513 Bacteria 1539
1511 nmdc:mga0rr50_41457_c1 3300050513 Bacteria 3355
1512 nmdc:mga0rr50_7202_c1 3300050513 Bacteria 6837
1513 nmdc:mga0rr50_900034_c1 3300050513 Bacteria 755
1514 nmdc:mga08x19_124824_c1 3300050514 Bacteria 1728
1515 nmdc:mga08x19_18260_c1 3300050514 Bacteria 4299
1516 nmdc:mga08x19_23986_c1 3300050514 Bacteria 3787
1517 nmdc:mga08x19_60947_c1 3300050514 Bacteria 2444
1518 nmdc:mga0a205_146001_c1 3300050515 Bacteria 2265
1519 nmdc:mga0a205_183296_c1 3300050515 Bacteria 1987
1520 nmdc:mga0a205_355641_c1 3300050515 Bacteria 1331
1521 nmdc:mga0a205_63577_c2 3300050515 Bacteria 2596
1522 nmdc:mga0a205_68103_c1 3300050515 Bacteria 3438
1523 Ga0495601_0028519 3300053077 Bacteria 3458
1524 Ga0495601_0032047 3300053077 Bacteria 3269
1525 Ga0495601_0130983 3300053077 Bacteria 1633
1526 Ga0495601_0218275 3300053077 Bacteria 1245
1527 Ga0495601_0219762 3300053077 Bacteria 1241
1528 Ga0495612_0098448 3300053078 Bacteria 1243
1529 Ga0495655_0014165 3300053083 Bacteria 1667
1530 Ga0495595_0038191 3300053084 Bacteria 2187
1531 Ga0495595_0089848 3300053084 Bacteria 1472
1532 Ga0495619_0112963 3300053085 Bacteria 1857
1533 Ga0495619_0168074 3300053085 Bacteria 1516
1534 Ga0495619_0277866 3300053085 Bacteria 1160
1535 Ga0501084_0002110 3300054114 Bacteria 15891
1536 Ga0501084_0014050 3300054114 Bacteria 6629
1537 Ga0501084_0037438 3300054114 Bacteria 4053
1538 Ga0501084_0063641 3300054114 Bacteria 3088
1539 Ga0501084_0064439 3300054114 Bacteria 3067
1540 Ga0501084_0359087 3300054114 Bacteria 1231
1541 Ga0501084_0414711 3300054114 Bacteria 1138
1542 Ga0501084_0983958 3300054114 Bacteria 709
1543 Ga0501084_1052625 3300054114 Bacteria 683
1544 Ga0501082_0000313 3300060353 Bacteria 43217
1545 Ga0501082_0012587 3300060353 Bacteria 7270
1546 Ga0501082_0020003 3300060353 Bacteria 5768
1547 Ga0501082_0024988 3300060353 Bacteria 5147
1548 Ga0501082_0093581 3300060353 Bacteria 2597
1549 Ga0501082_0108042 3300060353 Bacteria 2407
1550 Ga0501082_0424530 3300060353 Bacteria 1161
1551 Ga0501082_0525765 3300060353 Bacteria 1034
1552 Ga0501082_0536456 3300060353 Bacteria 1023
1553 Ga0530510_0001549 3300061734 Bacteria 15503
1554 Ga0530510_0024268 3300061734 Bacteria 4325
1555 Ga0530510_0063603 3300061734 Bacteria 2671
1556 Ga0530510_0074542 3300061734 Bacteria 2464
1557 Ga0530510_0117389 3300061734 Bacteria 1951
1558 Ga0530510_0127555 3300061734 Bacteria 1871
1559 Ga0530510_0373551 3300061734 Bacteria 1073
1560 Ga0530510_0407407 3300061734 Bacteria 1026
1561 Ga0530510_0894348 3300061734 Bacteria 678

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005545 Ga0070695_100905479 Ga0070695_1009054791 155
2 3300009147 Ga0114129_11676300 Ga0114129_116763002 155
3 3300005444 Ga0070694_100146334 Ga0070694_1001463344 156
4 3300005981 Ga0081538_10192945 Ga0081538_101929451 158
5 3300035121 Ga0373960_0118361 Ga0373960_0118361_179_709 158
6 3300005445 Ga0070708_100003372 Ga0070708_10000337212 159
7 3300005445 Ga0070708_100218826 Ga0070708_1002188262 159
8 3300005467 Ga0070706_100439338 Ga0070706_1004393382 159
9 3300025910 Ga0207684_10218921 Ga0207684_102189212 159
10 3300048909 Ga0496106_0065848 Ga0496106_0065848_2018_2497 159
11 3300005458 Ga0070681_10848792 Ga0070681_108487921 164
12 3300049572 Ga0501036_0978152 Ga0501036_0978152_98_616 164
13 3300049824 Ga0501045_0119344 Ga0501045_0119344_1017_1511 164
14 3300005546 Ga0070696_100562646 Ga0070696_1005626461 165
15 3300013297 Ga0157378_11263573 Ga0157378_112635731 165
16 3300044706 Ga0466964_0079183 Ga0466964_0079183_260_784 165
17 3300048912 Ga0496109_0364800 Ga0496109_0364800_431_937 168
18 3300048917 Ga0496114_0411616 Ga0496114_0411616_325_831 168
19 3300049581 Ga0501047_0133267 Ga0501047_0133267_569_1078 168
20 3300049744 Ga0501083_0005932 Ga0501083_0005932_2336_2845 168
21 3300054114 Ga0501084_0064439 Ga0501084_0064439_2533_3042 168
22 3300006852 Ga0075433_10554021 Ga0075433_105540212 169
23 3300006871 Ga0075434_100829070 Ga0075434_1008290702 169
24 3300006914 Ga0075436_100259068 Ga0075436_1002590682 169
25 3300007076 Ga0075435_100086158 Ga0075435_1000861585 169
26 3300037466 Ga0395898_0732663 Ga0395898_0732663_98_610 169
27 3300038443 Ga0395901_0086190 Ga0395901_0086190_2413_2925 169
28 3300048910 Ga0496107_0291251 Ga0496107_0291251_84_596 169
29 3300050512 nmdc:mga0n895_1140809_c1 nmdc:mga0n895_1140809_c1_86_598 169
30 3300050513 nmdc:mga0rr50_41457_c1 nmdc:mga0rr50_41457_c1_1833_2345 169
31 3300005334 Ga0068869_100171527 Ga0068869_1001715273 170
32 3300005334 Ga0068869_100347890 Ga0068869_1003478903 170
33 3300005354 Ga0070675_100004496 Ga0070675_1000044963 170
34 3300005354 Ga0070675_100135821 Ga0070675_1001358212 170
35 3300005356 Ga0070674_100137282 Ga0070674_1001372823 170
36 3300005364 Ga0070673_100357059 Ga0070673_1003570592 170
37 3300005455 Ga0070663_100522301 Ga0070663_1005223012 170
38 3300005548 Ga0070665_100027976 Ga0070665_1000279762 170
39 3300005578 Ga0068854_100497488 Ga0068854_1004974882 170
40 3300005617 Ga0068859_100376781 Ga0068859_1003767813 170
41 3300005719 Ga0068861_100364609 Ga0068861_1003646092 170
42 3300005843 Ga0068860_100470533 Ga0068860_1004705333 170
43 3300006038 Ga0075365_10204495 Ga0075365_102044953 170
44 3300006048 Ga0075363_100114638 Ga0075363_1001146383 170
45 3300006051 Ga0075364_10124175 Ga0075364_101241751 170
46 3300006178 Ga0075367_10022708 Ga0075367_100227083 170
47 3300006195 Ga0075366_10009259 Ga0075366_100092594 170
48 3300006931 Ga0097620_100376792 Ga0097620_1003767923 170
49 3300009177 Ga0105248_10544370 Ga0105248_105443702 170
50 3300014497 Ga0182008_10344866 Ga0182008_103448661 170
51 3300014745 Ga0157377_10035073 Ga0157377_100350733 170
52 3300025910 Ga0207684_10739094 Ga0207684_107390942 170
53 3300025926 Ga0207659_10000241 Ga0207659_1000024113 170
54 3300025942 Ga0207689_10396616 Ga0207689_103966163 170
55 3300025944 Ga0207661_11548362 Ga0207661_115483622 170
56 3300025972 Ga0207668_10886534 Ga0207668_108865341 170
57 3300026067 Ga0207678_10404937 Ga0207678_104049372 170
58 3300026075 Ga0207708_10752383 Ga0207708_107523832 170
59 3300026118 Ga0207675_100257467 Ga0207675_1002574673 170
60 3300027866 Ga0209813_10036894 Ga0209813_100368941 170
61 3300028379 Ga0268266_10276433 Ga0268266_102764332 170
62 3300031239 Ga0265328_10172822 Ga0265328_101728221 170
63 3300031250 Ga0265331_10235257 Ga0265331_102352572 170
64 3300031251 Ga0265327_10002718 Ga0265327_100027184 170
65 3300031251 Ga0265327_10168001 Ga0265327_101680011 170
66 3300031548 Ga0307408_100259321 Ga0307408_1002593212 170
67 3300031731 Ga0307405_10007364 Ga0307405_100073645 170
68 3300031824 Ga0307413_10325996 Ga0307413_103259962 170
69 3300031901 Ga0307406_10013626 Ga0307406_100136268 170
70 3300031995 Ga0307409_100027617 Ga0307409_1000276173 170
71 3300032002 Ga0307416_100099034 Ga0307416_1000990344 170
72 3300032005 Ga0307411_10617531 Ga0307411_106175312 170
73 3300032126 Ga0307415_100000172 Ga0307415_10000017218 170
74 3300037312 Ga0395899_0132351 Ga0395899_0132351_601_1113 170
75 3300037466 Ga0395898_0031725 Ga0395898_0031725_1269_1781 170
76 3300037471 Ga0395905_0013225 Ga0395905_0013225_329_841 170
77 3300038443 Ga0395901_0028844 Ga0395901_0028844_4160_4672 170
78 3300044712 Ga0453684_0002411 Ga0453684_0002411_40676_41191 170
79 3300045836 Ga0466958_0428894 Ga0466958_0428894_85_606 170
80 3300049573 Ga0501037_0001951 Ga0501037_0001951_4674_5189 170
81 3300049573 Ga0501037_0011306 Ga0501037_0011306_419_934 170
82 3300049574 Ga0501038_0003569 Ga0501038_0003569_12436_12951 170
83 3300049578 Ga0501042_0786362 Ga0501042_0786362_99_614 170
84 3300049580 Ga0501046_0053782 Ga0501046_0053782_2052_2567 170
85 3300049581 Ga0501047_0556267 Ga0501047_0556267_165_680 170
86 3300049583 Ga0501067_0014258 Ga0501067_0014258_1279_1794 170
87 3300049585 Ga0501069_0006339 Ga0501069_0006339_1549_2064 170
88 3300049585 Ga0501069_0041416 Ga0501069_0041416_364_879 170
89 3300049586 Ga0501070_0006265 Ga0501070_0006265_2349_2864 170
90 3300049586 Ga0501070_0100033 Ga0501070_0100033_1484_1999 170
91 3300049586 Ga0501070_0424481 Ga0501070_0424481_371_886 170
92 3300049589 Ga0501073_0071097 Ga0501073_0071097_1856_2371 170
93 3300049590 Ga0501074_0000775 Ga0501074_0000775_104_619 170
94 3300049591 Ga0501075_0342998 Ga0501075_0342998_522_1037 170
95 3300049742 Ga0501080_0404736 Ga0501080_0404736_305_820 170
96 3300050490 nmdc:mga03n38_133685_c1 nmdc:mga03n38_133685_c1_668_1183 170
97 3300050491 nmdc:mga00v17_39763_c1 nmdc:mga00v17_39763_c1_2153_2668 170
98 3300050491 nmdc:mga00v17_45198_c1 nmdc:mga00v17_45198_c1_102_617 170
99 3300050493 nmdc:mga0k408_17201_c1 nmdc:mga0k408_17201_c1_1403_1918 170
100 3300050494 nmdc:mga06z11_113551_c1 nmdc:mga06z11_113551_c1_83_598 170
101 3300050494 nmdc:mga06z11_55359_c1 nmdc:mga06z11_55359_c1_1148_1663 170
102 3300050496 nmdc:mga07m45_136312_c1 nmdc:mga07m45_136312_c1_103_618 170
103 3300005327 Ga0070658_10013564 Ga0070658_100135645 171
104 3300005329 Ga0070683_100047057 Ga0070683_1000470573 171
105 3300005364 Ga0070673_100139018 Ga0070673_1001390184 171
106 3300005365 Ga0070688_100107992 Ga0070688_1001079923 171
107 3300005365 Ga0070688_100228172 Ga0070688_1002281722 171
108 3300005366 Ga0070659_100078874 Ga0070659_1000788744 171
109 3300005456 Ga0070678_100097991 Ga0070678_1000979913 171
110 3300005457 Ga0070662_100127607 Ga0070662_1001276073 171
111 3300005543 Ga0070672_101736281 Ga0070672_1017362811 171
112 3300005548 Ga0070665_100048573 Ga0070665_1000485733 171
113 3300005564 Ga0070664_100815412 Ga0070664_1008154122 171
114 3300005615 Ga0070702_100585510 Ga0070702_1005855101 171
115 3300005616 Ga0068852_100026783 Ga0068852_1000267833 171
116 3300005981 Ga0081538_10052043 Ga0081538_100520432 171
117 3300006881 Ga0068865_100598356 Ga0068865_1005983562 171
118 3300009148 Ga0105243_10570177 Ga0105243_105701771 171
119 3300009174 Ga0105241_10121293 Ga0105241_101212934 171
120 3300012478 Ga0157328_1012736 Ga0157328_10127361 171
121 3300013105 Ga0157369_10331436 Ga0157369_103314362 171
122 3300013296 Ga0157374_10550561 Ga0157374_105505613 171
123 3300013297 Ga0157378_10037769 Ga0157378_100377695 171
124 3300014969 Ga0157376_10602461 Ga0157376_106024612 171
125 3300025315 Ga0207697_10267863 Ga0207697_102678632 171
126 3300025909 Ga0207705_10052380 Ga0207705_100523803 171
127 3300025911 Ga0207654_10365878 Ga0207654_103658782 171
128 3300025918 Ga0207662_10225226 Ga0207662_102252262 171
129 3300025935 Ga0207709_10144666 Ga0207709_101446662 171
130 3300025944 Ga0207661_10247823 Ga0207661_102478232 171
131 3300026095 Ga0207676_10289914 Ga0207676_102899142 171
132 3300026142 Ga0207698_10187928 Ga0207698_101879283 171
133 3300031249 Ga0265339_10409453 Ga0265339_104094531 171
134 3300031711 Ga0265314_10227853 Ga0265314_102278531 171
135 3300035170 Ga0373943_0104588 Ga0373943_0104588_41_559 171
136 3300035398 Ga0316574_0011134 Ga0316574_0011134_2685_3215 171
137 3300035725 Ga0373947_0076631 Ga0373947_0076631_686_1204 171
138 3300037068 Ga0373925_1157749 Ga0373925_1157749_75_593 171
139 3300037466 Ga0395898_0286919 Ga0395898_0286919_27_545 171
140 3300042876 Ga0451577_0034759 Ga0451577_0034759_22_537 171
141 3300042876 Ga0451577_0048491 Ga0451577_0048491_192_707 171
142 3300042876 Ga0451577_0127446 Ga0451577_0127446_893_1408 171
143 3300042876 Ga0451577_0250384 Ga0451577_0250384_1062_1577 171
144 3300042876 Ga0451577_0337570 Ga0451577_0337570_807_1322 171
145 3300044673 Ga0453683_0143204 Ga0453683_0143204_470_985 171
146 3300044673 Ga0453683_0145343 Ga0453683_0145343_109_624 171
147 3300044673 Ga0453683_0480166 Ga0453683_0480166_121_636 171
148 3300044673 Ga0453683_0728694 Ga0453683_0728694_52_567 171
149 3300044712 Ga0453684_0002243 Ga0453684_0002243_30375_30890 171
150 3300044712 Ga0453684_0005904 Ga0453684_0005904_14531_15046 171
151 3300044712 Ga0453684_0006931 Ga0453684_0006931_11992_12507 171
152 3300044712 Ga0453684_0210021 Ga0453684_0210021_937_1452 171
153 3300044712 Ga0453684_0559665 Ga0453684_0559665_383_898 171
154 3300044712 Ga0453684_0637014 Ga0453684_0637014_31_546 171
155 3300044712 Ga0453684_0998711 Ga0453684_0998711_208_723 171
156 3300045051 Ga0451576_0155631 Ga0451576_0155631_1749_2264 171
157 3300045051 Ga0451576_0586319 Ga0451576_0586319_643_1158 171
158 3300045051 Ga0451576_0971392 Ga0451576_0971392_254_769 171
159 3300045051 Ga0451576_1194182 Ga0451576_1194182_81_596 171
160 3300046455 Ga0495603_0015080 Ga0495603_0015080_2956_3471 171
161 3300046459 Ga0495629_0010124 Ga0495629_0010124_4563_5078 171
162 3300046461 Ga0495641_0026985 Ga0495641_0026985_422_940 171
163 3300046473 Ga0495582_0099919 Ga0495582_0099919_435_950 171
164 3300046476 Ga0495662_0265890 Ga0495662_0265890_211_726 171
165 3300046499 Ga0495594_0074352 Ga0495594_0074352_684_1199 171
166 3300046642 Ga0495634_0078629 Ga0495634_0078629_1017_1532 171
