F494707
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1549 | 383 | 1548 | 171 |
Family's Representative Sequence
| Representative Sequence | 3300013306|Ga0163162_10947929|Ga0163162_109479291 |
| Length | 188 |
| Sequence | MSRSLHSSSQVHEHGDDRVSAAPDDDQRWFAIWTRSRHEQVVREQLLQKQIDTFLPTVTRWSRWKDRKKKIDWPLFPGYCFARFNPRERLPILKCTGVVTIISSQGGEPSAIPEHEIEGIRQLVQSDLAFDPCPMIREGTLVEVIHGPLKGVIGRLLRKSDKARLVLSVDLIGQAVSVEVDAADVRAY |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 2 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 3 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 4 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 5 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 6 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 7 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 9 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 15 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 17 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 19 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 21 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 32 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 46 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 47 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 53 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 54 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 55 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 57 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 62 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 63 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 65 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 66 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 67 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 69 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 70 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 71 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 72 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 73 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 74 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 75 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 76 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 77 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 78 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 79 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 80 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 81 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 83 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 84 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 85 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 86 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 88 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 89 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 90 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 91 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 92 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 93 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 94 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 95 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 96 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 98 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 124 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 129 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 198 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 202 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 203 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 204 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 205 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 206 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 207 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 208 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 209 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 210 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 211 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 212 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 213 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 214 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 215 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 216 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 217 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 218 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 219 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 220 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 221 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 222 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 223 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 224 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 225 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 226 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 227 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 228 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 229 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 230 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 231 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 232 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 233 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 234 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 235 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 236 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 237 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 238 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 239 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 240 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 241 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 242 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 243 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 244 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 245 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 246 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 247 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 248 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 249 | 3300042000 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 | Metagenome | Rhizosphere |
| 250 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 251 | 3300042130 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 | Metagenome | Rhizosphere |
| 252 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 253 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 254 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 255 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 256 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 257 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 258 | 3300042530 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 | Metagenome | Rhizosphere |
| 259 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 260 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 261 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 262 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 263 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 264 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 265 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 314 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 315 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 316 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 317 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 318 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 319 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 320 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 321 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 322 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 323 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 324 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 325 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 326 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 327 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 328 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 329 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 330 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 331 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 332 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 333 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 334 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 335 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 336 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 337 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 338 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 339 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 340 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 341 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 342 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 343 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 344 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 345 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 346 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 347 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 348 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 349 | 3300049660 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control | Metagenome | Rhizosphere |
| 350 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 351 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 352 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 353 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 354 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 355 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 356 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 357 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 358 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 359 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 360 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 361 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 362 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 363 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 364 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 365 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 366 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 367 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 368 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 369 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 370 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 371 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 375 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 376 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 377 | 3300059423 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 378 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 379 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 380 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 381 | 3300059655 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 382 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 383 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.87 |
| Metatranscriptomes | 0.13 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.39 |
| Nodule | 0 |
| Rhizoplane | 2.97 |
| Rhizosphere | 96.45 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.19 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24033J26618_1016701 | 3300002155 | Unclassified | 914 |
| 2 | JGI24751J29686_10013893 | 3300002459 | Bacteria | 1662 |
| 3 | JGI25406J46586_10097873 | 3300003203 | Bacteria | 878 |
| 4 | Ga0065714_10083408 | 3300005288 | Bacteria | 2244 |
| 5 | Ga0065704_10148721 | 3300005289 | Unclassified | 1413 |
| 6 | Ga0065704_10537012 | 3300005289 | Bacteria | 643 |
| 7 | Ga0065712_10002622 | 3300005290 | Bacteria | 5006 |
| 8 | Ga0065712_10067818 | 3300005290 | Bacteria | 29246 |
| 9 | Ga0065712_10099576 | 3300005290 | Unclassified | 2087 |
| 10 | Ga0065712_10149758 | 3300005290 | Bacteria | 1373 |
| 11 | Ga0065712_10162315 | 3300005290 | Bacteria | 1294 |
| 12 | Ga0065712_10319358 | 3300005290 | Unclassified | 831 |
| 13 | Ga0065715_10103959 | 3300005293 | Unclassified | 2995 |
| 14 | Ga0065715_10146880 | 3300005293 | Unclassified | 1771 |
| 15 | Ga0065715_10147926 | 3300005293 | Bacteria | 1765 |
| 16 | Ga0065715_10158966 | 3300005293 | Bacteria | 1648 |
| 17 | Ga0065715_10168749 | 3300005293 | Bacteria | 1564 |
| 18 | Ga0065715_10236028 | 3300005293 | Bacteria | 1216 |
| 19 | Ga0065715_10279735 | 3300005293 | Bacteria | 1078 |
| 20 | Ga0065715_10408396 | 3300005293 | Unclassified | 873 |
| 21 | Ga0065707_10247239 | 3300005295 | Bacteria | 1133 |
| 22 | Ga0065707_10289450 | 3300005295 | Unclassified | 1028 |
| 23 | Ga0065707_10302678 | 3300005295 | Bacteria | 1001 |
| 24 | Ga0065707_10412332 | 3300005295 | Unclassified | 840 |
| 25 | Ga0065707_10484671 | 3300005295 | Bacteria | 770 |
| 26 | Ga0070676_10026241 | 3300005328 | Bacteria | 3298 |
| 27 | Ga0070676_10199862 | 3300005328 | Unclassified | 1310 |
| 28 | Ga0070676_10297952 | 3300005328 | Bacteria | 1092 |
| 29 | Ga0070676_10331366 | 3300005328 | Bacteria | 1041 |
| 30 | Ga0070676_10357983 | 3300005328 | Unclassified | 1005 |
| 31 | Ga0070676_10438005 | 3300005328 | Unclassified | 916 |
| 32 | Ga0070676_10832927 | 3300005328 | Unclassified | 683 |
| 33 | Ga0070683_100024470 | 3300005329 | Bacteria | 5409 |
| 34 | Ga0070683_100338820 | 3300005329 | Unclassified | 1432 |
| 35 | Ga0070690_100000920 | 3300005330 | Bacteria | 14972 |
| 36 | Ga0070690_100166363 | 3300005330 | Unclassified | 1515 |
| 37 | Ga0070690_100197332 | 3300005330 | Bacteria | 1399 |
| 38 | Ga0070690_100922612 | 3300005330 | Bacteria | 684 |
| 39 | Ga0070690_100946779 | 3300005330 | Unclassified | 676 |
| 40 | Ga0070690_101430069 | 3300005330 | Bacteria | 557 |
| 41 | Ga0070670_100015640 | 3300005331 | Bacteria | 6514 |
| 42 | Ga0070670_100026375 | 3300005331 | Bacteria | 5001 |
| 43 | Ga0070670_100052956 | 3300005331 | Bacteria | 3486 |
| 44 | Ga0070670_100161978 | 3300005331 | Unclassified | 1939 |
| 45 | Ga0070670_100300500 | 3300005331 | Unclassified | 1404 |
| 46 | Ga0070670_100901418 | 3300005331 | Unclassified | 801 |
| 47 | Ga0070677_10013312 | 3300005333 | Bacteria | 2875 |
| 48 | Ga0070677_10044554 | 3300005333 | Unclassified | 1766 |
| 49 | Ga0070677_10049012 | 3300005333 | Bacteria | 1699 |
| 50 | Ga0070677_10279774 | 3300005333 | Bacteria | 840 |
| 51 | Ga0070677_10284896 | 3300005333 | Unclassified | 834 |
| 52 | Ga0070677_10422995 | 3300005333 | Unclassified | 707 |
| 53 | Ga0068869_100002153 | 3300005334 | Bacteria | 11844 |
| 54 | Ga0068869_100048862 | 3300005334 | Bacteria | 3061 |
| 55 | Ga0068869_100092460 | 3300005334 | Unclassified | 2277 |
| 56 | Ga0068869_100103497 | 3300005334 | Bacteria | 2157 |
| 57 | Ga0068869_100174532 | 3300005334 | Unclassified | 1681 |
| 58 | Ga0068869_100280507 | 3300005334 | Bacteria | 1340 |
| 59 | Ga0068869_100536026 | 3300005334 | Unclassified | 981 |
| 60 | Ga0068869_101215174 | 3300005334 | Bacteria | 663 |
| 61 | Ga0070666_10196882 | 3300005335 | Unclassified | 1417 |
| 62 | Ga0070666_10198726 | 3300005335 | Bacteria | 1410 |
| 63 | Ga0070666_10729581 | 3300005335 | Bacteria | 728 |
| 64 | Ga0070680_100025422 | 3300005336 | Bacteria | 4733 |
| 65 | Ga0070680_100153630 | 3300005336 | Unclassified | 1933 |
| 66 | Ga0070680_100630050 | 3300005336 | Bacteria | 921 |
| 67 | Ga0070680_100866206 | 3300005336 | Bacteria | 779 |
| 68 | Ga0070682_100900612 | 3300005337 | Unclassified | 727 |
| 69 | Ga0070682_101072323 | 3300005337 | Bacteria | 673 |
| 70 | Ga0070682_101249949 | 3300005337 | Bacteria | 629 |
| 71 | Ga0068868_100034955 | 3300005338 | Bacteria | 3882 |
| 72 | Ga0068868_100064048 | 3300005338 | Unclassified | 2918 |
| 73 | Ga0068868_100291802 | 3300005338 | Unclassified | 1383 |
| 74 | Ga0068868_100330401 | 3300005338 | Bacteria | 1301 |
| 75 | Ga0068868_100352495 | 3300005338 | Unclassified | 1261 |
| 76 | Ga0068868_100639711 | 3300005338 | Unclassified | 946 |
| 77 | Ga0068868_100741312 | 3300005338 | Bacteria | 882 |
| 78 | Ga0068868_101181271 | 3300005338 | Unclassified | 707 |
| 79 | Ga0070660_100001092 | 3300005339 | Bacteria | 18217 |
| 80 | Ga0070660_100441529 | 3300005339 | Bacteria | 1079 |
| 81 | Ga0070689_100043202 | 3300005340 | Bacteria | 3463 |
| 82 | Ga0070689_100065174 | 3300005340 | Bacteria | 2836 |
| 83 | Ga0070689_100199760 | 3300005340 | Unclassified | 1632 |
| 84 | Ga0070689_100215050 | 3300005340 | Bacteria | 1575 |
| 85 | Ga0070689_100327105 | 3300005340 | Unclassified | 1281 |
| 86 | Ga0070689_100340128 | 3300005340 | Unclassified | 1257 |
| 87 | Ga0070689_100586620 | 3300005340 | Unclassified | 964 |
| 88 | Ga0070689_100740161 | 3300005340 | Bacteria | 861 |
| 89 | Ga0070691_10000892 | 3300005341 | Bacteria | 12096 |
| 90 | Ga0070691_10043112 | 3300005341 | Unclassified | 2137 |
| 91 | Ga0070691_10149628 | 3300005341 | Unclassified | 1196 |
| 92 | Ga0070687_100038743 | 3300005343 | Unclassified | 2391 |
| 93 | Ga0070687_100095286 | 3300005343 | Bacteria | 1655 |
| 94 | Ga0070661_100265127 | 3300005344 | Unclassified | 1329 |
| 95 | Ga0070661_100414251 | 3300005344 | Bacteria | 1067 |
| 96 | Ga0070661_100608875 | 3300005344 | Bacteria | 884 |
| 97 | Ga0070661_101372584 | 3300005344 | Unclassified | 594 |
| 98 | Ga0070692_10035812 | 3300005345 | Viruses | 2515 |
| 99 | Ga0070692_10458705 | 3300005345 | Bacteria | 817 |
| 100 | Ga0070668_100105729 | 3300005347 | Bacteria | 2236 |
| 101 | Ga0070668_100454436 | 3300005347 | Unclassified | 1102 |
| 102 | Ga0070668_100735908 | 3300005347 | Bacteria | 872 |
| 103 | Ga0070669_100003474 | 3300005353 | Bacteria | 11357 |
| 104 | Ga0070669_100031310 | 3300005353 | Viruses | 3843 |
| 105 | Ga0070669_100038193 | 3300005353 | Bacteria | 3485 |
| 106 | Ga0070669_100092083 | 3300005353 | Bacteria | 2275 |
| 107 | Ga0070669_100162925 | 3300005353 | Unclassified | 1734 |
| 108 | Ga0070669_100313428 | 3300005353 | Bacteria | 1265 |
| 109 | Ga0070669_100339396 | 3300005353 | Bacteria | 1217 |
| 110 | Ga0070669_100423022 | 3300005353 | Unclassified | 1094 |
| 111 | Ga0070669_100548837 | 3300005353 | Bacteria | 963 |
| 112 | Ga0070669_100615765 | 3300005353 | Bacteria | 911 |
| 113 | Ga0070669_100669953 | 3300005353 | Unclassified | 874 |
| 114 | Ga0070669_100678850 | 3300005353 | Unclassified | 868 |
| 115 | Ga0070675_100000433 | 3300005354 | Bacteria | 28442 |
| 116 | Ga0070675_100001643 | 3300005354 | Bacteria | 16516 |
| 117 | Ga0070675_100003018 | 3300005354 | Bacteria | 12707 |
| 118 | Ga0070675_100007486 | 3300005354 | Bacteria | 8435 |
| 119 | Ga0070675_100007803 | 3300005354 | Bacteria | 8291 |
| 120 | Ga0070675_100022727 | 3300005354 | Bacteria | 5010 |
| 121 | Ga0070675_100036669 | 3300005354 | Bacteria | 3991 |
| 122 | Ga0070675_100205743 | 3300005354 | Bacteria | 1709 |
| 123 | Ga0070675_100217685 | 3300005354 | Bacteria | 1662 |
| 124 | Ga0070675_100313845 | 3300005354 | Bacteria | 1384 |
| 125 | Ga0070675_100344667 | 3300005354 | Bacteria | 1320 |
| 126 | Ga0070675_100439608 | 3300005354 | Archaea | 1168 |
| 127 | Ga0070675_100539788 | 3300005354 | Unclassified | 1054 |
| 128 | Ga0070671_100034834 | 3300005355 | Bacteria | 4169 |
| 129 | Ga0070671_100048508 | 3300005355 | Bacteria | 3531 |
| 130 | Ga0070671_100320519 | 3300005355 | Bacteria | 1321 |
| 131 | Ga0070671_100354947 | 3300005355 | Bacteria | 1252 |
| 132 | Ga0070671_100782269 | 3300005355 | Bacteria | 830 |
| 133 | Ga0070674_100021951 | 3300005356 | Bacteria | 4110 |
| 134 | Ga0070674_100044223 | 3300005356 | Bacteria | 3035 |
| 135 | Ga0070674_100140019 | 3300005356 | Unclassified | 1815 |
| 136 | Ga0070674_100241008 | 3300005356 | Unclassified | 1416 |
| 137 | Ga0070674_100519194 | 3300005356 | Unclassified | 995 |
| 138 | Ga0070674_100674351 | 3300005356 | Bacteria | 881 |
| 139 | Ga0070674_100779800 | 3300005356 | Unclassified | 824 |
| 140 | Ga0070674_101006082 | 3300005356 | Unclassified | 732 |
| 141 | Ga0070674_101255596 | 3300005356 | Unclassified | 659 |
| 142 | Ga0070674_101265879 | 3300005356 | Unclassified | 657 |
| 143 | Ga0070674_101447295 | 3300005356 | Unclassified | 616 |
| 144 | Ga0070673_100003132 | 3300005364 | Bacteria | 10234 |
| 145 | Ga0070673_100043274 | 3300005364 | Unclassified | 3478 |
| 146 | Ga0070673_100050178 | 3300005364 | Bacteria | 3261 |
| 147 | Ga0070673_100058513 | 3300005364 | Unclassified | 3047 |
| 148 | Ga0070673_100137316 | 3300005364 | Unclassified | 2059 |
| 149 | Ga0070673_100171940 | 3300005364 | Bacteria | 1850 |
| 150 | Ga0070673_100183156 | 3300005364 | Unclassified | 1794 |
| 151 | Ga0070673_100196196 | 3300005364 | Bacteria | 1736 |
| 152 | Ga0070673_100208212 | 3300005364 | Unclassified | 1687 |
| 153 | Ga0070673_100549318 | 3300005364 | Bacteria | 1049 |
| 154 | Ga0070673_100635366 | 3300005364 | Bacteria | 976 |
| 155 | Ga0070688_100060927 | 3300005365 | Bacteria | 2384 |
| 156 | Ga0070688_100098261 | 3300005365 | Unclassified | 1925 |
| 157 | Ga0070688_100216235 | 3300005365 | Unclassified | 1348 |
| 158 | Ga0070688_100476940 | 3300005365 | Unclassified | 937 |
| 159 | Ga0070688_101083333 | 3300005365 | Unclassified | 640 |
| 160 | Ga0070659_100197547 | 3300005366 | Bacteria | 1655 |
| 161 | Ga0070667_100179209 | 3300005367 | Unclassified | 1873 |
| 162 | Ga0070667_100414741 | 3300005367 | Bacteria | 1227 |
| 163 | Ga0070667_100587289 | 3300005367 | Unclassified | 1026 |
| 164 | Ga0070709_10007316 | 3300005434 | Bacteria | 6051 |
| 165 | Ga0070709_10759539 | 3300005434 | Bacteria | 758 |
| 166 | Ga0070714_100003070 | 3300005435 | Bacteria | 12391 |
| 167 | Ga0070713_100004893 | 3300005436 | Bacteria | 9089 |
| 168 | Ga0070713_100193518 | 3300005436 | Bacteria | 1834 |
| 169 | Ga0070713_100900072 | 3300005436 | Unclassified | 851 |
| 170 | Ga0070713_101253314 | 3300005436 | Unclassified | 718 |
| 171 | Ga0070713_101716902 | 3300005436 | Unclassified | 609 |
| 172 | Ga0070701_10080120 | 3300005438 | Bacteria | 1765 |
| 173 | Ga0070701_10102714 | 3300005438 | Unclassified | 1586 |
| 174 | Ga0070705_100001404 | 3300005440 | Bacteria | 12773 |
| 175 | Ga0070705_100014875 | 3300005440 | Bacteria | 4013 |
| 176 | Ga0070705_100053659 | 3300005440 | Bacteria | 2361 |
| 177 | Ga0070705_100135726 | 3300005440 | Bacteria | 1611 |
| 178 | Ga0070700_100000788 | 3300005441 | Bacteria | 15603 |
| 179 | Ga0070700_100006082 | 3300005441 | Bacteria | 6427 |
| 180 | Ga0070700_100059550 | 3300005441 | Unclassified | 2404 |
| 181 | Ga0070700_100068953 | 3300005441 | Unclassified | 2250 |
| 182 | Ga0070700_100274394 | 3300005441 | Bacteria | 1220 |
| 183 | Ga0070700_100906779 | 3300005441 | Bacteria | 718 |
| 184 | Ga0070694_100002894 | 3300005444 | Bacteria | 10201 |
| 185 | Ga0070694_100005858 | 3300005444 | Bacteria | 7456 |
| 186 | Ga0070694_100007026 | 3300005444 | Bacteria | 6848 |
| 187 | Ga0070694_100172110 | 3300005444 | Bacteria | 1596 |
| 188 | Ga0070694_100379711 | 3300005444 | Bacteria | 1102 |
| 189 | Ga0070694_100502706 | 3300005444 | Unclassified | 965 |
| 190 | Ga0070694_100802159 | 3300005444 | Bacteria | 772 |
| 191 | Ga0070708_100032111 | 3300005445 | Bacteria | 4551 |
| 192 | Ga0070708_100519664 | 3300005445 | Bacteria | 1123 |
| 193 | Ga0070708_100607625 | 3300005445 | Unclassified | 1031 |
| 194 | Ga0070708_100868844 | 3300005445 | Bacteria | 847 |