167 3300046683 Ga0495658_0007869 Ga0495658_0007869_485_1000 171
168 3300046689 Ga0495613_0004692 Ga0495613_0004692_4490_5005 171
169 3300047315 Ga0495581_0162642 Ga0495581_0162642_580_1095 171
170 3300047321 Ga0495676_0108914 Ga0495676_0108914_959_1477 171
171 3300048089 Ga0495614_0027239 Ga0495614_0027239_1343_1858 171
172 3300048907 Ga0496104_0865496 Ga0496104_0865496_217_732 171
173 3300048909 Ga0496106_0936206 Ga0496106_0936206_116_631 171
174 3300048917 Ga0496114_0314931 Ga0496114_0314931_231_746 171
175 3300049568 Ga0501031_0487727 Ga0501031_0487727_259_774 171
176 3300049572 Ga0501036_0205211 Ga0501036_0205211_364_879 171
177 3300049572 Ga0501036_0269432 Ga0501036_0269432_580_1095 171
178 3300049576 Ga0501040_0917813 Ga0501040_0917813_31_546 171
179 3300049578 Ga0501042_0146931 Ga0501042_0146931_575_1090 171
180 3300049578 Ga0501042_0171522 Ga0501042_0171522_421_936 171
181 3300049578 Ga0501042_0430463 Ga0501042_0430463_43_558 171
182 3300049578 Ga0501042_0650648 Ga0501042_0650648_126_641 171
183 3300049582 Ga0501048_0033148 Ga0501048_0033148_1494_2009 171
184 3300049587 Ga0501071_0301351 Ga0501071_0301351_531_1046 171
185 3300049588 Ga0501072_0404333 Ga0501072_0404333_121_636 171
186 3300049592 Ga0501076_0379342 Ga0501076_0379342_257_772 171
187 3300049741 Ga0501079_0035805 Ga0501079_0035805_2519_3034 171
188 3300049823 Ga0501044_0115062 Ga0501044_0115062_1397_1921 171
189 3300049824 Ga0501045_0481119 Ga0501045_0481119_155_670 171
190 3300053085 Ga0495619_0277866 Ga0495619_0277866_498_1013 171
191 3300054114 Ga0501084_1052625 Ga0501084_1052625_69_584 171
192 3300060353 Ga0501082_0525765 Ga0501082_0525765_55_570 171
193 3300061734 Ga0530510_0024268 Ga0530510_0024268_1599_2114 171
194 3300061734 Ga0530510_0074542 Ga0530510_0074542_1489_2004 171
195 3300005329 Ga0070683_100072321 Ga0070683_1000723212 172
196 3300005329 Ga0070683_101216916 Ga0070683_1012169161 172
197 3300005334 Ga0068869_100115018 Ga0068869_1001150183 172
198 3300005336 Ga0070680_100131314 Ga0070680_1001313143 172
199 3300005338 Ga0068868_101049775 Ga0068868_1010497752 172
200 3300005341 Ga0070691_10039783 Ga0070691_100397834 172
201 3300005341 Ga0070691_10043891 Ga0070691_100438913 172
202 3300005341 Ga0070691_10134306 Ga0070691_101343062 172
203 3300005345 Ga0070692_10146161 Ga0070692_101461612 172
204 3300005347 Ga0070668_100001897 Ga0070668_10000189710 172
205 3300005354 Ga0070675_101781559 Ga0070675_1017815591 172
206 3300005356 Ga0070674_100071027 Ga0070674_1000710273 172
207 3300005364 Ga0070673_100922492 Ga0070673_1009224922 172
208 3300005366 Ga0070659_100061128 Ga0070659_1000611284 172
209 3300005406 Ga0070703_10056139 Ga0070703_100561392 172
210 3300005436 Ga0070713_100744182 Ga0070713_1007441821 172
211 3300005440 Ga0070705_100123097 Ga0070705_1001230972 172
212 3300005440 Ga0070705_100235955 Ga0070705_1002359552 172
213 3300005441 Ga0070700_100153189 Ga0070700_1001531892 172
214 3300005444 Ga0070694_100088830 Ga0070694_1000888304 172
215 3300005444 Ga0070694_100339912 Ga0070694_1003399122 172
216 3300005445 Ga0070708_100136961 Ga0070708_1001369612 172
217 3300005456 Ga0070678_100088238 Ga0070678_1000882381 172
218 3300005456 Ga0070678_100194207 Ga0070678_1001942072 172
219 3300005456 Ga0070678_101160816 Ga0070678_1011608162 172
220 3300005457 Ga0070662_100232070 Ga0070662_1002320702 172
221 3300005458 Ga0070681_10752782 Ga0070681_107527822 172
222 3300005459 Ga0068867_100189693 Ga0068867_1001896932 172
223 3300005466 Ga0070685_10369098 Ga0070685_103690982 172
224 3300005466 Ga0070685_10393544 Ga0070685_103935442 172
225 3300005467 Ga0070706_100004922 Ga0070706_1000049229 172
226 3300005467 Ga0070706_101602945 Ga0070706_1016029451 172
227 3300005471 Ga0070698_100221234 Ga0070698_1002212343 172
228 3300005518 Ga0070699_100190316 Ga0070699_1001903162 172
229 3300005530 Ga0070679_100002455 Ga0070679_10000245515 172
230 3300005530 Ga0070679_100678943 Ga0070679_1006789432 172
231 3300005535 Ga0070684_100024095 Ga0070684_1000240955 172
232 3300005535 Ga0070684_100069572 Ga0070684_1000695723 172
233 3300005535 Ga0070684_100079394 Ga0070684_1000793943 172
234 3300005535 Ga0070684_100177495 Ga0070684_1001774952 172
235 3300005535 Ga0070684_101203293 Ga0070684_1012032932 172
236 3300005544 Ga0070686_100057915 Ga0070686_1000579153 172
237 3300005545 Ga0070695_100346542 Ga0070695_1003465422 172
238 3300005545 Ga0070695_100647753 Ga0070695_1006477532 172
239 3300005545 Ga0070695_100802624 Ga0070695_1008026242 172
240 3300005547 Ga0070693_100010410 Ga0070693_1000104102 172
241 3300005547 Ga0070693_100428161 Ga0070693_1004281612 172
242 3300005563 Ga0068855_100218159 Ga0068855_1002181592 172
243 3300005564 Ga0070664_100206813 Ga0070664_1002068132 172
244 3300005577 Ga0068857_100026664 Ga0068857_1000266645 172
245 3300005577 Ga0068857_100113007 Ga0068857_1001130072 172
246 3300005577 Ga0068857_100224002 Ga0068857_1002240022 172
247 3300005578 Ga0068854_100408156 Ga0068854_1004081561 172
248 3300005614 Ga0068856_100131278 Ga0068856_1001312784 172
249 3300005614 Ga0068856_100141095 Ga0068856_1001410953 172
250 3300005614 Ga0068856_100333868 Ga0068856_1003338683 172
251 3300005616 Ga0068852_100324583 Ga0068852_1003245833 172
252 3300005616 Ga0068852_100427970 Ga0068852_1004279702 172
253 3300005617 Ga0068859_100245662 Ga0068859_1002456623 172
254 3300005718 Ga0068866_10043808 Ga0068866_100438083 172
255 3300005718 Ga0068866_10090021 Ga0068866_100900212 172
256 3300005719 Ga0068861_100002424 Ga0068861_10000242414 172
257 3300005842 Ga0068858_100353047 Ga0068858_1003530472 172
258 3300005844 Ga0068862_100452969 Ga0068862_1004529692 172
259 3300005844 Ga0068862_100538650 Ga0068862_1005386502 172
260 3300005937 Ga0081455_10012924 Ga0081455_100129246 172
261 3300005937 Ga0081455_10026114 Ga0081455_100261145 172
262 3300005983 Ga0081540_1012281 Ga0081540_10122815 172
263 3300005985 Ga0081539_10006784 Ga0081539_100067848 172
264 3300006058 Ga0075432_10006518 Ga0075432_100065183 172
265 3300006058 Ga0075432_10136732 Ga0075432_101367322 172
266 3300006163 Ga0070715_10064900 Ga0070715_100649003 172
267 3300006173 Ga0070716_101103349 Ga0070716_1011033491 172
268 3300006844 Ga0075428_100111253 Ga0075428_1001112532 172
269 3300006844 Ga0075428_100138696 Ga0075428_1001386965 172
270 3300006846 Ga0075430_100395765 Ga0075430_1003957652 172
271 3300006847 Ga0075431_100283699 Ga0075431_1002836992 172
272 3300006847 Ga0075431_100963738 Ga0075431_1009637382 172
273 3300006852 Ga0075433_10116251 Ga0075433_101162512 172
274 3300006852 Ga0075433_10292703 Ga0075433_102927032 172
275 3300006871 Ga0075434_100187823 Ga0075434_1001878233 172
276 3300006871 Ga0075434_100219450 Ga0075434_1002194503 172
277 3300006871 Ga0075434_100287566 Ga0075434_1002875662 172
278 3300006880 Ga0075429_100129439 Ga0075429_1001294393 172
279 3300006881 Ga0068865_100243968 Ga0068865_1002439682 172
280 3300006881 Ga0068865_100462453 Ga0068865_1004624532 172
281 3300006914 Ga0075436_100014628 Ga0075436_1000146287 172
282 3300006931 Ga0097620_100245666 Ga0097620_1002456662 172
283 3300007076 Ga0075435_100101240 Ga0075435_1001012404 172
284 3300007076 Ga0075435_100432123 Ga0075435_1004321231 172
285 3300009093 Ga0105240_10170198 Ga0105240_101701982 172
286 3300009094 Ga0111539_10004483 Ga0111539_1000448322 172
287 3300009094 Ga0111539_10016073 Ga0111539_100160736 172
288 3300009094 Ga0111539_10476252 Ga0111539_104762522 172
289 3300009098 Ga0105245_10014895 Ga0105245_100148956 172
290 3300009098 Ga0105245_10094899 Ga0105245_100948994 172
291 3300009098 Ga0105245_10113502 Ga0105245_101135023 172
292 3300009098 Ga0105245_10249285 Ga0105245_102492852 172
293 3300009098 Ga0105245_10393290 Ga0105245_103932901 172
294 3300009098 Ga0105245_10772006 Ga0105245_107720061 172
295 3300009098 Ga0105245_10866365 Ga0105245_108663652 172
296 3300009147 Ga0114129_10204091 Ga0114129_102040913 172
297 3300009147 Ga0114129_11154630 Ga0114129_111546301 172
298 3300009148 Ga0105243_10013014 Ga0105243_100130142 172
299 3300009148 Ga0105243_10186336 Ga0105243_101863363 172
300 3300009148 Ga0105243_10526722 Ga0105243_105267222 172
301 3300009174 Ga0105241_10144058 Ga0105241_101440584 172
302 3300009176 Ga0105242_10053221 Ga0105242_100532213 172
303 3300009176 Ga0105242_10273755 Ga0105242_102737552 172
304 3300009177 Ga0105248_10199689 Ga0105248_101996893 172
305 3300009553 Ga0105249_10013812 Ga0105249_100138127 172
306 3300009553 Ga0105249_10117370 Ga0105249_101173702 172
307 3300009553 Ga0105249_10119279 Ga0105249_101192793 172
308 3300009553 Ga0105249_10393711 Ga0105249_103937112 172
309 3300010375 Ga0105239_10153954 Ga0105239_101539542 172
310 3300010375 Ga0105239_10166621 Ga0105239_101666215 172
311 3300010375 Ga0105239_10212834 Ga0105239_102128344 172
312 3300010375 Ga0105239_10826452 Ga0105239_108264522 172
313 3300012487 Ga0157321_1002465 Ga0157321_10024652 172
314 3300012491 Ga0157329_1010813 Ga0157329_10108132 172
315 3300012507 Ga0157342_1026908 Ga0157342_10269082 172
316 3300013100 Ga0157373_10408270 Ga0157373_104082702 172
317 3300013102 Ga0157371_10104947 Ga0157371_101049473 172
318 3300013105 Ga0157369_10712832 Ga0157369_107128322 172
319 3300013297 Ga0157378_10077747 Ga0157378_100777474 172
320 3300013306 Ga0163162_10028521 Ga0163162_100285215 172
321 3300013306 Ga0163162_10122773 Ga0163162_101227732 172
322 3300013306 Ga0163162_10312379 Ga0163162_103123792 172
323 3300013306 Ga0163162_12167155 Ga0163162_121671551 172
324 3300013308 Ga0157375_10939616 Ga0157375_109396162 172
325 3300014325 Ga0163163_10270577 Ga0163163_102705771 172
326 3300014325 Ga0163163_10338406 Ga0163163_103384063 172
327 3300014325 Ga0163163_10694992 Ga0163163_106949921 172
328 3300014326 Ga0157380_10092789 Ga0157380_100927892 172
329 3300014745 Ga0157377_10131718 Ga0157377_101317182 172
330 3300014745 Ga0157377_10619585 Ga0157377_106195852 172
331 3300014968 Ga0157379_10449395 Ga0157379_104493952 172
332 3300014968 Ga0157379_11164608 Ga0157379_111646082 172
333 3300014969 Ga0157376_10227182 Ga0157376_102271822 172
334 3300014969 Ga0157376_10247852 Ga0157376_102478522 172
335 3300014969 Ga0157376_11240889 Ga0157376_112408891 172
336 3300017792 Ga0163161_10033749 Ga0163161_100337495 172
337 3300025899 Ga0207642_10344990 Ga0207642_103449902 172
338 3300025901 Ga0207688_10073986 Ga0207688_100739862 172
339 3300025905 Ga0207685_10088473 Ga0207685_100884731 172
340 3300025910 Ga0207684_11140060 Ga0207684_111400602 172
341 3300025917 Ga0207660_10041554 Ga0207660_100415545 172
342 3300025917 Ga0207660_10416144 Ga0207660_104161442 172
343 3300025921 Ga0207652_10031128 Ga0207652_100311285 172
344 3300025921 Ga0207652_10186785 Ga0207652_101867853 172
345 3300025922 Ga0207646_10398511 Ga0207646_103985111 172
346 3300025926 Ga0207659_10332571 Ga0207659_103325712 172
347 3300025927 Ga0207687_10006344 Ga0207687_100063446 172
348 3300025927 Ga0207687_10158482 Ga0207687_101584822 172
349 3300025927 Ga0207687_10244862 Ga0207687_102448622 172
350 3300025927 Ga0207687_10303368 Ga0207687_103033682 172
351 3300025927 Ga0207687_10515905 Ga0207687_105159052 172
352 3300025928 Ga0207700_10379969 Ga0207700_103799691 172
353 3300025932 Ga0207690_10124969 Ga0207690_101249692 172
354 3300025933 Ga0207706_10008012 Ga0207706_100080126 172
355 3300025933 Ga0207706_10021316 Ga0207706_100213165 172
356 3300025933 Ga0207706_10358730 Ga0207706_103587302 172
357 3300025934 Ga0207686_10044632 Ga0207686_100446322 172
358 3300025934 Ga0207686_10201471 Ga0207686_102014712 172
359 3300025934 Ga0207686_10667105 Ga0207686_106671052 172
360 3300025935 Ga0207709_10123285 Ga0207709_101232853 172
361 3300025935 Ga0207709_10252863 Ga0207709_102528632 172
362 3300025935 Ga0207709_10325377 Ga0207709_103253772 172
363 3300025938 Ga0207704_10010376 Ga0207704_100103768 172
364 3300025938 Ga0207704_10273109 Ga0207704_102731092 172
365 3300025939 Ga0207665_10184889 Ga0207665_101848892 172
366 3300025941 Ga0207711_10170695 Ga0207711_101706953 172
367 3300025944 Ga0207661_10056126 Ga0207661_100561265 172
368 3300025944 Ga0207661_10955460 Ga0207661_109554602 172
369 3300025945 Ga0207679_10129309 Ga0207679_101293092 172
370 3300025945 Ga0207679_10845596 Ga0207679_108455962 172
371 3300025949 Ga0207667_10107721 Ga0207667_101077213 172
372 3300025949 Ga0207667_11252481 Ga0207667_112524811 172
373 3300025960 Ga0207651_10352547 Ga0207651_103525472 172
374 3300025961 Ga0207712_10293861 Ga0207712_102938612 172
375 3300025961 Ga0207712_10309093 Ga0207712_103090932 172
376 3300025972 Ga0207668_10004402 Ga0207668_100044028 172
377 3300025972 Ga0207668_10650131 Ga0207668_106501312 172
378 3300025981 Ga0207640_10473582 Ga0207640_104735822 172
379 3300025981 Ga0207640_10771839 Ga0207640_107718392 172
380 3300026023 Ga0207677_10069828 Ga0207677_100698284 172
381 3300026067 Ga0207678_10124500 Ga0207678_101245004 172
382 3300026067 Ga0207678_10282643 Ga0207678_102826432 172
383 3300026075 Ga0207708_10004986 Ga0207708_100049864 172
384 3300026075 Ga0207708_10178169 Ga0207708_101781693 172
385 3300026075 Ga0207708_10462649 Ga0207708_104626492 172
386 3300026078 Ga0207702_10042912 Ga0207702_100429125 172
387 3300026078 Ga0207702_10066413 Ga0207702_100664135 172
388 3300026078 Ga0207702_10453594 Ga0207702_104535942 172
389 3300026088 Ga0207641_10725696 Ga0207641_107256962 172
390 3300026089 Ga0207648_10053203 Ga0207648_100532035 172
391 3300026116 Ga0207674_10010865 Ga0207674_1001086511 172
392 3300026116 Ga0207674_10051126 Ga0207674_100511264 172
393 3300026116 Ga0207674_10693155 Ga0207674_106931552 172
394 3300026118 Ga0207675_100000913 Ga0207675_10000091330 172
395 3300026118 Ga0207675_100019453 Ga0207675_1000194535 172
396 3300026121 Ga0207683_10275573 Ga0207683_102755732 172
397 3300026121 Ga0207683_10314418 Ga0207683_103144182 172
398 3300026142 Ga0207698_10069122 Ga0207698_100691222 172
399 3300026142 Ga0207698_10572108 Ga0207698_105721082 172
400 3300027717 Ga0209998_10015633 Ga0209998_100156332 172
401 3300027907 Ga0207428_10003755 Ga0207428_100037553 172
402 3300027907 Ga0207428_10034447 Ga0207428_100344475 172
403 3300028380 Ga0268265_10060726 Ga0268265_100607263 172
404 3300028380 Ga0268265_10495546 Ga0268265_104955462 172
405 3300031548 Ga0307408_100018577 Ga0307408_1000185773 172
406 3300031548 Ga0307408_100057959 Ga0307408_1000579595 172
407 3300031731 Ga0307405_10066382 Ga0307405_100663822 172
408 3300031824 Ga0307413_10006153 Ga0307413_100061532 172
409 3300031852 Ga0307410_10001018 Ga0307410_100010188 172
410 3300031901 Ga0307406_10028069 Ga0307406_100280693 172
411 3300031901 Ga0307406_10382217 Ga0307406_103822172 172
412 3300031901 Ga0307406_11084648 Ga0307406_110846482 172
413 3300031903 Ga0307407_10032545 Ga0307407_100325454 172
414 3300031903 Ga0307407_10181384 Ga0307407_101813842 172
415 3300031911 Ga0307412_10008538 Ga0307412_100085389 172
416 3300031911 Ga0307412_10159099 Ga0307412_101590993 172
417 3300031995 Ga0307409_100207385 Ga0307409_1002073853 172
418 3300032002 Ga0307416_100015861 Ga0307416_1000158616 172
419 3300032002 Ga0307416_100021279 Ga0307416_1000212792 172
420 3300032005 Ga0307411_10031761 Ga0307411_100317615 172
421 3300032126 Ga0307415_100011216 Ga0307415_1000112165 172
422 3300032126 Ga0307415_101254367 Ga0307415_1012543671 172
423 3300037312 Ga0395899_0002123 Ga0395899_0002123_2641_3159 172
424 3300037312 Ga0395899_0045080 Ga0395899_0045080_1778_2296 172
425 3300037312 Ga0395899_0407213 Ga0395899_0407213_169_687 172
426 3300037418 Ga0395900_0003185 Ga0395900_0003185_10614_11132 172
427 3300037418 Ga0395900_0021555 Ga0395900_0021555_3009_3527 172
428 3300037418 Ga0395900_0189658 Ga0395900_0189658_218_736 172
429 3300037418 Ga0395900_0222887 Ga0395900_0222887_763_1281 172
430 3300037418 Ga0395900_0457855 Ga0395900_0457855_236_757 172
431 3300037466 Ga0395898_0005219 Ga0395898_0005219_10487_11005 172
432 3300037466 Ga0395898_0025363 Ga0395898_0025363_2395_2913 172
433 3300037466 Ga0395898_0491938 Ga0395898_0491938_447_965 172
434 3300037471 Ga0395905_0001212 Ga0395905_0001212_18995_19513 172
435 3300037471 Ga0395905_0023832 Ga0395905_0023832_2598_3116 172
436 3300037471 Ga0395905_0226200 Ga0395905_0226200_211_729 172
437 3300038443 Ga0395901_0001100 Ga0395901_0001100_9429_9947 172
438 3300038443 Ga0395901_0049465 Ga0395901_0049465_1944_2462 172
439 3300038443 Ga0395901_0083391 Ga0395901_0083391_2667_3185 172
440 3300038443 Ga0395901_0395695 Ga0395901_0395695_584_1105 172
441 3300038443 Ga0395901_0745556 Ga0395901_0745556_32_550 172
442 3300038443 Ga0395901_0761923 Ga0395901_0761923_149_667 172
443 3300041413 Ga0439465_0279201 Ga0439465_0279201_13_531 172
444 3300042005 Ga0439448_0047820 Ga0439448_0047820_386_904 172
445 3300042012 Ga0439455_0062903 Ga0439455_0062903_350_871 172
446 3300042122 Ga0450920_024494 Ga0450920_024494_208_726 172
447 3300042435 Ga0439434_0016609 Ga0439434_0016609_1585_2103 172
448 3300042439 Ga0439464_0037283 Ga0439464_0037283_518_1039 172
449 3300042876 Ga0451577_0021578 Ga0451577_0021578_2722_3240 172
450 3300045051 Ga0451576_0050107 Ga0451576_0050107_688_1209 172
451 3300045051 Ga0451576_0521466 Ga0451576_0521466_407_925 172
452 3300046452 Ga0495617_036421 Ga0495617_036421_69_587 172
453 3300046453 Ga0495627_140710 Ga0495627_140710_108_629 172
454 3300046455 Ga0495603_0088530 Ga0495603_0088530_72_590 172
455 3300046458 Ga0495591_028520 Ga0495591_028520_248_766 172
456 3300046473 Ga0495582_0261920 Ga0495582_0261920_320_838 172
457 3300046474 Ga0495605_0087421 Ga0495605_0087421_669_1187 172
458 3300046491 Ga0495584_0025064 Ga0495584_0025064_1639_2157 172
459 3300046491 Ga0495584_0225306 Ga0495584_0225306_231_749 172
460 3300046492 Ga0495585_0053537 Ga0495585_0053537_694_1212 172
461 3300046500 Ga0495596_0048503 Ga0495596_0048503_1018_1536 172
462 3300046501 Ga0495607_0047580 Ga0495607_0047580_914_1432 172
463 3300046513 Ga0495616_0035386 Ga0495616_0035386_465_983 172
464 3300046518 Ga0495631_0030018 Ga0495631_0030018_54_572 172
465 3300046519 Ga0495632_0100313 Ga0495632_0100313_491_1009 172
466 3300046520 Ga0495637_0020977 Ga0495637_0020977_693_1211 172
467 3300046523 Ga0495644_0015286 Ga0495644_0015286_1985_2503 172
468 3300046525 Ga0495663_0018369 Ga0495663_0018369_901_1419 172
469 3300046528 Ga0495642_0054398 Ga0495642_0054398_572_1090 172
470 3300046533 Ga0495640_0737296 Ga0495640_0737296_51_578 172
471 3300046537 Ga0495598_0016978 Ga0495598_0016978_130_648 172
472 3300046538 Ga0495609_0013389 Ga0495609_0013389_951_1469 172
473 3300046542 Ga0495597_0325935 Ga0495597_0325935_50_568 172
474 3300046558 Ga0495633_0123275 Ga0495633_0123275_317_835 172
475 3300046615 Ga0495656_0022492 Ga0495656_0022492_1155_1673 172
476 3300046615 Ga0495656_0032082 Ga0495656_0032082_1302_1820 172
477 3300046615 Ga0495656_0129371 Ga0495656_0129371_66_584 172
478 3300046616 Ga0495668_0046919 Ga0495668_0046919_552_1070 172
479 3300046642 Ga0495634_0276716 Ga0495634_0276716_140_658 172
480 3300046648 Ga0495611_0303632 Ga0495611_0303632_167_685 172
481 3300046660 Ga0495625_0241822 Ga0495625_0241822_626_1144 172
482 3300046664 Ga0495659_0048070 Ga0495659_0048070_480_998 172
483 3300046665 Ga0495661_0041451 Ga0495661_0041451_1765_2283 172
484 3300046691 Ga0495670_0103313 Ga0495670_0103313_941_1459 172
485 3300046691 Ga0495670_0167111 Ga0495670_0167111_420_938 172
486 3300046692 Ga0495671_0029803 Ga0495671_0029803_1101_1619 172
487 3300046694 Ga0495649_0282345 Ga0495649_0282345_153_671 172
488 3300046794 Ga0495589_0017749 Ga0495589_0017749_2356_2874 172
489 3300047318 Ga0495636_0045566 Ga0495636_0045566_287_805 172
490 3300047323 Ga0495683_0044129 Ga0495683_0044129_928_1446 172
491 3300047445 Ga0495677_0046872 Ga0495677_0046872_883_1401 172
492 3300047447 Ga0495685_038111 Ga0495685_038111_1015_1533 172
493 3300047469 Ga0495673_0157462 Ga0495673_0157462_11_529 172
494 3300047472 Ga0495686_0282842 Ga0495686_0282842_44_562 172
495 3300048091 Ga0495626_0033876 Ga0495626_0033876_1075_1593 172
496 3300048903 Ga0496100_0110690 Ga0496100_0110690_1029_1547 172
497 3300048903 Ga0496100_0139117 Ga0496100_0139117_1154_1672 172
498 3300048904 Ga0496101_0123032 Ga0496101_0123032_32_550 172
499 3300048904 Ga0496101_0801616 Ga0496101_0801616_67_585 172
500 3300048904 Ga0496101_1131222 Ga0496101_1131222_12_530 172
501 3300048905 Ga0496102_0058991 Ga0496102_0058991_467_985 172
502 3300048905 Ga0496102_0073441 Ga0496102_0073441_1542_2060 172
503 3300048905 Ga0496102_0793439 Ga0496102_0793439_236_754 172
504 3300048906 Ga0496103_0060786 Ga0496103_0060786_812_1330 172
505 3300048906 Ga0496103_0147380 Ga0496103_0147380_203_721 172
506 3300048906 Ga0496103_0177060 Ga0496103_0177060_647_1165 172
507 3300048906 Ga0496103_0429251 Ga0496103_0429251_227_745 172
508 3300048907 Ga0496104_0009978 Ga0496104_0009978_3723_4241 172
509 3300048907 Ga0496104_0016700 Ga0496104_0016700_3092_3610 172
510 3300048907 Ga0496104_0090679 Ga0496104_0090679_1218_1736 172
511 3300048908 Ga0496105_0012501 Ga0496105_0012501_3141_3659 172
512 3300048908 Ga0496105_0019775 Ga0496105_0019775_4816_5334 172
513 3300048908 Ga0496105_0131713 Ga0496105_0131713_950_1468 172
514 3300048909 Ga0496106_0100420 Ga0496106_0100420_1285_1803 172
515 3300048909 Ga0496106_0166182 Ga0496106_0166182_455_973 172
516 3300048909 Ga0496106_0194467 Ga0496106_0194467_715_1233 172
517 3300048910 Ga0496107_0016532 Ga0496107_0016532_3963_4481 172
518 3300048910 Ga0496107_0029102 Ga0496107_0029102_2191_2709 172
519 3300048910 Ga0496107_0060631 Ga0496107_0060631_1569_2087 172
520 3300048910 Ga0496107_0088315 Ga0496107_0088315_1537_2055 172
521 3300048911 Ga0496108_0020845 Ga0496108_0020845_4540_5058 172
522 3300048911 Ga0496108_0020926 Ga0496108_0020926_99_617 172
523 3300048911 Ga0496108_0021148 Ga0496108_0021148_901_1419 172
524 3300048911 Ga0496108_0022262 Ga0496108_0022262_3460_3978 172
525 3300048911 Ga0496108_0660014 Ga0496108_0660014_235_753 172
526 3300048912 Ga0496109_0008103 Ga0496109_0008103_6245_6763 172
527 3300048912 Ga0496109_0009875 Ga0496109_0009875_3077_3595 172
528 3300048912 Ga0496109_0033881 Ga0496109_0033881_203_721 172
529 3300048912 Ga0496109_0070748 Ga0496109_0070748_342_860 172
530 3300048913 Ga0496110_0000989 Ga0496110_0000989_7250_7768 172
531 3300048913 Ga0496110_0011692 Ga0496110_0011692_1632_2150 172
532 3300048913 Ga0496110_0014010 Ga0496110_0014010_5605_6123 172
533 3300048913 Ga0496110_0029152 Ga0496110_0029152_1210_1728 172
534 3300048913 Ga0496110_0368799 Ga0496110_0368799_342_860 172
535 3300048914 Ga0496111_0000061 Ga0496111_0000061_28672_29190 172
536 3300048914 Ga0496111_0026745 Ga0496111_0026745_451_969 172
537 3300048914 Ga0496111_0040100 Ga0496111_0040100_1175_1693 172
538 3300048914 Ga0496111_0303562 Ga0496111_0303562_429_947 172
539 3300048915 Ga0496112_0094070 Ga0496112_0094070_1299_1817 172
540 3300048916 Ga0496113_0005204 Ga0496113_0005204_7381_7899 172
541 3300048916 Ga0496113_1003086 Ga0496113_1003086_32_550 172
542 3300048917 Ga0496114_0000990 Ga0496114_0000990_3080_3598 172
543 3300048917 Ga0496114_0032625 Ga0496114_0032625_2689_3207 172
544 3300048917 Ga0496114_0611835 Ga0496114_0611835_262_780 172
545 3300048918 Ga0496115_0208828 Ga0496115_0208828_32_550 172
546 3300049572 Ga0501036_1386209 Ga0501036_1386209_14_532 172
547 3300049577 Ga0501041_0068525 Ga0501041_0068525_999_1517 172
548 3300049583 Ga0501067_0046851 Ga0501067_0046851_170_688 172
549 3300049583 Ga0501067_0093214 Ga0501067_0093214_306_824 172
550 3300049584 Ga0501068_0009594 Ga0501068_0009594_4701_5219 172
551 3300049585 Ga0501069_0002478 Ga0501069_0002478_5285_5803 172
552 3300049586 Ga0501070_0082845 Ga0501070_0082845_1721_2239 172
553 3300049587 Ga0501071_0064226 Ga0501071_0064226_1086_1604 172
554 3300049588 Ga0501072_0379839 Ga0501072_0379839_400_918 172
555 3300049588 Ga0501072_0975142 Ga0501072_0975142_22_540 172
556 3300049590 Ga0501074_0145528 Ga0501074_0145528_758_1276 172
557 3300049591 Ga0501075_0306460 Ga0501075_0306460_115_633 172
558 3300049741 Ga0501079_0207795 Ga0501079_0207795_265_783 172
559 3300049743 Ga0501081_0119433 Ga0501081_0119433_1263_1781 172
560 3300049851 Ga0501212_016970 Ga0501212_016970_442_960 172
561 3300050507 nmdc:mga05p37_632795_c1 nmdc:mga05p37_632795_c1_196_717 172
562 3300050508 nmdc:mga09592_208855_c1 nmdc:mga09592_208855_c1_496_1017 172
563 3300050509 nmdc:mga0qj67_368024_c1 nmdc:mga0qj67_368024_c1_505_1026 172
564 3300050510 nmdc:mga06r32_1288371_c1 nmdc:mga06r32_1288371_c1_77_598 172
565 3300050510 nmdc:mga06r32_347968_c1 nmdc:mga06r32_347968_c1_589_1110 172
566 3300050511 nmdc:mga08y16_3967_c1 nmdc:mga08y16_3967_c1_1028_1549 172
567 3300050511 nmdc:mga08y16_527898_c1 nmdc:mga08y16_527898_c1_384_902 172
568 3300050511 nmdc:mga08y16_91270_c1 nmdc:mga08y16_91270_c1_2340_2858 172
569 3300050511 nmdc:mga08y16_9596_c1 nmdc:mga08y16_9596_c1_7710_8228 172
570 3300050512 nmdc:mga0n895_235227_c1 nmdc:mga0n895_235227_c1_129_650 172
571 3300050512 nmdc:mga0n895_69449_c1 nmdc:mga0n895_69449_c1_1405_1926 172
572 3300050512 nmdc:mga0n895_818065_c1 nmdc:mga0n895_818065_c1_95_613 172
573 3300050513 nmdc:mga0rr50_228395_c1 nmdc:mga0rr50_228395_c1_963_1484 172
574 3300050513 nmdc:mga0rr50_900034_c1 nmdc:mga0rr50_900034_c1_76_597 172
575 3300050514 nmdc:mga08x19_124824_c1 nmdc:mga08x19_124824_c1_812_1333 172
576 3300050515 nmdc:mga0a205_146001_c1 nmdc:mga0a205_146001_c1_648_1169 172
577 3300050515 nmdc:mga0a205_355641_c1 nmdc:mga0a205_355641_c1_648_1166 172
578 3300053083 Ga0495655_0014165 Ga0495655_0014165_1091_1609 172
579 3300054114 Ga0501084_0037438 Ga0501084_0037438_3301_3819 172