| 195 | Ga0070663_100037019 | 3300005455 | Bacteria | 3394 |
| 196 | Ga0070663_100878596 | 3300005455 | Unclassified | 773 |
| 197 | Ga0070678_100109353 | 3300005456 | Bacteria | 2159 |
| 198 | Ga0070678_100116947 | 3300005456 | Bacteria | 2096 |
| 199 | Ga0070678_100130775 | 3300005456 | Bacteria | 1994 |
| 200 | Ga0070678_100140021 | 3300005456 | Bacteria | 1935 |
| 201 | Ga0070678_100494754 | 3300005456 | Unclassified | 1078 |
| 202 | Ga0070678_100653885 | 3300005456 | Unclassified | 943 |
| 203 | Ga0070678_100709470 | 3300005456 | Bacteria | 907 |
| 204 | Ga0070662_100073576 | 3300005457 | Bacteria | 2525 |
| 205 | Ga0070662_100203340 | 3300005457 | Unclassified | 1573 |
| 206 | Ga0070662_100380504 | 3300005457 | Bacteria | 1162 |
| 207 | Ga0070662_100593270 | 3300005457 | Unclassified | 931 |
| 208 | Ga0070662_100874882 | 3300005457 | Unclassified | 766 |
| 209 | Ga0070662_101063022 | 3300005457 | Bacteria | 694 |
| 210 | Ga0070681_10386081 | 3300005458 | Bacteria | 1311 |
| 211 | Ga0070681_11157304 | 3300005458 | Bacteria | 695 |
| 212 | Ga0068867_100000380 | 3300005459 | Bacteria | 29556 |
| 213 | Ga0068867_100115369 | 3300005459 | Bacteria | 2069 |
| 214 | Ga0068867_100138704 | 3300005459 | Bacteria | 1898 |
| 215 | Ga0068867_100139519 | 3300005459 | Unclassified | 1893 |
| 216 | Ga0068867_100686917 | 3300005459 | Bacteria | 902 |
| 217 | Ga0068867_100709371 | 3300005459 | Bacteria | 888 |
| 218 | Ga0068867_100713581 | 3300005459 | Unclassified | 886 |
| 219 | Ga0068867_100944408 | 3300005459 | Unclassified | 779 |
| 220 | Ga0068867_101063118 | 3300005459 | Bacteria | 737 |
| 221 | Ga0068867_101672557 | 3300005459 | Bacteria | 596 |
| 222 | Ga0068867_101710127 | 3300005459 | Unclassified | 590 |
| 223 | Ga0070685_10047159 | 3300005466 | Bacteria | 2477 |
| 224 | Ga0070685_10050222 | 3300005466 | Unclassified | 2409 |
| 225 | Ga0070685_10106243 | 3300005466 | Bacteria | 1722 |
| 226 | Ga0070685_10197670 | 3300005466 | Unclassified | 1305 |
| 227 | Ga0070685_10545954 | 3300005466 | Unclassified | 826 |
| 228 | Ga0070706_100186401 | 3300005467 | Bacteria | 1939 |
| 229 | Ga0070706_100236430 | 3300005467 | Bacteria | 1706 |
| 230 | Ga0070706_100286210 | 3300005467 | Bacteria | 1538 |
| 231 | Ga0070706_100774035 | 3300005467 | Bacteria | 889 |
| 232 | Ga0070706_101121435 | 3300005467 | Unclassified | 724 |
| 233 | Ga0070706_101226546 | 3300005467 | Unclassified | 689 |
| 234 | Ga0070707_100442076 | 3300005468 | Bacteria | 1261 |
| 235 | Ga0070707_100657285 | 3300005468 | Bacteria | 1011 |
| 236 | Ga0070707_101094705 | 3300005468 | Unclassified | 763 |
| 237 | Ga0070707_101286300 | 3300005468 | Unclassified | 698 |
| 238 | Ga0070698_100003115 | 3300005471 | Bacteria | 18284 |
| 239 | Ga0070698_100006640 | 3300005471 | Bacteria | 12545 |
| 240 | Ga0070698_100011223 | 3300005471 | Bacteria | 9517 |
| 241 | Ga0070698_100072413 | 3300005471 | Bacteria | 3454 |
| 242 | Ga0070698_100138182 | 3300005471 | Unclassified | 2390 |
| 243 | Ga0070698_100394572 | 3300005471 | Bacteria | 1317 |
| 244 | Ga0070699_100003719 | 3300005518 | Bacteria | 13483 |
| 245 | Ga0070699_100006814 | 3300005518 | Bacteria | 9942 |
| 246 | Ga0070699_100100290 | 3300005518 | Bacteria | 2538 |
| 247 | Ga0070699_100123199 | 3300005518 | Unclassified | 2281 |
| 248 | Ga0070679_100010050 | 3300005530 | Bacteria | 8963 |
| 249 | Ga0070679_100127817 | 3300005530 | Unclassified | 2523 |
| 250 | Ga0070679_100548131 | 3300005530 | Bacteria | 1100 |
| 251 | Ga0070679_100776591 | 3300005530 | Unclassified | 901 |
| 252 | Ga0070684_100076110 | 3300005535 | Bacteria | 2962 |
| 253 | Ga0070684_100179696 | 3300005535 | Bacteria | 1924 |
| 254 | Ga0070684_100519127 | 3300005535 | Bacteria | 1104 |
| 255 | Ga0070684_101199138 | 3300005535 | Bacteria | 714 |
| 256 | Ga0068853_100611029 | 3300005539 | Unclassified | 1036 |
| 257 | Ga0070672_100004404 | 3300005543 | Bacteria | 9223 |
| 258 | Ga0070672_100005217 | 3300005543 | Bacteria | 8597 |
| 259 | Ga0070672_100062004 | 3300005543 | Bacteria | 2950 |
| 260 | Ga0070672_100157158 | 3300005543 | Unclassified | 1884 |
| 261 | Ga0070672_100196808 | 3300005543 | Bacteria | 1684 |
| 262 | Ga0070672_100213036 | 3300005543 | Unclassified | 1618 |
| 263 | Ga0070672_100617737 | 3300005543 | Bacteria | 945 |
| 264 | Ga0070672_100692814 | 3300005543 | Bacteria | 892 |
| 265 | Ga0070672_100729197 | 3300005543 | Unclassified | 869 |
| 266 | Ga0070672_101137246 | 3300005543 | Unclassified | 694 |
| 267 | Ga0070686_100000153 | 3300005544 | Bacteria | 47434 |
| 268 | Ga0070686_100030299 | 3300005544 | Unclassified | 3299 |
| 269 | Ga0070686_100084274 | 3300005544 | Bacteria | 2111 |
| 270 | Ga0070686_100188159 | 3300005544 | Bacteria | 1472 |
| 271 | Ga0070686_100218647 | 3300005544 | Bacteria | 1376 |
| 272 | Ga0070686_100313655 | 3300005544 | Unclassified | 1167 |
| 273 | Ga0070686_100375621 | 3300005544 | Unclassified | 1075 |
| 274 | Ga0070686_100537386 | 3300005544 | Unclassified | 912 |
| 275 | Ga0070695_100016291 | 3300005545 | Bacteria | 4496 |
| 276 | Ga0070695_100027664 | 3300005545 | Bacteria | 3515 |
| 277 | Ga0070695_100170257 | 3300005545 | Bacteria | 1536 |
| 278 | Ga0070695_100502552 | 3300005545 | Unclassified | 938 |
| 279 | Ga0070695_100826694 | 3300005545 | Unclassified | 744 |
| 280 | Ga0070695_100954808 | 3300005545 | Unclassified | 695 |
| 281 | Ga0070696_100018169 | 3300005546 | Bacteria | 4750 |
| 282 | Ga0070696_100039612 | 3300005546 | Bacteria | 3253 |
| 283 | Ga0070696_100112265 | 3300005546 | Unclassified | 1964 |
| 284 | Ga0070696_100552454 | 3300005546 | Unclassified | 923 |
| 285 | Ga0070696_100587157 | 3300005546 | Bacteria | 897 |
| 286 | Ga0070693_100169522 | 3300005547 | Bacteria | 1397 |
| 287 | Ga0070693_100720868 | 3300005547 | Bacteria | 732 |
| 288 | Ga0070693_100759909 | 3300005547 | Unclassified | 715 |
| 289 | Ga0070693_100836877 | 3300005547 | Unclassified | 685 |
| 290 | Ga0070665_100002502 | 3300005548 | Bacteria | 20209 |
| 291 | Ga0070665_100010631 | 3300005548 | Bacteria | 9316 |
| 292 | Ga0070665_100020086 | 3300005548 | Bacteria | 6706 |
| 293 | Ga0070665_100078682 | 3300005548 | Bacteria | 3304 |
| 294 | Ga0070665_100195381 | 3300005548 | Unclassified | 2024 |
| 295 | Ga0070665_100950167 | 3300005548 | Unclassified | 872 |
| 296 | Ga0070704_100000089 | 3300005549 | Bacteria | 31704 |
| 297 | Ga0070704_100026609 | 3300005549 | Unclassified | 3825 |
| 298 | Ga0070704_100032604 | 3300005549 | Unclassified | 3516 |
| 299 | Ga0070704_100074989 | 3300005549 | Bacteria | 2469 |
| 300 | Ga0070704_100134456 | 3300005549 | Bacteria | 1922 |
| 301 | Ga0070704_100631855 | 3300005549 | Unclassified | 944 |
| 302 | Ga0070704_100700314 | 3300005549 | Unclassified | 898 |
| 303 | Ga0070704_101267826 | 3300005549 | Unclassified | 674 |
| 304 | Ga0070704_101301510 | 3300005549 | Unclassified | 665 |
| 305 | Ga0068855_100020680 | 3300005563 | Bacteria | 7892 |
| 306 | Ga0068855_100238478 | 3300005563 | Bacteria | 2033 |
| 307 | Ga0068855_100450881 | 3300005563 | Unclassified | 1404 |
| 308 | Ga0068855_100492643 | 3300005563 | Unclassified | 1333 |
| 309 | Ga0068855_100652639 | 3300005563 | Bacteria | 1130 |
| 310 | Ga0068855_100798835 | 3300005563 | Bacteria | 1003 |
| 311 | Ga0070664_100009603 | 3300005564 | Bacteria | 7847 |
| 312 | Ga0070664_100097790 | 3300005564 | Bacteria | 2549 |
| 313 | Ga0070664_100236671 | 3300005564 | Bacteria | 1638 |
| 314 | Ga0070664_100346288 | 3300005564 | Unclassified | 1351 |
| 315 | Ga0068857_100136211 | 3300005577 | Unclassified | 2217 |
| 316 | Ga0068857_100358762 | 3300005577 | Bacteria | 1351 |
| 317 | Ga0068857_100522165 | 3300005577 | Bacteria | 1116 |
| 318 | Ga0068857_100639122 | 3300005577 | Bacteria | 1008 |
| 319 | Ga0068854_100163499 | 3300005578 | Unclassified | 1726 |
| 320 | Ga0068854_101120050 | 3300005578 | Unclassified | 702 |
| 321 | Ga0068856_101833176 | 3300005614 | Bacteria | 618 |
| 322 | Ga0068856_101950599 | 3300005614 | Unclassified | 598 |
| 323 | Ga0070702_100003228 | 3300005615 | Bacteria | 7254 |
| 324 | Ga0070702_100053993 | 3300005615 | Unclassified | 2310 |
| 325 | Ga0070702_100357397 | 3300005615 | Unclassified | 1031 |
| 326 | Ga0070702_100962764 | 3300005615 | Bacteria | 673 |
| 327 | Ga0068852_100377942 | 3300005616 | Bacteria | 1389 |
| 328 | Ga0068852_100746608 | 3300005616 | Bacteria | 991 |
| 329 | Ga0068852_101897063 | 3300005616 | Unclassified | 618 |
| 330 | Ga0068859_100025246 | 3300005617 | Bacteria | 5963 |
| 331 | Ga0068859_100137975 | 3300005617 | Bacteria | 2512 |
| 332 | Ga0068859_100191448 | 3300005617 | Unclassified | 2130 |
| 333 | Ga0068859_100208366 | 3300005617 | Bacteria | 2041 |
| 334 | Ga0068859_100504379 | 3300005617 | Bacteria | 1305 |
| 335 | Ga0068859_100506815 | 3300005617 | Bacteria | 1302 |
| 336 | Ga0068859_100714266 | 3300005617 | Unclassified | 1092 |
| 337 | Ga0068859_100759169 | 3300005617 | Bacteria | 1059 |
| 338 | Ga0068859_101723599 | 3300005617 | Unclassified | 692 |
| 339 | Ga0068864_100002939 | 3300005618 | Bacteria | 14090 |
| 340 | Ga0068864_100099244 | 3300005618 | Unclassified | 2579 |
| 341 | Ga0068864_100201604 | 3300005618 | Viruses | 1828 |
| 342 | Ga0068864_100207644 | 3300005618 | Unclassified | 1802 |
| 343 | Ga0068864_100234303 | 3300005618 | Bacteria | 1699 |
| 344 | Ga0068864_100234644 | 3300005618 | Bacteria | 1698 |
| 345 | Ga0068864_100313810 | 3300005618 | Unclassified | 1471 |
| 346 | Ga0068864_100391631 | 3300005618 | Unclassified | 1319 |
| 347 | Ga0068864_100975212 | 3300005618 | Bacteria | 840 |
| 348 | Ga0068866_10009441 | 3300005718 | Bacteria | 4142 |
| 349 | Ga0068866_10024941 | 3300005718 | Unclassified | 2805 |
| 350 | Ga0068866_10084161 | 3300005718 | Unclassified | 1716 |
| 351 | Ga0068866_10085221 | 3300005718 | Bacteria | 1707 |
| 352 | Ga0068861_100010565 | 3300005719 | Bacteria | 6410 |
| 353 | Ga0068861_100079028 | 3300005719 | Viruses | 2571 |
| 354 | Ga0068861_100091306 | 3300005719 | Unclassified | 2404 |
| 355 | Ga0068861_100093769 | 3300005719 | Bacteria | 2374 |
| 356 | Ga0068861_100129925 | 3300005719 | Bacteria | 2044 |
| 357 | Ga0068861_100164360 | 3300005719 | Unclassified | 1834 |
| 358 | Ga0068861_100253110 | 3300005719 | Bacteria | 1504 |
| 359 | Ga0068861_100488257 | 3300005719 | Unclassified | 1111 |
| 360 | Ga0068861_100823788 | 3300005719 | Unclassified | 873 |
| 361 | Ga0068861_101454819 | 3300005719 | Unclassified | 671 |
| 362 | Ga0068851_10033637 | 3300005834 | Bacteria | 2556 |
| 363 | Ga0068851_10150437 | 3300005834 | Unclassified | 1272 |
| 364 | Ga0068870_10002891 | 3300005840 | Bacteria | 7236 |
| 365 | Ga0068870_10032435 | 3300005840 | Bacteria | 2656 |
| 366 | Ga0068870_10034344 | 3300005840 | Bacteria | 2595 |
| 367 | Ga0068870_10234070 | 3300005840 | Bacteria | 1131 |
| 368 | Ga0068870_10616965 | 3300005840 | Bacteria | 739 |
| 369 | Ga0068863_100062464 | 3300005841 | Bacteria | 3523 |
| 370 | Ga0068863_100143458 | 3300005841 | Unclassified | 2283 |
| 371 | Ga0068863_100184236 | 3300005841 | Bacteria | 2005 |
| 372 | Ga0068863_100199173 | 3300005841 | Unclassified | 1926 |
| 373 | Ga0068863_100300972 | 3300005841 | Bacteria | 1556 |
| 374 | Ga0068863_100313525 | 3300005841 | Unclassified | 1523 |
| 375 | Ga0068863_100650258 | 3300005841 | Unclassified | 1046 |
| 376 | Ga0068863_101144537 | 3300005841 | Unclassified | 783 |
| 377 | Ga0068858_100003255 | 3300005842 | Bacteria | 16182 |
| 378 | Ga0068858_100017044 | 3300005842 | Bacteria | 6819 |
| 379 | Ga0068858_100039216 | 3300005842 | Bacteria | 4393 |
| 380 | Ga0068858_100075256 | 3300005842 | Bacteria | 3136 |
| 381 | Ga0068858_100130019 | 3300005842 | Bacteria | 2360 |
| 382 | Ga0068858_100206865 | 3300005842 | Bacteria | 1857 |
| 383 | Ga0068858_100559154 | 3300005842 | Unclassified | 1108 |
| 384 | Ga0068858_101037450 | 3300005842 | Unclassified | 804 |
| 385 | Ga0068860_100017193 | 3300005843 | Bacteria | 7050 |
| 386 | Ga0068860_100034523 | 3300005843 | Unclassified | 4852 |
| 387 | Ga0068860_100219487 | 3300005843 | Bacteria | 1846 |
| 388 | Ga0068860_100271636 | 3300005843 | Unclassified | 1655 |
| 389 | Ga0068860_100347516 | 3300005843 | Bacteria | 1459 |
| 390 | Ga0068860_100354361 | 3300005843 | Unclassified | 1445 |
| 391 | Ga0068860_100356221 | 3300005843 | Unclassified | 1441 |
| 392 | Ga0068860_100392211 | 3300005843 | Bacteria | 1372 |
| 393 | Ga0068862_100021517 | 3300005844 | Bacteria | 5389 |
| 394 | Ga0068862_100024869 | 3300005844 | Bacteria | 5025 |
| 395 | Ga0068862_100040092 | 3300005844 | Unclassified | 3980 |
| 396 | Ga0068862_100053094 | 3300005844 | Bacteria | 3469 |
| 397 | Ga0068862_100260760 | 3300005844 | Bacteria | 1582 |
| 398 | Ga0068862_100384271 | 3300005844 | Bacteria | 1310 |
| 399 | Ga0068862_100429973 | 3300005844 | Bacteria | 1241 |
| 400 | Ga0068862_100594903 | 3300005844 | Bacteria | 1061 |
| 401 | Ga0068862_100636813 | 3300005844 | Unclassified | 1027 |
| 402 | Ga0068862_100657343 | 3300005844 | Bacteria | 1011 |
| 403 | Ga0068862_100746979 | 3300005844 | Unclassified | 951 |
| 404 | Ga0081455_10008971 | 3300005937 | Bacteria | 10330 |
| 405 | Ga0081455_10047875 | 3300005937 | Bacteria | 3698 |
| 406 | Ga0081539_10002012 | 3300005985 | Bacteria | 30795 |
| 407 | Ga0070717_11361300 | 3300006028 | Bacteria | 645 |
| 408 | Ga0075365_10059942 | 3300006038 | Bacteria | 2538 |
| 409 | Ga0070715_10045399 | 3300006163 | Unclassified | 1863 |
| 410 | Ga0070715_10059729 | 3300006163 | Unclassified | 1669 |
| 411 | Ga0070715_10370458 | 3300006163 | Bacteria | 788 |
| 412 | Ga0070716_100007561 | 3300006173 | Bacteria | 5360 |
| 413 | Ga0070716_100112531 | 3300006173 | Bacteria | 1690 |
| 414 | Ga0070716_100520649 | 3300006173 | Bacteria | 881 |
| 415 | Ga0070716_100865244 | 3300006173 | Unclassified | 705 |
| 416 | Ga0070712_100031176 | 3300006175 | Bacteria | 3590 |
| 417 | Ga0070712_100416201 | 3300006175 | Unclassified | 1113 |
| 418 | Ga0097621_100000125 | 3300006237 | Bacteria | 44370 |
| 419 | Ga0097621_100014893 | 3300006237 | Bacteria | 5835 |
| 420 | Ga0097621_100017310 | 3300006237 | Bacteria | 5470 |
| 421 | Ga0097621_100039658 | 3300006237 | Bacteria | 3784 |
| 422 | Ga0097621_100069253 | 3300006237 | Bacteria | 2913 |
| 423 | Ga0097621_100113414 | 3300006237 | Unclassified | 2293 |
| 424 | Ga0097621_100126207 | 3300006237 | Bacteria | 2174 |
| 425 | Ga0097621_100378715 | 3300006237 | Bacteria | 1263 |
| 426 | Ga0097621_100616551 | 3300006237 | Bacteria | 993 |
| 427 | Ga0097621_100643048 | 3300006237 | Unclassified | 973 |
| 428 | Ga0097621_100724582 | 3300006237 | Unclassified | 917 |
| 429 | Ga0097621_101182064 | 3300006237 | Unclassified | 720 |
| 430 | Ga0068871_100000134 | 3300006358 | Bacteria | 47412 |
| 431 | Ga0068871_100005587 | 3300006358 | Bacteria | 8816 |
| 432 | Ga0068871_100039886 | 3300006358 | Unclassified | 3759 |
| 433 | Ga0068871_100063808 | 3300006358 | Bacteria | 3014 |
| 434 | Ga0068871_100069169 | 3300006358 | Bacteria | 2899 |
| 435 | Ga0068871_100077391 | 3300006358 | Bacteria | 2749 |
| 436 | Ga0068871_100146031 | 3300006358 | Unclassified | 2014 |
| 437 | Ga0068871_100149927 | 3300006358 | Bacteria | 1988 |
| 438 | Ga0068871_100193434 | 3300006358 | Bacteria | 1753 |
| 439 | Ga0068871_100291605 | 3300006358 | Bacteria | 1430 |
| 440 | Ga0068871_100497971 | 3300006358 | Bacteria | 1098 |
| 441 | Ga0068871_100649783 | 3300006358 | Bacteria | 963 |
| 442 | Ga0068871_100695008 | 3300006358 | Unclassified | 931 |
| 443 | Ga0075428_100000497 | 3300006844 | Bacteria | 39844 |
| 444 | Ga0075428_100006846 | 3300006844 | Bacteria | 12668 |
| 445 | Ga0075428_100009506 | 3300006844 | Bacteria | 10796 |
| 446 | Ga0075428_100026808 | 3300006844 | Bacteria | 6380 |
| 447 | Ga0075428_100031650 | 3300006844 | Bacteria | 5845 |
| 448 | Ga0075428_100057506 | 3300006844 | Bacteria | 4257 |
| 449 | Ga0075428_100089732 | 3300006844 | Bacteria | 3352 |
| 450 | Ga0075428_100121569 | 3300006844 | Unclassified | 2843 |
| 451 | Ga0075428_100245232 | 3300006844 | Bacteria | 1932 |
| 452 | Ga0075428_100310045 | 3300006844 | Bacteria | 1696 |
| 453 | Ga0075428_100429732 | 3300006844 | Unclassified | 1415 |
| 454 | Ga0075428_100602931 | 3300006844 | Bacteria | 1173 |
| 455 | Ga0075428_101084827 | 3300006844 | Bacteria | 846 |
| 456 | Ga0075428_101635840 | 3300006844 | Bacteria | 673 |
| 457 | Ga0075430_100001681 | 3300006846 | Bacteria | 18091 |
| 458 | Ga0075430_100002096 | 3300006846 | Bacteria | 16500 |
| 459 | Ga0075430_100013822 | 3300006846 | Bacteria | 6877 |
| 460 | Ga0075430_100019140 | 3300006846 | Bacteria | 5823 |
| 461 | Ga0075430_100025839 | 3300006846 | Bacteria | 4997 |
| 462 | Ga0075430_100028057 | 3300006846 | Bacteria | 4782 |
| 463 | Ga0075430_100054894 | 3300006846 | Unclassified | 3351 |
| 464 | Ga0075431_100001219 | 3300006847 | Bacteria | 23281 |
| 465 | Ga0075431_100003323 | 3300006847 | Bacteria | 15578 |
| 466 | Ga0075431_100023672 | 3300006847 | Bacteria | 6287 |
| 467 | Ga0075431_100069493 | 3300006847 | Unclassified | 3633 |
| 468 | Ga0075431_100079466 | 3300006847 | Bacteria | 3385 |
| 469 | Ga0075431_100199916 | 3300006847 | Bacteria | 2045 |
| 470 | Ga0075431_100215703 | 3300006847 | Bacteria | 1959 |
| 471 | Ga0075431_100241070 | 3300006847 | Bacteria | 1839 |
| 472 | Ga0075431_100486414 | 3300006847 | Unclassified | 1226 |
| 473 | Ga0075431_100830336 | 3300006847 | Bacteria | 896 |
| 474 | Ga0075433_10000157 | 3300006852 | Bacteria | 36577 |
| 475 | Ga0075433_10116506 | 3300006852 | Bacteria | 2370 |
| 476 | Ga0075433_10146790 | 3300006852 | Bacteria | 2097 |
| 477 | Ga0075433_10177266 | 3300006852 | Unclassified | 1896 |
| 478 | Ga0075433_10323195 | 3300006852 | Bacteria | 1365 |
| 479 | Ga0075433_10336636 | 3300006852 | Unclassified | 1334 |
| 480 | Ga0075433_10467641 | 3300006852 | Bacteria | 1111 |
| 481 | Ga0075433_10615587 | 3300006852 | Unclassified | 953 |
| 482 | Ga0075433_10789605 | 3300006852 | Bacteria | 830 |
| 483 | Ga0075433_10835721 | 3300006852 | Bacteria | 804 |
| 484 | Ga0075433_11039815 | 3300006852 | Unclassified | 713 |
| 485 | Ga0075433_11078459 | 3300006852 | Bacteria | 699 |
| 486 | Ga0075434_100002504 | 3300006871 | Bacteria | 16204 |
| 487 | Ga0075434_100005743 | 3300006871 | Bacteria | 11328 |
| 488 | Ga0075434_100006773 | 3300006871 | Bacteria | 10532 |
| 489 | Ga0075434_100011771 | 3300006871 | Bacteria | 8264 |
| 490 | Ga0075434_100017244 | 3300006871 | Bacteria | 6954 |
| 491 | Ga0075434_100029295 | 3300006871 | Bacteria | 5414 |
| 492 | Ga0075434_100065080 | 3300006871 | Unclassified | 3631 |
| 493 | Ga0075434_100082673 | 3300006871 | Bacteria | 3209 |
| 494 | Ga0075434_100151742 | 3300006871 | Bacteria | 2337 |
| 495 | Ga0075434_100192229 | 3300006871 | Bacteria | 2061 |
| 496 | Ga0075434_100302147 | 3300006871 | Bacteria | 1621 |
| 497 | Ga0075434_100453363 | 3300006871 | Bacteria | 1304 |
| 498 | Ga0075434_100476073 | 3300006871 | Bacteria | 1270 |
| 499 | Ga0075434_100489240 | 3300006871 | Bacteria | 1251 |
| 500 | Ga0075434_100524690 | 3300006871 | Unclassified | 1205 |
| 501 | Ga0075429_100004479 | 3300006880 | Bacteria | 12017 |
| 502 | Ga0075429_100005139 | 3300006880 | Bacteria | 11253 |
| 503 | Ga0075429_100008026 | 3300006880 | Bacteria | 9173 |
| 504 | Ga0075429_100019963 | 3300006880 | Bacteria | 5812 |
| 505 | Ga0075429_100096081 | 3300006880 | Bacteria | 2584 |
| 506 | Ga0075429_100122343 | 3300006880 | Unclassified | 2275 |
| 507 | Ga0075429_100126374 | 3300006880 | Bacteria | 2236 |
| 508 | Ga0075429_100239199 | 3300006880 | Unclassified | 1590 |
| 509 | Ga0075429_100266863 | 3300006880 | Bacteria | 1499 |
| 510 | Ga0075429_100314822 | 3300006880 | Bacteria | 1370 |
| 511 | Ga0075429_100319622 | 3300006880 | Unclassified | 1359 |
| 512 | Ga0068865_100002757 | 3300006881 | Bacteria | 10443 |
| 513 | Ga0068865_100030248 | 3300006881 | Bacteria | 3601 |
| 514 | Ga0068865_100076131 | 3300006881 | Bacteria | 2394 |
| 515 | Ga0068865_100145708 | 3300006881 | Bacteria | 1791 |
| 516 | Ga0068865_100189475 | 3300006881 | Unclassified | 1589 |
| 517 | Ga0068865_100576003 | 3300006881 | Unclassified | 948 |
| 518 | Ga0068865_100760792 | 3300006881 | Unclassified | 833 |
| 519 | Ga0068865_100834735 | 3300006881 | Bacteria | 797 |
| 520 | Ga0075436_100004813 | 3300006914 | Bacteria | 9275 |
| 521 | Ga0075436_100017704 | 3300006914 | Bacteria | 4877 |
| 522 | Ga0075436_100017749 | 3300006914 | Bacteria | 4872 |
| 523 | Ga0075436_100084710 | 3300006914 | Unclassified | 2200 |
| 524 | Ga0075436_100104286 | 3300006914 | Unclassified | 1976 |
| 525 | Ga0075436_100132881 | 3300006914 | Bacteria | 1746 |
| 526 | Ga0075436_100241247 | 3300006914 | Bacteria | 1285 |
| 527 | Ga0097620_100025246 | 3300006931 | Bacteria | 5963 |
| 528 | Ga0097620_100137972 | 3300006931 | Bacteria | 2512 |
| 529 | Ga0097620_100191442 | 3300006931 | Unclassified | 2130 |
| 530 | Ga0097620_100208383 | 3300006931 | Bacteria | 2041 |
| 531 | Ga0097620_100504446 | 3300006931 | Bacteria | 1305 |
| 532 | Ga0097620_100506803 | 3300006931 | Bacteria | 1302 |
| 533 | Ga0097620_100714267 | 3300006931 | Unclassified | 1092 |
| 534 | Ga0097620_100759135 | 3300006931 | Bacteria | 1059 |
| 535 | Ga0097620_100837173 | 3300006931 | Bacteria | 1006 |
| 536 | Ga0097620_101723800 | 3300006931 | Unclassified | 692 |
| 537 | Ga0075435_100000204 | 3300007076 | Bacteria | 35933 |
| 538 | Ga0075435_100007928 | 3300007076 | Bacteria | 7601 |
| 539 | Ga0075435_100015754 | 3300007076 | Bacteria | 5688 |
| 540 | Ga0075435_100027042 | 3300007076 | Bacteria | 4484 |
| 541 | Ga0075435_100065934 | 3300007076 | Bacteria | 2944 |
| 542 | Ga0075435_100177038 | 3300007076 | Bacteria | 1801 |
| 543 | Ga0075435_100212697 | 3300007076 | Bacteria | 1641 |
| 544 | Ga0075435_100310333 | 3300007076 | Bacteria | 1350 |
| 545 | Ga0075435_100494082 | 3300007076 | Bacteria | 1058 |
| 546 | Ga0075435_100509157 | 3300007076 | Bacteria | 1041 |
| 547 | Ga0105251_10096311 | 3300009011 | Bacteria | 1356 |
| 548 | Ga0105244_10445466 | 3300009036 | Unclassified | 596 |
| 549 | Ga0105240_10037691 | 3300009093 | Bacteria | 6211 |
| 550 | Ga0105240_10170233 | 3300009093 | Bacteria | 2581 |
| 551 | Ga0105240_10311990 | 3300009093 | Unclassified | 1796 |
| 552 | Ga0105240_10450127 | 3300009093 | Unclassified | 1441 |
| 553 | Ga0105240_10794797 | 3300009093 | Bacteria | 1025 |
| 554 | Ga0105240_11465595 | 3300009093 | Unclassified | 716 |
| 555 | Ga0111539_10000014 | 3300009094 | Bacteria | 307501 |
| 556 | Ga0111539_10000134 | 3300009094 | Bacteria | 84765 |
| 557 | Ga0111539_10001078 | 3300009094 | Bacteria | 36028 |
| 558 | Ga0111539_10002632 | 3300009094 | Bacteria | 23770 |
| 559 | Ga0111539_10004027 | 3300009094 | Bacteria | 19292 |
| 560 | Ga0111539_10010143 | 3300009094 | Bacteria | 11870 |
| 561 | Ga0111539_10015933 | 3300009094 | Bacteria | 9339 |
| 562 | Ga0111539_10018505 | 3300009094 | Bacteria | 8629 |
| 563 | Ga0111539_10066788 | 3300009094 | Bacteria | 4248 |
| 564 | Ga0111539_10097678 | 3300009094 | Bacteria | 3450 |
| 565 | Ga0111539_10187478 | 3300009094 | Bacteria | 2415 |
| 566 | Ga0111539_10291782 | 3300009094 | Unclassified | 1898 |
| 567 | Ga0111539_10321189 | 3300009094 | Bacteria | 1802 |
| 568 | Ga0111539_10426199 | 3300009094 | Bacteria | 1545 |
| 569 | Ga0111539_10510089 | 3300009094 | Bacteria | 1401 |
| 570 | Ga0111539_10661077 | 3300009094 | Bacteria | 1217 |
| 571 | Ga0111539_10806024 | 3300009094 | Bacteria | 1093 |
| 572 | Ga0111539_11242735 | 3300009094 | Unclassified | 865 |
| 573 | Ga0111539_11566589 | 3300009094 | Unclassified | 764 |
| 574 | Ga0105245_10018654 | 3300009098 | Bacteria | 6068 |
| 575 | Ga0105245_10046562 | 3300009098 | Bacteria | 3876 |
| 576 | Ga0105245_10266120 | 3300009098 | Bacteria | 1670 |
| 577 | Ga0105245_10518549 | 3300009098 | Bacteria | 1210 |
| 578 | Ga0105245_10832324 | 3300009098 | Unclassified | 962 |
| 579 | Ga0105245_11922539 | 3300009098 | Unclassified | 645 |
| 580 | Ga0105247_10058133 | 3300009101 | Bacteria | 2392 |
| 581 | Ga0105247_10159725 | 3300009101 | Bacteria | 1491 |
| 582 | Ga0105247_10271953 | 3300009101 | Bacteria | 1166 |
| 583 | Ga0114129_10000426 | 3300009147 | Bacteria | 50026 |
| 584 | Ga0114129_10001213 | 3300009147 | Bacteria | 34237 |
| 585 | Ga0114129_10004137 | 3300009147 | Bacteria | 20495 |
| 586 | Ga0114129_10009181 | 3300009147 | Bacteria | 14099 |
| 587 | Ga0114129_10009385 | 3300009147 | Bacteria | 13946 |
| 588 | Ga0114129_10011201 | 3300009147 | Bacteria | 12784 |
| 589 | Ga0114129_10016744 | 3300009147 | Bacteria | 10441 |
| 590 | Ga0114129_10016919 | 3300009147 | Bacteria | 10383 |
| 591 | Ga0114129_10029055 | 3300009147 | Bacteria | 7831 |
| 592 | Ga0114129_10048963 | 3300009147 | Bacteria | 5939 |
| 593 | Ga0114129_10051960 | 3300009147 | Bacteria | 5753 |
| 594 | Ga0114129_10057730 | 3300009147 | Bacteria | 5430 |
| 595 | Ga0114129_10064329 | 3300009147 | Bacteria | 5118 |
| 596 | Ga0114129_10067793 | 3300009147 | Bacteria | 4975 |
| 597 | Ga0114129_10072643 | 3300009147 | Bacteria | 4795 |
| 598 | Ga0114129_10073868 | 3300009147 | Bacteria | 4750 |
| 599 | Ga0114129_10095042 | 3300009147 | Unclassified | 4128 |
| 600 | Ga0114129_10109022 | 3300009147 | Bacteria | 3822 |
| 601 | Ga0114129_10143188 | 3300009147 | Bacteria | 3276 |
| 602 | Ga0114129_10295970 | 3300009147 | Bacteria | 2159 |
| 603 | Ga0114129_10566980 | 3300009147 | Bacteria | 1475 |
| 604 | Ga0114129_11160523 | 3300009147 | Bacteria | 964 |
| 605 | Ga0114129_11692215 | 3300009147 | Unclassified | 772 |
| 606 | Ga0114129_12487459 | 3300009147 | Unclassified | 619 |
| 607 | Ga0114129_12703291 | 3300009147 | Unclassified | 591 |
| 608 | Ga0105243_10006934 | 3300009148 | Bacteria | 8724 |
| 609 | Ga0105243_10010791 | 3300009148 | Bacteria | 6914 |
| 610 | Ga0105243_10089689 | 3300009148 | Bacteria | 2529 |
| 611 | Ga0105243_10175709 | 3300009148 | Bacteria | 1858 |
| 612 | Ga0105243_10506248 | 3300009148 | Bacteria | 1145 |
| 613 | Ga0105243_10771100 | 3300009148 | Unclassified | 945 |
| 614 | Ga0105243_10923197 | 3300009148 | Unclassified | 870 |
| 615 | Ga0105243_11471236 | 3300009148 | Bacteria | 704 |
| 616 | Ga0105243_11608999 | 3300009148 | Unclassified | 676 |
| 617 | Ga0105241_10026107 | 3300009174 | Bacteria | 4345 |
| 618 | Ga0105241_10568860 | 3300009174 | Bacteria | 1020 |
| 619 | Ga0105241_11039566 | 3300009174 | Bacteria | 768 |
| 620 | Ga0105241_11892246 | 3300009174 | Unclassified | 584 |
| 621 | Ga0105242_10022412 | 3300009176 | Bacteria | 4966 |
| 622 | Ga0105242_10026817 | 3300009176 | Unclassified | 4569 |
| 623 | Ga0105242_10268432 | 3300009176 | Unclassified | 1544 |
| 624 | Ga0105242_10328003 | 3300009176 | Bacteria | 1406 |
| 625 | Ga0105242_10366387 | 3300009176 | Bacteria | 1335 |
| 626 | Ga0105242_10665893 | 3300009176 | Bacteria | 1014 |
| 627 | Ga0105242_11024614 | 3300009176 | Bacteria | 835 |
| 628 | Ga0105248_10002172 | 3300009177 | Bacteria | 21714 |
| 629 | Ga0105248_10007536 | 3300009177 | Bacteria | 11949 |
| 630 | Ga0105248_10043045 | 3300009177 | Bacteria | 5064 |
| 631 | Ga0105248_10052710 | 3300009177 | Bacteria | 4565 |
| 632 | Ga0105248_10059992 | 3300009177 | Bacteria | 4272 |
| 633 | Ga0105248_10068556 | 3300009177 | Bacteria | 3982 |
| 634 | Ga0105248_10107031 | 3300009177 | Bacteria | 3153 |
| 635 | Ga0105248_10162200 | 3300009177 | Unclassified | 2521 |
| 636 | Ga0105248_10200910 | 3300009177 | Unclassified | 2246 |
| 637 | Ga0105248_10231761 | 3300009177 | Unclassified | 2079 |
| 638 | Ga0105248_10320423 | 3300009177 | Unclassified | 1746 |
| 639 | Ga0105248_10411347 | 3300009177 | Unclassified | 1523 |
| 640 | Ga0105248_10495834 | 3300009177 | Unclassified | 1377 |
| 641 | Ga0105248_11356672 | 3300009177 | Bacteria | 804 |
| 642 | Ga0105248_12175856 | 3300009177 | Unclassified | 631 |
| 643 | Ga0105237_10709398 | 3300009545 | Bacteria | 1012 |
| 644 | Ga0105237_11273509 | 3300009545 | Bacteria | 742 |
| 645 | Ga0105238_10036372 | 3300009551 | Bacteria | 5005 |
| 646 | Ga0105238_10251909 | 3300009551 | Unclassified | 1744 |
| 647 | Ga0105238_11837913 | 3300009551 | Bacteria | 638 |
| 648 | Ga0105249_10025255 | 3300009553 | Bacteria | 5347 |
| 649 | Ga0105249_10081617 | 3300009553 | Bacteria | 3006 |
| 650 | Ga0105249_10272878 | 3300009553 | Unclassified | 1685 |
| 651 | Ga0105249_10293297 | 3300009553 | Unclassified | 1629 |
| 652 | Ga0105249_10350611 | 3300009553 | Unclassified | 1495 |
| 653 | Ga0105249_10455199 | 3300009553 | Unclassified | 1319 |
| 654 | Ga0105249_10867528 | 3300009553 | Unclassified | 969 |
| 655 | Ga0105249_11977180 | 3300009553 | Unclassified | 656 |
| 656 | Ga0105249_12262412 | 3300009553 | Unclassified | 616 |
| 657 | Ga0105239_10699477 | 3300010375 | Bacteria | 1159 |
| 658 | Ga0105239_10713110 | 3300010375 | Bacteria | 1147 |
| 659 | Ga0105239_10815702 | 3300010375 | Unclassified | 1069 |
| 660 | Ga0105246_10105238 | 3300011119 | Unclassified | 2062 |
| 661 | Ga0105246_10467635 | 3300011119 | Bacteria | 1064 |
| 662 | Ga0105246_10868449 | 3300011119 | Unclassified | 806 |
| 663 | Ga0157373_11108636 | 3300013100 | Unclassified | 594 |
| 664 | Ga0157370_10733794 | 3300013104 | Unclassified | 900 |
| 665 | Ga0157374_10083773 | 3300013296 | Bacteria | 3030 |
| 666 | Ga0157374_10104979 | 3300013296 | Unclassified | 2713 |
| 667 | Ga0157374_10443606 | 3300013296 | Bacteria | 1299 |
| 668 | Ga0157374_11656934 | 3300013296 | Unclassified | 664 |
| 669 | Ga0157378_10009109 | 3300013297 | Bacteria | 8639 |
| 670 | Ga0157378_10144928 | 3300013297 | Bacteria | 2208 |
| 671 | Ga0157378_10561950 | 3300013297 | Bacteria | 1148 |
| 672 | Ga0163162_10186185 | 3300013306 | Unclassified | 2203 |
| 673 | Ga0163162_10549926 | 3300013306 | Bacteria | 1283 |
| 674 | Ga0163162_10559856 | 3300013306 | Bacteria | 1271 |
| 675 | Ga0163162_10609618 | 3300013306 | Bacteria | 1217 |
| 676 | Ga0163162_10947929 | 3300013306 | Unclassified | 972 |
| 677 | Ga0163162_11769678 | 3300013306 | Bacteria | 706 |
| 678 | Ga0157372_10454180 | 3300013307 | Bacteria | 1493 |
| 679 | Ga0157375_10055322 | 3300013308 | Bacteria | 3912 |
| 680 | Ga0157375_10265853 | 3300013308 | Unclassified | 1877 |
| 681 | Ga0157375_10340654 | 3300013308 | Unclassified | 1665 |
| 682 | Ga0157375_10374552 | 3300013308 | Unclassified | 1590 |
| 683 | Ga0157375_10587096 | 3300013308 | Unclassified | 1274 |
| 684 | Ga0157375_10658352 | 3300013308 | Unclassified | 1203 |
| 685 | Ga0157375_11224686 | 3300013308 | Bacteria | 881 |
| 686 | Ga0163163_10006091 | 3300014325 | Bacteria | 10498 |
| 687 | Ga0163163_10024951 | 3300014325 | Bacteria | 5693 |
| 688 | Ga0163163_10033095 | 3300014325 | Bacteria | 4999 |
| 689 | Ga0163163_10044334 | 3300014325 | Bacteria | 4363 |
| 690 | Ga0163163_10049145 | 3300014325 | Bacteria | 4150 |
| 691 | Ga0163163_10457893 | 3300014325 | Unclassified | 1336 |
| 692 | Ga0163163_10662976 | 3300014325 | Unclassified | 1107 |
| 693 | Ga0163163_11872649 | 3300014325 | Bacteria | 660 |
| 694 | Ga0163163_12172974 | 3300014325 | Unclassified | 614 |
| 695 | Ga0157380_10002946 | 3300014326 | Bacteria | 11577 |
| 696 | Ga0157380_10008813 | 3300014326 | Bacteria | 7207 |
| 697 | Ga0157380_10018744 | 3300014326 | Bacteria | 5145 |
| 698 | Ga0157380_10048867 | 3300014326 | Unclassified | 3334 |
| 699 | Ga0157380_10078622 | 3300014326 | Unclassified | 2692 |
| 700 | Ga0157380_10088271 | 3300014326 | Bacteria | 2551 |
| 701 | Ga0157380_10279419 | 3300014326 | Bacteria | 1527 |
| 702 | Ga0157380_10417166 | 3300014326 | Unclassified | 1279 |
| 703 | Ga0157380_10691176 | 3300014326 | Unclassified | 1024 |
| 704 | Ga0157380_11418633 | 3300014326 | Unclassified | 745 |
| 705 | Ga0157380_11524746 | 3300014326 | Bacteria | 722 |
| 706 | Ga0157380_11547105 | 3300014326 | Unclassified | 717 |
| 707 | Ga0157380_11772989 | 3300014326 | Unclassified | 676 |
| 708 | Ga0182008_10291273 | 3300014497 | Bacteria | 852 |
| 709 | Ga0157377_10066174 | 3300014745 | Unclassified | 2077 |
| 710 | Ga0157377_10095762 | 3300014745 | Bacteria | 1760 |
| 711 | Ga0157377_10155723 | 3300014745 | Unclassified | 1417 |
| 712 | Ga0157377_10275103 | 3300014745 | Bacteria | 1101 |
| 713 | Ga0157377_10331777 | 3300014745 | Unclassified | 1014 |
| 714 | Ga0157377_10550822 | 3300014745 | Unclassified | 815 |
| 715 | Ga0157379_10007040 | 3300014968 | Bacteria | 9721 |
| 716 | Ga0157379_10007133 | 3300014968 | Bacteria | 9664 |
| 717 | Ga0157379_10030765 | 3300014968 | Bacteria | 4780 |
| 718 | Ga0157379_10037871 | 3300014968 | Bacteria | 4302 |
| 719 | Ga0157379_10222767 | 3300014968 | Bacteria | 1709 |
| 720 | Ga0157379_10304951 | 3300014968 | Bacteria | 1452 |
| 721 | Ga0157379_10328355 | 3300014968 | Bacteria | 1397 |
| 722 | Ga0157379_10640056 | 3300014968 | Bacteria | 995 |
| 723 | Ga0157376_10024569 | 3300014969 | Unclassified | 4734 |
| 724 | Ga0157376_10024693 | 3300014969 | Bacteria | 4724 |
| 725 | Ga0157376_10086620 | 3300014969 | Unclassified | 2701 |
| 726 | Ga0157376_10189607 | 3300014969 | Bacteria | 1885 |
| 727 | Ga0157376_10366170 | 3300014969 | Unclassified | 1384 |
| 728 | Ga0157376_10823342 | 3300014969 | Bacteria | 942 |
| 729 | Ga0157376_11082052 | 3300014969 | Unclassified | 827 |
| 730 | Ga0163161_10279799 | 3300017792 | Bacteria | 1308 |
| 731 | Ga0163161_10379530 | 3300017792 | Bacteria | 1129 |
| 732 | Ga0163161_10965245 | 3300017792 | Unclassified | 726 |
| 733 | Ga0213876_10074971 | 3300021384 | Bacteria | 1787 |
| 734 | Ga0207697_10024138 | 3300025315 | Unclassified | 2490 |
| 735 | Ga0207697_10072296 | 3300025315 | Bacteria | 1446 |
| 736 | Ga0207697_10274146 | 3300025315 | Bacteria | 747 |
| 737 | Ga0207697_10357179 | 3300025315 | Unclassified | 649 |
| 738 | Ga0207656_10097732 | 3300025321 | Unclassified | 1342 |
| 739 | Ga0207653_10093372 | 3300025885 | Unclassified | 1056 |
| 740 | Ga0207682_10004207 | 3300025893 | Bacteria | 6079 |
| 741 | Ga0207682_10045366 | 3300025893 | Unclassified | 1803 |
| 742 | Ga0207682_10048222 | 3300025893 | Bacteria | 1756 |
| 743 | Ga0207682_10052586 | 3300025893 | Unclassified | 1688 |
| 744 | Ga0207682_10064298 | 3300025893 | Bacteria | 1542 |
| 745 | Ga0207682_10089494 | 3300025893 | Unclassified | 1332 |
| 746 | Ga0207682_10093133 | 3300025893 | Unclassified | 1309 |
| 747 | Ga0207682_10327128 | 3300025893 | Unclassified | 720 |
| 748 | Ga0207692_10397454 | 3300025898 | Bacteria | 859 |
| 749 | Ga0207642_10036643 | 3300025899 | Bacteria | 2107 |
| 750 | Ga0207642_10101553 | 3300025899 | Unclassified | 1445 |
| 751 | Ga0207710_10082088 | 3300025900 | Bacteria | 1497 |
| 752 | Ga0207688_10348566 | 3300025901 | Unclassified | 912 |
| 753 | Ga0207680_10023105 | 3300025903 | Bacteria | 3391 |
| 754 | Ga0207680_10049583 | 3300025903 | Unclassified | 2500 |
| 755 | Ga0207680_10132754 | 3300025903 | Bacteria | 1643 |
| 756 | Ga0207680_10318152 | 3300025903 | Unclassified | 1088 |
| 757 | Ga0207680_10792231 | 3300025903 | Unclassified | 679 |
| 758 | Ga0207685_10174223 | 3300025905 | Bacteria | 992 |
| 759 | Ga0207699_10026366 | 3300025906 | Bacteria | 3203 |
| 760 | Ga0207699_10257100 | 3300025906 | Bacteria | 1206 |
| 761 | Ga0207645_10001406 | 3300025907 | Bacteria | 19717 |
| 762 | Ga0207645_10002286 | 3300025907 | Bacteria | 15200 |
| 763 | Ga0207645_10065309 | 3300025907 | Bacteria | 2325 |
| 764 | Ga0207645_10142585 | 3300025907 | Unclassified | 1561 |
| 765 | Ga0207645_10148909 | 3300025907 | Unclassified | 1527 |
| 766 | Ga0207643_10003202 | 3300025908 | Bacteria | 8817 |
| 767 | Ga0207643_10042613 | 3300025908 | Bacteria | 2559 |
| 768 | Ga0207643_10057393 | 3300025908 | Bacteria | 2216 |
| 769 | Ga0207643_10077467 | 3300025908 | Bacteria | 1922 |
| 770 | Ga0207643_10549995 | 3300025908 | Unclassified | 741 |
| 771 | Ga0207684_10180841 | 3300025910 | Unclassified | 1818 |
| 772 | Ga0207684_10189929 | 3300025910 | Bacteria | 1772 |
| 773 | Ga0207684_10228661 | 3300025910 | Bacteria | 1605 |
| 774 | Ga0207654_10301123 | 3300025911 | Unclassified | 1090 |
| 775 | Ga0207707_10331947 | 3300025912 | Bacteria | 1312 |
| 776 | Ga0207695_10151584 | 3300025913 | Unclassified | 2257 |
| 777 | Ga0207695_10360308 | 3300025913 | Unclassified | 1341 |
| 778 | Ga0207695_10428856 | 3300025913 | Bacteria | 1206 |
| 779 | Ga0207695_10757082 | 3300025913 | Bacteria | 851 |
| 780 | Ga0207671_10227660 | 3300025914 | Bacteria | 1462 |
| 781 | Ga0207671_11049257 | 3300025914 | Bacteria | 641 |
| 782 | Ga0207693_10139612 | 3300025915 | Bacteria | 1906 |
| 783 | Ga0207693_10488325 | 3300025915 | Unclassified | 962 |
| 784 | Ga0207693_10738222 | 3300025915 | Unclassified | 761 |
| 785 | Ga0207663_10226206 | 3300025916 | Unclassified | 1364 |
| 786 | Ga0207660_10085009 | 3300025917 | Unclassified | 2333 |
| 787 | Ga0207660_10096368 | 3300025917 | Bacteria | 2202 |
| 788 | Ga0207660_10165751 | 3300025917 | Unclassified | 1707 |
| 789 | Ga0207660_10247169 | 3300025917 | Bacteria | 1407 |
| 790 | Ga0207662_10007637 | 3300025918 | Bacteria | 5894 |
| 791 | Ga0207662_10015889 | 3300025918 | Bacteria | 4241 |
| 792 | Ga0207662_10099277 | 3300025918 | Bacteria | 1802 |
| 793 | Ga0207662_10131006 | 3300025918 | Unclassified | 1581 |
| 794 | Ga0207657_10006096 | 3300025919 | Bacteria | 12536 |
| 795 | Ga0207657_10144559 | 3300025919 | Bacteria | 1941 |
| 796 | Ga0207649_10073295 | 3300025920 | Unclassified | 2193 |
| 797 | Ga0207649_10075530 | 3300025920 | Unclassified | 2166 |
| 798 | Ga0207649_10727068 | 3300025920 | Bacteria | 771 |
| 799 | Ga0207649_10857902 | 3300025920 | Unclassified | 711 |
| 800 | Ga0207652_10052515 | 3300025921 | Bacteria | 3499 |
| 801 | Ga0207652_10360643 | 3300025921 | Unclassified | 1312 |
| 802 | Ga0207652_10399292 | 3300025921 | Bacteria | 1240 |
| 803 | Ga0207652_10697637 | 3300025921 | Unclassified | 906 |
| 804 | Ga0207652_10727255 | 3300025921 | Bacteria | 884 |
| 805 | Ga0207646_10067972 | 3300025922 | Bacteria | 3182 |
| 806 | Ga0207646_10146933 | 3300025922 | Unclassified | 2124 |
| 807 | Ga0207646_10167580 | 3300025922 | Bacteria | 1983 |
| 808 | Ga0207646_10658221 | 3300025922 | Unclassified | 938 |
| 809 | Ga0207646_10771753 | 3300025922 | Unclassified | 857 |
| 810 | Ga0207646_10980208 | 3300025922 | Bacteria | 747 |
| 811 | Ga0207681_10009178 | 3300025923 | Bacteria | 6042 |
| 812 | Ga0207681_10022038 | 3300025923 | Bacteria | 4059 |
| 813 | Ga0207681_10025121 | 3300025923 | Bacteria | 3829 |
| 814 | Ga0207681_10036364 | 3300025923 | Bacteria | 3248 |
| 815 | Ga0207681_10051798 | 3300025923 | Unclassified | 2782 |
| 816 | Ga0207681_10146109 | 3300025923 | Bacteria | 1767 |
| 817 | Ga0207681_10438186 | 3300025923 | Bacteria | 1061 |
| 818 | Ga0207694_10142401 | 3300025924 | Unclassified | 1929 |
| 819 | Ga0207650_10002374 | 3300025925 | Bacteria | 13100 |
| 820 | Ga0207650_10084901 | 3300025925 | Bacteria | 2407 |
| 821 | Ga0207650_10121252 | 3300025925 | Unclassified | 2036 |
| 822 | Ga0207650_10295594 | 3300025925 | Unclassified | 1322 |
| 823 | Ga0207650_10549731 | 3300025925 | Unclassified | 968 |
| 824 | Ga0207650_10801154 | 3300025925 | Unclassified | 798 |
| 825 | Ga0207659_10000079 | 3300025926 | Bacteria | 60790 |
| 826 | Ga0207659_10001272 | 3300025926 | Bacteria | 15110 |
| 827 | Ga0207659_10001629 | 3300025926 | Bacteria | 13323 |
| 828 | Ga0207659_10012585 | 3300025926 | Bacteria | 5389 |
| 829 | Ga0207659_10029655 | 3300025926 | Bacteria | 3731 |
| 830 | Ga0207659_10058294 | 3300025926 | Bacteria | 2772 |
| 831 | Ga0207659_10097120 | 3300025926 | Bacteria | 2212 |
| 832 | Ga0207659_10136365 | 3300025926 | Bacteria | 1900 |
| 833 | Ga0207659_10163907 | 3300025926 | Bacteria | 1748 |
| 834 | Ga0207659_10193963 | 3300025926 | Bacteria | 1618 |
| 835 | Ga0207659_10235224 | 3300025926 | Bacteria | 1479 |
| 836 | Ga0207659_10581384 | 3300025926 | Bacteria | 954 |
| 837 | Ga0207687_10124628 | 3300025927 | Bacteria | 1932 |
| 838 | Ga0207687_10136073 | 3300025927 | Viruses | 1858 |
| 839 | Ga0207687_10263500 | 3300025927 | Bacteria | 1375 |
| 840 | Ga0207687_11381762 | 3300025927 | Unclassified | 605 |
| 841 | Ga0207700_10005583 | 3300025928 | Bacteria | 7549 |
| 842 | Ga0207700_10006132 | 3300025928 | Bacteria | 7239 |
| 843 | Ga0207700_10279505 | 3300025928 | Bacteria | 1436 |
| 844 | Ga0207700_10438202 | 3300025928 | Bacteria | 1150 |
| 845 | Ga0207700_11121973 | 3300025928 | Bacteria | 703 |
| 846 | Ga0207664_10139643 | 3300025929 | Bacteria | 2048 |
| 847 | Ga0207644_10098430 | 3300025931 | Bacteria | 2192 |
| 848 | Ga0207644_10103306 | 3300025931 | Bacteria | 2144 |
| 849 | Ga0207644_10464392 | 3300025931 | Bacteria | 1041 |
| 850 | Ga0207644_11140984 | 3300025931 | Unclassified | 655 |
| 851 | Ga0207690_10116446 | 3300025932 | Bacteria | 1933 |
| 852 | Ga0207690_10159647 | 3300025932 | Bacteria | 1680 |
| 853 | Ga0207706_10006050 | 3300025933 | Bacteria | 11253 |
| 854 | Ga0207706_10101857 | 3300025933 | Unclassified | 2527 |
| 855 | Ga0207706_10129500 | 3300025933 | Unclassified | 2219 |
| 856 | Ga0207706_10134783 | 3300025933 | Bacteria | 2172 |
| 857 | Ga0207706_10164552 | 3300025933 | Bacteria | 1949 |
| 858 | Ga0207706_10167166 | 3300025933 | Bacteria | 1933 |
| 859 | Ga0207706_10388096 | 3300025933 | Unclassified | 1211 |
| 860 | Ga0207706_10418896 | 3300025933 | Unclassified | 1160 |
| 861 | Ga0207706_10902198 | 3300025933 | Unclassified | 746 |
| 862 | Ga0207686_10012850 | 3300025934 | Bacteria | 4615 |
| 863 | Ga0207686_10020581 | 3300025934 | Bacteria | 3771 |
| 864 | Ga0207686_10049693 | 3300025934 | Bacteria | 2604 |
| 865 | Ga0207686_10238381 | 3300025934 | Bacteria | 1322 |
| 866 | Ga0207686_10242409 | 3300025934 | Bacteria | 1313 |
| 867 | Ga0207686_10647968 | 3300025934 | Bacteria | 835 |
| 868 | Ga0207686_11249943 | 3300025934 | Bacteria | 609 |
| 869 | Ga0207709_10004795 | 3300025935 | Bacteria | 7750 |
| 870 | Ga0207709_10006292 | 3300025935 | Bacteria | 6666 |
| 871 | Ga0207709_10194962 | 3300025935 | Unclassified | 1442 |
| 872 | Ga0207709_10307838 | 3300025935 | Bacteria | 1181 |
| 873 | Ga0207670_10002109 | 3300025936 | Bacteria | 10392 |
| 874 | Ga0207670_10093752 | 3300025936 | Unclassified | 2128 |
| 875 | Ga0207670_10163474 | 3300025936 | Bacteria | 1664 |
| 876 | Ga0207670_10250581 | 3300025936 | Bacteria | 1368 |
| 877 | Ga0207670_10341404 | 3300025936 | Bacteria | 1184 |
| 878 | Ga0207670_10496198 | 3300025936 | Bacteria | 991 |
| 879 | Ga0207670_10639302 | 3300025936 | Bacteria | 876 |
| 880 | Ga0207670_10803123 | 3300025936 | Unclassified | 784 |
| 881 | Ga0207669_10029033 | 3300025937 | Bacteria | 3052 |
| 882 | Ga0207669_10322202 | 3300025937 | Bacteria | 1183 |
| 883 | Ga0207669_10380953 | 3300025937 | Unclassified | 1099 |
| 884 | Ga0207669_10612134 | 3300025937 | Bacteria | 886 |
| 885 | Ga0207669_10702761 | 3300025937 | Bacteria | 831 |
| 886 | Ga0207669_10807414 | 3300025937 | Unclassified | 778 |
| 887 | Ga0207669_10889369 | 3300025937 | Unclassified | 743 |
| 888 | Ga0207669_11210408 | 3300025937 | Unclassified | 640 |
| 889 | Ga0207704_10001806 | 3300025938 | Bacteria | 9595 |
| 890 | Ga0207704_10022964 | 3300025938 | Bacteria | 3353 |
| 891 | Ga0207704_10095293 | 3300025938 | Bacteria | 1967 |
| 892 | Ga0207704_10101794 | 3300025938 | Bacteria | 1917 |
| 893 | Ga0207704_10141205 | 3300025938 | Unclassified | 1685 |
| 894 | Ga0207704_10668633 | 3300025938 | Bacteria | 857 |
| 895 | Ga0207665_10090888 | 3300025939 | Unclassified | 2116 |
| 896 | Ga0207665_10553627 | 3300025939 | Bacteria | 894 |
| 897 | Ga0207665_10852006 | 3300025939 | Unclassified | 722 |
| 898 | Ga0207691_10018862 | 3300025940 | Bacteria | 6533 |
| 899 | Ga0207691_10045113 | 3300025940 | Bacteria | 4054 |
| 900 | Ga0207691_10070189 | 3300025940 | Bacteria | 3164 |
| 901 | Ga0207691_10122904 | 3300025940 | Bacteria | 2298 |
| 902 | Ga0207691_10176973 | 3300025940 | Bacteria | 1866 |
| 903 | Ga0207691_10353247 | 3300025940 | Bacteria | 1257 |
| 904 | Ga0207691_10428238 | 3300025940 | Unclassified | 1127 |
| 905 | Ga0207691_10538456 | 3300025940 | Bacteria | 990 |
| 906 | Ga0207691_10642074 | 3300025940 | Unclassified | 897 |
| 907 | Ga0207691_10649339 | 3300025940 | Unclassified | 891 |
| 908 | Ga0207711_10006268 | 3300025941 | Bacteria | 10036 |
| 909 | Ga0207711_10027728 | 3300025941 | Bacteria | 4759 |
| 910 | Ga0207711_10036902 | 3300025941 | Bacteria | 4148 |
| 911 | Ga0207711_10057589 | 3300025941 | Bacteria | 3341 |
| 912 | Ga0207711_10082424 | 3300025941 | Bacteria | 2811 |
| 913 | Ga0207711_10141424 | 3300025941 | Bacteria | 2166 |
| 914 | Ga0207711_10379055 | 3300025941 | Bacteria | 1312 |
| 915 | Ga0207711_10584376 | 3300025941 | Unclassified | 1042 |
| 916 | Ga0207711_10589809 | 3300025941 | Bacteria | 1037 |
| 917 | Ga0207711_10821846 | 3300025941 | Unclassified | 865 |
| 918 | Ga0207711_10920258 | 3300025941 | Bacteria | 813 |
| 919 | Ga0207711_11097910 | 3300025941 | Unclassified | 736 |
| 920 | Ga0207689_10000032 | 3300025942 | Bacteria | 96794 |
| 921 | Ga0207689_10045085 | 3300025942 | Bacteria | 3647 |
| 922 | Ga0207689_10081837 | 3300025942 | Bacteria | 2654 |
| 923 | Ga0207689_10125401 | 3300025942 | Bacteria | 2112 |
| 924 | Ga0207689_10228789 | 3300025942 | Bacteria | 1537 |
| 925 | Ga0207689_10240049 | 3300025942 | Bacteria | 1498 |
| 926 | Ga0207689_10323548 | 3300025942 | Unclassified | 1280 |
| 927 | Ga0207661_10098786 | 3300025944 | Viruses | 2447 |
| 928 | Ga0207661_10106732 | 3300025944 | Unclassified | 2361 |
| 929 | Ga0207661_10334552 | 3300025944 | Bacteria | 1364 |
| 930 | Ga0207661_10342356 | 3300025944 | Bacteria | 1348 |
| 931 | Ga0207661_10396865 | 3300025944 | Bacteria | 1250 |
| 932 | Ga0207661_10795048 | 3300025944 | Bacteria | 871 |
| 933 | Ga0207679_10073204 | 3300025945 | Bacteria | 2591 |
| 934 | Ga0207679_10686495 | 3300025945 | Bacteria | 928 |
| 935 | Ga0207679_10744666 | 3300025945 | Unclassified | 891 |
| 936 | Ga0207679_10801763 | 3300025945 | Unclassified | 858 |
| 937 | Ga0207679_11371468 | 3300025945 | Bacteria | 649 |
| 938 | Ga0207667_10104283 | 3300025949 | Bacteria | 2925 |
| 939 | Ga0207667_10451829 | 3300025949 | Bacteria | 1306 |
| 940 | Ga0207667_10866185 | 3300025949 | Unclassified | 897 |
| 941 | Ga0207667_11025418 | 3300025949 | Bacteria | 811 |
| 942 | Ga0207651_10010999 | 3300025960 | Bacteria | 5043 |
| 943 | Ga0207651_10048187 | 3300025960 | Unclassified | 2878 |
| 944 | Ga0207651_10110003 | 3300025960 | Bacteria | 2066 |
| 945 | Ga0207651_10185688 | 3300025960 | Bacteria | 1654 |
| 946 | Ga0207651_10342397 | 3300025960 | Unclassified | 1256 |
| 947 | Ga0207651_10524791 | 3300025960 | Bacteria | 1027 |
| 948 | Ga0207712_10073047 | 3300025961 | Unclassified | 2472 |
| 949 | Ga0207712_10260004 | 3300025961 | Bacteria | 1407 |
| 950 | Ga0207712_11240747 | 3300025961 | Unclassified | 666 |
| 951 | Ga0207712_11279341 | 3300025961 | Unclassified | 655 |
| 952 | Ga0207668_10085374 | 3300025972 | Bacteria | 2303 |
| 953 | Ga0207668_10730246 | 3300025972 | Bacteria | 872 |
| 954 | Ga0207668_11564651 | 3300025972 | Unclassified | 595 |
| 955 | Ga0207640_10873542 | 3300025981 | Unclassified | 784 |
| 956 | Ga0207640_10910496 | 3300025981 | Unclassified | 769 |
| 957 | Ga0207640_11062493 | 3300025981 | Unclassified | 715 |
| 958 | Ga0207677_10065710 | 3300026023 | Unclassified | 2532 |