580 3300060353 Ga0501082_0024988 Ga0501082_0024988_2790_3308 172
581 3300060353 Ga0501082_0536456 Ga0501082_0536456_315_833 172
582 3300005329 Ga0070683_100896093 Ga0070683_1008960932 173
583 3300005330 Ga0070690_100030426 Ga0070690_1000304263 173
584 3300005334 Ga0068869_100065671 Ga0068869_1000656712 173
585 3300005334 Ga0068869_100237428 Ga0068869_1002374282 173
586 3300005335 Ga0070666_11064517 Ga0070666_110645171 173
587 3300005338 Ga0068868_100286811 Ga0068868_1002868112 173
588 3300005347 Ga0070668_100049552 Ga0070668_1000495524 173
589 3300005347 Ga0070668_100772215 Ga0070668_1007722151 173
590 3300005355 Ga0070671_100599287 Ga0070671_1005992872 173
591 3300005356 Ga0070674_100532753 Ga0070674_1005327531 173
592 3300005435 Ga0070714_100038774 Ga0070714_1000387745 173
593 3300005436 Ga0070713_100363709 Ga0070713_1003637092 173
594 3300005459 Ga0068867_100270724 Ga0068867_1002707242 173
595 3300005466 Ga0070685_10203862 Ga0070685_102038622 173
596 3300005535 Ga0070684_100073692 Ga0070684_1000736925 173
597 3300005535 Ga0070684_100208069 Ga0070684_1002080692 173
598 3300005544 Ga0070686_100078490 Ga0070686_1000784903 173
599 3300005544 Ga0070686_100609865 Ga0070686_1006098651 173
600 3300005548 Ga0070665_100547070 Ga0070665_1005470702 173
601 3300005564 Ga0070664_100591133 Ga0070664_1005911332 173
602 3300005564 Ga0070664_100725240 Ga0070664_1007252402 173
603 3300005577 Ga0068857_100007066 Ga0068857_10000706612 173
604 3300005614 Ga0068856_100009373 Ga0068856_1000093735 173
605 3300005615 Ga0070702_100004814 Ga0070702_1000048143 173
606 3300005842 Ga0068858_100839237 Ga0068858_1008392371 173
607 3300005937 Ga0081455_10010933 Ga0081455_1001093312 173
608 3300005937 Ga0081455_10037900 Ga0081455_100379002 173
609 3300005985 Ga0081539_10007140 Ga0081539_100071407 173
610 3300006038 Ga0075365_10277440 Ga0075365_102774402 173
611 3300006163 Ga0070715_10021794 Ga0070715_100217943 173
612 3300006173 Ga0070716_100191068 Ga0070716_1001910682 173
613 3300006175 Ga0070712_100029726 Ga0070712_1000297265 173
614 3300006844 Ga0075428_100005458 Ga0075428_1000054581 173
615 3300006846 Ga0075430_100024628 Ga0075430_1000246282 173
616 3300006846 Ga0075430_100461322 Ga0075430_1004613222 173
617 3300006846 Ga0075430_100569942 Ga0075430_1005699421 173
618 3300006880 Ga0075429_100040651 Ga0075429_1000406515 173
619 3300006881 Ga0068865_100112413 Ga0068865_1001124132 173
620 3300006881 Ga0068865_100144097 Ga0068865_1001440973 173
621 3300009094 Ga0111539_10212514 Ga0111539_102125143 173
622 3300009098 Ga0105245_10172767 Ga0105245_101727674 173
623 3300009098 Ga0105245_10520023 Ga0105245_105200232 173
624 3300009147 Ga0114129_10049600 Ga0114129_100496005 173
625 3300009147 Ga0114129_10085007 Ga0114129_100850073 173
626 3300009148 Ga0105243_10349557 Ga0105243_103495572 173
627 3300009148 Ga0105243_10594212 Ga0105243_105942122 173
628 3300009148 Ga0105243_11439924 Ga0105243_114399241 173
629 3300009176 Ga0105242_11178556 Ga0105242_111785562 173
630 3300009553 Ga0105249_10172754 Ga0105249_101727543 173
631 3300009553 Ga0105249_10787344 Ga0105249_107873442 173
632 3300010375 Ga0105239_10221068 Ga0105239_102210682 173
633 3300010375 Ga0105239_10772623 Ga0105239_107726231 173
634 3300010375 Ga0105239_11545387 Ga0105239_115453872 173
635 3300011119 Ga0105246_10119238 Ga0105246_101192382 173
636 3300011119 Ga0105246_10190082 Ga0105246_101900821 173
637 3300013306 Ga0163162_10018138 Ga0163162_100181386 173
638 3300013307 Ga0157372_10012974 Ga0157372_100129748 173
639 3300013308 Ga0157375_10081109 Ga0157375_100811096 173
640 3300014497 Ga0182008_10214597 Ga0182008_102145972 173
641 3300014968 Ga0157379_10550758 Ga0157379_105507582 173
642 3300014969 Ga0157376_10149254 Ga0157376_101492541 173
643 3300014969 Ga0157376_10357952 Ga0157376_103579522 173
644 3300014969 Ga0157376_12481369 Ga0157376_124813691 173
645 3300025908 Ga0207643_10244368 Ga0207643_102443682 173
646 3300025916 Ga0207663_10016959 Ga0207663_100169595 173
647 3300025919 Ga0207657_10150928 Ga0207657_101509283 173
648 3300025934 Ga0207686_10101386 Ga0207686_101013862 173
649 3300025938 Ga0207704_10069954 Ga0207704_100699542 173
650 3300025944 Ga0207661_10020944 Ga0207661_100209443 173
651 3300025944 Ga0207661_10042739 Ga0207661_100427396 173
652 3300025944 Ga0207661_10364887 Ga0207661_103648872 173
653 3300025945 Ga0207679_10516589 Ga0207679_105165891 173
654 3300025961 Ga0207712_10690146 Ga0207712_106901462 173
655 3300025961 Ga0207712_10918192 Ga0207712_109181922 173
656 3300025972 Ga0207668_10213466 Ga0207668_102134662 173
657 3300026023 Ga0207677_10036202 Ga0207677_100362024 173
658 3300026023 Ga0207677_10315266 Ga0207677_103152662 173
659 3300026075 Ga0207708_10296808 Ga0207708_102968082 173
660 3300026075 Ga0207708_10344007 Ga0207708_103440072 173
661 3300026089 Ga0207648_10377428 Ga0207648_103774282 173
662 3300026116 Ga0207674_10017099 Ga0207674_100170993 173
663 3300026118 Ga0207675_100420993 Ga0207675_1004209931 173
664 3300026142 Ga0207698_11521014 Ga0207698_115210142 173
665 3300028379 Ga0268266_10191032 Ga0268266_101910323 173
666 3300028380 Ga0268265_10111584 Ga0268265_101115842 173
667 3300028381 Ga0268264_10303553 Ga0268264_103035532 173
668 3300031548 Ga0307408_100066364 Ga0307408_1000663642 173
669 3300031824 Ga0307413_11424262 Ga0307413_114242621 173
670 3300031852 Ga0307410_10039370 Ga0307410_100393702 173
671 3300031901 Ga0307406_10130643 Ga0307406_101306433 173
672 3300031903 Ga0307407_10055570 Ga0307407_100555702 173
673 3300031911 Ga0307412_10027022 Ga0307412_100270225 173
674 3300031995 Ga0307409_100301192 Ga0307409_1003011922 173
675 3300031995 Ga0307409_100628401 Ga0307409_1006284012 173
676 3300032002 Ga0307416_100385979 Ga0307416_1003859792 173
677 3300032004 Ga0307414_10105005 Ga0307414_101050053 173
678 3300032005 Ga0307411_10513613 Ga0307411_105136131 173
679 3300032126 Ga0307415_100217280 Ga0307415_1002172802 173
680 3300032126 Ga0307415_100348511 Ga0307415_1003485112 173
681 3300036401 Ga0373937_0336722 Ga0373937_0336722_22_543 173
682 3300037312 Ga0395899_0086100 Ga0395899_0086100_260_790 173
683 3300037312 Ga0395899_0525442 Ga0395899_0525442_17_547 173
684 3300037418 Ga0395900_0044991 Ga0395900_0044991_3444_3974 173
685 3300037418 Ga0395900_0062293 Ga0395900_0062293_1361_1891 173
686 3300037418 Ga0395900_0076257 Ga0395900_0076257_129_659 173
687 3300037418 Ga0395900_0183897 Ga0395900_0183897_657_1187 173
688 3300037418 Ga0395900_0437074 Ga0395900_0437074_366_896 173
689 3300037418 Ga0395900_0634219 Ga0395900_0634219_273_803 173
690 3300037466 Ga0395898_0002613 Ga0395898_0002613_8013_8543 173
691 3300037466 Ga0395898_0230719 Ga0395898_0230719_518_1048 173
692 3300037466 Ga0395898_0237782 Ga0395898_0237782_859_1389 173
693 3300037466 Ga0395898_0266177 Ga0395898_0266177_738_1268 173
694 3300037466 Ga0395898_0404140 Ga0395898_0404140_655_1185 173
695 3300037466 Ga0395898_1164516 Ga0395898_1164516_104_634 173
696 3300037471 Ga0395905_0039611 Ga0395905_0039611_2201_2731 173
697 3300037471 Ga0395905_0054704 Ga0395905_0054704_2258_2788 173
698 3300037471 Ga0395905_0057239 Ga0395905_0057239_2875_3405 173
699 3300037471 Ga0395905_0156721 Ga0395905_0156721_1558_2088 173
700 3300037471 Ga0395905_0391383 Ga0395905_0391383_461_991 173
701 3300038443 Ga0395901_0001850 Ga0395901_0001850_9684_10214 173
702 3300038443 Ga0395901_0017959 Ga0395901_0017959_3787_4317 173
703 3300038443 Ga0395901_0061814 Ga0395901_0061814_58_588 173
704 3300038443 Ga0395901_0442172 Ga0395901_0442172_602_1132 173
705 3300038443 Ga0395901_1044316 Ga0395901_1044316_130_660 173
706 3300041459 Ga0451800_0192217 Ga0451800_0192217_345_875 173
707 3300042005 Ga0439448_0023196 Ga0439448_0023196_495_1025 173
708 3300044673 Ga0453683_0012839 Ga0453683_0012839_4346_4867 173
709 3300044712 Ga0453684_0046007 Ga0453684_0046007_4419_4940 173
710 3300045051 Ga0451576_0002250 Ga0451576_0002250_25820_26341 173
711 3300046455 Ga0495603_0196648 Ga0495603_0196648_492_1022 173
712 3300046461 Ga0495641_0030587 Ga0495641_0030587_1819_2349 173
713 3300046474 Ga0495605_0058579 Ga0495605_0058579_1280_1810 173
714 3300046491 Ga0495584_0065661 Ga0495584_0065661_1188_1718 173
715 3300046499 Ga0495594_0380816 Ga0495594_0380816_60_590 173
716 3300046501 Ga0495607_0381401 Ga0495607_0381401_95_625 173
717 3300046513 Ga0495616_0035556 Ga0495616_0035556_376_906 173
718 3300046515 Ga0495620_0083889 Ga0495620_0083889_556_1086 173
719 3300046520 Ga0495637_0038044 Ga0495637_0038044_425_955 173
720 3300046526 Ga0495666_0230391 Ga0495666_0230391_301_831 173
721 3300046528 Ga0495642_0076354 Ga0495642_0076354_322_852 173
722 3300046531 Ga0495665_0030829 Ga0495665_0030829_1979_2509 173
723 3300046538 Ga0495609_0099557 Ga0495609_0099557_150_680 173
724 3300046616 Ga0495668_0090581 Ga0495668_0090581_473_1003 173
725 3300046664 Ga0495659_0008584 Ga0495659_0008584_1985_2515 173
726 3300046664 Ga0495659_0106410 Ga0495659_0106410_83_613 173
727 3300046665 Ga0495661_0082060 Ga0495661_0082060_119_649 173
728 3300046681 Ga0495647_0134114 Ga0495647_0134114_187_717 173
729 3300046681 Ga0495647_0185029 Ga0495647_0185029_87_617 173
730 3300046683 Ga0495658_0010122 Ga0495658_0010122_2685_3215 173
731 3300046684 Ga0495669_0057692 Ga0495669_0057692_254_784 173
732 3300046689 Ga0495613_0027711 Ga0495613_0027711_230_760 173
733 3300046690 Ga0495624_0096157 Ga0495624_0096157_76_606 173
734 3300046810 Ga0495660_0173046 Ga0495660_0173046_235_765 173
735 3300047315 Ga0495581_0002157 Ga0495581_0002157_8621_9151 173
736 3300047318 Ga0495636_0104283 Ga0495636_0104283_404_934 173
737 3300047321 Ga0495676_0048973 Ga0495676_0048973_1161_1691 173
738 3300047445 Ga0495677_0028600 Ga0495677_0028600_648_1178 173
739 3300047472 Ga0495686_0352949 Ga0495686_0352949_183_713 173
740 3300048088 Ga0495602_0396781 Ga0495602_0396781_188_709 173
741 3300048903 Ga0496100_0011221 Ga0496100_0011221_1959_2489 173
742 3300048904 Ga0496101_0004366 Ga0496101_0004366_2336_2866 173
743 3300048905 Ga0496102_0007946 Ga0496102_0007946_5807_6337 173
744 3300048906 Ga0496103_0150603 Ga0496103_0150603_649_1179 173
745 3300048907 Ga0496104_0281818 Ga0496104_0281818_347_877 173
746 3300048908 Ga0496105_0128108 Ga0496105_0128108_759_1289 173
747 3300048909 Ga0496106_0003471 Ga0496106_0003471_2342_2872 173
748 3300048910 Ga0496107_0001575 Ga0496107_0001575_6307_6837 173
749 3300048911 Ga0496108_0040952 Ga0496108_0040952_1520_2050 173
750 3300048911 Ga0496108_0081016 Ga0496108_0081016_579_1109 173
751 3300048912 Ga0496109_0439461 Ga0496109_0439461_536_1066 173
752 3300048912 Ga0496109_0481138 Ga0496109_0481138_431_961 173
753 3300048913 Ga0496110_0053559 Ga0496110_0053559_1472_2002 173
754 3300048913 Ga0496110_0219272 Ga0496110_0219272_963_1484 173
755 3300048914 Ga0496111_0847654 Ga0496111_0847654_121_642 173
756 3300048915 Ga0496112_0000580 Ga0496112_0000580_21712_22233 173
757 3300048916 Ga0496113_0935062 Ga0496113_0935062_133_663 173
758 3300048917 Ga0496114_0004294 Ga0496114_0004294_8966_9496 173
759 3300048918 Ga0496115_0387038 Ga0496115_0387038_115_645 173
760 3300049581 Ga0501047_1161488 Ga0501047_1161488_15_545 173
761 3300049584 Ga0501068_0287858 Ga0501068_0287858_26_556 173
762 3300049584 Ga0501068_0876552 Ga0501068_0876552_11_535 173
763 3300049586 Ga0501070_0148420 Ga0501070_0148420_268_798 173
764 3300049588 Ga0501072_0956339 Ga0501072_0956339_128_652 173
765 3300049589 Ga0501073_0303149 Ga0501073_0303149_544_1074 173
766 3300049589 Ga0501073_0403824 Ga0501073_0403824_77_607 173
767 3300049741 Ga0501079_0262201 Ga0501079_0262201_103_633 173
768 3300049742 Ga0501080_0052517 Ga0501080_0052517_913_1443 173
769 3300049822 Ga0501035_0354544 Ga0501035_0354544_189_719 173
770 3300050507 nmdc:mga05p37_328162_c1 nmdc:mga05p37_328162_c1_229_759 173
771 3300050507 nmdc:mga05p37_5169_c1 nmdc:mga05p37_5169_c1_5355_5876 173
772 3300050508 nmdc:mga09592_36326_c1 nmdc:mga09592_36326_c1_576_1097 173
773 3300050509 nmdc:mga0qj67_228278_c1 nmdc:mga0qj67_228278_c1_814_1344 173
774 3300050509 nmdc:mga0qj67_41943_c1 nmdc:mga0qj67_41943_c1_2580_3101 173
775 3300050509 nmdc:mga0qj67_613674_c1 nmdc:mga0qj67_613674_c1_116_637 173
776 3300050510 nmdc:mga06r32_580342_c1 nmdc:mga06r32_580342_c1_521_1045 173
777 3300050510 nmdc:mga06r32_967967_c1 nmdc:mga06r32_967967_c1_85_606 173
778 3300050515 nmdc:mga0a205_183296_c1 nmdc:mga0a205_183296_c1_1282_1812 173
779 3300054114 Ga0501084_0983958 Ga0501084_0983958_22_546 173
780 3300061734 Ga0530510_0127555 Ga0530510_0127555_1140_1670 173
781 3300003373 JGI25407J50210_10003696 JGI25407J50210_100036966 174
782 3300003373 JGI25407J50210_10012536 JGI25407J50210_100125362 174
783 3300005329 Ga0070683_100003232 Ga0070683_1000032323 174
784 3300005329 Ga0070683_100145696 Ga0070683_1001456963 174
785 3300005331 Ga0070670_100005367 Ga0070670_10000536714 174
786 3300005334 Ga0068869_100293960 Ga0068869_1002939602 174
787 3300005338 Ga0068868_100807503 Ga0068868_1008075031 174
788 3300005340 Ga0070689_100113525 Ga0070689_1001135253 174
789 3300005344 Ga0070661_100524915 Ga0070661_1005249152 174
790 3300005354 Ga0070675_100220962 Ga0070675_1002209622 174
791 3300005354 Ga0070675_100325641 Ga0070675_1003256412 174
792 3300005364 Ga0070673_100000724 Ga0070673_10000072418 174
793 3300005365 Ga0070688_100001291 Ga0070688_10000129114 174
794 3300005456 Ga0070678_100061997 Ga0070678_1000619972 174
795 3300005458 Ga0070681_10761679 Ga0070681_107616791 174
796 3300005466 Ga0070685_10009316 Ga0070685_100093165 174
797 3300005535 Ga0070684_100003023 Ga0070684_1000030239 174
798 3300005544 Ga0070686_100049268 Ga0070686_1000492682 174
799 3300005617 Ga0068859_100451380 Ga0068859_1004513802 174
800 3300005937 Ga0081455_10045237 Ga0081455_100452376 174
801 3300005937 Ga0081455_10069231 Ga0081455_100692315 174
802 3300005981 Ga0081538_10000059 Ga0081538_1000005925 174
803 3300005981 Ga0081538_10001038 Ga0081538_100010384 174
804 3300005981 Ga0081538_10003925 Ga0081538_100039255 174
805 3300005981 Ga0081538_10004995 Ga0081538_100049954 174
806 3300006931 Ga0097620_100451349 Ga0097620_1004513492 174
807 3300009094 Ga0111539_10015915 Ga0111539_100159156 174
808 3300009094 Ga0111539_10033880 Ga0111539_100338803 174
809 3300009177 Ga0105248_10616511 Ga0105248_106165111 174
810 3300013296 Ga0157374_10065260 Ga0157374_100652603 174
811 3300013297 Ga0157378_10837217 Ga0157378_108372172 174
812 3300025315 Ga0207697_10145097 Ga0207697_101450972 174
813 3300025925 Ga0207650_10007816 Ga0207650_100078163 174
814 3300025926 Ga0207659_10256197 Ga0207659_102561972 174
815 3300025931 Ga0207644_10681245 Ga0207644_106812452 174
816 3300025936 Ga0207670_10052217 Ga0207670_100522173 174
817 3300025938 Ga0207704_10082832 Ga0207704_100828323 174
818 3300025940 Ga0207691_10108646 Ga0207691_101086463 174
819 3300025940 Ga0207691_10407097 Ga0207691_104070972 174
820 3300025941 Ga0207711_10215632 Ga0207711_102156323 174
821 3300025942 Ga0207689_10721332 Ga0207689_107213322 174
822 3300025944 Ga0207661_10016225 Ga0207661_100162258 174
823 3300025960 Ga0207651_10000299 Ga0207651_100002993 174
824 3300025960 Ga0207651_10500548 Ga0207651_105005482 174
825 3300026023 Ga0207677_10531098 Ga0207677_105310982 174
826 3300026121 Ga0207683_10088971 Ga0207683_100889712 174
827 3300027907 Ga0207428_10062017 Ga0207428_100620172 174
828 3300031241 Ga0265325_10118906 Ga0265325_101189062 174
829 3300035117 Ga0373953_0077814 Ga0373953_0077814_563_1105 174
830 3300035118 Ga0373954_0034072 Ga0373954_0034072_1116_1658 174
831 3300035119 Ga0373956_0007002 Ga0373956_0007002_2068_2610 174
832 3300035171 Ga0373946_0568611 Ga0373946_0568611_16_546 174
833 3300036401 Ga0373937_0004887 Ga0373937_0004887_7731_8273 174
834 3300048907 Ga0496104_0062449 Ga0496104_0062449_1774_2328 174
835 3300048915 Ga0496112_0260050 Ga0496112_0260050_506_1051 174
836 3300049568 Ga0501031_0000961 Ga0501031_0000961_13144_13668 174
837 3300049568 Ga0501031_0034384 Ga0501031_0034384_1686_2210 174
838 3300049569 Ga0501032_0005599 Ga0501032_0005599_1415_1939 174
839 3300049570 Ga0501033_0001359 Ga0501033_0001359_19253_19777 174
840 3300049570 Ga0501033_0162155 Ga0501033_0162155_57_581 174
841 3300049572 Ga0501036_0000470 Ga0501036_0000470_8069_8593 174
842 3300049573 Ga0501037_0000275 Ga0501037_0000275_19763_20287 174
843 3300049574 Ga0501038_0018137 Ga0501038_0018137_2046_2570 174
844 3300049574 Ga0501038_0134544 Ga0501038_0134544_215_739 174
845 3300049575 Ga0501039_0000176 Ga0501039_0000176_37413_37937 174
846 3300049575 Ga0501039_0121934 Ga0501039_0121934_300_824 174
847 3300049575 Ga0501039_1104633 Ga0501039_1104633_22_546 174
848 3300049576 Ga0501040_0000327 Ga0501040_0000327_15717_16241 174
849 3300049576 Ga0501040_0060781 Ga0501040_0060781_1025_1549 174
850 3300049576 Ga0501040_0438790 Ga0501040_0438790_333_857 174
851 3300049577 Ga0501041_0000736 Ga0501041_0000736_9603_10127 174
852 3300049577 Ga0501041_0072939 Ga0501041_0072939_33_557 174
853 3300049578 Ga0501042_0000738 Ga0501042_0000738_3772_4296 174
854 3300049578 Ga0501042_0038212 Ga0501042_0038212_1167_1691 174
855 3300049578 Ga0501042_0054934 Ga0501042_0054934_318_842 174
856 3300049578 Ga0501042_0161737 Ga0501042_0161737_65_589 174
857 3300049578 Ga0501042_0542314 Ga0501042_0542314_20_544 174
858 3300049579 Ga0501043_0000891 Ga0501043_0000891_20996_21520 174
859 3300049579 Ga0501043_0378744 Ga0501043_0378744_316_840 174
860 3300049580 Ga0501046_0005272 Ga0501046_0005272_3669_4193 174
861 3300049580 Ga0501046_0098368 Ga0501046_0098368_302_826 174
862 3300049580 Ga0501046_0114777 Ga0501046_0114777_878_1402 174
863 3300049580 Ga0501046_0199830 Ga0501046_0199830_832_1356 174
864 3300049581 Ga0501047_0001498 Ga0501047_0001498_20192_20716 174
865 3300049582 Ga0501048_0003680 Ga0501048_0003680_3794_4318 174
866 3300049582 Ga0501048_0160004 Ga0501048_0160004_456_980 174
867 3300049584 Ga0501068_0000011 Ga0501068_0000011_55899_56423 174
868 3300049584 Ga0501068_0257708 Ga0501068_0257708_535_1059 174
869 3300049585 Ga0501069_0009450 Ga0501069_0009450_2033_2557 174
870 3300049586 Ga0501070_0023391 Ga0501070_0023391_1851_2375 174
871 3300049587 Ga0501071_0002227 Ga0501071_0002227_3794_4318 174
872 3300049587 Ga0501071_0092530 Ga0501071_0092530_379_903 174
873 3300049587 Ga0501071_0433143 Ga0501071_0433143_67_591 174
874 3300049587 Ga0501071_0622363 Ga0501071_0622363_190_714 174
875 3300049588 Ga0501072_0003584 Ga0501072_0003584_3791_4315 174
876 3300049588 Ga0501072_0049039 Ga0501072_0049039_2433_2957 174
877 3300049588 Ga0501072_0087222 Ga0501072_0087222_1343_1867 174
878 3300049589 Ga0501073_0033899 Ga0501073_0033899_1051_1575 174
879 3300049590 Ga0501074_0000438 Ga0501074_0000438_3794_4318 174
880 3300049591 Ga0501075_0000040 Ga0501075_0000040_22663_23187 174
881 3300049591 Ga0501075_0098145 Ga0501075_0098145_798_1322 174
882 3300049591 Ga0501075_0185336 Ga0501075_0185336_878_1402 174
883 3300049592 Ga0501076_0000089 Ga0501076_0000089_9519_10043 174
884 3300049592 Ga0501076_0035621 Ga0501076_0035621_2308_2832 174
885 3300049592 Ga0501076_0584132 Ga0501076_0584132_139_666 174
886 3300049592 Ga0501076_1076563 Ga0501076_1076563_77_601 174
887 3300049593 Ga0501077_0000172 Ga0501077_0000172_32814_33338 174
888 3300049593 Ga0501077_0216903 Ga0501077_0216903_301_825 174
889 3300049741 Ga0501079_0000399 Ga0501079_0000399_11680_12204 174
890 3300049741 Ga0501079_0533386 Ga0501079_0533386_17_541 174
891 3300049742 Ga0501080_0019285 Ga0501080_0019285_2050_2574 174
892 3300049743 Ga0501081_0000040 Ga0501081_0000040_44390_44914 174
893 3300049743 Ga0501081_0078804 Ga0501081_0078804_1077_1601 174
894 3300049743 Ga0501081_0151302 Ga0501081_0151302_603_1127 174
895 3300049744 Ga0501083_0030195 Ga0501083_0030195_2032_2556 174
896 3300049744 Ga0501083_0065893 Ga0501083_0065893_1015_1539 174
897 3300049822 Ga0501035_0005775 Ga0501035_0005775_7369_7893 174
898 3300049822 Ga0501035_0184062 Ga0501035_0184062_1256_1780 174
899 3300049823 Ga0501044_0042148 Ga0501044_0042148_3794_4318 174
900 3300049824 Ga0501045_0000098 Ga0501045_0000098_28950_29474 174
901 3300049824 Ga0501045_0019519 Ga0501045_0019519_3541_4065 174
902 3300049824 Ga0501045_0062844 Ga0501045_0062844_1815_2339 174
903 3300050509 nmdc:mga0qj67_19561_c1 nmdc:mga0qj67_19561_c1_1568_2092 174
904 3300050511 nmdc:mga08y16_45566_c1 nmdc:mga08y16_45566_c1_1487_2011 174
905 3300053077 Ga0495601_0219762 Ga0495601_0219762_11_553 174
906 3300054114 Ga0501084_0002110 Ga0501084_0002110_9578_10102 174
907 3300054114 Ga0501084_0063641 Ga0501084_0063641_1057_1581 174
908 3300054114 Ga0501084_0359087 Ga0501084_0359087_176_700 174
909 3300054114 Ga0501084_0414711 Ga0501084_0414711_182_706 174
910 3300060353 Ga0501082_0000313 Ga0501082_0000313_40675_41199 174
911 3300060353 Ga0501082_0093581 Ga0501082_0093581_768_1292 174
912 3300060353 Ga0501082_0108042 Ga0501082_0108042_610_1134 174
913 3300060353 Ga0501082_0424530 Ga0501082_0424530_589_1113 174
914 3300061734 Ga0530510_0001549 Ga0530510_0001549_9603_10127 174
915 3300061734 Ga0530510_0407407 Ga0530510_0407407_270_794 174
916 3300005328 Ga0070676_10061055 Ga0070676_100610553 175
917 3300005329 Ga0070683_101607043 Ga0070683_1016070431 175
918 3300005330 Ga0070690_100075974 Ga0070690_1000759743 175
919 3300005335 Ga0070666_10095153 Ga0070666_100951533 175
920 3300005337 Ga0070682_100351863 Ga0070682_1003518632 175
921 3300005338 Ga0068868_100029603 Ga0068868_1000296035 175
922 3300005338 Ga0068868_101101452 Ga0068868_1011014521 175
923 3300005340 Ga0070689_100234803 Ga0070689_1002348032 175
924 3300005343 Ga0070687_100189213 Ga0070687_1001892131 175
925 3300005345 Ga0070692_10526698 Ga0070692_105266981 175
926 3300005347 Ga0070668_100046541 Ga0070668_1000465414 175
927 3300005364 Ga0070673_100166475 Ga0070673_1001664752 175
928 3300005366 Ga0070659_100011172 Ga0070659_1000111725 175
929 3300005434 Ga0070709_10235711 Ga0070709_102357113 175
930 3300005435 Ga0070714_100065808 Ga0070714_1000658085 175
931 3300005436 Ga0070713_100176043 Ga0070713_1001760432 175
932 3300005438 Ga0070701_10067435 Ga0070701_100674353 175
933 3300005439 Ga0070711_100208352 Ga0070711_1002083522 175
934 3300005455 Ga0070663_100184098 Ga0070663_1001840982 175
935 3300005456 Ga0070678_100117617 Ga0070678_1001176172 175
936 3300005458 Ga0070681_10116951 Ga0070681_101169513 175
937 3300005543 Ga0070672_100836494 Ga0070672_1008364942 175
938 3300005544 Ga0070686_100064132 Ga0070686_1000641323 175
939 3300005545 Ga0070695_100313506 Ga0070695_1003135061 175
940 3300005546 Ga0070696_100433376 Ga0070696_1004333761 175
941 3300005548 Ga0070665_100044114 Ga0070665_1000441144 175
942 3300005563 Ga0068855_100008572 Ga0068855_1000085722 175
943 3300005578 Ga0068854_100025573 Ga0068854_1000255733 175
944 3300005614 Ga0068856_100009219 Ga0068856_1000092195 175
945 3300005614 Ga0068856_100309502 Ga0068856_1003095022 175
946 3300005615 Ga0070702_100022737 Ga0070702_1000227375 175
947 3300005616 Ga0068852_100247772 Ga0068852_1002477723 175
948 3300005618 Ga0068864_100213706 Ga0068864_1002137062 175
949 3300005842 Ga0068858_100063116 Ga0068858_1000631162 175
950 3300005843 Ga0068860_100443033 Ga0068860_1004430332 175
951 3300005844 Ga0068862_100811797 Ga0068862_1008117972 175
952 3300005937 Ga0081455_10056874 Ga0081455_100568743 175
953 3300005981 Ga0081538_10004092 Ga0081538_100040927 175
954 3300006028 Ga0070717_10303936 Ga0070717_103039362 175
955 3300006175 Ga0070712_100259254 Ga0070712_1002592542 175
956 3300006175 Ga0070712_100470149 Ga0070712_1004701492 175
957 3300006237 Ga0097621_100349566 Ga0097621_1003495662 175
958 3300006358 Ga0068871_100082631 Ga0068871_1000826312 175
959 3300006871 Ga0075434_100004302 Ga0075434_1000043024 175
960 3300006881 Ga0068865_100411660 Ga0068865_1004116602 175
961 3300006914 Ga0075436_100002762 Ga0075436_10000276210 175
962 3300007076 Ga0075435_100003383 Ga0075435_1000033834 175
963 3300009093 Ga0105240_10289334 Ga0105240_102893343 175
964 3300009098 Ga0105245_10021132 Ga0105245_100211325 175
965 3300009098 Ga0105245_10362526 Ga0105245_103625262 175
966 3300009101 Ga0105247_10051571 Ga0105247_100515713 175
967 3300009148 Ga0105243_10165890 Ga0105243_101658902 175
968 3300009148 Ga0105243_11540731 Ga0105243_115407311 175
969 3300009174 Ga0105241_10044583 Ga0105241_100445834 175
970 3300009176 Ga0105242_10064698 Ga0105242_100646985 175
971 3300009177 Ga0105248_10306725 Ga0105248_103067251 175
972 3300009545 Ga0105237_10038264 Ga0105237_100382644 175
973 3300009551 Ga0105238_10028919 Ga0105238_100289194 175
974 3300009553 Ga0105249_10027388 Ga0105249_100273886 175
975 3300010375 Ga0105239_10886529 Ga0105239_108865292 175
976 3300011119 Ga0105246_10013171 Ga0105246_100131714 175
977 3300013104 Ga0157370_10403256 Ga0157370_104032561 175
978 3300013296 Ga0157374_10019586 Ga0157374_100195865 175
979 3300013297 Ga0157378_10743843 Ga0157378_107438431 175
980 3300013306 Ga0163162_10655684 Ga0163162_106556842 175
981 3300013307 Ga0157372_10084223 Ga0157372_100842234 175
982 3300013307 Ga0157372_10120458 Ga0157372_101204585 175
983 3300013308 Ga0157375_11019559 Ga0157375_110195592 175
984 3300014325 Ga0163163_10009378 Ga0163163_100093787 175
985 3300014745 Ga0157377_10008185 Ga0157377_100081855 175
986 3300014969 Ga0157376_10027031 Ga0157376_100270314 175
987 3300017792 Ga0163161_10161760 Ga0163161_101617602 175
988 3300025900 Ga0207710_10021697 Ga0207710_100216972 175
989 3300025907 Ga0207645_10077687 Ga0207645_100776873 175
990 3300025913 Ga0207695_10815178 Ga0207695_108151781 175