| 959 | Ga0207677_10201274 | 3300026023 | Unclassified | 1583 |
| 960 | Ga0207677_10270975 | 3300026023 | Bacteria | 1389 |
| 961 | Ga0207677_10331780 | 3300026023 | Bacteria | 1268 |
| 962 | Ga0207677_10557228 | 3300026023 | Unclassified | 1000 |
| 963 | Ga0207703_10008882 | 3300026035 | Bacteria | 7918 |
| 964 | Ga0207703_10018977 | 3300026035 | Bacteria | 5372 |
| 965 | Ga0207703_10045404 | 3300026035 | Bacteria | 3534 |
| 966 | Ga0207703_10049674 | 3300026035 | Bacteria | 3392 |
| 967 | Ga0207703_10065358 | 3300026035 | Bacteria | 2989 |
| 968 | Ga0207703_10167253 | 3300026035 | Unclassified | 1931 |
| 969 | Ga0207703_10227604 | 3300026035 | Bacteria | 1670 |
| 970 | Ga0207703_10838593 | 3300026035 | Bacteria | 879 |
| 971 | Ga0207703_10888294 | 3300026035 | Unclassified | 853 |
| 972 | Ga0207703_11245904 | 3300026035 | Unclassified | 715 |
| 973 | Ga0207639_10200242 | 3300026041 | Bacteria | 1712 |
| 974 | Ga0207678_10054360 | 3300026067 | Bacteria | 3448 |
| 975 | Ga0207678_10292250 | 3300026067 | Bacteria | 1400 |
| 976 | Ga0207708_10004043 | 3300026075 | Bacteria | 10785 |
| 977 | Ga0207708_10004337 | 3300026075 | Bacteria | 10446 |
| 978 | Ga0207708_10102480 | 3300026075 | Unclassified | 2216 |
| 979 | Ga0207708_10115449 | 3300026075 | Unclassified | 2088 |
| 980 | Ga0207708_10132107 | 3300026075 | Bacteria | 1953 |
| 981 | Ga0207708_10227810 | 3300026075 | Bacteria | 1495 |
| 982 | Ga0207708_10231410 | 3300026075 | Bacteria | 1484 |
| 983 | Ga0207708_10289983 | 3300026075 | Bacteria | 1328 |
| 984 | Ga0207708_10419909 | 3300026075 | Bacteria | 1109 |
| 985 | Ga0207702_10314643 | 3300026078 | Unclassified | 1489 |
| 986 | Ga0207641_10000955 | 3300026088 | Bacteria | 29716 |
| 987 | Ga0207641_10106423 | 3300026088 | Bacteria | 2479 |
| 988 | Ga0207641_10329613 | 3300026088 | Bacteria | 1450 |
| 989 | Ga0207641_10341335 | 3300026088 | Unclassified | 1425 |
| 990 | Ga0207641_10790080 | 3300026088 | Bacteria | 938 |
| 991 | Ga0207641_11598577 | 3300026088 | Unclassified | 654 |
| 992 | Ga0207648_10001379 | 3300026089 | Bacteria | 26764 |
| 993 | Ga0207648_10002536 | 3300026089 | Bacteria | 19594 |
| 994 | Ga0207648_10053012 | 3300026089 | Bacteria | 3546 |
| 995 | Ga0207648_10092785 | 3300026089 | Bacteria | 2640 |
| 996 | Ga0207648_10099685 | 3300026089 | Unclassified | 2544 |
| 997 | Ga0207648_10139264 | 3300026089 | Bacteria | 2138 |
| 998 | Ga0207648_10211164 | 3300026089 | Bacteria | 1723 |
| 999 | Ga0207648_10254914 | 3300026089 | Unclassified | 1565 |
| 1000 | Ga0207648_10281533 | 3300026089 | Unclassified | 1487 |
| 1001 | Ga0207648_10334651 | 3300026089 | Unclassified | 1362 |
| 1002 | Ga0207648_11322834 | 3300026089 | Bacteria | 677 |
| 1003 | Ga0207648_11467147 | 3300026089 | Bacteria | 641 |
| 1004 | Ga0207676_10014812 | 3300026095 | Bacteria | 5618 |
| 1005 | Ga0207676_10032483 | 3300026095 | Bacteria | 3934 |
| 1006 | Ga0207676_10034193 | 3300026095 | Bacteria | 3847 |
| 1007 | Ga0207676_10109644 | 3300026095 | Unclassified | 2307 |
| 1008 | Ga0207676_10150793 | 3300026095 | Bacteria | 2002 |
| 1009 | Ga0207676_10180475 | 3300026095 | Viruses | 1848 |
| 1010 | Ga0207676_10307813 | 3300026095 | Unclassified | 1449 |
| 1011 | Ga0207676_10525687 | 3300026095 | Bacteria | 1127 |
| 1012 | Ga0207674_10061584 | 3300026116 | Bacteria | 3792 |
| 1013 | Ga0207674_10592894 | 3300026116 | Bacteria | 1070 |
| 1014 | Ga0207674_10656898 | 3300026116 | Bacteria | 1013 |
| 1015 | Ga0207674_10707475 | 3300026116 | Unclassified | 972 |
| 1016 | Ga0207675_100087094 | 3300026118 | Unclassified | 2933 |
| 1017 | Ga0207675_100088170 | 3300026118 | Bacteria | 2914 |
| 1018 | Ga0207675_100115838 | 3300026118 | Unclassified | 2532 |
| 1019 | Ga0207675_100116172 | 3300026118 | Bacteria | 2529 |
| 1020 | Ga0207675_100230505 | 3300026118 | Bacteria | 1787 |
| 1021 | Ga0207675_100254408 | 3300026118 | Bacteria | 1701 |
| 1022 | Ga0207675_100278637 | 3300026118 | Bacteria | 1624 |
| 1023 | Ga0207675_100347885 | 3300026118 | Unclassified | 1452 |
| 1024 | Ga0207675_100385732 | 3300026118 | Bacteria | 1378 |
| 1025 | Ga0207675_100595480 | 3300026118 | Bacteria | 1108 |
| 1026 | Ga0207675_100618544 | 3300026118 | Bacteria | 1087 |
| 1027 | Ga0207675_100857438 | 3300026118 | Unclassified | 923 |
| 1028 | Ga0207675_101042915 | 3300026118 | Bacteria | 837 |
| 1029 | Ga0207683_10033044 | 3300026121 | Bacteria | 4493 |
| 1030 | Ga0207683_10157417 | 3300026121 | Bacteria | 2052 |
| 1031 | Ga0207683_10206224 | 3300026121 | Bacteria | 1788 |
| 1032 | Ga0207683_10313072 | 3300026121 | Unclassified | 1437 |
| 1033 | Ga0207683_10414536 | 3300026121 | Bacteria | 1240 |
| 1034 | Ga0207683_10433160 | 3300026121 | Bacteria | 1212 |
| 1035 | Ga0207683_10558342 | 3300026121 | Bacteria | 1059 |
| 1036 | Ga0207683_10688106 | 3300026121 | Unclassified | 948 |
| 1037 | Ga0207683_10800358 | 3300026121 | Bacteria | 875 |
| 1038 | Ga0207683_11067291 | 3300026121 | Unclassified | 749 |
| 1039 | Ga0207683_11146007 | 3300026121 | Bacteria | 721 |
| 1040 | Ga0207698_10400208 | 3300026142 | Unclassified | 1312 |
| 1041 | Ga0209983_1106675 | 3300027665 | Unclassified | 636 |
| 1042 | Ga0209971_1026227 | 3300027682 | Unclassified | 1393 |
| 1043 | Ga0209974_10063480 | 3300027876 | Bacteria | 1252 |
| 1044 | Ga0207428_10000005 | 3300027907 | Bacteria | 520045 |
| 1045 | Ga0207428_10000156 | 3300027907 | Bacteria | 93294 |
| 1046 | Ga0207428_10003214 | 3300027907 | Bacteria | 15966 |
| 1047 | Ga0207428_10006617 | 3300027907 | Bacteria | 10661 |
| 1048 | Ga0207428_10007795 | 3300027907 | Bacteria | 9748 |
| 1049 | Ga0207428_10017798 | 3300027907 | Bacteria | 6093 |
| 1050 | Ga0207428_10032828 | 3300027907 | Bacteria | 4269 |
| 1051 | Ga0207428_10035587 | 3300027907 | Bacteria | 4069 |
| 1052 | Ga0207428_10331834 | 3300027907 | Unclassified | 1121 |
| 1053 | Ga0207428_10630272 | 3300027907 | Bacteria | 771 |
| 1054 | Ga0268266_10076315 | 3300028379 | Bacteria | 2912 |
| 1055 | Ga0268266_10148463 | 3300028379 | Bacteria | 2110 |
| 1056 | Ga0268266_10204191 | 3300028379 | Bacteria | 1810 |
| 1057 | Ga0268266_10400322 | 3300028379 | Unclassified | 1298 |
| 1058 | Ga0268265_10007655 | 3300028380 | Bacteria | 7289 |
| 1059 | Ga0268265_10080399 | 3300028380 | Bacteria | 2570 |
| 1060 | Ga0268265_10151383 | 3300028380 | Unclassified | 1957 |
| 1061 | Ga0268265_10192637 | 3300028380 | Bacteria | 1762 |
| 1062 | Ga0268265_10221870 | 3300028380 | Unclassified | 1655 |
| 1063 | Ga0268265_10533288 | 3300028380 | Bacteria | 1111 |
| 1064 | Ga0268265_10595829 | 3300028380 | Unclassified | 1055 |
| 1065 | Ga0268264_10023300 | 3300028381 | Bacteria | 5051 |
| 1066 | Ga0268264_10035080 | 3300028381 | Bacteria | 4130 |
| 1067 | Ga0268264_10148355 | 3300028381 | Bacteria | 2100 |
| 1068 | Ga0268264_10278405 | 3300028381 | Bacteria | 1566 |
| 1069 | Ga0268264_10282422 | 3300028381 | Unclassified | 1556 |
| 1070 | Ga0268264_10334699 | 3300028381 | Unclassified | 1436 |
| 1071 | Ga0268264_10473607 | 3300028381 | Unclassified | 1217 |
| 1072 | Ga0265316_10444674 | 3300031344 | Bacteria | 930 |
| 1073 | Ga0307408_100078365 | 3300031548 | Bacteria | 2463 |
| 1074 | Ga0307408_100081459 | 3300031548 | Bacteria | 2420 |
| 1075 | Ga0307408_100392206 | 3300031548 | Bacteria | 1190 |
| 1076 | Ga0307408_100803021 | 3300031548 | Bacteria | 854 |
| 1077 | Ga0265314_10033286 | 3300031711 | Bacteria | 3782 |
| 1078 | Ga0307405_10079173 | 3300031731 | Unclassified | 2141 |
| 1079 | Ga0307405_10112523 | 3300031731 | Unclassified | 1847 |
| 1080 | Ga0307405_10133043 | 3300031731 | Bacteria | 1722 |
| 1081 | Ga0307405_10482364 | 3300031731 | Unclassified | 990 |
| 1082 | Ga0307405_10597284 | 3300031731 | Unclassified | 900 |
| 1083 | Ga0307413_10100156 | 3300031824 | Unclassified | 1912 |
| 1084 | Ga0307413_10463454 | 3300031824 | Unclassified | 1009 |
| 1085 | Ga0307413_10927710 | 3300031824 | Unclassified | 741 |
| 1086 | Ga0307410_10051926 | 3300031852 | Unclassified | 2766 |
| 1087 | Ga0307410_10079408 | 3300031852 | Bacteria | 2299 |
| 1088 | Ga0307410_10116868 | 3300031852 | Unclassified | 1939 |
| 1089 | Ga0307410_10124814 | 3300031852 | Bacteria | 1883 |
| 1090 | Ga0307410_10835309 | 3300031852 | Unclassified | 785 |
| 1091 | Ga0307406_10343830 | 3300031901 | Bacteria | 1163 |
| 1092 | Ga0307407_10084019 | 3300031903 | Unclassified | 1933 |
| 1093 | Ga0307412_10194730 | 3300031911 | Bacteria | 1535 |
| 1094 | Ga0307412_10542345 | 3300031911 | Bacteria | 975 |
| 1095 | Ga0307409_100074356 | 3300031995 | Unclassified | 2715 |
| 1096 | Ga0307409_100300793 | 3300031995 | Bacteria | 1492 |
| 1097 | Ga0307416_100028056 | 3300032002 | Bacteria | 4180 |
| 1098 | Ga0307416_100038313 | 3300032002 | Bacteria | 3698 |
| 1099 | Ga0307416_100059664 | 3300032002 | Bacteria | 3101 |
| 1100 | Ga0307416_100300829 | 3300032002 | Bacteria | 1594 |
| 1101 | Ga0307416_100374617 | 3300032002 | Unclassified | 1451 |
| 1102 | Ga0307416_100707017 | 3300032002 | Bacteria | 1097 |
| 1103 | Ga0307414_10097706 | 3300032004 | Bacteria | 2201 |
| 1104 | Ga0307414_10129721 | 3300032004 | Bacteria | 1955 |
| 1105 | Ga0307414_10349360 | 3300032004 | Bacteria | 1269 |
| 1106 | Ga0307414_10615760 | 3300032004 | Unclassified | 975 |
| 1107 | Ga0307414_10640988 | 3300032004 | Unclassified | 957 |
| 1108 | Ga0307414_11121239 | 3300032004 | Bacteria | 727 |
| 1109 | Ga0307411_10114535 | 3300032005 | Unclassified | 1937 |
| 1110 | Ga0307411_10117822 | 3300032005 | Unclassified | 1914 |
| 1111 | Ga0307411_10202710 | 3300032005 | Bacteria | 1525 |
| 1112 | Ga0307411_10435962 | 3300032005 | Bacteria | 1092 |
| 1113 | Ga0307411_10460682 | 3300032005 | Unclassified | 1066 |
| 1114 | Ga0307415_100010673 | 3300032126 | Bacteria | 5213 |
| 1115 | Ga0307415_100154027 | 3300032126 | Bacteria | 1773 |
| 1116 | Ga0307415_100668424 | 3300032126 | Unclassified | 933 |
| 1117 | Ga0307415_101172548 | 3300032126 | Unclassified | 722 |
| 1118 | Ga0373930_0002854 | 3300034816 | Bacteria | 2711 |
| 1119 | Ga0373948_0018575 | 3300034817 | Unclassified | 1307 |
| 1120 | Ga0373950_0000492 | 3300034818 | Bacteria | 4841 |
| 1121 | Ga0373958_0024338 | 3300034819 | Bacteria | 1145 |
| 1122 | Ga0373928_0006977 | 3300035084 | Bacteria | 2177 |
| 1123 | Ga0373929_0000407 | 3300035085 | Bacteria | 8103 |
| 1124 | Ga0373949_0000966 | 3300035090 | Bacteria | 8928 |
| 1125 | Ga0373952_0000798 | 3300035092 | Bacteria | 5659 |
| 1126 | Ga0373923_0079124 | 3300035111 | Unclassified | 1424 |
| 1127 | Ga0373939_0030625 | 3300035114 | Bacteria | 1549 |
| 1128 | Ga0373939_0109649 | 3300035114 | Unclassified | 959 |
| 1129 | Ga0373941_0013295 | 3300035115 | Bacteria | 2173 |
| 1130 | Ga0373941_0183910 | 3300035115 | Unclassified | 786 |
| 1131 | Ga0373953_0220071 | 3300035117 | Bacteria | 822 |
| 1132 | Ga0373954_0051964 | 3300035118 | Bacteria | 1926 |
| 1133 | Ga0373954_0184461 | 3300035118 | Bacteria | 1024 |
| 1134 | Ga0373960_0217085 | 3300035121 | Unclassified | 683 |
| 1135 | Ga0373943_0021226 | 3300035170 | Bacteria | 2997 |
| 1136 | Ga0373943_0185733 | 3300035170 | Bacteria | 1145 |
| 1137 | Ga0373943_0217615 | 3300035170 | Unclassified | 1063 |
| 1138 | Ga0373943_0224021 | 3300035170 | Bacteria | 1048 |
| 1139 | Ga0373946_0029315 | 3300035171 | Bacteria | 2190 |
| 1140 | Ga0373946_0318098 | 3300035171 | Bacteria | 773 |
| 1141 | Ga0373955_0003019 | 3300035172 | Bacteria | 7378 |
| 1142 | Ga0373955_0046443 | 3300035172 | Unclassified | 2348 |
| 1143 | Ga0373955_0076519 | 3300035172 | Bacteria | 1883 |
| 1144 | Ga0373955_0442855 | 3300035172 | Unclassified | 791 |
| 1145 | Ga0373955_0842861 | 3300035172 | Unclassified | 564 |
| 1146 | Ga0373942_0001566 | 3300035207 | Bacteria | 5861 |
| 1147 | Ga0373924_0021449 | 3300035410 | Unclassified | 2520 |
| 1148 | Ga0373924_0140817 | 3300035410 | Unclassified | 1052 |
| 1149 | Ga0373931_0007480 | 3300035691 | Bacteria | 5143 |
| 1150 | Ga0373935_0083599 | 3300035692 | Bacteria | 2078 |
| 1151 | Ga0373935_0134413 | 3300035692 | Bacteria | 1665 |
| 1152 | Ga0373935_0164017 | 3300035692 | Unclassified | 1516 |
| 1153 | Ga0373935_0185751 | 3300035692 | Bacteria | 1429 |
| 1154 | Ga0373927_0155381 | 3300035695 | Unclassified | 1498 |
| 1155 | Ga0373933_0418322 | 3300035724 | Bacteria | 875 |
| 1156 | Ga0373933_0740285 | 3300035724 | Unclassified | 647 |
| 1157 | Ga0373947_0003818 | 3300035725 | Bacteria | 8873 |
| 1158 | Ga0373937_0012405 | 3300036401 | Bacteria | 7495 |
| 1159 | Ga0373937_0176206 | 3300036401 | Bacteria | 2007 |
| 1160 | Ga0373937_0381356 | 3300036401 | Bacteria | 1337 |
| 1161 | Ga0373937_0393320 | 3300036401 | Unclassified | 1315 |
| 1162 | Ga0373937_0608866 | 3300036401 | Unclassified | 1037 |
| 1163 | Ga0373937_1823949 | 3300036401 | Bacteria | 555 |
| 1164 | Ga0373925_0266622 | 3300037068 | Bacteria | 1377 |
| 1165 | Ga0373925_0482653 | 3300037068 | Bacteria | 1017 |
| 1166 | Ga0373925_0542746 | 3300037068 | Bacteria | 956 |
| 1167 | Ga0373925_1199410 | 3300037068 | Bacteria | 624 |
| 1168 | Ga0395900_0459263 | 3300037418 | Unclassified | 1229 |
| 1169 | Ga0395905_0197773 | 3300037471 | Bacteria | 1885 |
| 1170 | Ga0242420_027094 | 3300038996 | Unclassified | 1049 |
| 1171 | Ga0436365_0956175 | 3300039437 | Bacteria | 2742 |
| 1172 | Ga0436365_1732685 | 3300039437 | Bacteria | 2188 |
| 1173 | Ga0439439_0093016 | 3300041406 | Bacteria | 825 |
| 1174 | Ga0439453_0017767 | 3300041408 | Bacteria | 1252 |
| 1175 | Ga0439453_0026277 | 3300041408 | Bacteria | 1078 |
| 1176 | Ga0439431_0006753 | 3300041997 | Unclassified | 2547 |
| 1177 | Ga0439433_0001889 | 3300041999 | Bacteria | 4381 |
| 1178 | Ga0439437_014446 | 3300042000 | Unclassified | 923 |
| 1179 | Ga0439462_0051606 | 3300042015 | Bacteria | 1106 |
| 1180 | Ga0450892_007492 | 3300042130 | Bacteria | 921 |
| 1181 | Ga0439446_0028655 | 3300042156 | Bacteria | 1604 |
| 1182 | Ga0439446_0095397 | 3300042156 | Unclassified | 935 |
| 1183 | Ga0439446_0251776 | 3300042156 | Bacteria | 609 |
| 1184 | Ga0439458_0092357 | 3300042157 | Bacteria | 780 |
| 1185 | Ga0439434_0099914 | 3300042435 | Bacteria | 934 |
| 1186 | Ga0439435_0052341 | 3300042436 | Bacteria | 1172 |
| 1187 | Ga0439435_0069724 | 3300042436 | Bacteria | 1039 |
| 1188 | Ga0439464_0061668 | 3300042439 | Bacteria | 1098 |
| 1189 | Ga0439460_0040424 | 3300042461 | Bacteria | 1366 |
| 1190 | Ga0439460_0063976 | 3300042461 | Bacteria | 1128 |
| 1191 | Ga0439460_0123444 | 3300042461 | Bacteria | 849 |
| 1192 | Ga0450916_034769 | 3300042530 | Bacteria | 747 |
| 1193 | Ga0451577_0424665 | 3300042876 | Unclassified | 1207 |
| 1194 | Ga0439440_0033118 | 3300042993 | Bacteria | 1230 |
| 1195 | Ga0439440_0098351 | 3300042993 | Unclassified | 793 |
| 1196 | Ga0466963_0184194 | 3300044694 | Bacteria | 1458 |
| 1197 | Ga0466963_0239302 | 3300044694 | Bacteria | 1273 |
| 1198 | Ga0466957_0155932 | 3300044842 | Bacteria | 1480 |
| 1199 | Ga0451576_0003703 | 3300045051 | Bacteria | 20672 |
| 1200 | Ga0451576_0301734 | 3300045051 | Bacteria | 1675 |
| 1201 | Ga0466967_0493469 | 3300045976 | Bacteria | 1201 |
| 1202 | Ga0495592_0025040 | 3300046454 | Bacteria | 4532 |
| 1203 | Ga0495592_0139872 | 3300046454 | Bacteria | 1685 |
| 1204 | Ga0495603_0028319 | 3300046455 | Unclassified | 3379 |
| 1205 | Ga0495603_0042909 | 3300046455 | Unclassified | 2702 |
| 1206 | Ga0495603_0358636 | 3300046455 | Bacteria | 836 |
| 1207 | Ga0495629_0085053 | 3300046459 | Unclassified | 2207 |
| 1208 | Ga0495629_0206389 | 3300046459 | Unclassified | 1358 |
| 1209 | Ga0495580_0316248 | 3300046472 | Viruses | 1061 |
| 1210 | Ga0495582_0181798 | 3300046473 | Bacteria | 1198 |
| 1211 | Ga0495582_0472333 | 3300046473 | Bacteria | 725 |
| 1212 | Ga0495639_0076786 | 3300046475 | Unclassified | 1550 |
| 1213 | Ga0495664_0171598 | 3300046477 | Bacteria | 1316 |
| 1214 | Ga0495664_0296679 | 3300046477 | Bacteria | 976 |
| 1215 | Ga0495584_0025210 | 3300046491 | Bacteria | 3014 |
| 1216 | Ga0495584_0410163 | 3300046491 | Unclassified | 689 |
| 1217 | Ga0495594_0029180 | 3300046499 | Unclassified | 2981 |
| 1218 | Ga0495594_0066860 | 3300046499 | Bacteria | 1994 |
| 1219 | Ga0495594_0252872 | 3300046499 | Bacteria | 1004 |
| 1220 | Ga0495594_0353963 | 3300046499 | Bacteria | 836 |
| 1221 | Ga0495608_0003942 | 3300046511 | Bacteria | 10667 |
| 1222 | Ga0495618_0086045 | 3300046514 | Bacteria | 2010 |
| 1223 | Ga0495618_0617134 | 3300046514 | Bacteria | 644 |
| 1224 | Ga0495630_0009709 | 3300046517 | Bacteria | 6922 |
| 1225 | Ga0495630_1022797 | 3300046517 | Unclassified | 628 |
| 1226 | Ga0495643_0009097 | 3300046522 | Bacteria | 6222 |
| 1227 | Ga0495644_0096332 | 3300046523 | Unclassified | 1118 |
| 1228 | Ga0495663_0017329 | 3300046525 | Bacteria | 2043 |
| 1229 | Ga0495652_0245893 | 3300046529 | Unclassified | 1328 |
| 1230 | Ga0495652_0635473 | 3300046529 | Unclassified | 724 |
| 1231 | Ga0495654_0322069 | 3300046530 | Unclassified | 627 |
| 1232 | Ga0495665_0483848 | 3300046531 | Bacteria | 624 |
| 1233 | Ga0495640_0047607 | 3300046533 | Bacteria | 2967 |
| 1234 | Ga0495640_0078023 | 3300046533 | Unclassified | 2207 |
| 1235 | Ga0495640_0416169 | 3300046533 | Bacteria | 824 |
| 1236 | Ga0495587_0051732 | 3300046536 | Bacteria | 2427 |
| 1237 | Ga0495587_0176508 | 3300046536 | Bacteria | 1212 |
| 1238 | Ga0495598_0012654 | 3300046537 | Unclassified | 2076 |
| 1239 | Ga0495598_0117596 | 3300046537 | Bacteria | 898 |
| 1240 | Ga0495598_0146081 | 3300046537 | Unclassified | 822 |
| 1241 | Ga0495609_0019629 | 3300046538 | Bacteria | 3125 |
| 1242 | Ga0495621_0003364 | 3300046539 | Bacteria | 4412 |
| 1243 | Ga0495621_0037939 | 3300046539 | Bacteria | 1678 |
| 1244 | Ga0495621_0109503 | 3300046539 | Unclassified | 1058 |
| 1245 | Ga0495621_0116445 | 3300046539 | Unclassified | 1029 |
| 1246 | Ga0495645_0000450 | 3300046543 | Bacteria | 28247 |
| 1247 | Ga0495633_0093088 | 3300046558 | Unclassified | 1401 |
| 1248 | Ga0495667_0040064 | 3300046559 | Bacteria | 3112 |
| 1249 | Ga0495634_0081249 | 3300046642 | Bacteria | 2120 |
| 1250 | Ga0495634_0326616 | 3300046642 | Bacteria | 923 |
| 1251 | Ga0495634_0422055 | 3300046642 | Bacteria | 790 |
| 1252 | Ga0495611_0197354 | 3300046648 | Bacteria | 939 |
| 1253 | Ga0495635_0053736 | 3300046663 | Bacteria | 2775 |
| 1254 | Ga0495635_0088667 | 3300046663 | Bacteria | 2117 |
| 1255 | Ga0495659_0015579 | 3300046664 | Bacteria | 2501 |
| 1256 | Ga0495659_0191227 | 3300046664 | Unclassified | 836 |
| 1257 | Ga0495588_0057859 | 3300046674 | Bacteria | 2003 |
| 1258 | Ga0495657_0311723 | 3300046675 | Bacteria | 937 |
| 1259 | Ga0495623_0047499 | 3300046679 | Unclassified | 2725 |
| 1260 | Ga0495647_0214209 | 3300046681 | Bacteria | 848 |
| 1261 | Ga0495658_0025322 | 3300046683 | Bacteria | 3170 |
| 1262 | Ga0495658_0090500 | 3300046683 | Bacteria | 1811 |
| 1263 | Ga0495658_0168637 | 3300046683 | Unclassified | 1354 |
| 1264 | Ga0495658_0580717 | 3300046683 | Bacteria | 718 |
| 1265 | Ga0495669_0004081 | 3300046684 | Bacteria | 6006 |
| 1266 | Ga0495669_0007347 | 3300046684 | Bacteria | 4616 |
| 1267 | Ga0495669_0103649 | 3300046684 | Unclassified | 1323 |
| 1268 | Ga0495669_0333198 | 3300046684 | Unclassified | 733 |
| 1269 | Ga0495613_0001676 | 3300046689 | Bacteria | 16870 |
| 1270 | Ga0495670_0077989 | 3300046691 | Bacteria | 1685 |
| 1271 | Ga0495600_0092987 | 3300046809 | Unclassified | 1967 |
| 1272 | Ga0495600_0332280 | 3300046809 | Bacteria | 954 |
| 1273 | Ga0495636_0043766 | 3300047318 | Bacteria | 1863 |
| 1274 | Ga0495674_0082858 | 3300047319 | Unclassified | 2750 |
| 1275 | Ga0495674_0091091 | 3300047319 | Bacteria | 2605 |
| 1276 | Ga0495674_0233224 | 3300047319 | Unclassified | 1518 |
| 1277 | Ga0495676_0071461 | 3300047321 | Unclassified | 2668 |
| 1278 | Ga0495675_0452837 | 3300047444 | Unclassified | 742 |
| 1279 | Ga0495675_0476815 | 3300047444 | Bacteria | 719 |
| 1280 | Ga0495677_0021678 | 3300047445 | Bacteria | 2329 |
| 1281 | Ga0495685_063483 | 3300047447 | Unclassified | 1243 |
| 1282 | Ga0495684_0002679 | 3300047471 | Bacteria | 14108 |
| 1283 | Ga0495684_0025447 | 3300047471 | Unclassified | 4548 |
| 1284 | Ga0495593_0174023 | 3300047673 | Bacteria | 1085 |
| 1285 | Ga0495602_0401247 | 3300048088 | Unclassified | 978 |
| 1286 | Ga0496100_0005315 | 3300048903 | Bacteria | 6921 |
| 1287 | Ga0496100_1547020 | 3300048903 | Unclassified | 524 |
| 1288 | Ga0496101_0000338 | 3300048904 | Bacteria | 31903 |
| 1289 | Ga0496101_0163598 | 3300048904 | Bacteria | 1708 |
| 1290 | Ga0496101_0504818 | 3300048904 | Bacteria | 955 |
| 1291 | Ga0496102_0120104 | 3300048905 | Unclassified | 2454 |
| 1292 | Ga0496102_0365200 | 3300048905 | Bacteria | 1359 |
| 1293 | Ga0496104_0011885 | 3300048907 | Bacteria | 7814 |
| 1294 | Ga0496104_0063755 | 3300048907 | Bacteria | 3496 |
| 1295 | Ga0496104_0116270 | 3300048907 | Bacteria | 2567 |
| 1296 | Ga0496104_0641105 | 3300048907 | Bacteria | 971 |
| 1297 | Ga0496104_0791916 | 3300048907 | Unclassified | 854 |
| 1298 | Ga0496105_0027444 | 3300048908 | Bacteria | 4652 |
| 1299 | Ga0496105_0263662 | 3300048908 | Bacteria | 1393 |
| 1300 | Ga0496105_0522093 | 3300048908 | Bacteria | 930 |
| 1301 | Ga0496105_0534097 | 3300048908 | Unclassified | 917 |
| 1302 | Ga0496106_0080483 | 3300048909 | Unclassified | 2502 |
| 1303 | Ga0496107_0007329 | 3300048910 | Bacteria | 7605 |
| 1304 | Ga0496108_0228402 | 3300048911 | Bacteria | 1618 |
| 1305 | Ga0496108_0685751 | 3300048911 | Bacteria | 889 |
| 1306 | Ga0496108_0934304 | 3300048911 | Bacteria | 743 |
| 1307 | Ga0496109_0079029 | 3300048912 | Bacteria | 3030 |
| 1308 | Ga0496109_0165002 | 3300048912 | Bacteria | 2076 |
| 1309 | Ga0496109_0585075 | 3300048912 | Bacteria | 1052 |
| 1310 | Ga0496109_0689410 | 3300048912 | Bacteria | 959 |
| 1311 | Ga0496110_0659312 | 3300048913 | Unclassified | 947 |
| 1312 | Ga0496111_0221188 | 3300048914 | Bacteria | 1407 |
| 1313 | Ga0496111_1030007 | 3300048914 | Bacteria | 589 |
| 1314 | Ga0496112_0002810 | 3300048915 | Bacteria | 14131 |
| 1315 | Ga0496112_0086620 | 3300048915 | Bacteria | 3099 |
| 1316 | Ga0496112_0167090 | 3300048915 | Bacteria | 2166 |
| 1317 | Ga0496112_0216587 | 3300048915 | Bacteria | 1871 |
| 1318 | Ga0496112_0242980 | 3300048915 | Bacteria | 1753 |
| 1319 | Ga0496112_0422774 | 3300048915 | Bacteria | 1271 |
| 1320 | Ga0496112_0456036 | 3300048915 | Unclassified | 1216 |
| 1321 | Ga0496112_0741276 | 3300048915 | Bacteria | 909 |
| 1322 | Ga0496113_0379672 | 3300048916 | Bacteria | 1134 |
| 1323 | Ga0496114_0001212 | 3300048917 | Bacteria | 19503 |
| 1324 | Ga0496114_0050503 | 3300048917 | Bacteria | 3462 |
| 1325 | Ga0496114_0084214 | 3300048917 | Bacteria | 2692 |
| 1326 | Ga0496114_0124083 | 3300048917 | Bacteria | 2224 |
| 1327 | Ga0496114_0198014 | 3300048917 | Bacteria | 1759 |
| 1328 | Ga0496114_0222524 | 3300048917 | Unclassified | 1657 |
| 1329 | Ga0496114_0357960 | 3300048917 | Bacteria | 1291 |
| 1330 | Ga0496114_0508159 | 3300048917 | Unclassified | 1066 |
| 1331 | Ga0496115_0125497 | 3300048918 | Bacteria | 2114 |
| 1332 | Ga0501299_060055 | 3300049522 | Unclassified | 804 |
| 1333 | Ga0501031_0169692 | 3300049568 | Bacteria | 1426 |
| 1334 | Ga0501031_0245236 | 3300049568 | Bacteria | 1164 |
| 1335 | Ga0501031_0281248 | 3300049568 | Bacteria | 1079 |
| 1336 | Ga0501034_0158536 | 3300049571 | Bacteria | 2236 |
| 1337 | Ga0501036_0258953 | 3300049572 | Bacteria | 1457 |
| 1338 | Ga0501036_0316407 | 3300049572 | Bacteria | 1304 |
| 1339 | Ga0501036_0355452 | 3300049572 | Bacteria | 1223 |
| 1340 | Ga0501036_0632035 | 3300049572 | Unclassified | 887 |
| 1341 | Ga0501037_0177620 | 3300049573 | Bacteria | 1512 |
| 1342 | Ga0501037_0531813 | 3300049573 | Bacteria | 795 |
| 1343 | Ga0501038_0043210 | 3300049574 | Bacteria | 3920 |
| 1344 | Ga0501038_0134017 | 3300049574 | Bacteria | 2031 |
| 1345 | Ga0501039_0005083 | 3300049575 | Bacteria | 9967 |
| 1346 | Ga0501040_0009144 | 3300049576 | Bacteria | 6452 |
| 1347 | Ga0501040_0021727 | 3300049576 | Bacteria | 4290 |
| 1348 | Ga0501040_0049618 | 3300049576 | Bacteria | 2870 |
| 1349 | Ga0501040_0422137 | 3300049576 | Bacteria | 959 |
| 1350 | Ga0501040_0617110 | 3300049576 | Bacteria | 784 |
| 1351 | Ga0501041_0080818 | 3300049577 | Bacteria | 2001 |
| 1352 | Ga0501041_0944903 | 3300049577 | Unclassified | 554 |
| 1353 | Ga0501042_0003809 | 3300049578 | Bacteria | 9538 |
| 1354 | Ga0501042_0085038 | 3300049578 | Bacteria | 2268 |
| 1355 | Ga0501043_0038916 | 3300049579 | Bacteria | 3739 |
| 1356 | Ga0501046_0047476 | 3300049580 | Bacteria | 3404 |
| 1357 | Ga0501046_0054245 | 3300049580 | Bacteria | 3154 |
| 1358 | Ga0501047_0453613 | 3300049581 | Bacteria | 1111 |
| 1359 | Ga0501048_0049799 | 3300049582 | Bacteria | 2985 |
| 1360 | Ga0501048_0279882 | 3300049582 | Unclassified | 1186 |
| 1361 | Ga0501048_1149577 | 3300049582 | Bacteria | 558 |
| 1362 | Ga0501068_0082561 | 3300049584 | Bacteria | 1974 |
| 1363 | Ga0501068_0511945 | 3300049584 | Bacteria | 779 |
| 1364 | Ga0501071_0015832 | 3300049587 | Bacteria | 5179 |
| 1365 | Ga0501071_0192495 | 3300049587 | Bacteria | 1530 |
| 1366 | Ga0501071_0934381 | 3300049587 | Bacteria | 669 |
| 1367 | Ga0501072_0006572 | 3300049588 | Bacteria | 8854 |
| 1368 | Ga0501072_0026593 | 3300049588 | Bacteria | 4511 |
| 1369 | Ga0501073_0326630 | 3300049589 | Bacteria | 1059 |
| 1370 | Ga0501075_0023042 | 3300049591 | Bacteria | 4555 |
| 1371 | Ga0501075_0110545 | 3300049591 | Bacteria | 2089 |
| 1372 | Ga0501075_0468852 | 3300049591 | Unclassified | 960 |
| 1373 | Ga0501076_0040773 | 3300049592 | Bacteria | 3650 |
| 1374 | Ga0501076_0136177 | 3300049592 | Bacteria | 1994 |
| 1375 | Ga0501076_0423239 | 3300049592 | Bacteria | 1096 |
| 1376 | Ga0501076_0656617 | 3300049592 | Bacteria | 865 |
| 1377 | Ga0501077_0047177 | 3300049593 | Bacteria | 2737 |
| 1378 | Ga0501077_0072533 | 3300049593 | Bacteria | 2182 |
| 1379 | Ga0501216_072708 | 3300049660 | Unclassified | 714 |
| 1380 | Ga0501221_035984 | 3300049704 | Unclassified | 1059 |
| 1381 | Ga0501079_0005197 | 3300049741 | Bacteria | 9676 |
| 1382 | Ga0501079_0087472 | 3300049741 | Bacteria | 2412 |
| 1383 | Ga0501079_0669540 | 3300049741 | Bacteria | 817 |
| 1384 | Ga0501080_0425907 | 3300049742 | Bacteria | 1192 |
| 1385 | Ga0501081_0008696 | 3300049743 | Bacteria | 6598 |
| 1386 | Ga0501081_0041776 | 3300049743 | Bacteria | 3141 |
| 1387 | Ga0501081_0588644 | 3300049743 | Unclassified | 832 |
| 1388 | Ga0501083_0073605 | 3300049744 | Bacteria | 2271 |
| 1389 | Ga0501035_0192170 | 3300049822 | Bacteria | 1755 |
| 1390 | Ga0501035_0933073 | 3300049822 | Unclassified | 686 |
| 1391 | Ga0501035_0961356 | 3300049822 | Bacteria | 673 |
| 1392 | Ga0501044_0092948 | 3300049823 | Bacteria | 3042 |
| 1393 | Ga0501044_1290198 | 3300049823 | Unclassified | 597 |
| 1394 | Ga0501045_0004657 | 3300049824 | Bacteria | 9472 |
| 1395 | Ga0501045_0241444 | 3300049824 | Unclassified | 1345 |
| 1396 | Ga0501045_0264909 | 3300049824 | Bacteria | 1279 |
| 1397 | nmdc:mga03683_1149_c1 | 3300050489 | Bacteria | 7787 |
| 1398 | nmdc:mga00v17_7255_c1 | 3300050491 | Bacteria | 5906 |
| 1399 | nmdc:mga0yw44_555493_c1 | 3300050492 | Unclassified | 780 |
| 1400 | nmdc:mga05p37_11071_c1 | 3300050507 | Bacteria | 10716 |
| 1401 | nmdc:mga05p37_138803_c1 | 3300050507 | Bacteria | 2979 |
| 1402 | nmdc:mga05p37_139331_c1 | 3300050507 | Unclassified | 2973 |
| 1403 | nmdc:mga05p37_158861_c1 | 3300050507 | Bacteria | 2761 |
| 1404 | nmdc:mga05p37_1965492_c1 | 3300050507 | Unclassified | 555 |
| 1405 | nmdc:mga05p37_1997_c1 | 3300050507 | Bacteria | 23815 |
| 1406 | nmdc:mga05p37_20363_c1 | 3300050507 | Bacteria | 8026 |
| 1407 | nmdc:mga05p37_23209_c1 | 3300050507 | Bacteria | 7526 |
| 1408 | nmdc:mga05p37_24698_c1 | 3300050507 | Bacteria | 7305 |
| 1409 | nmdc:mga05p37_25595_c1 | 3300050507 | Bacteria | 7178 |
| 1410 | nmdc:mga05p37_26118_c2 | 3300050507 | Bacteria | 5344 |
| 1411 | nmdc:mga05p37_34921_c1 | 3300050507 | Bacteria | 6162 |
| 1412 | nmdc:mga05p37_37736_c1 | 3300050507 | Bacteria | 5926 |
| 1413 | nmdc:mga05p37_43651_c1 | 3300050507 | Bacteria | 5516 |
| 1414 | nmdc:mga05p37_44023_c1 | 3300050507 | Bacteria | 5492 |
| 1415 | nmdc:mga05p37_48901_c1 | 3300050507 | Bacteria | 5200 |
| 1416 | nmdc:mga05p37_5217_c1 | 3300050507 | Bacteria | 15249 |
| 1417 | nmdc:mga05p37_73083_c1 | 3300050507 | Bacteria | 4220 |
| 1418 | nmdc:mga05p37_91576_c1 | 3300050507 | Bacteria | 3747 |
| 1419 | nmdc:mga05p37_967626_c1 | 3300050507 | Bacteria | 909 |
| 1420 | nmdc:mga09592_1189676_c1 | 3300050508 | Bacteria | 630 |
| 1421 | nmdc:mga09592_13559_c1 | 3300050508 | Bacteria | 6657 |
| 1422 | nmdc:mga09592_139923_c1 | 3300050508 | Unclassified | 2086 |
| 1423 | nmdc:mga09592_149535_c1 | 3300050508 | Unclassified | 2014 |
| 1424 | nmdc:mga09592_19921_c1 | 3300050508 | Bacteria | 5511 |
| 1425 | nmdc:mga09592_201873_c1 | 3300050508 | Bacteria | 1722 |
| 1426 | nmdc:mga09592_23513_c1 | 3300050508 | Bacteria | 5090 |
| 1427 | nmdc:mga09592_26276_c1 | 3300050508 | Bacteria | 4822 |
| 1428 | nmdc:mga09592_38159_c1 | 3300050508 | Bacteria | 4031 |
| 1429 | nmdc:mga09592_456600_c1 | 3300050508 | Bacteria | 1102 |
| 1430 | nmdc:mga09592_68792_c1 | 3300050508 | Bacteria | 3003 |
| 1431 | nmdc:mga0qj67_194295_c1 | 3300050509 | Bacteria | 1649 |
| 1432 | nmdc:mga0qj67_245188_c1 | 3300050509 | Bacteria | 1454 |
| 1433 | nmdc:mga0qj67_255819_c1 | 3300050509 | Bacteria | 1421 |
| 1434 | nmdc:mga0qj67_27328_c1 | 3300050509 | Bacteria | 4422 |
| 1435 | nmdc:mga0qj67_7153_c1 | 3300050509 | Bacteria | 8234 |
| 1436 | nmdc:mga0qj67_7629_c1 | 3300050509 | Bacteria | 7992 |
| 1437 | nmdc:mga06r32_1076344_c1 | 3300050510 | Bacteria | 754 |
| 1438 | nmdc:mga06r32_132439_c1 | 3300050510 | Bacteria | 2466 |
| 1439 | nmdc:mga06r32_14936_c1 | 3300050510 | Bacteria | 7048 |
| 1440 | nmdc:mga06r32_270474_c1 | 3300050510 | Unclassified | 1687 |
| 1441 | nmdc:mga06r32_29574_c1 | 3300050510 | Bacteria | 5137 |
| 1442 | nmdc:mga06r32_616343_c1 | 3300050510 | Unclassified | 1055 |
| 1443 | nmdc:mga06r32_655429_c1 | 3300050510 | Unclassified | 1018 |
| 1444 | nmdc:mga06r32_86132_c1 | 3300050510 | Bacteria | 3064 |
| 1445 | nmdc:mga06r32_9476_c1 | 3300050510 | Bacteria | 8790 |
| 1446 | nmdc:mga08y16_108808_c1 | 3300050511 | Bacteria | 2886 |
| 1447 | nmdc:mga08y16_116259_c1 | 3300050511 | Unclassified | 2784 |
| 1448 | nmdc:mga08y16_1178584_c1 | 3300050511 | Bacteria | 738 |
| 1449 | nmdc:mga08y16_1367_c1 | 3300050511 | Bacteria | 24369 |
| 1450 | nmdc:mga08y16_1568_c1 | 3300050511 | Bacteria | 23067 |
| 1451 | nmdc:mga08y16_227293_c1 | 3300050511 | Unclassified | 1931 |
| 1452 | nmdc:mga08y16_2507_c1 | 3300050511 | Bacteria | 18886 |
| 1453 | nmdc:mga08y16_2643_c1 | 3300050511 | Bacteria | 18424 |
| 1454 | nmdc:mga08y16_266469_c1 | 3300050511 | Bacteria | 1769 |
| 1455 | nmdc:mga08y16_273804_c1 | 3300050511 | Unclassified | 1742 |
| 1456 | nmdc:mga08y16_2862_c1 | 3300050511 | Bacteria | 17748 |
| 1457 | nmdc:mga08y16_352547_c1 | 3300050511 | Bacteria | 1511 |
| 1458 | nmdc:mga08y16_390387_c1 | 3300050511 | Bacteria | 1426 |
| 1459 | nmdc:mga08y16_449722_c1 | 3300050511 | Bacteria | 1314 |
| 1460 | nmdc:mga08y16_4998_c1 | 3300050511 | Bacteria | 13866 |
| 1461 | nmdc:mga08y16_658_c1 | 3300050511 | Bacteria | 32511 |
| 1462 | nmdc:mga08y16_67477_c1 | 3300050511 | Unclassified | 3731 |
| 1463 | nmdc:mga08y16_9_c1 | 3300050511 | Bacteria | 566088 |
| 1464 | nmdc:mga0n895_1037810_c1 | 3300050512 | Unclassified | 799 |
| 1465 | nmdc:mga0n895_13596_c1 | 3300050512 | Bacteria | 7353 |
| 1466 | nmdc:mga0n895_141_c1 | 3300050512 | Bacteria | 43611 |
| 1467 | nmdc:mga0n895_166078_c1 | 3300050512 | Bacteria | 2239 |
| 1468 | nmdc:mga0n895_19824_c1 | 3300050512 | Bacteria | 6259 |
| 1469 | nmdc:mga0n895_267490_c1 | 3300050512 | Bacteria | 1734 |
| 1470 | nmdc:mga0n895_304759_c1 | 3300050512 | Bacteria | 1615 |
| 1471 | nmdc:mga0n895_343217_c1 | 3300050512 | Unclassified | 1512 |
| 1472 | nmdc:mga0n895_35782_c1 | 3300050512 | Bacteria | 4790 |
| 1473 | nmdc:mga0n895_472679_c1 | 3300050512 | Bacteria | 1265 |
| 1474 | nmdc:mga0n895_476418_c1 | 3300050512 | Bacteria | 1259 |
| 1475 | nmdc:mga0n895_546195_c1 | 3300050512 | Unclassified | 1165 |
| 1476 | nmdc:mga0n895_58404_c1 | 3300050512 | Bacteria | 3804 |
| 1477 | nmdc:mga0n895_602783_c1 | 3300050512 | Bacteria | 1100 |
| 1478 | nmdc:mga0n895_72372_c1 | 3300050512 | Bacteria | 3420 |
| 1479 | nmdc:mga0n895_737660_c1 | 3300050512 | Bacteria | 979 |
| 1480 | nmdc:mga0n895_81880_c1 | 3300050512 | Unclassified | 3217 |
| 1481 | nmdc:mga0rr50_1006114_c1 | 3300050513 | Bacteria | 710 |
| 1482 | nmdc:mga0rr50_12990_c1 | 3300050513 | Bacteria | 5404 |
| 1483 | nmdc:mga0rr50_14183_c1 | 3300050513 | Bacteria | 5218 |
| 1484 | nmdc:mga0rr50_176227_c1 | 3300050513 | Bacteria | 1745 |
| 1485 | nmdc:mga0rr50_1_c1 | 3300050513 | Bacteria | 558123 |
| 1486 | nmdc:mga0rr50_316066_c1 | 3300050513 | Bacteria | 1309 |
| 1487 | nmdc:mga0rr50_398071_c1 | 3300050513 | Bacteria | 1163 |
| 1488 | nmdc:mga0rr50_539301_c1 | 3300050513 | Unclassified | 993 |
| 1489 | nmdc:mga0rr50_560727_c1 | 3300050513 | Unclassified | 973 |
| 1490 | nmdc:mga0rr50_682119_c1 | 3300050513 | Bacteria | 877 |
| 1491 | nmdc:mga0rr50_761091_c1 | 3300050513 | Bacteria | 827 |
| 1492 | nmdc:mga0rr50_8550_c1 | 3300050513 | Bacteria | 6378 |
| 1493 | nmdc:mga0rr50_8679_c1 | 3300050513 | Bacteria | 6338 |
| 1494 | nmdc:mga08x19_148053_c1 | 3300050514 | Unclassified | 1589 |
| 1495 | nmdc:mga08x19_153311_c1 | 3300050514 | Bacteria | 1562 |
| 1496 | nmdc:mga08x19_191333_c1 | 3300050514 | Bacteria | 1400 |
| 1497 | nmdc:mga08x19_3155_c1 | 3300050514 | Bacteria | 9893 |
| 1498 | nmdc:mga08x19_34798_c1 | 3300050514 | Unclassified | 3185 |
| 1499 | nmdc:mga08x19_416343_c1 | 3300050514 | Unclassified | 944 |
| 1500 | nmdc:mga08x19_92_c1 | 3300050514 | Bacteria | 80986 |
| 1501 | nmdc:mga0a205_112707_c2 | 3300050515 | Bacteria | 2158 |
| 1502 | nmdc:mga0a205_120196_c1 | 3300050515 | Unclassified | 2526 |
| 1503 | nmdc:mga0a205_12067_c2 | 3300050515 | Bacteria | 5976 |
| 1504 | nmdc:mga0a205_1225776_c1 | 3300050515 | Bacteria | 598 |
| 1505 | nmdc:mga0a205_131663_c1 | 3300050515 | Bacteria | 2401 |
| 1506 | nmdc:mga0a205_132875_c1 | 3300050515 | Unclassified | 2389 |
| 1507 | nmdc:mga0a205_151535_c1 | 3300050515 | Unclassified | 2218 |
| 1508 | nmdc:mga0a205_167404_c1 | 3300050515 | Unclassified | 2094 |
| 1509 | nmdc:mga0a205_219892_c1 | 3300050515 | Bacteria | 1785 |
| 1510 | nmdc:mga0a205_2573_c1 | 3300050515 | Bacteria | 15998 |
| 1511 | nmdc:mga0a205_281542_c1 | 3300050515 | Unclassified | 1538 |
| 1512 | nmdc:mga0a205_370522_c1 | 3300050515 | Bacteria | 1298 |
| 1513 | nmdc:mga0a205_394862_c1 | 3300050515 | Bacteria | 1247 |
| 1514 | nmdc:mga0a205_532506_c1 | 3300050515 | Bacteria | 1031 |
| 1515 | nmdc:mga0a205_649189_c1 | 3300050515 | Bacteria | 907 |
| 1516 | nmdc:mga0a205_676287_c1 | 3300050515 | Bacteria | 883 |
| 1517 | nmdc:mga0sz30_222545_c1 | 3300050516 | Bacteria | 839 |
| 1518 | Ga0495601_0003730 | 3300053077 | Bacteria | 8770 |
| 1519 | Ga0495601_0068407 | 3300053077 | Bacteria | 2264 |
| 1520 | Ga0495601_0135362 | 3300053077 | Bacteria | 1606 |
| 1521 | Ga0495595_0012548 | 3300053084 | Bacteria | 3564 |
| 1522 | Ga0495595_0405849 | 3300053084 | Bacteria | 691 |
| 1523 | Ga0495619_0006567 | 3300053085 | Bacteria | 7357 |
| 1524 | Ga0495619_0280366 | 3300053085 | Bacteria | 1155 |
| 1525 | Ga0495619_0433888 | 3300053085 | Bacteria | 906 |
| 1526 | Ga0495619_0769263 | 3300053085 | Unclassified | 652 |
| 1527 | Ga0500628_043052 | 3300053129 | Bacteria | 1040 |
| 1528 | Ga0501084_0009574 | 3300054114 | Bacteria | 8018 |
| 1529 | Ga0501084_0043281 | 3300054114 | Bacteria | 3767 |
| 1530 | Ga0501084_0359012 | 3300054114 | Unclassified | 1231 |
| 1531 | Ga0501084_1006567 | 3300054114 | Unclassified | 700 |
| 1532 | Ga0590071_000739 | 3300059421 | Bacteria | 9160 |
| 1533 | Ga0590071_005043 | 3300059421 | Bacteria | 3187 |
| 1534 | Ga0590074_003587 | 3300059423 | Bacteria | 2570 |
| 1535 | Ga0590074_042319 | 3300059423 | Unclassified | 821 |
| 1536 | Ga0590075_001312 | 3300059424 | Bacteria | 6243 |
| 1537 | Ga0590075_002211 | 3300059424 | Bacteria | 4679 |
| 1538 | Ga0590075_057765 | 3300059424 | Unclassified | 999 |
| 1539 | Ga0590075_113661 | 3300059424 | Bacteria | 707 |
| 1540 | Ga0590077_000747 | 3300059426 | Bacteria | 8520 |
| 1541 | Ga0587091_100514 | 3300059511 | Bacteria | 678 |
| 1542 | Ga0587114_031768 | 3300059655 | Unclassified | 811 |
| 1543 | Ga0501082_0163480 | 3300060353 | Bacteria | 1934 |
| 1544 | Ga0501082_0444785 | 3300060353 | Unclassified | 1132 |
| 1545 | Ga0501082_0818939 | 3300060353 | Bacteria | 814 |
| 1546 | Ga0530510_0009184 | 3300061734 | Bacteria | 6928 |
| 1547 | Ga0530510_0062078 | 3300061734 | Bacteria | 2705 |
| 1548 | Ga0530510_0289552 | 3300061734 | Unclassified | 1224 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025315 | Ga0207697_10072296 | Ga0207697_100722963 | 144 |
| 2 | 3300049568 | Ga0501031_0169692 | Ga0501031_0169692_711_1154 | 147 |
| 3 | 3300049572 | Ga0501036_0355452 | Ga0501036_0355452_45_488 | 147 |
| 4 | 3300049582 | Ga0501048_1149577 | Ga0501048_1149577_90_533 | 147 |
| 5 | 3300049592 | Ga0501076_0423239 | Ga0501076_0423239_297_740 | 147 |
| 6 | 3300005458 | Ga0070681_11157304 | Ga0070681_111573042 | 152 |
| 7 | 3300025915 | Ga0207693_10139612 | Ga0207693_101396123 | 153 |
| 8 | 3300049744 | Ga0501083_0073605 | Ga0501083_0073605_804_1322 | 156 |
| 9 | 3300050511 | nmdc:mga08y16_1178584_c1 | nmdc:mga08y16_1178584_c1_251_721 | 156 |
| 10 | 3300005347 | Ga0070668_100735908 | Ga0070668_1007359081 | 158 |
| 11 | 3300005459 | Ga0068867_101672557 | Ga0068867_1016725571 | 158 |
| 12 | 3300005844 | Ga0068862_100594903 | Ga0068862_1005949032 | 158 |
| 13 | 3300006844 | Ga0075428_101635840 | Ga0075428_1016358401 | 158 |
| 14 | 3300009094 | Ga0111539_10426199 | Ga0111539_104261993 | 158 |
| 15 | 3300025936 | Ga0207670_10496198 | Ga0207670_104961981 | 158 |
| 16 | 3300025961 | Ga0207712_11240747 | Ga0207712_112407471 | 158 |
| 17 | 3300025972 | Ga0207668_10730246 | Ga0207668_107302461 | 158 |
| 18 | 3300005289 | Ga0065704_10537012 | Ga0065704_105370121 | 159 |
| 19 | 3300005290 | Ga0065712_10162315 | Ga0065712_101623153 | 159 |
| 20 | 3300005293 | Ga0065715_10408396 | Ga0065715_104083961 | 159 |
| 21 | 3300005295 | Ga0065707_10247239 | Ga0065707_102472391 | 159 |
| 22 | 3300005295 | Ga0065707_10302678 | Ga0065707_103026782 | 159 |
| 23 | 3300005295 | Ga0065707_10484671 | Ga0065707_104846711 | 159 |
| 24 | 3300005328 | Ga0070676_10026241 | Ga0070676_100262412 | 159 |
| 25 | 3300005328 | Ga0070676_10199862 | Ga0070676_101998621 | 159 |
| 26 | 3300005328 | Ga0070676_10357983 | Ga0070676_103579832 | 159 |
| 27 | 3300005331 | Ga0070670_100052956 | Ga0070670_1000529563 | 159 |
| 28 | 3300005334 | Ga0068869_101215174 | Ga0068869_1012151741 | 159 |
| 29 | 3300005335 | Ga0070666_10198726 | Ga0070666_101987261 | 159 |
| 30 | 3300005337 | Ga0070682_100900612 | Ga0070682_1009006121 | 159 |
| 31 | 3300005337 | Ga0070682_101072323 | Ga0070682_1010723231 | 159 |
| 32 | 3300005338 | Ga0068868_100064048 | Ga0068868_1000640483 | 159 |
| 33 | 3300005338 | Ga0068868_100330401 | Ga0068868_1003304012 | 159 |
| 34 | 3300005340 | Ga0070689_100586620 | Ga0070689_1005866202 | 159 |
| 35 | 3300005341 | Ga0070691_10000892 | Ga0070691_100008923 | 159 |
| 36 | 3300005345 | Ga0070692_10035812 | Ga0070692_100358122 | 159 |
| 37 | 3300005347 | Ga0070668_100105729 | Ga0070668_1001057292 | 159 |
| 38 | 3300005353 | Ga0070669_100031310 | Ga0070669_1000313102 | 159 |
| 39 | 3300005353 | Ga0070669_100615765 | Ga0070669_1006157651 | 159 |
| 40 | 3300005353 | Ga0070669_100669953 | Ga0070669_1006699532 | 159 |
| 41 | 3300005353 | Ga0070669_100678850 | Ga0070669_1006788501 | 159 |
| 42 | 3300005354 | Ga0070675_100217685 | Ga0070675_1002176852 | 159 |
| 43 | 3300005354 | Ga0070675_100313845 | Ga0070675_1003138452 | 159 |
| 44 | 3300005355 | Ga0070671_100320519 | Ga0070671_1003205192 | 159 |
| 45 | 3300005355 | Ga0070671_100354947 | Ga0070671_1003549471 | 159 |
| 46 | 3300005356 | Ga0070674_100044223 | Ga0070674_1000442233 | 159 |
| 47 | 3300005356 | Ga0070674_100140019 | Ga0070674_1001400192 | 159 |
| 48 | 3300005356 | Ga0070674_100241008 | Ga0070674_1002410082 | 159 |
| 49 | 3300005356 | Ga0070674_100779800 | Ga0070674_1007798002 | 159 |
| 50 | 3300005356 | Ga0070674_101255596 | Ga0070674_1012555961 | 159 |
| 51 | 3300005434 | Ga0070709_10007316 | Ga0070709_100073162 | 159 |
| 52 | 3300005434 | Ga0070709_10759539 | Ga0070709_107595392 | 159 |
| 53 | 3300005435 | Ga0070714_100003070 | Ga0070714_1000030702 | 159 |
| 54 | 3300005436 | Ga0070713_100004893 | Ga0070713_1000048935 | 159 |
| 55 | 3300005436 | Ga0070713_100193518 | Ga0070713_1001935182 | 159 |
| 56 | 3300005440 | Ga0070705_100001404 | Ga0070705_10000140410 | 159 |
| 57 | 3300005441 | Ga0070700_100000788 | Ga0070700_1000007888 | 159 |
| 58 | 3300005441 | Ga0070700_100068953 | Ga0070700_1000689532 | 159 |
| 59 | 3300005441 | Ga0070700_100274394 | Ga0070700_1002743941 | 159 |
| 60 | 3300005444 | Ga0070694_100007026 | Ga0070694_1000070263 | 159 |
| 61 | 3300005445 | Ga0070708_100032111 | Ga0070708_1000321113 | 159 |
| 62 | 3300005456 | Ga0070678_100116947 | Ga0070678_1001169472 | 159 |
| 63 | 3300005456 | Ga0070678_100140021 | Ga0070678_1001400212 | 159 |
| 64 | 3300005456 | Ga0070678_100653885 | Ga0070678_1006538851 | 159 |
| 65 | 3300005457 | Ga0070662_100073576 | Ga0070662_1000735763 | 159 |
| 66 | 3300005457 | Ga0070662_100203340 | Ga0070662_1002033401 | 159 |
| 67 | 3300005457 | Ga0070662_101063022 | Ga0070662_1010630221 | 159 |
| 68 | 3300005458 | Ga0070681_10386081 | Ga0070681_103860812 | 159 |
| 69 | 3300005459 | Ga0068867_100115369 | Ga0068867_1001153692 | 159 |
| 70 | 3300005459 | Ga0068867_100139519 | Ga0068867_1001395192 | 159 |
| 71 | 3300005466 | Ga0070685_10047159 | Ga0070685_100471593 | 159 |
| 72 | 3300005466 | Ga0070685_10106243 | Ga0070685_101062431 | 159 |
| 73 | 3300005467 | Ga0070706_100236430 | Ga0070706_1002364302 | 159 |
| 74 | 3300005467 | Ga0070706_100286210 | Ga0070706_1002862101 | 159 |
| 75 | 3300005468 | Ga0070707_100657285 | Ga0070707_1006572852 | 159 |
| 76 | 3300005471 | Ga0070698_100011223 | Ga0070698_1000112233 | 159 |
| 77 | 3300005471 | Ga0070698_100138182 | Ga0070698_1001381821 | 159 |
| 78 | 3300005530 | Ga0070679_100127817 | Ga0070679_1001278173 | 159 |
| 79 | 3300005535 | Ga0070684_100179696 | Ga0070684_1001796963 | 159 |
| 80 | 3300005543 | Ga0070672_100196808 | Ga0070672_1001968081 | 159 |
| 81 | 3300005543 | Ga0070672_100617737 | Ga0070672_1006177372 | 159 |
| 82 | 3300005545 | Ga0070695_100016291 | Ga0070695_1000162913 | 159 |
| 83 | 3300005546 | Ga0070696_100039612 | Ga0070696_1000396123 | 159 |
| 84 | 3300005547 | Ga0070693_100169522 | Ga0070693_1001695222 | 159 |
| 85 | 3300005548 | Ga0070665_100020086 | Ga0070665_1000200864 | 159 |
| 86 | 3300005548 | Ga0070665_100195381 | Ga0070665_1001953811 | 159 |
| 87 | 3300005549 | Ga0070704_100026609 | Ga0070704_1000266092 | 159 |
| 88 | 3300005563 | Ga0068855_100238478 | Ga0068855_1002384782 | 159 |
| 89 | 3300005614 | Ga0068856_101833176 | Ga0068856_1018331761 | 159 |
| 90 | 3300005615 | Ga0070702_100003228 | Ga0070702_1000032282 | 159 |
| 91 | 3300005615 | Ga0070702_100962764 | Ga0070702_1009627642 | 159 |
| 92 | 3300005616 | Ga0068852_101897063 | Ga0068852_1018970631 | 159 |
| 93 | 3300005617 | Ga0068859_100208366 | Ga0068859_1002083662 | 159 |
| 94 | 3300005618 | Ga0068864_100201604 | Ga0068864_1002016043 | 159 |
| 95 | 3300005718 | Ga0068866_10024941 | Ga0068866_100249413 | 159 |
| 96 | 3300005718 | Ga0068866_10085221 | Ga0068866_100852212 | 159 |
| 97 | 3300005719 | Ga0068861_100010565 | Ga0068861_1000105652 | 159 |
| 98 | 3300005719 | Ga0068861_100079028 | Ga0068861_1000790282 | 159 |
| 99 | 3300005719 | Ga0068861_100164360 | Ga0068861_1001643602 | 159 |
| 100 | 3300005719 | Ga0068861_100823788 | Ga0068861_1008237882 | 159 |
| 101 | 3300005834 | Ga0068851_10033637 | Ga0068851_100336372 | 159 |
| 102 | 3300005841 | Ga0068863_100062464 | Ga0068863_1000624643 | 159 |
| 103 | 3300005841 | Ga0068863_100184236 | Ga0068863_1001842363 | 159 |
| 104 | 3300005843 | Ga0068860_100219487 | Ga0068860_1002194872 | 159 |
| 105 | 3300005844 | Ga0068862_100021517 | Ga0068862_1000215172 | 159 |
| 106 | 3300005844 | Ga0068862_100040092 | Ga0068862_1000400923 | 159 |
| 107 | 3300005844 | Ga0068862_100053094 | Ga0068862_1000530942 | 159 |
| 108 | 3300005844 | Ga0068862_100260760 | Ga0068862_1002607602 | 159 |
| 109 | 3300005844 | Ga0068862_100636813 | Ga0068862_1006368132 | 159 |
| 110 | 3300005844 | Ga0068862_100657343 | Ga0068862_1006573432 | 159 |
| 111 | 3300005844 | Ga0068862_100746979 | Ga0068862_1007469791 | 159 |
| 112 | 3300006163 | Ga0070715_10045399 | Ga0070715_100453992 | 159 |
| 113 | 3300006163 | Ga0070715_10059729 | Ga0070715_100597292 | 159 |
| 114 | 3300006163 | Ga0070715_10370458 | Ga0070715_103704582 | 159 |
| 115 | 3300006173 | Ga0070716_100520649 | Ga0070716_1005206492 | 159 |
| 116 | 3300006173 | Ga0070716_100865244 | Ga0070716_1008652442 | 159 |
| 117 | 3300006237 | Ga0097621_100000125 | Ga0097621_10000012526 | 159 |
| 118 | 3300006237 | Ga0097621_100014893 | Ga0097621_1000148933 | 159 |
| 119 | 3300006237 | Ga0097621_100017310 | Ga0097621_1000173103 | 159 |
| 120 | 3300006237 | Ga0097621_100113414 | Ga0097621_1001134143 | 159 |
| 121 | 3300006358 | Ga0068871_100000134 | Ga0068871_10000013437 | 159 |
| 122 | 3300006358 | Ga0068871_100005587 | Ga0068871_1000055873 | 159 |
| 123 | 3300006358 | Ga0068871_100039886 | Ga0068871_1000398863 | 159 |
| 124 | 3300006358 | Ga0068871_100149927 | Ga0068871_1001499272 | 159 |
| 125 | 3300006358 | Ga0068871_100291605 | Ga0068871_1002916052 | 159 |
| 126 | 3300006844 | Ga0075428_100000497 | Ga0075428_10000049722 | 159 |
| 127 | 3300006847 | Ga0075431_100199916 | Ga0075431_1001999162 | 159 |
| 128 | 3300006852 | Ga0075433_10177266 | Ga0075433_101772662 | 159 |
| 129 | 3300006852 | Ga0075433_10467641 | Ga0075433_104676412 | 159 |
| 130 | 3300006852 | Ga0075433_11039815 | Ga0075433_110398152 | 159 |
| 131 | 3300006871 | Ga0075434_100005743 | Ga0075434_1000057434 | 159 |
| 132 | 3300006871 | Ga0075434_100082673 | Ga0075434_1000826733 | 159 |
| 133 | 3300006881 | Ga0068865_100030248 | Ga0068865_1000302482 | 159 |
| 134 | 3300006881 | Ga0068865_100145708 | Ga0068865_1001457082 | 159 |
| 135 | 3300006881 | Ga0068865_100189475 | Ga0068865_1001894753 | 159 |
| 136 | 3300006881 | Ga0068865_100576003 | Ga0068865_1005760031 | 159 |
| 137 | 3300006914 | Ga0075436_100084710 | Ga0075436_1000847103 | 159 |
| 138 | 3300006931 | Ga0097620_100208383 | Ga0097620_1002083832 | 159 |
| 139 | 3300007076 | Ga0075435_100065934 | Ga0075435_1000659343 | 159 |
| 140 | 3300007076 | Ga0075435_100509157 | Ga0075435_1005091572 | 159 |
| 141 | 3300009093 | Ga0105240_10170233 | Ga0105240_101702333 | 159 |
| 142 | 3300009094 | Ga0111539_10000014 | Ga0111539_10000014141 | 159 |
| 143 | 3300009094 | Ga0111539_10004027 | Ga0111539_100040279 | 159 |
| 144 | 3300009094 | Ga0111539_10018505 | Ga0111539_100185055 | 159 |
| 145 | 3300009094 | Ga0111539_10806024 | Ga0111539_108060241 | 159 |