991 3300025914 Ga0207671_10258728 Ga0207671_102587282 175
992 3300025915 Ga0207693_10217170 Ga0207693_102171702 175
993 3300025915 Ga0207693_10302739 Ga0207693_103027392 175
994 3300025918 Ga0207662_10187678 Ga0207662_101876782 175
995 3300025919 Ga0207657_10007381 Ga0207657_1000738110 175
996 3300025921 Ga0207652_10854772 Ga0207652_108547722 175
997 3300025924 Ga0207694_10058043 Ga0207694_100580431 175
998 3300025926 Ga0207659_10186685 Ga0207659_101866853 175
999 3300025927 Ga0207687_10015379 Ga0207687_100153796 175
1000 3300025927 Ga0207687_10152675 Ga0207687_101526753 175
1001 3300025929 Ga0207664_10327935 Ga0207664_103279352 175
1002 3300025929 Ga0207664_10896791 Ga0207664_108967912 175
1003 3300025929 Ga0207664_11074045 Ga0207664_110740451 175
1004 3300025932 Ga0207690_10002378 Ga0207690_1000237811 175
1005 3300025933 Ga0207706_10054711 Ga0207706_100547115 175
1006 3300025935 Ga0207709_10041105 Ga0207709_100411055 175
1007 3300025936 Ga0207670_10188671 Ga0207670_101886712 175
1008 3300025938 Ga0207704_10072413 Ga0207704_100724135 175
1009 3300025939 Ga0207665_10043153 Ga0207665_100431535 175
1010 3300025941 Ga0207711_10148212 Ga0207711_101482123 175
1011 3300025942 Ga0207689_10085658 Ga0207689_100856582 175
1012 3300025949 Ga0207667_10017984 Ga0207667_100179842 175
1013 3300025961 Ga0207712_10089073 Ga0207712_100890732 175
1014 3300025972 Ga0207668_10828457 Ga0207668_108284571 175
1015 3300025981 Ga0207640_10066202 Ga0207640_100662023 175
1016 3300026023 Ga0207677_10133478 Ga0207677_101334782 175
1017 3300026067 Ga0207678_10077494 Ga0207678_100774942 175
1018 3300026078 Ga0207702_10002160 Ga0207702_100021609 175
1019 3300026078 Ga0207702_10325588 Ga0207702_103255882 175
1020 3300026095 Ga0207676_10179816 Ga0207676_101798163 175
1021 3300026121 Ga0207683_10055645 Ga0207683_100556455 175
1022 3300028379 Ga0268266_10306923 Ga0268266_103069232 175
1023 3300031251 Ga0265327_10000388 Ga0265327_1000038867 175
1024 3300031344 Ga0265316_10002997 Ga0265316_100029977 175
1025 3300034819 Ga0373958_0035826 Ga0373958_0035826_388_915 175
1026 3300035116 Ga0373945_0031758 Ga0373945_0031758_1306_1833 175
1027 3300035119 Ga0373956_0060070 Ga0373956_0060070_691_1218 175
1028 3300035121 Ga0373960_0074633 Ga0373960_0074633_159_686 175
1029 3300035170 Ga0373943_0006737 Ga0373943_0006737_103_630 175
1030 3300035171 Ga0373946_0001734 Ga0373946_0001734_1104_1631 175
1031 3300035172 Ga0373955_0012109 Ga0373955_0012109_2882_3409 175
1032 3300035691 Ga0373931_0217052 Ga0373931_0217052_328_855 175
1033 3300035692 Ga0373935_0016894 Ga0373935_0016894_3119_3646 175
1034 3300035695 Ga0373927_0028499 Ga0373927_0028499_735_1262 175
1035 3300035724 Ga0373933_0102482 Ga0373933_0102482_827_1354 175
1036 3300035725 Ga0373947_0012589 Ga0373947_0012589_868_1395 175
1037 3300036401 Ga0373937_0012607 Ga0373937_0012607_182_709 175
1038 3300038443 Ga0395901_0714664 Ga0395901_0714664_333_860 175
1039 3300042013 Ga0439456_078650 Ga0439456_078650_70_597 175
1040 3300042131 Ga0450894_004432 Ga0450894_004432_1060_1590 175
1041 3300042132 Ga0450895_001970 Ga0450895_001970_350_880 175
1042 3300042135 Ga0450899_005271 Ga0450899_005271_140_670 175
1043 3300042461 Ga0439460_0072659 Ga0439460_0072659_464_991 175
1044 3300044694 Ga0466963_0135750 Ga0466963_0135750_579_1106 175
1045 3300044901 Ga0466960_0021378 Ga0466960_0021378_1206_1733 175
1046 3300046455 Ga0495603_0071163 Ga0495603_0071163_354_881 175
1047 3300046459 Ga0495629_0034171 Ga0495629_0034171_171_698 175
1048 3300046463 Ga0495653_0012965 Ga0495653_0012965_3931_4458 175
1049 3300046472 Ga0495580_0025973 Ga0495580_0025973_2974_3501 175
1050 3300046472 Ga0495580_0648493 Ga0495580_0648493_38_565 175
1051 3300046475 Ga0495639_0002626 Ga0495639_0002626_4044_4571 175
1052 3300046476 Ga0495662_0020694 Ga0495662_0020694_771_1298 175
1053 3300046499 Ga0495594_0008671 Ga0495594_0008671_2059_2586 175
1054 3300046499 Ga0495594_0174705 Ga0495594_0174705_661_1188 175
1055 3300046514 Ga0495618_0027070 Ga0495618_0027070_2338_2865 175
1056 3300046517 Ga0495630_0020828 Ga0495630_0020828_2659_3186 175
1057 3300046517 Ga0495630_0186553 Ga0495630_0186553_34_561 175
1058 3300046526 Ga0495666_0069858 Ga0495666_0069858_248_775 175
1059 3300046526 Ga0495666_0310401 Ga0495666_0310401_41_568 175
1060 3300046531 Ga0495665_0012337 Ga0495665_0012337_3012_3539 175
1061 3300046535 Ga0495586_0009166 Ga0495586_0009166_3764_4291 175
1062 3300046559 Ga0495667_0015868 Ga0495667_0015868_1669_2196 175
1063 3300046642 Ga0495634_0003395 Ga0495634_0003395_5564_6091 175
1064 3300046674 Ga0495588_0005580 Ga0495588_0005580_572_1099 175
1065 3300046674 Ga0495588_0017973 Ga0495588_0017973_991_1518 175
1066 3300046675 Ga0495657_0048394 Ga0495657_0048394_2044_2571 175
1067 3300046678 Ga0495599_0105089 Ga0495599_0105089_40_567 175
1068 3300046679 Ga0495623_0100084 Ga0495623_0100084_349_876 175
1069 3300046680 Ga0495646_0342619 Ga0495646_0342619_229_756 175
1070 3300046689 Ga0495613_0049317 Ga0495613_0049317_1040_1567 175
1071 3300046690 Ga0495624_0009055 Ga0495624_0009055_569_1096 175
1072 3300046809 Ga0495600_0044805 Ga0495600_0044805_785_1312 175
1073 3300047315 Ga0495581_0006490 Ga0495581_0006490_2758_3285 175
1074 3300047319 Ga0495674_0071942 Ga0495674_0071942_398_925 175
1075 3300047319 Ga0495674_0177342 Ga0495674_0177342_398_925 175
1076 3300047319 Ga0495674_0239553 Ga0495674_0239553_609_1136 175
1077 3300047321 Ga0495676_0028449 Ga0495676_0028449_1739_2266 175
1078 3300047321 Ga0495676_0062120 Ga0495676_0062120_507_1034 175
1079 3300047322 Ga0495680_0043380 Ga0495680_0043380_1575_2102 175
1080 3300047444 Ga0495675_0025370 Ga0495675_0025370_39_566 175
1081 3300048088 Ga0495602_0486920 Ga0495602_0486920_20_547 175
1082 3300048089 Ga0495614_0018916 Ga0495614_0018916_2038_2565 175
1083 3300048903 Ga0496100_0021727 Ga0496100_0021727_2679_3206 175
1084 3300048904 Ga0496101_0010082 Ga0496101_0010082_4175_4702 175
1085 3300048904 Ga0496101_0170542 Ga0496101_0170542_66_593 175
1086 3300048904 Ga0496101_0376686 Ga0496101_0376686_291_818 175
1087 3300048905 Ga0496102_0030938 Ga0496102_0030938_3985_4512 175
1088 3300048905 Ga0496102_0135068 Ga0496102_0135068_1599_2126 175
1089 3300048906 Ga0496103_0012040 Ga0496103_0012040_4082_4609 175
1090 3300048907 Ga0496104_0056464 Ga0496104_0056464_889_1416 175
1091 3300048908 Ga0496105_0030988 Ga0496105_0030988_2284_2811 175
1092 3300048909 Ga0496106_0154625 Ga0496106_0154625_672_1199 175
1093 3300048909 Ga0496106_0319803 Ga0496106_0319803_491_1018 175
1094 3300048910 Ga0496107_0003573 Ga0496107_0003573_4483_5010 175
1095 3300048910 Ga0496107_0013371 Ga0496107_0013371_593_1120 175
1096 3300048911 Ga0496108_0018620 Ga0496108_0018620_852_1379 175
1097 3300048911 Ga0496108_0259129 Ga0496108_0259129_327_854 175
1098 3300048912 Ga0496109_0002950 Ga0496109_0002950_10224_10751 175
1099 3300048912 Ga0496109_0086639 Ga0496109_0086639_1430_1957 175
1100 3300048912 Ga0496109_0157183 Ga0496109_0157183_1209_1736 175
1101 3300048913 Ga0496110_0002127 Ga0496110_0002127_7487_8014 175
1102 3300048913 Ga0496110_0037596 Ga0496110_0037596_1948_2475 175
1103 3300048914 Ga0496111_0036550 Ga0496111_0036550_292_819 175
1104 3300048915 Ga0496112_0025388 Ga0496112_0025388_1631_2158 175
1105 3300048915 Ga0496112_0059478 Ga0496112_0059478_370_897 175
1106 3300048916 Ga0496113_0001497 Ga0496113_0001497_3523_4050 175
1107 3300048916 Ga0496113_0006676 Ga0496113_0006676_5155_5682 175
1108 3300048917 Ga0496114_0053907 Ga0496114_0053907_2041_2568 175
1109 3300048918 Ga0496115_0203713 Ga0496115_0203713_419_946 175
1110 3300049569 Ga0501032_0562442 Ga0501032_0562442_15_542 175
1111 3300049570 Ga0501033_0073160 Ga0501033_0073160_568_1095 175
1112 3300049570 Ga0501033_0134465 Ga0501033_0134465_1151_1678 175
1113 3300049571 Ga0501034_1090225 Ga0501034_1090225_130_657 175
1114 3300049572 Ga0501036_0251705 Ga0501036_0251705_780_1307 175
1115 3300049573 Ga0501037_0237843 Ga0501037_0237843_82_609 175
1116 3300049574 Ga0501038_0050253 Ga0501038_0050253_24_551 175
1117 3300049575 Ga0501039_0009149 Ga0501039_0009149_4746_5273 175
1118 3300049575 Ga0501039_0250521 Ga0501039_0250521_796_1323 175
1119 3300049576 Ga0501040_0004612 Ga0501040_0004612_8391_8918 175
1120 3300049576 Ga0501040_0024949 Ga0501040_0024949_3385_3912 175
1121 3300049577 Ga0501041_0145714 Ga0501041_0145714_669_1196 175
1122 3300049578 Ga0501042_0375166 Ga0501042_0375166_376_903 175
1123 3300049578 Ga0501042_0796807 Ga0501042_0796807_135_662 175
1124 3300049582 Ga0501048_0066497 Ga0501048_0066497_19_546 175
1125 3300049585 Ga0501069_0539739 Ga0501069_0539739_50_577 175
1126 3300049585 Ga0501069_0605945 Ga0501069_0605945_24_551 175
1127 3300049586 Ga0501070_0305585 Ga0501070_0305585_485_1045 175
1128 3300049586 Ga0501070_0331602 Ga0501070_0331602_561_1088 175
1129 3300049587 Ga0501071_0020595 Ga0501071_0020595_3236_3763 175
1130 3300049588 Ga0501072_0003471 Ga0501072_0003471_9331_9858 175
1131 3300049588 Ga0501072_0019708 Ga0501072_0019708_3861_4388 175
1132 3300049588 Ga0501072_0570361 Ga0501072_0570361_215_742 175
1133 3300049589 Ga0501073_0078812 Ga0501073_0078812_26_607 175
1134 3300049590 Ga0501074_0383931 Ga0501074_0383931_344_871 175
1135 3300049591 Ga0501075_0004055 Ga0501075_0004055_2376_2903 175
1136 3300049591 Ga0501075_0008849 Ga0501075_0008849_38_565 175
1137 3300049592 Ga0501076_0001453 Ga0501076_0001453_37_564 175
1138 3300049592 Ga0501076_0245874 Ga0501076_0245874_807_1334 175
1139 3300049593 Ga0501077_0010213 Ga0501077_0010213_1817_2344 175
1140 3300049593 Ga0501077_0017902 Ga0501077_0017902_1528_2055 175
1141 3300049741 Ga0501079_0007902 Ga0501079_0007902_2545_3072 175
1142 3300049741 Ga0501079_0039486 Ga0501079_0039486_1134_1661 175
1143 3300049742 Ga0501080_0378656 Ga0501080_0378656_623_1150 175
1144 3300049743 Ga0501081_0005944 Ga0501081_0005944_3501_4028 175
1145 3300049744 Ga0501083_0098846 Ga0501083_0098846_715_1242 175
1146 3300049822 Ga0501035_0137488 Ga0501035_0137488_1525_2052 175
1147 3300049824 Ga0501045_0007355 Ga0501045_0007355_265_792 175
1148 3300049824 Ga0501045_0202836 Ga0501045_0202836_111_638 175
1149 3300050507 nmdc:mga05p37_6410_c1 nmdc:mga05p37_6410_c1_3836_4372 175
1150 3300050512 nmdc:mga0n895_17465_c1 nmdc:mga0n895_17465_c1_4629_5156 175
1151 3300050513 nmdc:mga0rr50_1486_c1 nmdc:mga0rr50_1486_c1_8275_8802 175
1152 3300050514 nmdc:mga08x19_23986_c1 nmdc:mga08x19_23986_c1_1808_2335 175
1153 3300053077 Ga0495601_0032047 Ga0495601_0032047_1270_1797 175
1154 3300053077 Ga0495601_0130983 Ga0495601_0130983_666_1193 175
1155 3300053078 Ga0495612_0098448 Ga0495612_0098448_218_745 175
1156 3300053084 Ga0495595_0089848 Ga0495595_0089848_299_826 175
1157 3300053085 Ga0495619_0112963 Ga0495619_0112963_515_1042 175
1158 3300054114 Ga0501084_0014050 Ga0501084_0014050_1409_1936 175
1159 3300060353 Ga0501082_0012587 Ga0501082_0012587_6706_7233 175
1160 3300060353 Ga0501082_0020003 Ga0501082_0020003_38_565 175
1161 3300061734 Ga0530510_0117389 Ga0530510_0117389_946_1473 175
1162 3300061734 Ga0530510_0894348 Ga0530510_0894348_23_550 175
1163 3300005329 Ga0070683_100041707 Ga0070683_1000417074 176
1164 3300005336 Ga0070680_100118054 Ga0070680_1001180543 176
1165 3300005338 Ga0068868_100113827 Ga0068868_1001138272 176
1166 3300005340 Ga0070689_100342354 Ga0070689_1003423542 176
1167 3300005344 Ga0070661_100481031 Ga0070661_1004810312 176
1168 3300005345 Ga0070692_10004960 Ga0070692_100049606 176
1169 3300005356 Ga0070674_100979066 Ga0070674_1009790661 176
1170 3300005406 Ga0070703_10014288 Ga0070703_100142882 176
1171 3300005435 Ga0070714_100015487 Ga0070714_1000154875 176
1172 3300005436 Ga0070713_100034429 Ga0070713_1000344295 176
1173 3300005437 Ga0070710_10033928 Ga0070710_100339282 176
1174 3300005439 Ga0070711_100012787 Ga0070711_1000127874 176
1175 3300005455 Ga0070663_100309035 Ga0070663_1003090352 176
1176 3300005456 Ga0070678_100019909 Ga0070678_1000199095 176
1177 3300005456 Ga0070678_100096591 Ga0070678_1000965914 176
1178 3300005458 Ga0070681_10492057 Ga0070681_104920572 176
1179 3300005466 Ga0070685_10013428 Ga0070685_100134285 176
1180 3300005530 Ga0070679_100530107 Ga0070679_1005301072 176
1181 3300005535 Ga0070684_100076274 Ga0070684_1000762742 176
1182 3300005535 Ga0070684_100155075 Ga0070684_1001550754 176
1183 3300005539 Ga0068853_100452548 Ga0068853_1004525482 176
1184 3300005545 Ga0070695_100168584 Ga0070695_1001685842 176
1185 3300005546 Ga0070696_100168506 Ga0070696_1001685061 176
1186 3300005547 Ga0070693_100037050 Ga0070693_1000370504 176
1187 3300005564 Ga0070664_100033897 Ga0070664_1000338974 176
1188 3300005564 Ga0070664_101198903 Ga0070664_1011989032 176
1189 3300005577 Ga0068857_100044578 Ga0068857_1000445785 176
1190 3300005577 Ga0068857_100059948 Ga0068857_1000599483 176
1191 3300005578 Ga0068854_100012985 Ga0068854_1000129852 176
1192 3300005578 Ga0068854_101622971 Ga0068854_1016229711 176
1193 3300005614 Ga0068856_100045085 Ga0068856_1000450854 176
1194 3300005614 Ga0068856_100126640 Ga0068856_1001266402 176
1195 3300005614 Ga0068856_100274713 Ga0068856_1002747132 176
1196 3300005616 Ga0068852_100283604 Ga0068852_1002836042 176
1197 3300005616 Ga0068852_101012546 Ga0068852_1010125462 176
1198 3300005617 Ga0068859_100754918 Ga0068859_1007549181 176
1199 3300005618 Ga0068864_100388021 Ga0068864_1003880212 176
1200 3300005843 Ga0068860_101188183 Ga0068860_1011881832 176
1201 3300006028 Ga0070717_10311175 Ga0070717_103111753 176
1202 3300006175 Ga0070712_100029637 Ga0070712_1000296375 176
1203 3300006175 Ga0070712_100041213 Ga0070712_1000412134 176
1204 3300006175 Ga0070712_100535922 Ga0070712_1005359221 176
1205 3300006358 Ga0068871_100488259 Ga0068871_1004882592 176
1206 3300006852 Ga0075433_10206884 Ga0075433_102068842 176
1207 3300006871 Ga0075434_100004091 Ga0075434_1000040915 176
1208 3300006871 Ga0075434_100013572 Ga0075434_1000135723 176
1209 3300006871 Ga0075434_100429268 Ga0075434_1004292682 176
1210 3300006914 Ga0075436_100001611 Ga0075436_1000016119 176
1211 3300006931 Ga0097620_100755004 Ga0097620_1007550042 176
1212 3300007076 Ga0075435_100008638 Ga0075435_1000086385 176
1213 3300007076 Ga0075435_100011180 Ga0075435_1000111806 176
1214 3300009093 Ga0105240_10238496 Ga0105240_102384962 176
1215 3300009148 Ga0105243_10713136 Ga0105243_107131362 176
1216 3300009174 Ga0105241_11362001 Ga0105241_113620011 176
1217 3300009176 Ga0105242_10026845 Ga0105242_100268454 176
1218 3300009177 Ga0105248_10288796 Ga0105248_102887962 176
1219 3300009177 Ga0105248_10515333 Ga0105248_105153332 176
1220 3300009545 Ga0105237_10275733 Ga0105237_102757332 176
1221 3300009545 Ga0105237_10389096 Ga0105237_103890962 176
1222 3300009545 Ga0105237_10620848 Ga0105237_106208481 176
1223 3300009551 Ga0105238_10082598 Ga0105238_100825984 176
1224 3300010375 Ga0105239_10426427 Ga0105239_104264272 176
1225 3300013102 Ga0157371_10456271 Ga0157371_104562711 176
1226 3300013104 Ga0157370_10100783 Ga0157370_101007832 176
1227 3300013104 Ga0157370_10655170 Ga0157370_106551701 176
1228 3300013105 Ga0157369_10011849 Ga0157369_100118499 176
1229 3300013105 Ga0157369_10226764 Ga0157369_102267642 176
1230 3300013296 Ga0157374_10031749 Ga0157374_100317492 176
1231 3300013297 Ga0157378_10440496 Ga0157378_104404962 176
1232 3300013307 Ga0157372_10345920 Ga0157372_103459202 176
1233 3300013308 Ga0157375_10294437 Ga0157375_102944373 176
1234 3300014325 Ga0163163_10384180 Ga0163163_103841802 176
1235 3300014326 Ga0157380_10782167 Ga0157380_107821671 176
1236 3300014745 Ga0157377_10046413 Ga0157377_100464132 176
1237 3300014745 Ga0157377_10116265 Ga0157377_101162652 176
1238 3300014968 Ga0157379_10737352 Ga0157379_107373522 176
1239 3300014969 Ga0157376_10239553 Ga0157376_102395532 176
1240 3300022467 Ga0224712_10006500 Ga0224712_100065001 176
1241 3300025321 Ga0207656_10163562 Ga0207656_101635622 176
1242 3300025898 Ga0207692_10035754 Ga0207692_100357543 176
1243 3300025899 Ga0207642_10023382 Ga0207642_100233823 176
1244 3300025901 Ga0207688_10208345 Ga0207688_102083452 176
1245 3300025906 Ga0207699_10134473 Ga0207699_101344731 176
1246 3300025911 Ga0207654_10287002 Ga0207654_102870022 176
1247 3300025912 Ga0207707_10186544 Ga0207707_101865443 176
1248 3300025913 Ga0207695_10150956 Ga0207695_101509563 176
1249 3300025914 Ga0207671_10092126 Ga0207671_100921262 176
1250 3300025915 Ga0207693_10007894 Ga0207693_100078948 176
1251 3300025915 Ga0207693_10014148 Ga0207693_100141484 176
1252 3300025916 Ga0207663_10009042 Ga0207663_100090424 176
1253 3300025917 Ga0207660_10011918 Ga0207660_100119183 176
1254 3300025921 Ga0207652_10677548 Ga0207652_106775482 176
1255 3300025928 Ga0207700_10041931 Ga0207700_100419313 176
1256 3300025928 Ga0207700_10155720 Ga0207700_101557201 176
1257 3300025929 Ga0207664_10002473 Ga0207664_100024739 176
1258 3300025932 Ga0207690_10077677 Ga0207690_100776772 176
1259 3300025932 Ga0207690_10215928 Ga0207690_102159282 176
1260 3300025935 Ga0207709_10233448 Ga0207709_102334482 176
1261 3300025944 Ga0207661_10090151 Ga0207661_100901512 176
1262 3300025944 Ga0207661_10253727 Ga0207661_102537272 176
1263 3300025945 Ga0207679_10034514 Ga0207679_100345144 176
1264 3300025949 Ga0207667_10048059 Ga0207667_100480595 176
1265 3300026023 Ga0207677_10046113 Ga0207677_100461131 176
1266 3300026035 Ga0207703_10338889 Ga0207703_103388892 176
1267 3300026041 Ga0207639_10148963 Ga0207639_101489632 176
1268 3300026067 Ga0207678_10157217 Ga0207678_101572173 176
1269 3300026075 Ga0207708_10004867 Ga0207708_100048678 176
1270 3300026078 Ga0207702_10075193 Ga0207702_100751934 176
1271 3300026078 Ga0207702_10499025 Ga0207702_104990252 176
1272 3300026089 Ga0207648_10029813 Ga0207648_100298135 176
1273 3300026116 Ga0207674_10057175 Ga0207674_100571754 176
1274 3300026116 Ga0207674_10086643 Ga0207674_100866431 176
1275 3300026121 Ga0207683_10384397 Ga0207683_103843972 176
1276 3300026142 Ga0207698_10651531 Ga0207698_106515312 176
1277 3300026142 Ga0207698_11412476 Ga0207698_114124762 176
1278 3300027907 Ga0207428_10101461 Ga0207428_101014612 176
1279 3300028800 Ga0265338_10125319 Ga0265338_101253194 176
1280 3300031251 Ga0265327_10019109 Ga0265327_100191092 176
1281 3300031731 Ga0307405_10147644 Ga0307405_101476442 176
1282 3300032126 Ga0307415_100375053 Ga0307415_1003750533 176
1283 3300035086 Ga0373934_0273160 Ga0373934_0273160_42_572 176
1284 3300035090 Ga0373949_0119686 Ga0373949_0119686_157_687 176
1285 3300035111 Ga0373923_0190597 Ga0373923_0190597_228_758 176
1286 3300035172 Ga0373955_0087630 Ga0373955_0087630_1208_1738 176
1287 3300035241 Ga0373961_0082494 Ga0373961_0082494_293_823 176
1288 3300035410 Ga0373924_0285466 Ga0373924_0285466_118_648 176
1289 3300036401 Ga0373937_0306824 Ga0373937_0306824_961_1491 176
1290 3300037068 Ga0373925_0115453 Ga0373925_0115453_1532_2062 176
1291 3300039450 Ga0436363_1085457 Ga0436363_1085457_43_585 176
1292 3300042876 Ga0451577_0054384 Ga0451577_0054384_840_1373 176
1293 3300044683 Ga0466965_0509512 Ga0466965_0509512_128_658 176
1294 3300044706 Ga0466964_0287204 Ga0466964_0287204_222_773 176
1295 3300044712 Ga0453684_0006913 Ga0453684_0006913_3890_4423 176
1296 3300044712 Ga0453684_0049727 Ga0453684_0049727_321_854 176
1297 3300044719 Ga0466971_0098329 Ga0466971_0098329_565_1116 176
1298 3300044735 Ga0466968_0053600 Ga0466968_0053600_304_834 176
1299 3300044842 Ga0466957_0046701 Ga0466957_0046701_570_1121 176
1300 3300044842 Ga0466957_0238345 Ga0466957_0238345_403_954 176
1301 3300044901 Ga0466960_0006810 Ga0466960_0006810_3308_3859 176
1302 3300044901 Ga0466960_0022238 Ga0466960_0022238_1595_2125 176
1303 3300045051 Ga0451576_0309559 Ga0451576_0309559_343_876 176
1304 3300045836 Ga0466958_0132761 Ga0466958_0132761_130_681 176
1305 3300045836 Ga0466958_0223549 Ga0466958_0223549_601_1152 176
1306 3300045976 Ga0466967_0020607 Ga0466967_0020607_516_1067 176
1307 3300045976 Ga0466967_0238546 Ga0466967_0238546_474_1025 176
1308 3300045976 Ga0466967_0251176 Ga0466967_0251176_340_891 176
1309 3300045976 Ga0466967_0307391 Ga0466967_0307391_846_1397 176
1310 3300046455 Ga0495603_0072656 Ga0495603_0072656_398_928 176
1311 3300046459 Ga0495629_0132258 Ga0495629_0132258_1155_1685 176
1312 3300046473 Ga0495582_0235181 Ga0495582_0235181_160_690 176
1313 3300046475 Ga0495639_0241962 Ga0495639_0241962_147_677 176
1314 3300046499 Ga0495594_0283467 Ga0495594_0283467_163_693 176
1315 3300046511 Ga0495608_0216707 Ga0495608_0216707_137_667 176
1316 3300046517 Ga0495630_0691113 Ga0495630_0691113_170_700 176
1317 3300046526 Ga0495666_0307588 Ga0495666_0307588_27_557 176
1318 3300046543 Ga0495645_0177869 Ga0495645_0177869_241_771 176
1319 3300046559 Ga0495667_0535462 Ga0495667_0535462_126_656 176
1320 3300046680 Ga0495646_0263675 Ga0495646_0263675_234_764 176
1321 3300046681 Ga0495647_0092151 Ga0495647_0092151_669_1199 176
1322 3300046683 Ga0495658_0206261 Ga0495658_0206261_504_1034 176
1323 3300046683 Ga0495658_0593707 Ga0495658_0593707_160_690 176
1324 3300046689 Ga0495613_0486533 Ga0495613_0486533_143_673 176
1325 3300047319 Ga0495674_0117622 Ga0495674_0117622_362_892 176
1326 3300047321 Ga0495676_0214944 Ga0495676_0214944_204_734 176
1327 3300047321 Ga0495676_0406066 Ga0495676_0406066_31_561 176
1328 3300047322 Ga0495680_0045354 Ga0495680_0045354_2297_2827 176
1329 3300047471 Ga0495684_0136882 Ga0495684_0136882_1260_1790 176
1330 3300048088 Ga0495602_0273079 Ga0495602_0273079_692_1222 176
1331 3300048903 Ga0496100_0015073 Ga0496100_0015073_391_942 176
1332 3300048904 Ga0496101_0093951 Ga0496101_0093951_906_1457 176
1333 3300048904 Ga0496101_0100417 Ga0496101_0100417_202_732 176
1334 3300048904 Ga0496101_0173951 Ga0496101_0173951_1096_1626 176
1335 3300048905 Ga0496102_0142566 Ga0496102_0142566_642_1193 176
1336 3300048908 Ga0496105_0148134 Ga0496105_0148134_916_1446 176
1337 3300048908 Ga0496105_0218572 Ga0496105_0218572_536_1087 176
1338 3300048909 Ga0496106_0017548 Ga0496106_0017548_4511_5062 176
1339 3300048910 Ga0496107_0028310 Ga0496107_0028310_748_1278 176
1340 3300048910 Ga0496107_0064175 Ga0496107_0064175_1335_1886 176
1341 3300048911 Ga0496108_0021388 Ga0496108_0021388_3014_3544 176
1342 3300048911 Ga0496108_0029910 Ga0496108_0029910_3063_3593 176
1343 3300048911 Ga0496108_0067823 Ga0496108_0067823_899_1429 176
1344 3300048912 Ga0496109_0010242 Ga0496109_0010242_377_907 176
1345 3300048912 Ga0496109_0055339 Ga0496109_0055339_1523_2053 176
1346 3300048912 Ga0496109_0409790 Ga0496109_0409790_76_606 176
1347 3300048913 Ga0496110_0089087 Ga0496110_0089087_901_1431 176
1348 3300048913 Ga0496110_0661403 Ga0496110_0661403_131_661 176
1349 3300048914 Ga0496111_0219952 Ga0496111_0219952_256_786 176
1350 3300048914 Ga0496111_0307938 Ga0496111_0307938_476_1006 176
1351 3300048914 Ga0496111_0622324 Ga0496111_0622324_157_687 176
1352 3300048915 Ga0496112_0085404 Ga0496112_0085404_1588_2118 176
1353 3300048915 Ga0496112_0514355 Ga0496112_0514355_560_1090 176
1354 3300048916 Ga0496113_0230350 Ga0496113_0230350_440_970 176
1355 3300048917 Ga0496114_0059840 Ga0496114_0059840_336_866 176
1356 3300048917 Ga0496114_0062923 Ga0496114_0062923_2517_3047 176
1357 3300048917 Ga0496114_0120566 Ga0496114_0120566_773_1324 176
1358 3300048918 Ga0496115_0006389 Ga0496115_0006389_6776_7306 176
1359 3300048918 Ga0496115_0053777 Ga0496115_0053777_1700_2251 176
1360 3300049583 Ga0501067_0000131 Ga0501067_0000131_18569_19099 176
1361 3300049583 Ga0501067_0002559 Ga0501067_0002559_7888_8418 176
1362 3300049584 Ga0501068_0000106 Ga0501068_0000106_12366_12896 176
1363 3300049585 Ga0501069_0000029 Ga0501069_0000029_86619_87149 176
1364 3300049585 Ga0501069_0003014 Ga0501069_0003014_80_610 176
1365 3300049586 Ga0501070_0042240 Ga0501070_0042240_1188_1718 176
1366 3300049586 Ga0501070_0164269 Ga0501070_0164269_523_1053 176
1367 3300050512 nmdc:mga0n895_13708_c1 nmdc:mga0n895_13708_c1_5361_5891 176
1368 3300050513 nmdc:mga0rr50_17362_c1 nmdc:mga0rr50_17362_c1_824_1354 176
1369 3300050513 nmdc:mga0rr50_7202_c1 nmdc:mga0rr50_7202_c1_4332_4862 176
1370 3300050514 nmdc:mga08x19_18260_c1 nmdc:mga08x19_18260_c1_685_1215 176
1371 3300050514 nmdc:mga08x19_60947_c1 nmdc:mga08x19_60947_c1_193_723 176
1372 3300050515 nmdc:mga0a205_63577_c2 nmdc:mga0a205_63577_c2_65_595 176
1373 3300050515 nmdc:mga0a205_68103_c1 nmdc:mga0a205_68103_c1_386_916 176
1374 3300053077 Ga0495601_0028519 Ga0495601_0028519_2520_3050 176
1375 3300053077 Ga0495601_0218275 Ga0495601_0218275_649_1179 176
1376 3300053084 Ga0495595_0038191 Ga0495595_0038191_513_1043 176
1377 3300053085 Ga0495619_0168074 Ga0495619_0168074_588_1118 176
1378 3300061734 Ga0530510_0063603 Ga0530510_0063603_1353_1883 176
1379 3300061734 Ga0530510_0373551 Ga0530510_0373551_379_909 176
1380 3300036401 Ga0373937_0462300 Ga0373937_0462300_485_1072 178
1381 3300047319 Ga0495674_0311221 Ga0495674_0311221_401_988 178
1382 3300048918 Ga0496115_0068354 Ga0496115_0068354_1075_1662 178
1383 3300001990 JGI24737J22298_10037973 JGI24737J22298_100379731 179
1384 3300001991 JGI24743J22301_10016894 JGI24743J22301_100168942 179
1385 3300002076 JGI24749J21850_1006737 JGI24749J21850_10067371 179
1386 3300002239 JGI24034J26672_10017726 JGI24034J26672_100177262 179
1387 3300005295 Ga0065707_10279534 Ga0065707_102795341 179
1388 3300005327 Ga0070658_10000148 Ga0070658_100001489 179
1389 3300005328 Ga0070676_10002170 Ga0070676_1000217012 179
1390 3300005329 Ga0070683_100009682 Ga0070683_1000096828 179
1391 3300005330 Ga0070690_100000880 Ga0070690_1000008805 179
1392 3300005331 Ga0070670_100805416 Ga0070670_1008054161 179
1393 3300005333 Ga0070677_10000593 Ga0070677_1000059312 179