| 146 | 3300009098 | Ga0105245_10518549 | Ga0105245_105185492 | 159 |
| 147 | 3300009147 | Ga0114129_11160523 | Ga0114129_111605231 | 159 |
| 148 | 3300009148 | Ga0105243_10010791 | Ga0105243_100107912 | 159 |
| 149 | 3300009148 | Ga0105243_10089689 | Ga0105243_100896893 | 159 |
| 150 | 3300009174 | Ga0105241_11892246 | Ga0105241_118922461 | 159 |
| 151 | 3300009176 | Ga0105242_10026817 | Ga0105242_100268174 | 159 |
| 152 | 3300009176 | Ga0105242_10268432 | Ga0105242_102684322 | 159 |
| 153 | 3300009176 | Ga0105242_10665893 | Ga0105242_106658931 | 159 |
| 154 | 3300009177 | Ga0105248_10200910 | Ga0105248_102009102 | 159 |
| 155 | 3300009177 | Ga0105248_10411347 | Ga0105248_104113472 | 159 |
| 156 | 3300009177 | Ga0105248_12175856 | Ga0105248_121758562 | 159 |
| 157 | 3300009551 | Ga0105238_10036372 | Ga0105238_100363722 | 159 |
| 158 | 3300009551 | Ga0105238_10251909 | Ga0105238_102519091 | 159 |
| 159 | 3300009551 | Ga0105238_11837913 | Ga0105238_118379131 | 159 |
| 160 | 3300009553 | Ga0105249_10025255 | Ga0105249_100252554 | 159 |
| 161 | 3300009553 | Ga0105249_10293297 | Ga0105249_102932972 | 159 |
| 162 | 3300010375 | Ga0105239_10699477 | Ga0105239_106994772 | 159 |
| 163 | 3300013104 | Ga0157370_10733794 | Ga0157370_107337941 | 159 |
| 164 | 3300013296 | Ga0157374_10443606 | Ga0157374_104436061 | 159 |
| 165 | 3300013297 | Ga0157378_10009109 | Ga0157378_100091092 | 159 |
| 166 | 3300013297 | Ga0157378_10144928 | Ga0157378_101449282 | 159 |
| 167 | 3300013306 | Ga0163162_10186185 | Ga0163162_101861852 | 159 |
| 168 | 3300013308 | Ga0157375_11224686 | Ga0157375_112246862 | 159 |
| 169 | 3300014325 | Ga0163163_11872649 | Ga0163163_118726492 | 159 |
| 170 | 3300014325 | Ga0163163_12172974 | Ga0163163_121729741 | 159 |
| 171 | 3300014326 | Ga0157380_10008813 | Ga0157380_100088136 | 159 |
| 172 | 3300014326 | Ga0157380_10417166 | Ga0157380_104171662 | 159 |
| 173 | 3300014326 | Ga0157380_11772989 | Ga0157380_117729891 | 159 |
| 174 | 3300014968 | Ga0157379_10304951 | Ga0157379_103049512 | 159 |
| 175 | 3300014969 | Ga0157376_10024569 | Ga0157376_100245696 | 159 |
| 176 | 3300014969 | Ga0157376_10024693 | Ga0157376_100246933 | 159 |
| 177 | 3300014969 | Ga0157376_10823342 | Ga0157376_108233422 | 159 |
| 178 | 3300014969 | Ga0157376_11082052 | Ga0157376_110820521 | 159 |
| 179 | 3300017792 | Ga0163161_10279799 | Ga0163161_102797992 | 159 |
| 180 | 3300025315 | Ga0207697_10024138 | Ga0207697_100241383 | 159 |
| 181 | 3300025315 | Ga0207697_10274146 | Ga0207697_102741462 | 159 |
| 182 | 3300025885 | Ga0207653_10093372 | Ga0207653_100933722 | 159 |
| 183 | 3300025893 | Ga0207682_10052586 | Ga0207682_100525862 | 159 |
| 184 | 3300025893 | Ga0207682_10089494 | Ga0207682_100894942 | 159 |
| 185 | 3300025898 | Ga0207692_10397454 | Ga0207692_103974542 | 159 |
| 186 | 3300025899 | Ga0207642_10101553 | Ga0207642_101015532 | 159 |
| 187 | 3300025903 | Ga0207680_10132754 | Ga0207680_101327542 | 159 |
| 188 | 3300025905 | Ga0207685_10174223 | Ga0207685_101742232 | 159 |
| 189 | 3300025906 | Ga0207699_10026366 | Ga0207699_100263662 | 159 |
| 190 | 3300025907 | Ga0207645_10001406 | Ga0207645_100014063 | 159 |
| 191 | 3300025907 | Ga0207645_10065309 | Ga0207645_100653093 | 159 |
| 192 | 3300025907 | Ga0207645_10142585 | Ga0207645_101425852 | 159 |
| 193 | 3300025910 | Ga0207684_10180841 | Ga0207684_101808412 | 159 |
| 194 | 3300025910 | Ga0207684_10189929 | Ga0207684_101899292 | 159 |
| 195 | 3300025912 | Ga0207707_10331947 | Ga0207707_103319472 | 159 |
| 196 | 3300025915 | Ga0207693_10488325 | Ga0207693_104883252 | 159 |
| 197 | 3300025920 | Ga0207649_10727068 | Ga0207649_107270681 | 159 |
| 198 | 3300025921 | Ga0207652_10360643 | Ga0207652_103606432 | 159 |
| 199 | 3300025923 | Ga0207681_10025121 | Ga0207681_100251212 | 159 |
| 200 | 3300025923 | Ga0207681_10146109 | Ga0207681_101461092 | 159 |
| 201 | 3300025924 | Ga0207694_10142401 | Ga0207694_101424012 | 159 |
| 202 | 3300025925 | Ga0207650_10084901 | Ga0207650_100849012 | 159 |
| 203 | 3300025926 | Ga0207659_10136365 | Ga0207659_101363652 | 159 |
| 204 | 3300025926 | Ga0207659_10193963 | Ga0207659_101939632 | 159 |
| 205 | 3300025927 | Ga0207687_10124628 | Ga0207687_101246283 | 159 |
| 206 | 3300025928 | Ga0207700_10005583 | Ga0207700_100055833 | 159 |
| 207 | 3300025928 | Ga0207700_10279505 | Ga0207700_102795052 | 159 |
| 208 | 3300025928 | Ga0207700_10438202 | Ga0207700_104382022 | 159 |
| 209 | 3300025929 | Ga0207664_10139643 | Ga0207664_101396432 | 159 |
| 210 | 3300025933 | Ga0207706_10129500 | Ga0207706_101295003 | 159 |
| 211 | 3300025933 | Ga0207706_10167166 | Ga0207706_101671661 | 159 |
| 212 | 3300025933 | Ga0207706_10388096 | Ga0207706_103880962 | 159 |
| 213 | 3300025934 | Ga0207686_10049693 | Ga0207686_100496932 | 159 |
| 214 | 3300025934 | Ga0207686_10238381 | Ga0207686_102383812 | 159 |
| 215 | 3300025934 | Ga0207686_10242409 | Ga0207686_102424093 | 159 |
| 216 | 3300025935 | Ga0207709_10004795 | Ga0207709_100047952 | 159 |
| 217 | 3300025935 | Ga0207709_10307838 | Ga0207709_103078381 | 159 |
| 218 | 3300025936 | Ga0207670_10341404 | Ga0207670_103414042 | 159 |
| 219 | 3300025937 | Ga0207669_10029033 | Ga0207669_100290333 | 159 |
| 220 | 3300025937 | Ga0207669_10380953 | Ga0207669_103809531 | 159 |
| 221 | 3300025938 | Ga0207704_10101794 | Ga0207704_101017942 | 159 |
| 222 | 3300025938 | Ga0207704_10141205 | Ga0207704_101412052 | 159 |
| 223 | 3300025939 | Ga0207665_10553627 | Ga0207665_105536272 | 159 |
| 224 | 3300025939 | Ga0207665_10852006 | Ga0207665_108520062 | 159 |
| 225 | 3300025940 | Ga0207691_10176973 | Ga0207691_101769732 | 159 |
| 226 | 3300025940 | Ga0207691_10353247 | Ga0207691_103532472 | 159 |
| 227 | 3300025941 | Ga0207711_10036902 | Ga0207711_100369023 | 159 |
| 228 | 3300025941 | Ga0207711_10589809 | Ga0207711_105898092 | 159 |
| 229 | 3300025941 | Ga0207711_10821846 | Ga0207711_108218462 | 159 |
| 230 | 3300025941 | Ga0207711_10920258 | Ga0207711_109202581 | 159 |
| 231 | 3300025942 | Ga0207689_10240049 | Ga0207689_102400492 | 159 |
| 232 | 3300025944 | Ga0207661_10098786 | Ga0207661_100987863 | 159 |
| 233 | 3300025944 | Ga0207661_10106732 | Ga0207661_101067322 | 159 |
| 234 | 3300025949 | Ga0207667_11025418 | Ga0207667_110254182 | 159 |
| 235 | 3300025960 | Ga0207651_10110003 | Ga0207651_101100032 | 159 |
| 236 | 3300025960 | Ga0207651_10185688 | Ga0207651_101856883 | 159 |
| 237 | 3300025972 | Ga0207668_10085374 | Ga0207668_100853742 | 159 |
| 238 | 3300026023 | Ga0207677_10065710 | Ga0207677_100657103 | 159 |
| 239 | 3300026075 | Ga0207708_10004337 | Ga0207708_100043372 | 159 |
| 240 | 3300026075 | Ga0207708_10115449 | Ga0207708_101154492 | 159 |
| 241 | 3300026075 | Ga0207708_10231410 | Ga0207708_102314101 | 159 |
| 242 | 3300026088 | Ga0207641_10790080 | Ga0207641_107900802 | 159 |
| 243 | 3300026088 | Ga0207641_11598577 | Ga0207641_115985772 | 159 |
| 244 | 3300026089 | Ga0207648_10002536 | Ga0207648_100025362 | 159 |
| 245 | 3300026089 | Ga0207648_10092785 | Ga0207648_100927853 | 159 |
| 246 | 3300026089 | Ga0207648_10099685 | Ga0207648_100996852 | 159 |
| 247 | 3300026089 | Ga0207648_11322834 | Ga0207648_113228342 | 159 |
| 248 | 3300026095 | Ga0207676_10180475 | Ga0207676_101804752 | 159 |
| 249 | 3300026118 | Ga0207675_100116172 | Ga0207675_1001161722 | 159 |
| 250 | 3300026118 | Ga0207675_100595480 | Ga0207675_1005954802 | 159 |
| 251 | 3300026121 | Ga0207683_10157417 | Ga0207683_101574172 | 159 |
| 252 | 3300026121 | Ga0207683_10433160 | Ga0207683_104331602 | 159 |
| 253 | 3300027876 | Ga0209974_10063480 | Ga0209974_100634802 | 159 |
| 254 | 3300027907 | Ga0207428_10000005 | Ga0207428_10000005105 | 159 |
| 255 | 3300027907 | Ga0207428_10003214 | Ga0207428_1000321412 | 159 |
| 256 | 3300027907 | Ga0207428_10032828 | Ga0207428_100328284 | 159 |
| 257 | 3300028379 | Ga0268266_10076315 | Ga0268266_100763153 | 159 |
| 258 | 3300028379 | Ga0268266_10400322 | Ga0268266_104003222 | 159 |
| 259 | 3300028380 | Ga0268265_10080399 | Ga0268265_100803991 | 159 |
| 260 | 3300028380 | Ga0268265_10151383 | Ga0268265_101513832 | 159 |
| 261 | 3300028380 | Ga0268265_10192637 | Ga0268265_101926372 | 159 |
| 262 | 3300028380 | Ga0268265_10533288 | Ga0268265_105332881 | 159 |
| 263 | 3300028381 | Ga0268264_10473607 | Ga0268264_104736072 | 159 |
| 264 | 3300031548 | Ga0307408_100392206 | Ga0307408_1003922062 | 159 |
| 265 | 3300031711 | Ga0265314_10033286 | Ga0265314_100332862 | 159 |
| 266 | 3300031731 | Ga0307405_10482364 | Ga0307405_104823642 | 159 |
| 267 | 3300031852 | Ga0307410_10116868 | Ga0307410_101168682 | 159 |
| 268 | 3300032005 | Ga0307411_10435962 | Ga0307411_104359621 | 159 |
| 269 | 3300035111 | Ga0373923_0079124 | Ga0373923_0079124_487_987 | 159 |
| 270 | 3300035117 | Ga0373953_0220071 | Ga0373953_0220071_113_613 | 159 |
| 271 | 3300035118 | Ga0373954_0051964 | Ga0373954_0051964_694_1194 | 159 |
| 272 | 3300035118 | Ga0373954_0184461 | Ga0373954_0184461_86_586 | 159 |
| 273 | 3300035170 | Ga0373943_0021226 | Ga0373943_0021226_2227_2727 | 159 |
| 274 | 3300035170 | Ga0373943_0217615 | Ga0373943_0217615_147_641 | 159 |
| 275 | 3300035171 | Ga0373946_0029315 | Ga0373946_0029315_1655_2155 | 159 |
| 276 | 3300035171 | Ga0373946_0318098 | Ga0373946_0318098_34_528 | 159 |
| 277 | 3300035172 | Ga0373955_0003019 | Ga0373955_0003019_1404_1904 | 159 |
| 278 | 3300035172 | Ga0373955_0076519 | Ga0373955_0076519_798_1292 | 159 |
| 279 | 3300035692 | Ga0373935_0083599 | Ga0373935_0083599_305_805 | 159 |
| 280 | 3300035692 | Ga0373935_0164017 | Ga0373935_0164017_217_717 | 159 |
| 281 | 3300035695 | Ga0373927_0155381 | Ga0373927_0155381_488_988 | 159 |
| 282 | 3300035724 | Ga0373933_0418322 | Ga0373933_0418322_275_775 | 159 |
| 283 | 3300035725 | Ga0373947_0003818 | Ga0373947_0003818_4437_4937 | 159 |
| 284 | 3300036401 | Ga0373937_0381356 | Ga0373937_0381356_807_1307 | 159 |
| 285 | 3300036401 | Ga0373937_0393320 | Ga0373937_0393320_105_605 | 159 |
| 286 | 3300036401 | Ga0373937_1823949 | Ga0373937_1823949_30_530 | 159 |
| 287 | 3300037068 | Ga0373925_0266622 | Ga0373925_0266622_278_772 | 159 |
| 288 | 3300037068 | Ga0373925_0542746 | Ga0373925_0542746_30_530 | 159 |
| 289 | 3300039437 | Ga0436365_0956175 | Ga0436365_0956175_1136_1639 | 159 |
| 290 | 3300042130 | Ga0450892_007492 | Ga0450892_007492_323_814 | 159 |
| 291 | 3300042435 | Ga0439434_0099914 | Ga0439434_0099914_261_752 | 159 |
| 292 | 3300042436 | Ga0439435_0052341 | Ga0439435_0052341_657_1151 | 159 |
| 293 | 3300042436 | Ga0439435_0069724 | Ga0439435_0069724_513_1004 | 159 |
| 294 | 3300044842 | Ga0466957_0155932 | Ga0466957_0155932_103_609 | 159 |
| 295 | 3300045051 | Ga0451576_0003703 | Ga0451576_0003703_13618_14103 | 159 |
| 296 | 3300045976 | Ga0466967_0493469 | Ga0466967_0493469_180_668 | 159 |
| 297 | 3300046454 | Ga0495592_0025040 | Ga0495592_0025040_1570_2070 | 159 |
| 298 | 3300046455 | Ga0495603_0358636 | Ga0495603_0358636_278_781 | 159 |
| 299 | 3300046473 | Ga0495582_0181798 | Ga0495582_0181798_398_898 | 159 |
| 300 | 3300046477 | Ga0495664_0171598 | Ga0495664_0171598_244_738 | 159 |
| 301 | 3300046477 | Ga0495664_0296679 | Ga0495664_0296679_187_687 | 159 |
| 302 | 3300046499 | Ga0495594_0252872 | Ga0495594_0252872_478_978 | 159 |
| 303 | 3300046511 | Ga0495608_0003942 | Ga0495608_0003942_10090_10590 | 159 |
| 304 | 3300046514 | Ga0495618_0086045 | Ga0495618_0086045_931_1431 | 159 |
| 305 | 3300046517 | Ga0495630_0009709 | Ga0495630_0009709_5295_5795 | 159 |
| 306 | 3300046529 | Ga0495652_0245893 | Ga0495652_0245893_349_849 | 159 |
| 307 | 3300046531 | Ga0495665_0483848 | Ga0495665_0483848_37_537 | 159 |
| 308 | 3300046533 | Ga0495640_0078023 | Ga0495640_0078023_236_736 | 159 |
| 309 | 3300046536 | Ga0495587_0051732 | Ga0495587_0051732_1833_2333 | 159 |
| 310 | 3300046539 | Ga0495621_0037939 | Ga0495621_0037939_405_905 | 159 |
| 311 | 3300046559 | Ga0495667_0040064 | Ga0495667_0040064_57_557 | 159 |
| 312 | 3300046642 | Ga0495634_0081249 | Ga0495634_0081249_1160_1660 | 159 |
| 313 | 3300046642 | Ga0495634_0326616 | Ga0495634_0326616_318_818 | 159 |
| 314 | 3300046642 | Ga0495634_0422055 | Ga0495634_0422055_240_743 | 159 |
| 315 | 3300046663 | Ga0495635_0088667 | Ga0495635_0088667_202_696 | 159 |
| 316 | 3300046679 | Ga0495623_0047499 | Ga0495623_0047499_1529_2029 | 159 |
| 317 | 3300046681 | Ga0495647_0214209 | Ga0495647_0214209_31_534 | 159 |
| 318 | 3300046684 | Ga0495669_0004081 | Ga0495669_0004081_4045_4548 | 159 |
| 319 | 3300046684 | Ga0495669_0007347 | Ga0495669_0007347_2509_3009 | 159 |
| 320 | 3300046684 | Ga0495669_0333198 | Ga0495669_0333198_22_576 | 159 |
| 321 | 3300046689 | Ga0495613_0001676 | Ga0495613_0001676_8233_8733 | 159 |
| 322 | 3300046809 | Ga0495600_0332280 | Ga0495600_0332280_92_592 | 159 |
| 323 | 3300047319 | Ga0495674_0233224 | Ga0495674_0233224_78_578 | 159 |
| 324 | 3300047444 | Ga0495675_0452837 | Ga0495675_0452837_25_525 | 159 |
| 325 | 3300047471 | Ga0495684_0002679 | Ga0495684_0002679_12160_12660 | 159 |
| 326 | 3300048088 | Ga0495602_0401247 | Ga0495602_0401247_425_925 | 159 |
| 327 | 3300048903 | Ga0496100_0005315 | Ga0496100_0005315_4754_5254 | 159 |
| 328 | 3300048904 | Ga0496101_0000338 | Ga0496101_0000338_1159_1659 | 159 |
| 329 | 3300048904 | Ga0496101_0504818 | Ga0496101_0504818_11_511 | 159 |
| 330 | 3300048905 | Ga0496102_0120104 | Ga0496102_0120104_587_1087 | 159 |
| 331 | 3300048907 | Ga0496104_0011885 | Ga0496104_0011885_614_1114 | 159 |
| 332 | 3300048907 | Ga0496104_0063755 | Ga0496104_0063755_2984_3484 | 159 |
| 333 | 3300048907 | Ga0496104_0791916 | Ga0496104_0791916_71_571 | 159 |
| 334 | 3300048908 | Ga0496105_0027444 | Ga0496105_0027444_485_985 | 159 |
| 335 | 3300048908 | Ga0496105_0263662 | Ga0496105_0263662_463_963 | 159 |
| 336 | 3300048910 | Ga0496107_0007329 | Ga0496107_0007329_6624_7124 | 159 |
| 337 | 3300048917 | Ga0496114_0001212 | Ga0496114_0001212_15311_15811 | 159 |
| 338 | 3300048917 | Ga0496114_0222524 | Ga0496114_0222524_730_1230 | 159 |
| 339 | 3300049576 | Ga0501040_0422137 | Ga0501040_0422137_442_933 | 159 |
| 340 | 3300049576 | Ga0501040_0617110 | Ga0501040_0617110_262_756 | 159 |
| 341 | 3300050511 | nmdc:mga08y16_352547_c1 | nmdc:mga08y16_352547_c1_654_1154 | 159 |
| 342 | 3300050511 | nmdc:mga08y16_4998_c1 | nmdc:mga08y16_4998_c1_2078_2584 | 159 |
| 343 | 3300050511 | nmdc:mga08y16_9_c1 | nmdc:mga08y16_9_c1_433241_433732 | 159 |
| 344 | 3300050512 | nmdc:mga0n895_472679_c1 | nmdc:mga0n895_472679_c1_593_1084 | 159 |
| 345 | 3300050512 | nmdc:mga0n895_72372_c1 | nmdc:mga0n895_72372_c1_1308_1823 | 159 |
| 346 | 3300050513 | nmdc:mga0rr50_682119_c1 | nmdc:mga0rr50_682119_c1_124_627 | 159 |
| 347 | 3300050513 | nmdc:mga0rr50_761091_c1 | nmdc:mga0rr50_761091_c1_245_736 | 159 |
| 348 | 3300050514 | nmdc:mga08x19_416343_c1 | nmdc:mga08x19_416343_c1_112_603 | 159 |
| 349 | 3300050515 | nmdc:mga0a205_112707_c2 | nmdc:mga0a205_112707_c2_1031_1540 | 159 |
| 350 | 3300050515 | nmdc:mga0a205_120196_c1 | nmdc:mga0a205_120196_c1_1687_2187 | 159 |
| 351 | 3300050515 | nmdc:mga0a205_167404_c1 | nmdc:mga0a205_167404_c1_1530_2045 | 159 |
| 352 | 3300050515 | nmdc:mga0a205_370522_c1 | nmdc:mga0a205_370522_c1_666_1157 | 159 |
| 353 | 3300053077 | Ga0495601_0003730 | Ga0495601_0003730_7591_8091 | 159 |
| 354 | 3300053077 | Ga0495601_0068407 | Ga0495601_0068407_319_813 | 159 |
| 355 | 3300053084 | Ga0495595_0405849 | Ga0495595_0405849_33_533 | 159 |
| 356 | 3300053085 | Ga0495619_0006567 | Ga0495619_0006567_6126_6626 | 159 |
| 357 | 3300053085 | Ga0495619_0280366 | Ga0495619_0280366_206_706 | 159 |
| 358 | 3300005356 | Ga0070674_101447295 | Ga0070674_1014472951 | 160 |
| 359 | 3300005455 | Ga0070663_100878596 | Ga0070663_1008785962 | 160 |
| 360 | 3300005548 | Ga0070665_100950167 | Ga0070665_1009501671 | 160 |
| 361 | 3300005563 | Ga0068855_100450881 | Ga0068855_1004508812 | 160 |
| 362 | 3300005614 | Ga0068856_101950599 | Ga0068856_1019505991 | 160 |
| 363 | 3300009093 | Ga0105240_10037691 | Ga0105240_100376914 | 160 |
| 364 | 3300009147 | Ga0114129_10009181 | Ga0114129_100091813 | 160 |
| 365 | 3300014326 | Ga0157380_10018744 | Ga0157380_100187445 | 160 |
| 366 | 3300025893 | Ga0207682_10093133 | Ga0207682_100931332 | 160 |
| 367 | 3300025913 | Ga0207695_10151584 | Ga0207695_101515842 | 160 |
| 368 | 3300025926 | Ga0207659_10001629 | Ga0207659_100016293 | 160 |
| 369 | 3300025937 | Ga0207669_11210408 | Ga0207669_112104081 | 160 |
| 370 | 3300025949 | Ga0207667_10866185 | Ga0207667_108661852 | 160 |
| 371 | 3300026067 | Ga0207678_10292250 | Ga0207678_102922502 | 160 |
| 372 | 3300026121 | Ga0207683_11146007 | Ga0207683_111460071 | 160 |
| 373 | 3300035170 | Ga0373943_0185733 | Ga0373943_0185733_534_1022 | 160 |
| 374 | 3300037418 | Ga0395900_0459263 | Ga0395900_0459263_82_570 | 160 |
| 375 | 3300037471 | Ga0395905_0197773 | Ga0395905_0197773_504_992 | 160 |
| 376 | 3300005288 | Ga0065714_10083408 | Ga0065714_100834081 | 161 |
| 377 | 3300005290 | Ga0065712_10099576 | Ga0065712_100995762 | 161 |
| 378 | 3300005290 | Ga0065712_10149758 | Ga0065712_101497582 | 161 |
| 379 | 3300005290 | Ga0065712_10319358 | Ga0065712_103193581 | 161 |
| 380 | 3300005293 | Ga0065715_10103959 | Ga0065715_101039592 | 161 |
| 381 | 3300005293 | Ga0065715_10146880 | Ga0065715_101468802 | 161 |
| 382 | 3300005293 | Ga0065715_10236028 | Ga0065715_102360282 | 161 |
| 383 | 3300005328 | Ga0070676_10331366 | Ga0070676_103313662 | 161 |
| 384 | 3300005329 | Ga0070683_100024470 | Ga0070683_1000244703 | 161 |
| 385 | 3300005330 | Ga0070690_100166363 | Ga0070690_1001663632 | 161 |
| 386 | 3300005331 | Ga0070670_100026375 | Ga0070670_1000263753 | 161 |
| 387 | 3300005335 | Ga0070666_10196882 | Ga0070666_101968822 | 161 |
| 388 | 3300005338 | Ga0068868_100034955 | Ga0068868_1000349553 | 161 |
| 389 | 3300005339 | Ga0070660_100441529 | Ga0070660_1004415291 | 161 |
| 390 | 3300005340 | Ga0070689_100215050 | Ga0070689_1002150502 | 161 |
| 391 | 3300005340 | Ga0070689_100340128 | Ga0070689_1003401283 | 161 |
| 392 | 3300005343 | Ga0070687_100038743 | Ga0070687_1000387432 | 161 |
| 393 | 3300005344 | Ga0070661_100265127 | Ga0070661_1002651272 | 161 |
| 394 | 3300005353 | Ga0070669_100092083 | Ga0070669_1000920832 | 161 |
| 395 | 3300005353 | Ga0070669_100162925 | Ga0070669_1001629252 | 161 |
| 396 | 3300005354 | Ga0070675_100022727 | Ga0070675_1000227272 | 161 |
| 397 | 3300005364 | Ga0070673_100208212 | Ga0070673_1002082122 | 161 |
| 398 | 3300005365 | Ga0070688_100060927 | Ga0070688_1000609272 | 161 |
| 399 | 3300005365 | Ga0070688_100098261 | Ga0070688_1000982612 | 161 |
| 400 | 3300005366 | Ga0070659_100197547 | Ga0070659_1001975472 | 161 |
| 401 | 3300005367 | Ga0070667_100587289 | Ga0070667_1005872892 | 161 |
| 402 | 3300005436 | Ga0070713_101253314 | Ga0070713_1012533141 | 161 |
| 403 | 3300005436 | Ga0070713_101716902 | Ga0070713_1017169021 | 161 |
| 404 | 3300005444 | Ga0070694_100502706 | Ga0070694_1005027061 | 161 |
| 405 | 3300005456 | Ga0070678_100130775 | Ga0070678_1001307752 | 161 |
| 406 | 3300005457 | Ga0070662_100593270 | Ga0070662_1005932702 | 161 |
| 407 | 3300005466 | Ga0070685_10197670 | Ga0070685_101976701 | 161 |
| 408 | 3300005535 | Ga0070684_100076110 | Ga0070684_1000761103 | 161 |
| 409 | 3300005543 | Ga0070672_100157158 | Ga0070672_1001571582 | 161 |
| 410 | 3300005544 | Ga0070686_100537386 | Ga0070686_1005373861 | 161 |
| 411 | 3300005546 | Ga0070696_100587157 | Ga0070696_1005871572 | 161 |
| 412 | 3300005547 | Ga0070693_100759909 | Ga0070693_1007599091 | 161 |
| 413 | 3300005548 | Ga0070665_100002502 | Ga0070665_10000250221 | 161 |
| 414 | 3300005549 | Ga0070704_101267826 | Ga0070704_1012678261 | 161 |
| 415 | 3300005577 | Ga0068857_100136211 | Ga0068857_1001362112 | 161 |
| 416 | 3300005577 | Ga0068857_100639122 | Ga0068857_1006391222 | 161 |
| 417 | 3300005615 | Ga0070702_100357397 | Ga0070702_1003573972 | 161 |
| 418 | 3300005618 | Ga0068864_100099244 | Ga0068864_1000992442 | 161 |
| 419 | 3300005718 | Ga0068866_10009441 | Ga0068866_100094412 | 161 |
| 420 | 3300005841 | Ga0068863_101144537 | Ga0068863_1011445372 | 161 |
| 421 | 3300005842 | Ga0068858_100017044 | Ga0068858_1000170445 | 161 |
| 422 | 3300005843 | Ga0068860_100354361 | Ga0068860_1003543612 | 161 |
| 423 | 3300006237 | Ga0097621_100039658 | Ga0097621_1000396585 | 161 |
| 424 | 3300006237 | Ga0097621_100643048 | Ga0097621_1006430482 | 161 |
| 425 | 3300006358 | Ga0068871_100063808 | Ga0068871_1000638082 | 161 |
| 426 | 3300006358 | Ga0068871_100146031 | Ga0068871_1001460313 | 161 |
| 427 | 3300006844 | Ga0075428_100245232 | Ga0075428_1002452321 | 161 |
| 428 | 3300006844 | Ga0075428_100310045 | Ga0075428_1003100452 | 161 |
| 429 | 3300006846 | Ga0075430_100001681 | Ga0075430_10000168114 | 161 |
| 430 | 3300006846 | Ga0075430_100013822 | Ga0075430_1000138224 | 161 |
| 431 | 3300006846 | Ga0075430_100028057 | Ga0075430_1000280577 | 161 |
| 432 | 3300006847 | Ga0075431_100001219 | Ga0075431_1000012195 | 161 |
| 433 | 3300006847 | Ga0075431_100079466 | Ga0075431_1000794665 | 161 |
| 434 | 3300006847 | Ga0075431_100486414 | Ga0075431_1004864142 | 161 |
| 435 | 3300006847 | Ga0075431_100830336 | Ga0075431_1008303362 | 161 |
| 436 | 3300006852 | Ga0075433_11078459 | Ga0075433_110784592 | 161 |
| 437 | 3300006871 | Ga0075434_100192229 | Ga0075434_1001922292 | 161 |
| 438 | 3300006880 | Ga0075429_100019963 | Ga0075429_1000199635 | 161 |
| 439 | 3300006880 | Ga0075429_100096081 | Ga0075429_1000960813 | 161 |
| 440 | 3300006880 | Ga0075429_100122343 | Ga0075429_1001223432 | 161 |
| 441 | 3300006880 | Ga0075429_100266863 | Ga0075429_1002668632 | 161 |
| 442 | 3300006881 | Ga0068865_100834735 | Ga0068865_1008347351 | 161 |
| 443 | 3300006914 | Ga0075436_100104286 | Ga0075436_1001042862 | 161 |
| 444 | 3300009093 | Ga0105240_10311990 | Ga0105240_103119902 | 161 |
| 445 | 3300009093 | Ga0105240_10450127 | Ga0105240_104501272 | 161 |
| 446 | 3300009094 | Ga0111539_10066788 | Ga0111539_100667882 | 161 |
| 447 | 3300009094 | Ga0111539_10097678 | Ga0111539_100976783 | 161 |
| 448 | 3300009094 | Ga0111539_10661077 | Ga0111539_106610772 | 161 |
| 449 | 3300009098 | Ga0105245_10046562 | Ga0105245_100465622 | 161 |
| 450 | 3300009147 | Ga0114129_10004137 | Ga0114129_100041375 | 161 |
| 451 | 3300009147 | Ga0114129_10009385 | Ga0114129_100093855 | 161 |
| 452 | 3300009147 | Ga0114129_10072643 | Ga0114129_100726432 | 161 |
| 453 | 3300009147 | Ga0114129_11692215 | Ga0114129_116922152 | 161 |
| 454 | 3300009147 | Ga0114129_12487459 | Ga0114129_124874591 | 161 |
| 455 | 3300009174 | Ga0105241_10568860 | Ga0105241_105688602 | 161 |
| 456 | 3300009176 | Ga0105242_10022412 | Ga0105242_100224123 | 161 |
| 457 | 3300009177 | Ga0105248_10007536 | Ga0105248_100075362 | 161 |
| 458 | 3300009177 | Ga0105248_10059992 | Ga0105248_100599922 | 161 |
| 459 | 3300009553 | Ga0105249_12262412 | Ga0105249_122624121 | 161 |
| 460 | 3300010375 | Ga0105239_10713110 | Ga0105239_107131102 | 161 |
| 461 | 3300010375 | Ga0105239_10815702 | Ga0105239_108157022 | 161 |
| 462 | 3300011119 | Ga0105246_10868449 | Ga0105246_108684492 | 161 |
| 463 | 3300013296 | Ga0157374_10083773 | Ga0157374_100837732 | 161 |
| 464 | 3300013296 | Ga0157374_10104979 | Ga0157374_101049792 | 161 |
| 465 | 3300013296 | Ga0157374_11656934 | Ga0157374_116569341 | 161 |
| 466 | 3300013306 | Ga0163162_10559856 | Ga0163162_105598562 | 161 |
| 467 | 3300013308 | Ga0157375_10340654 | Ga0157375_103406542 | 161 |
| 468 | 3300013308 | Ga0157375_10658352 | Ga0157375_106583522 | 161 |
| 469 | 3300014325 | Ga0163163_10006091 | Ga0163163_100060915 | 161 |
| 470 | 3300014326 | Ga0157380_11418633 | Ga0157380_114186331 | 161 |
| 471 | 3300014968 | Ga0157379_10030765 | Ga0157379_100307653 | 161 |
| 472 | 3300014969 | Ga0157376_10086620 | Ga0157376_100866203 | 161 |
| 473 | 3300014969 | Ga0157376_10366170 | Ga0157376_103661702 | 161 |
| 474 | 3300025321 | Ga0207656_10097732 | Ga0207656_100977322 | 161 |
| 475 | 3300025899 | Ga0207642_10036643 | Ga0207642_100366432 | 161 |
| 476 | 3300025903 | Ga0207680_10023105 | Ga0207680_100231054 | 161 |
| 477 | 3300025911 | Ga0207654_10301123 | Ga0207654_103011232 | 161 |
| 478 | 3300025913 | Ga0207695_10360308 | Ga0207695_103603082 | 161 |
| 479 | 3300025918 | Ga0207662_10015889 | Ga0207662_100158893 | 161 |
| 480 | 3300025919 | Ga0207657_10144559 | Ga0207657_101445592 | 161 |
| 481 | 3300025920 | Ga0207649_10075530 | Ga0207649_100755302 | 161 |
| 482 | 3300025923 | Ga0207681_10022038 | Ga0207681_100220384 | 161 |
| 483 | 3300025925 | Ga0207650_10121252 | Ga0207650_101212523 | 161 |
| 484 | 3300025926 | Ga0207659_10097120 | Ga0207659_100971202 | 161 |
| 485 | 3300025932 | Ga0207690_10159647 | Ga0207690_101596472 | 161 |
| 486 | 3300025933 | Ga0207706_10418896 | Ga0207706_104188961 | 161 |
| 487 | 3300025934 | Ga0207686_10012850 | Ga0207686_100128503 | 161 |
| 488 | 3300025936 | Ga0207670_10093752 | Ga0207670_100937522 | 161 |
| 489 | 3300025936 | Ga0207670_10803123 | Ga0207670_108031231 | 161 |
| 490 | 3300025937 | Ga0207669_10807414 | Ga0207669_108074141 | 161 |
| 491 | 3300025940 | Ga0207691_10428238 | Ga0207691_104282382 | 161 |
| 492 | 3300025941 | Ga0207711_10057589 | Ga0207711_100575892 | 161 |
| 493 | 3300025944 | Ga0207661_10396865 | Ga0207661_103968652 | 161 |
| 494 | 3300025949 | Ga0207667_10451829 | Ga0207667_104518292 | 161 |
| 495 | 3300026035 | Ga0207703_10018977 | Ga0207703_100189772 | 161 |
| 496 | 3300026041 | Ga0207639_10200242 | Ga0207639_102002423 | 161 |
| 497 | 3300026075 | Ga0207708_10227810 | Ga0207708_102278101 | 161 |
| 498 | 3300026075 | Ga0207708_10289983 | Ga0207708_102899832 | 161 |
| 499 | 3300026089 | Ga0207648_10281533 | Ga0207648_102815333 | 161 |
| 500 | 3300026095 | Ga0207676_10525687 | Ga0207676_105256872 | 161 |
| 501 | 3300026116 | Ga0207674_10061584 | Ga0207674_100615843 | 161 |
| 502 | 3300026116 | Ga0207674_10656898 | Ga0207674_106568982 | 161 |
| 503 | 3300026121 | Ga0207683_10688106 | Ga0207683_106881062 | 161 |
| 504 | 3300026121 | Ga0207683_11067291 | Ga0207683_110672912 | 161 |
| 505 | 3300027907 | Ga0207428_10630272 | Ga0207428_106302721 | 161 |
| 506 | 3300028379 | Ga0268266_10148463 | Ga0268266_101484632 | 161 |
| 507 | 3300028381 | Ga0268264_10282422 | Ga0268264_102824222 | 161 |
| 508 | 3300031731 | Ga0307405_10133043 | Ga0307405_101330433 | 161 |
| 509 | 3300031824 | Ga0307413_10463454 | Ga0307413_104634542 | 161 |
| 510 | 3300031852 | Ga0307410_10079408 | Ga0307410_100794082 | 161 |
| 511 | 3300031911 | Ga0307412_10194730 | Ga0307412_101947302 | 161 |
| 512 | 3300032002 | Ga0307416_100300829 | Ga0307416_1003008292 | 161 |
| 513 | 3300032002 | Ga0307416_100374617 | Ga0307416_1003746172 | 161 |
| 514 | 3300032004 | Ga0307414_10097706 | Ga0307414_100977063 | 161 |
| 515 | 3300032005 | Ga0307411_10202710 | Ga0307411_102027102 | 161 |
| 516 | 3300032126 | Ga0307415_100668424 | Ga0307415_1006684242 | 161 |
| 517 | 3300035410 | Ga0373924_0021449 | Ga0373924_0021449_1593_2093 | 161 |
| 518 | 3300035410 | Ga0373924_0140817 | Ga0373924_0140817_536_1033 | 161 |
| 519 | 3300037068 | Ga0373925_0482653 | Ga0373925_0482653_373_870 | 161 |
| 520 | 3300037068 | Ga0373925_1199410 | Ga0373925_1199410_45_542 | 161 |
| 521 | 3300042461 | Ga0439460_0040424 | Ga0439460_0040424_276_785 | 161 |
| 522 | 3300042530 | Ga0450916_034769 | Ga0450916_034769_229_720 | 161 |
| 523 | 3300044694 | Ga0466963_0184194 | Ga0466963_0184194_297_791 | 161 |
| 524 | 3300046499 | Ga0495594_0353963 | Ga0495594_0353963_299_817 | 161 |
| 525 | 3300046533 | Ga0495640_0416169 | Ga0495640_0416169_312_809 | 161 |
| 526 | 3300046663 | Ga0495635_0053736 | Ga0495635_0053736_1980_2477 | 161 |
| 527 | 3300046691 | Ga0495670_0077989 | Ga0495670_0077989_662_1153 | 161 |
| 528 | 3300046809 | Ga0495600_0092987 | Ga0495600_0092987_1257_1790 | 161 |
| 529 | 3300048903 | Ga0496100_1547020 | Ga0496100_1547020_13_510 | 161 |
| 530 | 3300048907 | Ga0496104_0116270 | Ga0496104_0116270_1226_1723 | 161 |
| 531 | 3300048908 | Ga0496105_0522093 | Ga0496105_0522093_304_792 | 161 |
| 532 | 3300048912 | Ga0496109_0689410 | Ga0496109_0689410_233_730 | 161 |
| 533 | 3300048915 | Ga0496112_0086620 | Ga0496112_0086620_1450_1947 | 161 |
| 534 | 3300048915 | Ga0496112_0167090 | Ga0496112_0167090_614_1111 | 161 |
| 535 | 3300048915 | Ga0496112_0422774 | Ga0496112_0422774_322_819 | 161 |
| 536 | 3300048917 | Ga0496114_0084214 | Ga0496114_0084214_865_1362 | 161 |
| 537 | 3300048918 | Ga0496115_0125497 | Ga0496115_0125497_674_1171 | 161 |
| 538 | 3300049522 | Ga0501299_060055 | Ga0501299_060055_38_571 | 161 |
| 539 | 3300049587 | Ga0501071_0192495 | Ga0501071_0192495_1013_1510 | 161 |
| 540 | 3300049589 | Ga0501073_0326630 | Ga0501073_0326630_33_530 | 161 |
| 541 | 3300049592 | Ga0501076_0656617 | Ga0501076_0656617_309_806 | 161 |
| 542 | 3300049741 | Ga0501079_0669540 | Ga0501079_0669540_74_571 | 161 |
| 543 | 3300049824 | Ga0501045_0241444 | Ga0501045_0241444_660_1205 | 161 |
| 544 | 3300050507 | nmdc:mga05p37_138803_c1 | nmdc:mga05p37_138803_c1_1846_2355 | 161 |
| 545 | 3300050507 | nmdc:mga05p37_1965492_c1 | nmdc:mga05p37_1965492_c1_12_521 | 161 |
| 546 | 3300050507 | nmdc:mga05p37_23209_c1 | nmdc:mga05p37_23209_c1_5175_5684 | 161 |
| 547 | 3300050507 | nmdc:mga05p37_73083_c1 | nmdc:mga05p37_73083_c1_3273_3773 | 161 |
| 548 | 3300050508 | nmdc:mga09592_149535_c1 | nmdc:mga09592_149535_c1_692_1210 | 161 |
| 549 | 3300050508 | nmdc:mga09592_201873_c1 | nmdc:mga09592_201873_c1_153_662 | 161 |
| 550 | 3300050508 | nmdc:mga09592_38159_c1 | nmdc:mga09592_38159_c1_19_519 | 161 |
| 551 | 3300050508 | nmdc:mga09592_456600_c1 | nmdc:mga09592_456600_c1_480_992 | 161 |
| 552 | 3300050509 | nmdc:mga0qj67_245188_c1 | nmdc:mga0qj67_245188_c1_86_586 | 161 |
| 553 | 3300050509 | nmdc:mga0qj67_7153_c1 | nmdc:mga0qj67_7153_c1_67_576 | 161 |
| 554 | 3300050509 | nmdc:mga0qj67_7629_c1 | nmdc:mga0qj67_7629_c1_1950_2498 | 161 |
| 555 | 3300050510 | nmdc:mga06r32_1076344_c1 | nmdc:mga06r32_1076344_c1_87_596 | 161 |
| 556 | 3300050510 | nmdc:mga06r32_616343_c1 | nmdc:mga06r32_616343_c1_346_837 | 161 |
| 557 | 3300050510 | nmdc:mga06r32_86132_c1 | nmdc:mga06r32_86132_c1_2211_2711 | 161 |
| 558 | 3300050511 | nmdc:mga08y16_108808_c1 | nmdc:mga08y16_108808_c1_1595_2095 | 161 |
| 559 | 3300050511 | nmdc:mga08y16_116259_c1 | nmdc:mga08y16_116259_c1_1921_2412 | 161 |
| 560 | 3300050511 | nmdc:mga08y16_227293_c1 | nmdc:mga08y16_227293_c1_1180_1689 | 161 |
| 561 | 3300050511 | nmdc:mga08y16_449722_c1 | nmdc:mga08y16_449722_c1_533_1042 | 161 |
| 562 | 3300050512 | nmdc:mga0n895_737660_c1 | nmdc:mga0n895_737660_c1_38_547 | 161 |
| 563 | 3300050514 | nmdc:mga08x19_3155_c1 | nmdc:mga08x19_3155_c1_2044_2541 | 161 |
| 564 | 3300050515 | nmdc:mga0a205_131663_c1 | nmdc:mga0a205_131663_c1_1178_1687 | 161 |
| 565 | 3300050515 | nmdc:mga0a205_219892_c1 | nmdc:mga0a205_219892_c1_125_634 | 161 |
| 566 | 3300053085 | Ga0495619_0433888 | Ga0495619_0433888_392_889 | 161 |
| 567 | 3300054114 | Ga0501084_0359012 | Ga0501084_0359012_80_577 | 161 |
| 568 | 3300054114 | Ga0501084_1006567 | Ga0501084_1006567_45_551 | 161 |
| 569 | 3300059424 | Ga0590075_057765 | Ga0590075_057765_399_905 | 161 |
| 570 | 3300005328 | Ga0070676_10297952 | Ga0070676_102979522 | 162 |
| 571 | 3300005333 | Ga0070677_10279774 | Ga0070677_102797742 | 162 |
| 572 | 3300005354 | Ga0070675_100539788 | Ga0070675_1005397881 | 162 |
| 573 | 3300005356 | Ga0070674_100674351 | Ga0070674_1006743512 | 162 |
| 574 | 3300006358 | Ga0068871_100193434 | Ga0068871_1001934343 | 162 |
| 575 | 3300025934 | Ga0207686_11249943 | Ga0207686_112499431 | 162 |
| 576 | 3300025937 | Ga0207669_10612134 | Ga0207669_106121342 | 162 |
| 577 | 3300026116 | Ga0207674_10592894 | Ga0207674_105928942 | 162 |
| 578 | 3300026118 | Ga0207675_100278637 | Ga0207675_1002786371 | 162 |
| 579 | 3300031852 | Ga0307410_10051926 | Ga0307410_100519263 | 162 |
| 580 | 3300046455 | Ga0495603_0042909 | Ga0495603_0042909_621_1109 | 162 |
| 581 | 3300046499 | Ga0495594_0029180 | Ga0495594_0029180_1642_2130 | 162 |
| 582 | 3300046539 | Ga0495621_0003364 | Ga0495621_0003364_446_934 | 162 |
| 583 | 3300047321 | Ga0495676_0071461 | Ga0495676_0071461_464_952 | 162 |
| 584 | 3300047444 | Ga0495675_0476815 | Ga0495675_0476815_31_537 | 162 |
| 585 | 3300048907 | Ga0496104_0641105 | Ga0496104_0641105_356_853 | 162 |
| 586 | 3300002155 | JGI24033J26618_1016701 | JGI24033J26618_10167012 | 163 |
| 587 | 3300002459 | JGI24751J29686_10013893 | JGI24751J29686_100138932 | 163 |
| 588 | 3300003203 | JGI25406J46586_10097873 | JGI25406J46586_100978731 | 163 |
| 589 | 3300005289 | Ga0065704_10148721 | Ga0065704_101487212 | 163 |
| 590 | 3300005290 | Ga0065712_10002622 | Ga0065712_100026222 | 163 |
| 591 | 3300005290 | Ga0065712_10067818 | Ga0065712_1006781818 | 163 |
| 592 | 3300005293 | Ga0065715_10147926 | Ga0065715_101479262 | 163 |
| 593 | 3300005293 | Ga0065715_10158966 | Ga0065715_101589662 | 163 |
| 594 | 3300005293 | Ga0065715_10168749 | Ga0065715_101687492 | 163 |
| 595 | 3300005293 | Ga0065715_10279735 | Ga0065715_102797352 | 163 |
| 596 | 3300005295 | Ga0065707_10289450 | Ga0065707_102894502 | 163 |
| 597 | 3300005295 | Ga0065707_10412332 | Ga0065707_104123321 | 163 |
| 598 | 3300005328 | Ga0070676_10438005 | Ga0070676_104380052 | 163 |
| 599 | 3300005328 | Ga0070676_10832927 | Ga0070676_108329271 | 163 |
| 600 | 3300005329 | Ga0070683_100338820 | Ga0070683_1003388202 | 163 |
| 601 | 3300005330 | Ga0070690_100000920 | Ga0070690_1000009202 | 163 |
| 602 | 3300005330 | Ga0070690_100197332 | Ga0070690_1001973322 | 163 |
| 603 | 3300005330 | Ga0070690_100922612 | Ga0070690_1009226122 | 163 |
| 604 | 3300005330 | Ga0070690_100946779 | Ga0070690_1009467791 | 163 |
| 605 | 3300005330 | Ga0070690_101430069 | Ga0070690_1014300691 | 163 |
| 606 | 3300005331 | Ga0070670_100015640 | Ga0070670_1000156405 | 163 |
| 607 | 3300005331 | Ga0070670_100161978 | Ga0070670_1001619783 | 163 |
| 608 | 3300005331 | Ga0070670_100300500 | Ga0070670_1003005002 | 163 |
| 609 | 3300005331 | Ga0070670_100901418 | Ga0070670_1009014181 | 163 |
| 610 | 3300005333 | Ga0070677_10013312 | Ga0070677_100133122 | 163 |
| 611 | 3300005333 | Ga0070677_10044554 | Ga0070677_100445542 | 163 |
| 612 | 3300005333 | Ga0070677_10049012 | Ga0070677_100490122 | 163 |
| 613 | 3300005333 | Ga0070677_10284896 | Ga0070677_102848961 | 163 |
| 614 | 3300005333 | Ga0070677_10422995 | Ga0070677_104229951 | 163 |
| 615 | 3300005334 | Ga0068869_100002153 | Ga0068869_1000021533 | 163 |
| 616 | 3300005334 | Ga0068869_100048862 | Ga0068869_1000488623 | 163 |
| 617 | 3300005334 | Ga0068869_100092460 | Ga0068869_1000924603 | 163 |
| 618 | 3300005334 | Ga0068869_100103497 | Ga0068869_1001034972 | 163 |
| 619 | 3300005334 | Ga0068869_100174532 | Ga0068869_1001745322 | 163 |
| 620 | 3300005334 | Ga0068869_100280507 | Ga0068869_1002805072 | 163 |
| 621 | 3300005334 | Ga0068869_100536026 | Ga0068869_1005360262 | 163 |
| 622 | 3300005335 | Ga0070666_10729581 | Ga0070666_107295811 | 163 |
| 623 | 3300005336 | Ga0070680_100025422 | Ga0070680_1000254226 | 163 |
| 624 | 3300005336 | Ga0070680_100153630 | Ga0070680_1001536303 | 163 |
| 625 | 3300005336 | Ga0070680_100630050 | Ga0070680_1006300502 | 163 |
| 626 | 3300005336 | Ga0070680_100866206 | Ga0070680_1008662062 | 163 |
| 627 | 3300005337 | Ga0070682_101249949 | Ga0070682_1012499491 | 163 |
| 628 | 3300005338 | Ga0068868_100291802 | Ga0068868_1002918022 | 163 |
| 629 | 3300005338 | Ga0068868_100352495 | Ga0068868_1003524952 | 163 |
| 630 | 3300005338 | Ga0068868_100639711 | Ga0068868_1006397111 | 163 |
| 631 | 3300005338 | Ga0068868_100741312 | Ga0068868_1007413121 | 163 |
| 632 | 3300005338 | Ga0068868_101181271 | Ga0068868_1011812711 | 163 |
| 633 | 3300005339 | Ga0070660_100001092 | Ga0070660_10000109215 | 163 |
| 634 | 3300005340 | Ga0070689_100043202 | Ga0070689_1000432022 | 163 |
| 635 | 3300005340 | Ga0070689_100065174 | Ga0070689_1000651741 | 163 |
| 636 | 3300005340 | Ga0070689_100199760 | Ga0070689_1001997601 | 163 |
| 637 | 3300005340 | Ga0070689_100327105 | Ga0070689_1003271052 | 163 |
| 638 | 3300005340 | Ga0070689_100740161 | Ga0070689_1007401612 | 163 |
| 639 | 3300005341 | Ga0070691_10043112 | Ga0070691_100431122 | 163 |
| 640 | 3300005341 | Ga0070691_10149628 | Ga0070691_101496282 | 163 |
| 641 | 3300005343 | Ga0070687_100095286 | Ga0070687_1000952861 | 163 |
| 642 | 3300005344 | Ga0070661_100414251 | Ga0070661_1004142511 | 163 |
| 643 | 3300005344 | Ga0070661_100608875 | Ga0070661_1006088751 | 163 |
| 644 | 3300005344 | Ga0070661_101372584 | Ga0070661_1013725841 | 163 |
| 645 | 3300005345 | Ga0070692_10458705 | Ga0070692_104587051 | 163 |
| 646 | 3300005347 | Ga0070668_100454436 | Ga0070668_1004544362 | 163 |
| 647 | 3300005353 | Ga0070669_100003474 | Ga0070669_1000034743 | 163 |
| 648 | 3300005353 | Ga0070669_100038193 | Ga0070669_1000381933 | 163 |
| 649 | 3300005353 | Ga0070669_100313428 | Ga0070669_1003134282 | 163 |
| 650 | 3300005353 | Ga0070669_100339396 | Ga0070669_1003393961 | 163 |
| 651 | 3300005353 | Ga0070669_100423022 | Ga0070669_1004230221 | 163 |
| 652 | 3300005353 | Ga0070669_100548837 | Ga0070669_1005488372 | 163 |
| 653 | 3300005354 | Ga0070675_100000433 | Ga0070675_1000004339 | 163 |
| 654 | 3300005354 | Ga0070675_100001643 | Ga0070675_1000016438 | 163 |
| 655 | 3300005354 | Ga0070675_100003018 | Ga0070675_1000030184 | 163 |
| 656 | 3300005354 | Ga0070675_100007486 | Ga0070675_1000074866 | 163 |
| 657 | 3300005354 | Ga0070675_100007803 | Ga0070675_1000078037 | 163 |
| 658 | 3300005354 | Ga0070675_100036669 | Ga0070675_1000366693 | 163 |
| 659 | 3300005354 | Ga0070675_100205743 | Ga0070675_1002057432 | 163 |
| 660 | 3300005354 | Ga0070675_100344667 | Ga0070675_1003446671 | 163 |
| 661 | 3300005354 | Ga0070675_100439608 | Ga0070675_1004396081 | 163 |
| 662 | 3300005355 | Ga0070671_100034834 | Ga0070671_1000348342 | 163 |
| 663 | 3300005355 | Ga0070671_100048508 | Ga0070671_1000485082 | 163 |
| 664 | 3300005355 | Ga0070671_100782269 | Ga0070671_1007822691 | 163 |
| 665 | 3300005356 | Ga0070674_100021951 | Ga0070674_1000219513 | 163 |
| 666 | 3300005356 | Ga0070674_100519194 | Ga0070674_1005191942 | 163 |
| 667 | 3300005356 | Ga0070674_101006082 | Ga0070674_1010060821 | 163 |
| 668 | 3300005356 | Ga0070674_101265879 | Ga0070674_1012658791 | 163 |
| 669 | 3300005364 | Ga0070673_100003132 | Ga0070673_1000031323 | 163 |
| 670 | 3300005364 | Ga0070673_100043274 | Ga0070673_1000432742 | 163 |
| 671 | 3300005364 | Ga0070673_100050178 | Ga0070673_1000501782 | 163 |
| 672 | 3300005364 | Ga0070673_100058513 | Ga0070673_1000585133 | 163 |
| 673 | 3300005364 | Ga0070673_100137316 | Ga0070673_1001373162 | 163 |
| 674 | 3300005364 | Ga0070673_100171940 | Ga0070673_1001719401 | 163 |
| 675 | 3300005364 | Ga0070673_100183156 | Ga0070673_1001831562 | 163 |
| 676 | 3300005364 | Ga0070673_100196196 | Ga0070673_1001961961 | 163 |
| 677 | 3300005364 | Ga0070673_100549318 | Ga0070673_1005493182 | 163 |
| 678 | 3300005364 | Ga0070673_100635366 | Ga0070673_1006353662 | 163 |
| 679 | 3300005365 | Ga0070688_100216235 | Ga0070688_1002162352 | 163 |
| 680 | 3300005365 | Ga0070688_100476940 | Ga0070688_1004769401 | 163 |
| 681 | 3300005365 | Ga0070688_101083333 | Ga0070688_1010833331 | 163 |
| 682 | 3300005367 | Ga0070667_100179209 | Ga0070667_1001792092 | 163 |
| 683 | 3300005367 | Ga0070667_100414741 | Ga0070667_1004147412 | 163 |
| 684 | 3300005436 | Ga0070713_100900072 | Ga0070713_1009000722 | 163 |
| 685 | 3300005438 | Ga0070701_10080120 | Ga0070701_100801202 | 163 |
| 686 | 3300005438 | Ga0070701_10102714 | Ga0070701_101027142 | 163 |
| 687 | 3300005440 | Ga0070705_100014875 | Ga0070705_1000148752 | 163 |
| 688 | 3300005440 | Ga0070705_100053659 | Ga0070705_1000536593 | 163 |
| 689 | 3300005440 | Ga0070705_100135726 | Ga0070705_1001357262 | 163 |
| 690 | 3300005441 | Ga0070700_100006082 | Ga0070700_1000060823 | 163 |
| 691 | 3300005441 | Ga0070700_100059550 | Ga0070700_1000595503 | 163 |
| 692 | 3300005441 | Ga0070700_100906779 | Ga0070700_1009067791 | 163 |
| 693 | 3300005444 | Ga0070694_100002894 | Ga0070694_10000289410 | 163 |
| 694 | 3300005444 | Ga0070694_100005858 | Ga0070694_1000058582 | 163 |
| 695 | 3300005444 | Ga0070694_100172110 | Ga0070694_1001721101 | 163 |
| 696 | 3300005444 | Ga0070694_100379711 | Ga0070694_1003797112 | 163 |
| 697 | 3300005444 | Ga0070694_100802159 | Ga0070694_1008021592 | 163 |
| 698 | 3300005445 | Ga0070708_100519664 | Ga0070708_1005196642 | 163 |
| 699 | 3300005445 | Ga0070708_100607625 | Ga0070708_1006076252 | 163 |
| 700 | 3300005445 | Ga0070708_100868844 | Ga0070708_1008688442 | 163 |
| 701 | 3300005455 | Ga0070663_100037019 | Ga0070663_1000370192 | 163 |
| 702 | 3300005456 | Ga0070678_100109353 | Ga0070678_1001093532 | 163 |
| 703 | 3300005456 | Ga0070678_100494754 | Ga0070678_1004947542 | 163 |
| 704 | 3300005456 | Ga0070678_100709470 | Ga0070678_1007094701 | 163 |
| 705 | 3300005457 | Ga0070662_100380504 | Ga0070662_1003805041 | 163 |
| 706 | 3300005457 | Ga0070662_100874882 | Ga0070662_1008748821 | 163 |
| 707 | 3300005459 | Ga0068867_100000380 | Ga0068867_10000038023 | 163 |
| 708 | 3300005459 | Ga0068867_100138704 | Ga0068867_1001387042 | 163 |
| 709 | 3300005459 | Ga0068867_100686917 | Ga0068867_1006869172 | 163 |
| 710 | 3300005459 | Ga0068867_100709371 | Ga0068867_1007093712 | 163 |
| 711 | 3300005459 | Ga0068867_100713581 | Ga0068867_1007135812 | 163 |
| 712 | 3300005459 | Ga0068867_100944408 | Ga0068867_1009444082 | 163 |
| 713 | 3300005459 | Ga0068867_101063118 | Ga0068867_1010631181 | 163 |
| 714 | 3300005459 | Ga0068867_101710127 | Ga0068867_1017101271 | 163 |
| 715 | 3300005466 | Ga0070685_10050222 | Ga0070685_100502223 | 163 |
| 716 | 3300005466 | Ga0070685_10545954 | Ga0070685_105459541 | 163 |
| 717 | 3300005467 | Ga0070706_100186401 | Ga0070706_1001864012 | 163 |
| 718 | 3300005467 | Ga0070706_100774035 | Ga0070706_1007740352 | 163 |
| 719 | 3300005467 | Ga0070706_101121435 | Ga0070706_1011214351 | 163 |
| 720 | 3300005467 | Ga0070706_101226546 | Ga0070706_1012265461 | 163 |
| 721 | 3300005468 | Ga0070707_100442076 | Ga0070707_1004420762 | 163 |
| 722 | 3300005468 | Ga0070707_101094705 | Ga0070707_1010947051 | 163 |
| 723 | 3300005468 | Ga0070707_101286300 | Ga0070707_1012863002 | 163 |
| 724 | 3300005471 | Ga0070698_100003115 | Ga0070698_1000031153 | 163 |
| 725 | 3300005471 | Ga0070698_100006640 | Ga0070698_1000066402 | 163 |
| 726 | 3300005471 | Ga0070698_100072413 | Ga0070698_1000724132 | 163 |
| 727 | 3300005471 | Ga0070698_100394572 | Ga0070698_1003945722 | 163 |
| 728 | 3300005518 | Ga0070699_100003719 | Ga0070699_1000037191 | 163 |
| 729 | 3300005518 | Ga0070699_100006814 | Ga0070699_1000068143 | 163 |
| 730 | 3300005518 | Ga0070699_100100290 | Ga0070699_1001002902 | 163 |
| 731 | 3300005518 | Ga0070699_100123199 | Ga0070699_1001231992 | 163 |
| 732 | 3300005530 | Ga0070679_100010050 | Ga0070679_1000100502 | 163 |
| 733 | 3300005530 | Ga0070679_100548131 | Ga0070679_1005481312 | 163 |
| 734 | 3300005530 | Ga0070679_100776591 | Ga0070679_1007765911 | 163 |
| 735 | 3300005535 | Ga0070684_100519127 | Ga0070684_1005191272 | 163 |
| 736 | 3300005535 | Ga0070684_101199138 | Ga0070684_1011991381 | 163 |
| 737 | 3300005539 | Ga0068853_100611029 | Ga0068853_1006110292 | 163 |
| 738 | 3300005543 | Ga0070672_100004404 | Ga0070672_1000044045 | 163 |
| 739 | 3300005543 | Ga0070672_100005217 | Ga0070672_1000052178 | 163 |
| 740 | 3300005543 | Ga0070672_100062004 | Ga0070672_1000620042 | 163 |
| 741 | 3300005543 | Ga0070672_100213036 | Ga0070672_1002130361 | 163 |
| 742 | 3300005543 | Ga0070672_100692814 | Ga0070672_1006928141 | 163 |
| 743 | 3300005543 | Ga0070672_100729197 | Ga0070672_1007291972 | 163 |
| 744 | 3300005543 | Ga0070672_101137246 | Ga0070672_1011372461 | 163 |
| 745 | 3300005544 | Ga0070686_100000153 | Ga0070686_1000001533 | 163 |
| 746 | 3300005544 | Ga0070686_100030299 | Ga0070686_1000302993 | 163 |
| 747 | 3300005544 | Ga0070686_100084274 | Ga0070686_1000842742 | 163 |
| 748 | 3300005544 | Ga0070686_100188159 | Ga0070686_1001881592 | 163 |
| 749 | 3300005544 | Ga0070686_100218647 | Ga0070686_1002186472 | 163 |
| 750 | 3300005544 | Ga0070686_100313655 | Ga0070686_1003136552 | 163 |
| 751 | 3300005544 | Ga0070686_100375621 | Ga0070686_1003756212 | 163 |
| 752 | 3300005545 | Ga0070695_100027664 | Ga0070695_1000276643 | 163 |
| 753 | 3300005545 | Ga0070695_100170257 | Ga0070695_1001702572 | 163 |
| 754 | 3300005545 | Ga0070695_100502552 | Ga0070695_1005025522 | 163 |
| 755 | 3300005545 | Ga0070695_100826694 | Ga0070695_1008266942 | 163 |
| 756 | 3300005545 | Ga0070695_100954808 | Ga0070695_1009548081 | 163 |
| 757 | 3300005546 | Ga0070696_100018169 | Ga0070696_1000181693 | 163 |
| 758 | 3300005546 | Ga0070696_100112265 | Ga0070696_1001122651 | 163 |
| 759 | 3300005546 | Ga0070696_100552454 | Ga0070696_1005524542 | 163 |
| 760 | 3300005547 | Ga0070693_100720868 | Ga0070693_1007208681 | 163 |
| 761 | 3300005547 | Ga0070693_100836877 | Ga0070693_1008368771 | 163 |
| 762 | 3300005548 | Ga0070665_100010631 | Ga0070665_1000106315 | 163 |
| 763 | 3300005548 | Ga0070665_100078682 | Ga0070665_1000786822 | 163 |
| 764 | 3300005549 | Ga0070704_100000089 | Ga0070704_1000000896 | 163 |
| 765 | 3300005549 | Ga0070704_100032604 | Ga0070704_1000326043 | 163 |
| 766 | 3300005549 | Ga0070704_100074989 | Ga0070704_1000749893 | 163 |
| 767 | 3300005549 | Ga0070704_100134456 | Ga0070704_1001344562 | 163 |
| 768 | 3300005549 | Ga0070704_100631855 | Ga0070704_1006318552 | 163 |
| 769 | 3300005549 | Ga0070704_100700314 | Ga0070704_1007003142 | 163 |
| 770 | 3300005549 | Ga0070704_101301510 | Ga0070704_1013015101 | 163 |
| 771 | 3300005563 | Ga0068855_100020680 | Ga0068855_10002068010 | 163 |
| 772 | 3300005563 | Ga0068855_100492643 | Ga0068855_1004926431 | 163 |
| 773 | 3300005563 | Ga0068855_100652639 | Ga0068855_1006526391 | 163 |
| 774 | 3300005563 | Ga0068855_100798835 | Ga0068855_1007988351 | 163 |
| 775 | 3300005564 | Ga0070664_100009603 | Ga0070664_1000096033 | 163 |
| 776 | 3300005564 | Ga0070664_100097790 | Ga0070664_1000977902 | 163 |
| 777 | 3300005564 | Ga0070664_100236671 | Ga0070664_1002366712 | 163 |
| 778 | 3300005564 | Ga0070664_100346288 | Ga0070664_1003462882 | 163 |
| 779 | 3300005577 | Ga0068857_100358762 | Ga0068857_1003587621 | 163 |
| 780 | 3300005577 | Ga0068857_100522165 | Ga0068857_1005221652 | 163 |
| 781 | 3300005578 | Ga0068854_100163499 | Ga0068854_1001634992 | 163 |
| 782 | 3300005578 | Ga0068854_101120050 | Ga0068854_1011200502 | 163 |
| 783 | 3300005615 | Ga0070702_100053993 | Ga0070702_1000539932 | 163 |
| 784 | 3300005616 | Ga0068852_100377942 | Ga0068852_1003779422 | 163 |
| 785 | 3300005616 | Ga0068852_100746608 | Ga0068852_1007466082 | 163 |
| 786 | 3300005617 | Ga0068859_100025246 | Ga0068859_1000252463 | 163 |
| 787 | 3300005617 | Ga0068859_100137975 | Ga0068859_1001379751 | 163 |
| 788 | 3300005617 | Ga0068859_100191448 | Ga0068859_1001914483 | 163 |
| 789 | 3300005617 | Ga0068859_100504379 | Ga0068859_1005043791 | 163 |
| 790 | 3300005617 | Ga0068859_100506815 | Ga0068859_1005068152 | 163 |
| 791 | 3300005617 | Ga0068859_100714266 | Ga0068859_1007142662 | 163 |