1394 3300005334 Ga0068869_100005923 Ga0068869_1000059232 179
1395 3300005335 Ga0070666_10018715 Ga0070666_100187151 179
1396 3300005338 Ga0068868_100051182 Ga0068868_1000511824 179
1397 3300005339 Ga0070660_100001289 Ga0070660_10000128914 179
1398 3300005340 Ga0070689_100300290 Ga0070689_1003002901 179
1399 3300005343 Ga0070687_100000032 Ga0070687_10000003212 179
1400 3300005344 Ga0070661_100000412 Ga0070661_10000041234 179
1401 3300005344 Ga0070661_100021656 Ga0070661_1000216565 179
1402 3300005347 Ga0070668_100000345 Ga0070668_10000034521 179
1403 3300005353 Ga0070669_100000307 Ga0070669_10000030711 179
1404 3300005354 Ga0070675_100051540 Ga0070675_1000515404 179
1405 3300005355 Ga0070671_100013455 Ga0070671_1000134554 179
1406 3300005364 Ga0070673_100061685 Ga0070673_1000616851 179
1407 3300005365 Ga0070688_100000122 Ga0070688_10000012212 179
1408 3300005366 Ga0070659_100008431 Ga0070659_1000084311 179
1409 3300005367 Ga0070667_100051255 Ga0070667_1000512551 179
1410 3300005438 Ga0070701_10067011 Ga0070701_100670111 179
1411 3300005440 Ga0070705_100000837 Ga0070705_10000083712 179
1412 3300005441 Ga0070700_100034468 Ga0070700_1000344682 179
1413 3300005455 Ga0070663_100003529 Ga0070663_1000035291 179
1414 3300005456 Ga0070678_100040773 Ga0070678_1000407731 179
1415 3300005456 Ga0070678_100837980 Ga0070678_1008379801 179
1416 3300005457 Ga0070662_100000190 Ga0070662_10000019033 179
1417 3300005458 Ga0070681_10277713 Ga0070681_102777131 179
1418 3300005459 Ga0068867_100003036 Ga0068867_10000303613 179
1419 3300005466 Ga0070685_10230203 Ga0070685_102302031 179
1420 3300005530 Ga0070679_100006333 Ga0070679_10000633311 179
1421 3300005535 Ga0070684_100008834 Ga0070684_1000088344 179
1422 3300005539 Ga0068853_100000259 Ga0068853_10000025935 179
1423 3300005543 Ga0070672_100001842 Ga0070672_10000184212 179
1424 3300005544 Ga0070686_100000081 Ga0070686_10000008136 179
1425 3300005545 Ga0070695_100075759 Ga0070695_1000757593 179
1426 3300005546 Ga0070696_100034196 Ga0070696_1000341962 179
1427 3300005547 Ga0070693_100001141 Ga0070693_1000011415 179
1428 3300005548 Ga0070665_101000174 Ga0070665_1010001741 179
1429 3300005563 Ga0068855_100023755 Ga0068855_1000237558 179
1430 3300005564 Ga0070664_100001682 Ga0070664_10000168214 179
1431 3300005577 Ga0068857_100000447 Ga0068857_10000044728 179
1432 3300005577 Ga0068857_100020822 Ga0068857_1000208221 179
1433 3300005578 Ga0068854_100000223 Ga0068854_10000022311 179
1434 3300005614 Ga0068856_100026249 Ga0068856_1000262496 179
1435 3300005615 Ga0070702_100027098 Ga0070702_1000270981 179
1436 3300005616 Ga0068852_100003535 Ga0068852_1000035358 179
1437 3300005617 Ga0068859_100034014 Ga0068859_1000340145 179
1438 3300005618 Ga0068864_100001363 Ga0068864_10000136315 179
1439 3300005718 Ga0068866_10000018 Ga0068866_1000001816 179
1440 3300005719 Ga0068861_100000047 Ga0068861_1000000475 179
1441 3300005834 Ga0068851_10003415 Ga0068851_100034151 179
1442 3300005840 Ga0068870_10000033 Ga0068870_1000003339 179
1443 3300005841 Ga0068863_100016901 Ga0068863_1000169018 179
1444 3300005842 Ga0068858_100567252 Ga0068858_1005672522 179
1445 3300005843 Ga0068860_100040808 Ga0068860_1000408082 179
1446 3300005844 Ga0068862_100000659 Ga0068862_10000065939 179
1447 3300005983 Ga0081540_1000258 Ga0081540_100025825 179
1448 3300006237 Ga0097621_100004326 Ga0097621_1000043268 179
1449 3300006237 Ga0097621_100177381 Ga0097621_1001773812 179
1450 3300006358 Ga0068871_100000098 Ga0068871_10000009839 179
1451 3300006358 Ga0068871_100102265 Ga0068871_1001022653 179
1452 3300006871 Ga0075434_101082225 Ga0075434_1010822251 179
1453 3300006881 Ga0068865_100319979 Ga0068865_1003199792 179
1454 3300006931 Ga0097620_100034013 Ga0097620_1000340132 179
1455 3300009092 Ga0105250_10015032 Ga0105250_100150321 179
1456 3300009093 Ga0105240_10015234 Ga0105240_1001523412 179
1457 3300009098 Ga0105245_10000849 Ga0105245_1000084922 179
1458 3300009101 Ga0105247_10000104 Ga0105247_1000010443 179
1459 3300009148 Ga0105243_10001938 Ga0105243_100019386 179
1460 3300009174 Ga0105241_10001545 Ga0105241_1000154516 179
1461 3300009176 Ga0105242_10025418 Ga0105242_100254186 179
1462 3300009177 Ga0105248_10020173 Ga0105248_100201731 179
1463 3300009545 Ga0105237_10000477 Ga0105237_1000047715 179
1464 3300009551 Ga0105238_10003296 Ga0105238_1000329612 179
1465 3300009553 Ga0105249_10000482 Ga0105249_1000048231 179
1466 3300010375 Ga0105239_10002042 Ga0105239_100020421 179
1467 3300011119 Ga0105246_10000541 Ga0105246_1000054117 179
1468 3300013100 Ga0157373_10000785 Ga0157373_1000078518 179
1469 3300013102 Ga0157371_10000392 Ga0157371_100003925 179
1470 3300013105 Ga0157369_10000538 Ga0157369_1000053841 179
1471 3300013296 Ga0157374_10000442 Ga0157374_100004429 179
1472 3300013297 Ga0157378_10000974 Ga0157378_1000097423 179
1473 3300013306 Ga0163162_10000521 Ga0163162_100005218 179
1474 3300013307 Ga0157372_10000634 Ga0157372_100006348 179
1475 3300013308 Ga0157375_10000441 Ga0157375_100004418 179
1476 3300014325 Ga0163163_10001584 Ga0163163_100015841 179
1477 3300014326 Ga0157380_10074228 Ga0157380_100742281 179
1478 3300014745 Ga0157377_10000187 Ga0157377_1000018723 179
1479 3300014968 Ga0157379_10000098 Ga0157379_1000009838 179
1480 3300014969 Ga0157376_10000379 Ga0157376_1000037919 179
1481 3300017792 Ga0163161_10008814 Ga0163161_100088142 179
1482 3300025315 Ga0207697_10004773 Ga0207697_100047737 179
1483 3300025321 Ga0207656_10114321 Ga0207656_101143211 179
1484 3300025893 Ga0207682_10003048 Ga0207682_100030488 179
1485 3300025899 Ga0207642_10003181 Ga0207642_100031814 179
1486 3300025900 Ga0207710_10271541 Ga0207710_102715412 179
1487 3300025901 Ga0207688_10000100 Ga0207688_1000010034 179
1488 3300025903 Ga0207680_10050256 Ga0207680_100502563 179
1489 3300025904 Ga0207647_10004487 Ga0207647_1000448712 179
1490 3300025907 Ga0207645_10007893 Ga0207645_100078931 179
1491 3300025908 Ga0207643_10000002 Ga0207643_10000002158 179
1492 3300025911 Ga0207654_10016967 Ga0207654_100169675 179
1493 3300025912 Ga0207707_10240565 Ga0207707_102405651 179
1494 3300025913 Ga0207695_10017662 Ga0207695_100176627 179
1495 3300025914 Ga0207671_10000756 Ga0207671_1000075612 179
1496 3300025918 Ga0207662_10000011 Ga0207662_1000001144 179
1497 3300025919 Ga0207657_10000323 Ga0207657_1000032341 179
1498 3300025920 Ga0207649_10004231 Ga0207649_100042316 179
1499 3300025920 Ga0207649_10034225 Ga0207649_100342252 179
1500 3300025921 Ga0207652_10321993 Ga0207652_103219931 179
1501 3300025923 Ga0207681_10000108 Ga0207681_1000010864 179
1502 3300025924 Ga0207694_10002995 Ga0207694_100029954 179
1503 3300025925 Ga0207650_10000349 Ga0207650_1000034941 179
1504 3300025926 Ga0207659_10000123 Ga0207659_1000012342 179
1505 3300025927 Ga0207687_10003500 Ga0207687_100035008 179
1506 3300025931 Ga0207644_10002199 Ga0207644_1000219912 179
1507 3300025932 Ga0207690_10001018 Ga0207690_1000101813 179
1508 3300025933 Ga0207706_10000078 Ga0207706_1000007840 179
1509 3300025934 Ga0207686_10057304 Ga0207686_100573043 179
1510 3300025935 Ga0207709_10003349 Ga0207709_100033494 179
1511 3300025936 Ga0207670_10000399 Ga0207670_100003991 179
1512 3300025937 Ga0207669_10021798 Ga0207669_100217981 179
1513 3300025938 Ga0207704_10000264 Ga0207704_100002641 179
1514 3300025940 Ga0207691_10000389 Ga0207691_100003898 179
1515 3300025941 Ga0207711_10000261 Ga0207711_100002611 179
1516 3300025942 Ga0207689_10011980 Ga0207689_100119801 179
1517 3300025944 Ga0207661_10003584 Ga0207661_100035841 179
1518 3300025945 Ga0207679_10000445 Ga0207679_100004451 179
1519 3300025945 Ga0207679_10012745 Ga0207679_100127454 179
1520 3300025949 Ga0207667_10158173 Ga0207667_101581733 179
1521 3300025960 Ga0207651_10000020 Ga0207651_1000002036 179
1522 3300025961 Ga0207712_10001949 Ga0207712_100019498 179
1523 3300025972 Ga0207668_10020561 Ga0207668_100205611 179
1524 3300025981 Ga0207640_10000302 Ga0207640_1000030211 179
1525 3300025986 Ga0207658_10000437 Ga0207658_100004378 179
1526 3300026023 Ga0207677_10000079 Ga0207677_1000007942 179
1527 3300026035 Ga0207703_10000148 Ga0207703_1000014828 179
1528 3300026035 Ga0207703_10000236 Ga0207703_1000023614 179
1529 3300026041 Ga0207639_10007421 Ga0207639_100074218 179
1530 3300026067 Ga0207678_10013591 Ga0207678_100135911 179
1531 3300026075 Ga0207708_10004939 Ga0207708_1000493910 179
1532 3300026078 Ga0207702_10017281 Ga0207702_100172817 179
1533 3300026088 Ga0207641_10001330 Ga0207641_1000133019 179
1534 3300026089 Ga0207648_10000497 Ga0207648_100004978 179
1535 3300026095 Ga0207676_10000341 Ga0207676_1000034130 179
1536 3300026116 Ga0207674_10000427 Ga0207674_1000042744 179
1537 3300026116 Ga0207674_10006518 Ga0207674_100065189 179
1538 3300026118 Ga0207675_100000006 Ga0207675_10000000636 179
1539 3300026121 Ga0207683_10000933 Ga0207683_1000093319 179
1540 3300026142 Ga0207698_10000914 Ga0207698_1000091414 179
1541 3300028379 Ga0268266_10000687 Ga0268266_100006878 179
1542 3300028380 Ga0268265_10000340 Ga0268265_1000034037 179
1543 3300028381 Ga0268264_10000705 Ga0268264_100007058 179
1544 3300035691 Ga0373931_0143126 Ga0373931_0143126_240_779 179
1545 3300039450 Ga0436363_1083023 Ga0436363_1083023_66_605 179
1546 3300042005 Ga0439448_0048922 Ga0439448_0048922_816_1355 179
1547 3300042012 Ga0439455_0001365 Ga0439455_0001365_176_715 179
1548 3300042876 Ga0451577_0011117 Ga0451577_0011117_2505_3044 179
1549 3300045051 Ga0451576_0041854 Ga0451576_0041854_2899_3438 179
1550 3300045051 Ga0451576_0246482 Ga0451576_0246482_1222_1761 179
1551 3300048903 Ga0496100_0798384 Ga0496100_0798384_17_556 179
1552 3300048905 Ga0496102_0182787 Ga0496102_0182787_201_740 179
1553 3300048906 Ga0496103_0006194 Ga0496103_0006194_6361_6900 179
1554 3300048909 Ga0496106_0000648 Ga0496106_0000648_17948_18487 179
1555 3300048911 Ga0496108_0666862 Ga0496108_0666862_55_594 179
1556 3300048912 Ga0496109_0014398 Ga0496109_0014398_5189_5728 179
1557 3300048913 Ga0496110_0418414 Ga0496110_0418414_148_687 179
1558 3300048915 Ga0496112_0015002 Ga0496112_0015002_443_982 179
1559 3300048916 Ga0496113_0347702 Ga0496113_0347702_185_724 179
1560 3300050508 nmdc:mga09592_151892_c1 nmdc:mga09592_151892_c1_105_644 179
1561 3300050511 nmdc:mga08y16_360556_c1 nmdc:mga08y16_360556_c1_124_663 179

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00156

Pribosyltran

Phosphoribosyl transferase domain

26

171

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
4lza-assembly1.cif.gz_B crystal structure of adenine phosphoribosyltransferase from thermoanaerobacter pseudethanolicus atcc 33223, nysgrc target 029700. 0.9564 6 175
4lza-assembly1.cif.gz_A crystal structure of adenine phosphoribosyltransferase from thermoanaerobacter pseudethanolicus atcc 33223, nysgrc target 029700. 0.9479 6 175
6fd6-assembly1.cif.gz_B crystal structure of human aprt-tyr105phe variant in complex with adenine, prpp and mg2+, 30 days post crystallization (with amp and ppi products fully generated) 0.9445 4 176
4lza-assembly1.cif.gz_B crystal structure of adenine phosphoribosyltransferase from thermoanaerobacter pseudethanolicus atcc 33223, nysgrc target 029700. 0.9403 6 175
6fci-assembly1.cif.gz_A crystal structure of human aprt wild type in complex with adenine, prpp and mg2+ 0.9389 4 176
ID Description Score Start End Superfamily
af_P9WQ07_33_212_3.40.50.2020 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9342 5 175 3.40.50.2020
af_P12426_6_182_3.40.50.2020 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9286 4 175 3.40.50.2020
1l1rA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.928 6 175 3.40.50.2020
af_P91455_5_184_3.40.50.2020 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9278 4 177 3.40.50.2020
af_P69503_1_183_3.40.50.2020 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.924 1 175 3.40.50.2020
ID Description Score Start End GO Terms
AF-A0A4R6STR0-F1-model_v4 Adenine phosphoribosyltransferase (APRT) (EC 2.4.2.7) 0.9654 5 175 GO:0002055
GO:0003999
GO:0005737
GO:0006166
GO:0006168
GO:0016208
GO:0044209
AF-A0A1G1LJ80-F1-model_v4 Adenine phosphoribosyltransferase (APRT) (EC 2.4.2.7) 0.965 6 176 GO:0002055
GO:0003999
GO:0005737
GO:0006166
GO:0006168
GO:0016208
GO:0044209
AF-A7HLE2-F1-model_v4 Adenine phosphoribosyltransferase (APRT) (EC 2.4.2.7) 0.9632 9 175 GO:0002055
GO:0003999
GO:0005737
GO:0006166
GO:0006168
GO:0016208
GO:0044209
AF-A0A836BFT3-F1-model_v4 adenine phosphoribosyltransferase (EC 2.4.2.7) 0.9622 72 175 GO:0002055
GO:0003999
GO:0005737
GO:0006166
GO:0006168
GO:0016208
GO:0044209
AF-A0A6N8X6A8-F1-model_v4 adenine phosphoribosyltransferase (EC 2.4.2.7) 0.9621 5 165 GO:0003999
GO:0005737
GO:0006166
GO:0006168
GO:0044209

Feature Viewer

pLDDT pTM Quality
93.5 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map