| 792 | 3300005617 | Ga0068859_100759169 | Ga0068859_1007591692 | 163 |
| 793 | 3300005617 | Ga0068859_101723599 | Ga0068859_1017235992 | 163 |
| 794 | 3300005618 | Ga0068864_100002939 | Ga0068864_10000293912 | 163 |
| 795 | 3300005618 | Ga0068864_100207644 | Ga0068864_1002076442 | 163 |
| 796 | 3300005618 | Ga0068864_100234303 | Ga0068864_1002343033 | 163 |
| 797 | 3300005618 | Ga0068864_100234644 | Ga0068864_1002346442 | 163 |
| 798 | 3300005618 | Ga0068864_100313810 | Ga0068864_1003138102 | 163 |
| 799 | 3300005618 | Ga0068864_100391631 | Ga0068864_1003916312 | 163 |
| 800 | 3300005618 | Ga0068864_100975212 | Ga0068864_1009752122 | 163 |
| 801 | 3300005718 | Ga0068866_10084161 | Ga0068866_100841612 | 163 |
| 802 | 3300005719 | Ga0068861_100091306 | Ga0068861_1000913062 | 163 |
| 803 | 3300005719 | Ga0068861_100093769 | Ga0068861_1000937693 | 163 |
| 804 | 3300005719 | Ga0068861_100129925 | Ga0068861_1001299252 | 163 |
| 805 | 3300005719 | Ga0068861_100253110 | Ga0068861_1002531102 | 163 |
| 806 | 3300005719 | Ga0068861_100488257 | Ga0068861_1004882572 | 163 |
| 807 | 3300005719 | Ga0068861_101454819 | Ga0068861_1014548192 | 163 |
| 808 | 3300005834 | Ga0068851_10150437 | Ga0068851_101504372 | 163 |
| 809 | 3300005840 | Ga0068870_10002891 | Ga0068870_100028913 | 163 |
| 810 | 3300005840 | Ga0068870_10032435 | Ga0068870_100324352 | 163 |
| 811 | 3300005840 | Ga0068870_10034344 | Ga0068870_100343442 | 163 |
| 812 | 3300005840 | Ga0068870_10234070 | Ga0068870_102340701 | 163 |
| 813 | 3300005840 | Ga0068870_10616965 | Ga0068870_106169652 | 163 |
| 814 | 3300005841 | Ga0068863_100143458 | Ga0068863_1001434582 | 163 |
| 815 | 3300005841 | Ga0068863_100199173 | Ga0068863_1001991732 | 163 |
| 816 | 3300005841 | Ga0068863_100300972 | Ga0068863_1003009722 | 163 |
| 817 | 3300005841 | Ga0068863_100313525 | Ga0068863_1003135252 | 163 |
| 818 | 3300005841 | Ga0068863_100650258 | Ga0068863_1006502581 | 163 |
| 819 | 3300005842 | Ga0068858_100003255 | Ga0068858_10000325517 | 163 |
| 820 | 3300005842 | Ga0068858_100039216 | Ga0068858_1000392163 | 163 |
| 821 | 3300005842 | Ga0068858_100075256 | Ga0068858_1000752562 | 163 |
| 822 | 3300005842 | Ga0068858_100130019 | Ga0068858_1001300192 | 163 |
| 823 | 3300005842 | Ga0068858_100206865 | Ga0068858_1002068652 | 163 |
| 824 | 3300005842 | Ga0068858_100559154 | Ga0068858_1005591543 | 163 |
| 825 | 3300005842 | Ga0068858_101037450 | Ga0068858_1010374502 | 163 |
| 826 | 3300005843 | Ga0068860_100017193 | Ga0068860_1000171931 | 163 |
| 827 | 3300005843 | Ga0068860_100034523 | Ga0068860_1000345233 | 163 |
| 828 | 3300005843 | Ga0068860_100271636 | Ga0068860_1002716362 | 163 |
| 829 | 3300005843 | Ga0068860_100347516 | Ga0068860_1003475162 | 163 |
| 830 | 3300005843 | Ga0068860_100356221 | Ga0068860_1003562212 | 163 |
| 831 | 3300005843 | Ga0068860_100392211 | Ga0068860_1003922112 | 163 |
| 832 | 3300005844 | Ga0068862_100024869 | Ga0068862_1000248693 | 163 |
| 833 | 3300005844 | Ga0068862_100384271 | Ga0068862_1003842712 | 163 |
| 834 | 3300005844 | Ga0068862_100429973 | Ga0068862_1004299732 | 163 |
| 835 | 3300005937 | Ga0081455_10008971 | Ga0081455_100089718 | 163 |
| 836 | 3300005937 | Ga0081455_10047875 | Ga0081455_100478753 | 163 |
| 837 | 3300005985 | Ga0081539_10002012 | Ga0081539_1000201224 | 163 |
| 838 | 3300006028 | Ga0070717_11361300 | Ga0070717_113613001 | 163 |
| 839 | 3300006038 | Ga0075365_10059942 | Ga0075365_100599422 | 163 |
| 840 | 3300006173 | Ga0070716_100007561 | Ga0070716_1000075612 | 163 |
| 841 | 3300006173 | Ga0070716_100112531 | Ga0070716_1001125312 | 163 |
| 842 | 3300006175 | Ga0070712_100031176 | Ga0070712_1000311763 | 163 |
| 843 | 3300006175 | Ga0070712_100416201 | Ga0070712_1004162011 | 163 |
| 844 | 3300006237 | Ga0097621_100069253 | Ga0097621_1000692532 | 163 |
| 845 | 3300006237 | Ga0097621_100126207 | Ga0097621_1001262072 | 163 |
| 846 | 3300006237 | Ga0097621_100378715 | Ga0097621_1003787152 | 163 |
| 847 | 3300006237 | Ga0097621_100616551 | Ga0097621_1006165512 | 163 |
| 848 | 3300006237 | Ga0097621_100724582 | Ga0097621_1007245822 | 163 |
| 849 | 3300006237 | Ga0097621_101182064 | Ga0097621_1011820641 | 163 |
| 850 | 3300006358 | Ga0068871_100069169 | Ga0068871_1000691691 | 163 |
| 851 | 3300006358 | Ga0068871_100077391 | Ga0068871_1000773913 | 163 |
| 852 | 3300006358 | Ga0068871_100497971 | Ga0068871_1004979712 | 163 |
| 853 | 3300006358 | Ga0068871_100649783 | Ga0068871_1006497832 | 163 |
| 854 | 3300006358 | Ga0068871_100695008 | Ga0068871_1006950082 | 163 |
| 855 | 3300006844 | Ga0075428_100006846 | Ga0075428_10000684614 | 163 |
| 856 | 3300006844 | Ga0075428_100009506 | Ga0075428_1000095068 | 163 |
| 857 | 3300006844 | Ga0075428_100026808 | Ga0075428_1000268083 | 163 |
| 858 | 3300006844 | Ga0075428_100031650 | Ga0075428_1000316502 | 163 |
| 859 | 3300006844 | Ga0075428_100057506 | Ga0075428_1000575064 | 163 |
| 860 | 3300006844 | Ga0075428_100089732 | Ga0075428_1000897322 | 163 |
| 861 | 3300006844 | Ga0075428_100121569 | Ga0075428_1001215693 | 163 |
| 862 | 3300006844 | Ga0075428_100429732 | Ga0075428_1004297322 | 163 |
| 863 | 3300006844 | Ga0075428_100602931 | Ga0075428_1006029312 | 163 |
| 864 | 3300006844 | Ga0075428_101084827 | Ga0075428_1010848272 | 163 |
| 865 | 3300006846 | Ga0075430_100002096 | Ga0075430_1000020967 | 163 |
| 866 | 3300006846 | Ga0075430_100019140 | Ga0075430_1000191402 | 163 |
| 867 | 3300006846 | Ga0075430_100025839 | Ga0075430_1000258393 | 163 |
| 868 | 3300006846 | Ga0075430_100054894 | Ga0075430_1000548943 | 163 |
| 869 | 3300006847 | Ga0075431_100003323 | Ga0075431_1000033235 | 163 |
| 870 | 3300006847 | Ga0075431_100023672 | Ga0075431_1000236724 | 163 |
| 871 | 3300006847 | Ga0075431_100069493 | Ga0075431_1000694933 | 163 |
| 872 | 3300006847 | Ga0075431_100215703 | Ga0075431_1002157032 | 163 |
| 873 | 3300006847 | Ga0075431_100241070 | Ga0075431_1002410702 | 163 |
| 874 | 3300006852 | Ga0075433_10000157 | Ga0075433_100001572 | 163 |
| 875 | 3300006852 | Ga0075433_10116506 | Ga0075433_101165062 | 163 |
| 876 | 3300006852 | Ga0075433_10146790 | Ga0075433_101467902 | 163 |
| 877 | 3300006852 | Ga0075433_10323195 | Ga0075433_103231952 | 163 |
| 878 | 3300006852 | Ga0075433_10336636 | Ga0075433_103366362 | 163 |
| 879 | 3300006852 | Ga0075433_10615587 | Ga0075433_106155871 | 163 |
| 880 | 3300006852 | Ga0075433_10789605 | Ga0075433_107896052 | 163 |
| 881 | 3300006852 | Ga0075433_10835721 | Ga0075433_108357211 | 163 |
| 882 | 3300006871 | Ga0075434_100002504 | Ga0075434_10000250414 | 163 |
| 883 | 3300006871 | Ga0075434_100006773 | Ga0075434_1000067737 | 163 |
| 884 | 3300006871 | Ga0075434_100011771 | Ga0075434_1000117713 | 163 |
| 885 | 3300006871 | Ga0075434_100017244 | Ga0075434_1000172448 | 163 |
| 886 | 3300006871 | Ga0075434_100029295 | Ga0075434_1000292953 | 163 |
| 887 | 3300006871 | Ga0075434_100065080 | Ga0075434_1000650804 | 163 |
| 888 | 3300006871 | Ga0075434_100151742 | Ga0075434_1001517422 | 163 |
| 889 | 3300006871 | Ga0075434_100302147 | Ga0075434_1003021472 | 163 |
| 890 | 3300006871 | Ga0075434_100453363 | Ga0075434_1004533632 | 163 |
| 891 | 3300006871 | Ga0075434_100476073 | Ga0075434_1004760732 | 163 |
| 892 | 3300006871 | Ga0075434_100489240 | Ga0075434_1004892402 | 163 |
| 893 | 3300006871 | Ga0075434_100524690 | Ga0075434_1005246902 | 163 |
| 894 | 3300006880 | Ga0075429_100004479 | Ga0075429_1000044794 | 163 |
| 895 | 3300006880 | Ga0075429_100005139 | Ga0075429_1000051398 | 163 |
| 896 | 3300006880 | Ga0075429_100008026 | Ga0075429_1000080264 | 163 |
| 897 | 3300006880 | Ga0075429_100126374 | Ga0075429_1001263742 | 163 |
| 898 | 3300006880 | Ga0075429_100239199 | Ga0075429_1002391992 | 163 |
| 899 | 3300006880 | Ga0075429_100314822 | Ga0075429_1003148222 | 163 |
| 900 | 3300006880 | Ga0075429_100319622 | Ga0075429_1003196221 | 163 |
| 901 | 3300006881 | Ga0068865_100002757 | Ga0068865_1000027574 | 163 |
| 902 | 3300006881 | Ga0068865_100076131 | Ga0068865_1000761313 | 163 |
| 903 | 3300006881 | Ga0068865_100760792 | Ga0068865_1007607922 | 163 |
| 904 | 3300006914 | Ga0075436_100004813 | Ga0075436_1000048132 | 163 |
| 905 | 3300006914 | Ga0075436_100017704 | Ga0075436_1000177043 | 163 |
| 906 | 3300006914 | Ga0075436_100017749 | Ga0075436_1000177493 | 163 |
| 907 | 3300006914 | Ga0075436_100132881 | Ga0075436_1001328812 | 163 |
| 908 | 3300006914 | Ga0075436_100241247 | Ga0075436_1002412472 | 163 |
| 909 | 3300006931 | Ga0097620_100025246 | Ga0097620_1000252463 | 163 |
| 910 | 3300006931 | Ga0097620_100137972 | Ga0097620_1001379721 | 163 |
| 911 | 3300006931 | Ga0097620_100191442 | Ga0097620_1001914423 | 163 |
| 912 | 3300006931 | Ga0097620_100504446 | Ga0097620_1005044461 | 163 |
| 913 | 3300006931 | Ga0097620_100506803 | Ga0097620_1005068032 | 163 |
| 914 | 3300006931 | Ga0097620_100714267 | Ga0097620_1007142672 | 163 |
| 915 | 3300006931 | Ga0097620_100759135 | Ga0097620_1007591352 | 163 |
| 916 | 3300006931 | Ga0097620_100837173 | Ga0097620_1008371732 | 163 |
| 917 | 3300006931 | Ga0097620_101723800 | Ga0097620_1017238002 | 163 |
| 918 | 3300007076 | Ga0075435_100000204 | Ga0075435_10000020426 | 163 |
| 919 | 3300007076 | Ga0075435_100007928 | Ga0075435_1000079283 | 163 |
| 920 | 3300007076 | Ga0075435_100015754 | Ga0075435_1000157543 | 163 |
| 921 | 3300007076 | Ga0075435_100027042 | Ga0075435_1000270423 | 163 |
| 922 | 3300007076 | Ga0075435_100177038 | Ga0075435_1001770382 | 163 |
| 923 | 3300007076 | Ga0075435_100212697 | Ga0075435_1002126972 | 163 |
| 924 | 3300007076 | Ga0075435_100310333 | Ga0075435_1003103332 | 163 |
| 925 | 3300007076 | Ga0075435_100494082 | Ga0075435_1004940822 | 163 |
| 926 | 3300009011 | Ga0105251_10096311 | Ga0105251_100963112 | 163 |
| 927 | 3300009036 | Ga0105244_10445466 | Ga0105244_104454661 | 163 |
| 928 | 3300009093 | Ga0105240_10794797 | Ga0105240_107947972 | 163 |
| 929 | 3300009093 | Ga0105240_11465595 | Ga0105240_114655951 | 163 |
| 930 | 3300009094 | Ga0111539_10000134 | Ga0111539_1000013415 | 163 |
| 931 | 3300009094 | Ga0111539_10001078 | Ga0111539_1000107815 | 163 |
| 932 | 3300009094 | Ga0111539_10002632 | Ga0111539_100026323 | 163 |
| 933 | 3300009094 | Ga0111539_10010143 | Ga0111539_1001014310 | 163 |
| 934 | 3300009094 | Ga0111539_10015933 | Ga0111539_100159333 | 163 |
| 935 | 3300009094 | Ga0111539_10187478 | Ga0111539_101874783 | 163 |
| 936 | 3300009094 | Ga0111539_10291782 | Ga0111539_102917822 | 163 |
| 937 | 3300009094 | Ga0111539_10321189 | Ga0111539_103211892 | 163 |
| 938 | 3300009094 | Ga0111539_10510089 | Ga0111539_105100892 | 163 |
| 939 | 3300009094 | Ga0111539_11242735 | Ga0111539_112427352 | 163 |
| 940 | 3300009094 | Ga0111539_11566589 | Ga0111539_115665892 | 163 |
| 941 | 3300009098 | Ga0105245_10018654 | Ga0105245_100186545 | 163 |
| 942 | 3300009098 | Ga0105245_10266120 | Ga0105245_102661202 | 163 |
| 943 | 3300009098 | Ga0105245_10832324 | Ga0105245_108323241 | 163 |
| 944 | 3300009098 | Ga0105245_11922539 | Ga0105245_119225391 | 163 |
| 945 | 3300009101 | Ga0105247_10058133 | Ga0105247_100581333 | 163 |
| 946 | 3300009101 | Ga0105247_10159725 | Ga0105247_101597252 | 163 |
| 947 | 3300009101 | Ga0105247_10271953 | Ga0105247_102719532 | 163 |
| 948 | 3300009147 | Ga0114129_10000426 | Ga0114129_1000042613 | 163 |
| 949 | 3300009147 | Ga0114129_10001213 | Ga0114129_1000121310 | 163 |
| 950 | 3300009147 | Ga0114129_10011201 | Ga0114129_100112015 | 163 |
| 951 | 3300009147 | Ga0114129_10016744 | Ga0114129_100167444 | 163 |
| 952 | 3300009147 | Ga0114129_10016919 | Ga0114129_100169195 | 163 |
| 953 | 3300009147 | Ga0114129_10029055 | Ga0114129_100290552 | 163 |
| 954 | 3300009147 | Ga0114129_10048963 | Ga0114129_100489633 | 163 |
| 955 | 3300009147 | Ga0114129_10051960 | Ga0114129_100519604 | 163 |
| 956 | 3300009147 | Ga0114129_10057730 | Ga0114129_100577303 | 163 |
| 957 | 3300009147 | Ga0114129_10064329 | Ga0114129_100643293 | 163 |
| 958 | 3300009147 | Ga0114129_10067793 | Ga0114129_100677932 | 163 |
| 959 | 3300009147 | Ga0114129_10073868 | Ga0114129_100738688 | 163 |
| 960 | 3300009147 | Ga0114129_10095042 | Ga0114129_100950423 | 163 |
| 961 | 3300009147 | Ga0114129_10109022 | Ga0114129_101090223 | 163 |
| 962 | 3300009147 | Ga0114129_10143188 | Ga0114129_101431883 | 163 |
| 963 | 3300009147 | Ga0114129_10295970 | Ga0114129_102959701 | 163 |
| 964 | 3300009147 | Ga0114129_10566980 | Ga0114129_105669801 | 163 |
| 965 | 3300009147 | Ga0114129_12703291 | Ga0114129_127032911 | 163 |
| 966 | 3300009148 | Ga0105243_10006934 | Ga0105243_100069346 | 163 |
| 967 | 3300009148 | Ga0105243_10175709 | Ga0105243_101757092 | 163 |
| 968 | 3300009148 | Ga0105243_10506248 | Ga0105243_105062482 | 163 |
| 969 | 3300009148 | Ga0105243_10771100 | Ga0105243_107711002 | 163 |
| 970 | 3300009148 | Ga0105243_10923197 | Ga0105243_109231972 | 163 |
| 971 | 3300009148 | Ga0105243_11471236 | Ga0105243_114712362 | 163 |
| 972 | 3300009148 | Ga0105243_11608999 | Ga0105243_116089991 | 163 |
| 973 | 3300009174 | Ga0105241_10026107 | Ga0105241_100261072 | 163 |
| 974 | 3300009174 | Ga0105241_11039566 | Ga0105241_110395661 | 163 |
| 975 | 3300009176 | Ga0105242_10328003 | Ga0105242_103280032 | 163 |
| 976 | 3300009176 | Ga0105242_10366387 | Ga0105242_103663872 | 163 |
| 977 | 3300009176 | Ga0105242_11024614 | Ga0105242_110246142 | 163 |
| 978 | 3300009177 | Ga0105248_10002172 | Ga0105248_1000217211 | 163 |
| 979 | 3300009177 | Ga0105248_10043045 | Ga0105248_100430454 | 163 |
| 980 | 3300009177 | Ga0105248_10052710 | Ga0105248_100527102 | 163 |
| 981 | 3300009177 | Ga0105248_10068556 | Ga0105248_100685561 | 163 |
| 982 | 3300009177 | Ga0105248_10107031 | Ga0105248_101070313 | 163 |
| 983 | 3300009177 | Ga0105248_10162200 | Ga0105248_101622003 | 163 |
| 984 | 3300009177 | Ga0105248_10231761 | Ga0105248_102317612 | 163 |
| 985 | 3300009177 | Ga0105248_10231761 | Ga0105248_102317614 | 163 |
| 986 | 3300009177 | Ga0105248_10320423 | Ga0105248_103204231 | 163 |
| 987 | 3300009177 | Ga0105248_10495834 | Ga0105248_104958342 | 163 |
| 988 | 3300009177 | Ga0105248_11356672 | Ga0105248_113566721 | 163 |
| 989 | 3300009545 | Ga0105237_10709398 | Ga0105237_107093982 | 163 |
| 990 | 3300009545 | Ga0105237_11273509 | Ga0105237_112735092 | 163 |
| 991 | 3300009553 | Ga0105249_10081617 | Ga0105249_100816172 | 163 |
| 992 | 3300009553 | Ga0105249_10272878 | Ga0105249_102728782 | 163 |
| 993 | 3300009553 | Ga0105249_10350611 | Ga0105249_103506112 | 163 |
| 994 | 3300009553 | Ga0105249_10455199 | Ga0105249_104551992 | 163 |
| 995 | 3300009553 | Ga0105249_10867528 | Ga0105249_108675282 | 163 |
| 996 | 3300009553 | Ga0105249_11977180 | Ga0105249_119771801 | 163 |
| 997 | 3300011119 | Ga0105246_10105238 | Ga0105246_101052382 | 163 |
| 998 | 3300011119 | Ga0105246_10467635 | Ga0105246_104676352 | 163 |
| 999 | 3300013100 | Ga0157373_11108636 | Ga0157373_111086361 | 163 |
| 1000 | 3300013297 | Ga0157378_10561950 | Ga0157378_105619502 | 163 |
| 1001 | 3300013306 | Ga0163162_10549926 | Ga0163162_105499262 | 163 |
| 1002 | 3300013306 | Ga0163162_10609618 | Ga0163162_106096182 | 163 |
| 1003 | 3300013306 | Ga0163162_10947929 | Ga0163162_109479291 | 163 |
| 1004 | 3300013306 | Ga0163162_11769678 | Ga0163162_117696781 | 163 |
| 1005 | 3300013307 | Ga0157372_10454180 | Ga0157372_104541801 | 163 |
| 1006 | 3300013308 | Ga0157375_10055322 | Ga0157375_100553222 | 163 |
| 1007 | 3300013308 | Ga0157375_10265853 | Ga0157375_102658532 | 163 |
| 1008 | 3300013308 | Ga0157375_10374552 | Ga0157375_103745522 | 163 |
| 1009 | 3300013308 | Ga0157375_10587096 | Ga0157375_105870962 | 163 |
| 1010 | 3300014325 | Ga0163163_10024951 | Ga0163163_100249514 | 163 |
| 1011 | 3300014325 | Ga0163163_10033095 | Ga0163163_100330953 | 163 |
| 1012 | 3300014325 | Ga0163163_10044334 | Ga0163163_100443342 | 163 |
| 1013 | 3300014325 | Ga0163163_10049145 | Ga0163163_100491454 | 163 |
| 1014 | 3300014325 | Ga0163163_10457893 | Ga0163163_104578932 | 163 |
| 1015 | 3300014325 | Ga0163163_10662976 | Ga0163163_106629762 | 163 |
| 1016 | 3300014326 | Ga0157380_10002946 | Ga0157380_100029469 | 163 |
| 1017 | 3300014326 | Ga0157380_10048867 | Ga0157380_100488672 | 163 |
| 1018 | 3300014326 | Ga0157380_10078622 | Ga0157380_100786222 | 163 |
| 1019 | 3300014326 | Ga0157380_10088271 | Ga0157380_100882713 | 163 |
| 1020 | 3300014326 | Ga0157380_10279419 | Ga0157380_102794192 | 163 |
| 1021 | 3300014326 | Ga0157380_10691176 | Ga0157380_106911762 | 163 |
| 1022 | 3300014326 | Ga0157380_11524746 | Ga0157380_115247461 | 163 |
| 1023 | 3300014326 | Ga0157380_11547105 | Ga0157380_115471052 | 163 |
| 1024 | 3300014497 | Ga0182008_10291273 | Ga0182008_102912731 | 163 |
| 1025 | 3300014745 | Ga0157377_10066174 | Ga0157377_100661743 | 163 |
| 1026 | 3300014745 | Ga0157377_10095762 | Ga0157377_100957621 | 163 |
| 1027 | 3300014745 | Ga0157377_10155723 | Ga0157377_101557232 | 163 |
| 1028 | 3300014745 | Ga0157377_10275103 | Ga0157377_102751032 | 163 |
| 1029 | 3300014745 | Ga0157377_10331777 | Ga0157377_103317772 | 163 |
| 1030 | 3300014745 | Ga0157377_10550822 | Ga0157377_105508221 | 163 |
| 1031 | 3300014968 | Ga0157379_10007040 | Ga0157379_100070405 | 163 |
| 1032 | 3300014968 | Ga0157379_10007133 | Ga0157379_100071332 | 163 |
| 1033 | 3300014968 | Ga0157379_10037871 | Ga0157379_100378712 | 163 |
| 1034 | 3300014968 | Ga0157379_10222767 | Ga0157379_102227672 | 163 |
| 1035 | 3300014968 | Ga0157379_10328355 | Ga0157379_103283552 | 163 |
| 1036 | 3300014968 | Ga0157379_10640056 | Ga0157379_106400561 | 163 |
| 1037 | 3300014969 | Ga0157376_10189607 | Ga0157376_101896072 | 163 |
| 1038 | 3300017792 | Ga0163161_10379530 | Ga0163161_103795302 | 163 |
| 1039 | 3300017792 | Ga0163161_10965245 | Ga0163161_109652452 | 163 |
| 1040 | 3300021384 | Ga0213876_10074971 | Ga0213876_100749712 | 163 |
| 1041 | 3300025315 | Ga0207697_10357179 | Ga0207697_103571792 | 163 |
| 1042 | 3300025893 | Ga0207682_10004207 | Ga0207682_100042073 | 163 |
| 1043 | 3300025893 | Ga0207682_10045366 | Ga0207682_100453662 | 163 |
| 1044 | 3300025893 | Ga0207682_10048222 | Ga0207682_100482221 | 163 |
| 1045 | 3300025893 | Ga0207682_10064298 | Ga0207682_100642982 | 163 |
| 1046 | 3300025893 | Ga0207682_10327128 | Ga0207682_103271281 | 163 |
| 1047 | 3300025900 | Ga0207710_10082088 | Ga0207710_100820882 | 163 |
| 1048 | 3300025901 | Ga0207688_10348566 | Ga0207688_103485661 | 163 |
| 1049 | 3300025903 | Ga0207680_10049583 | Ga0207680_100495832 | 163 |
| 1050 | 3300025903 | Ga0207680_10318152 | Ga0207680_103181522 | 163 |
| 1051 | 3300025903 | Ga0207680_10792231 | Ga0207680_107922312 | 163 |
| 1052 | 3300025906 | Ga0207699_10257100 | Ga0207699_102571002 | 163 |
| 1053 | 3300025907 | Ga0207645_10002286 | Ga0207645_100022864 | 163 |
| 1054 | 3300025907 | Ga0207645_10148909 | Ga0207645_101489093 | 163 |
| 1055 | 3300025908 | Ga0207643_10003202 | Ga0207643_100032023 | 163 |
| 1056 | 3300025908 | Ga0207643_10042613 | Ga0207643_100426132 | 163 |
| 1057 | 3300025908 | Ga0207643_10057393 | Ga0207643_100573932 | 163 |
| 1058 | 3300025908 | Ga0207643_10077467 | Ga0207643_100774672 | 163 |
| 1059 | 3300025908 | Ga0207643_10549995 | Ga0207643_105499952 | 163 |
| 1060 | 3300025910 | Ga0207684_10228661 | Ga0207684_102286612 | 163 |
| 1061 | 3300025913 | Ga0207695_10428856 | Ga0207695_104288562 | 163 |
| 1062 | 3300025913 | Ga0207695_10757082 | Ga0207695_107570822 | 163 |
| 1063 | 3300025914 | Ga0207671_10227660 | Ga0207671_102276602 | 163 |
| 1064 | 3300025914 | Ga0207671_11049257 | Ga0207671_110492571 | 163 |
| 1065 | 3300025915 | Ga0207693_10738222 | Ga0207693_107382221 | 163 |
| 1066 | 3300025916 | Ga0207663_10226206 | Ga0207663_102262062 | 163 |
| 1067 | 3300025917 | Ga0207660_10085009 | Ga0207660_100850093 | 163 |
| 1068 | 3300025917 | Ga0207660_10096368 | Ga0207660_100963683 | 163 |
| 1069 | 3300025917 | Ga0207660_10165751 | Ga0207660_101657512 | 163 |
| 1070 | 3300025917 | Ga0207660_10247169 | Ga0207660_102471691 | 163 |
| 1071 | 3300025918 | Ga0207662_10007637 | Ga0207662_100076373 | 163 |
| 1072 | 3300025918 | Ga0207662_10099277 | Ga0207662_100992772 | 163 |
| 1073 | 3300025918 | Ga0207662_10131006 | Ga0207662_101310062 | 163 |
| 1074 | 3300025919 | Ga0207657_10006096 | Ga0207657_100060965 | 163 |
| 1075 | 3300025920 | Ga0207649_10073295 | Ga0207649_100732952 | 163 |
| 1076 | 3300025920 | Ga0207649_10857902 | Ga0207649_108579022 | 163 |
| 1077 | 3300025921 | Ga0207652_10052515 | Ga0207652_100525154 | 163 |
| 1078 | 3300025921 | Ga0207652_10399292 | Ga0207652_103992922 | 163 |
| 1079 | 3300025921 | Ga0207652_10697637 | Ga0207652_106976372 | 163 |
| 1080 | 3300025921 | Ga0207652_10727255 | Ga0207652_107272551 | 163 |
| 1081 | 3300025922 | Ga0207646_10067972 | Ga0207646_100679723 | 163 |
| 1082 | 3300025922 | Ga0207646_10146933 | Ga0207646_101469333 | 163 |
| 1083 | 3300025922 | Ga0207646_10167580 | Ga0207646_101675802 | 163 |
| 1084 | 3300025922 | Ga0207646_10658221 | Ga0207646_106582212 | 163 |
| 1085 | 3300025922 | Ga0207646_10771753 | Ga0207646_107717532 | 163 |
| 1086 | 3300025922 | Ga0207646_10980208 | Ga0207646_109802081 | 163 |
| 1087 | 3300025923 | Ga0207681_10009178 | Ga0207681_100091782 | 163 |
| 1088 | 3300025923 | Ga0207681_10036364 | Ga0207681_100363643 | 163 |
| 1089 | 3300025923 | Ga0207681_10051798 | Ga0207681_100517982 | 163 |
| 1090 | 3300025923 | Ga0207681_10438186 | Ga0207681_104381862 | 163 |
| 1091 | 3300025925 | Ga0207650_10002374 | Ga0207650_100023749 | 163 |
| 1092 | 3300025925 | Ga0207650_10295594 | Ga0207650_102955942 | 163 |
| 1093 | 3300025925 | Ga0207650_10549731 | Ga0207650_105497311 | 163 |
| 1094 | 3300025925 | Ga0207650_10801154 | Ga0207650_108011542 | 163 |
| 1095 | 3300025926 | Ga0207659_10000079 | Ga0207659_1000007930 | 163 |
| 1096 | 3300025926 | Ga0207659_10001272 | Ga0207659_100012723 | 163 |
| 1097 | 3300025926 | Ga0207659_10012585 | Ga0207659_100125853 | 163 |
| 1098 | 3300025926 | Ga0207659_10029655 | Ga0207659_100296552 | 163 |
| 1099 | 3300025926 | Ga0207659_10058294 | Ga0207659_100582942 | 163 |
| 1100 | 3300025926 | Ga0207659_10163907 | Ga0207659_101639072 | 163 |
| 1101 | 3300025926 | Ga0207659_10235224 | Ga0207659_102352241 | 163 |
| 1102 | 3300025926 | Ga0207659_10581384 | Ga0207659_105813842 | 163 |
| 1103 | 3300025927 | Ga0207687_10136073 | Ga0207687_101360732 | 163 |
| 1104 | 3300025927 | Ga0207687_10263500 | Ga0207687_102635002 | 163 |
| 1105 | 3300025927 | Ga0207687_11381762 | Ga0207687_113817622 | 163 |
| 1106 | 3300025928 | Ga0207700_10006132 | Ga0207700_100061322 | 163 |
| 1107 | 3300025928 | Ga0207700_11121973 | Ga0207700_111219731 | 163 |
| 1108 | 3300025931 | Ga0207644_10098430 | Ga0207644_100984302 | 163 |
| 1109 | 3300025931 | Ga0207644_10103306 | Ga0207644_101033062 | 163 |
| 1110 | 3300025931 | Ga0207644_10464392 | Ga0207644_104643922 | 163 |
| 1111 | 3300025931 | Ga0207644_11140984 | Ga0207644_111409842 | 163 |
| 1112 | 3300025932 | Ga0207690_10116446 | Ga0207690_101164462 | 163 |
| 1113 | 3300025933 | Ga0207706_10006050 | Ga0207706_100060509 | 163 |
| 1114 | 3300025933 | Ga0207706_10101857 | Ga0207706_101018572 | 163 |
| 1115 | 3300025933 | Ga0207706_10134783 | Ga0207706_101347832 | 163 |
| 1116 | 3300025933 | Ga0207706_10164552 | Ga0207706_101645522 | 163 |
| 1117 | 3300025933 | Ga0207706_10902198 | Ga0207706_109021982 | 163 |
| 1118 | 3300025934 | Ga0207686_10020581 | Ga0207686_100205812 | 163 |
| 1119 | 3300025934 | Ga0207686_10647968 | Ga0207686_106479681 | 163 |
| 1120 | 3300025935 | Ga0207709_10006292 | Ga0207709_100062923 | 163 |
| 1121 | 3300025935 | Ga0207709_10194962 | Ga0207709_101949622 | 163 |
| 1122 | 3300025936 | Ga0207670_10002109 | Ga0207670_100021098 | 163 |
| 1123 | 3300025936 | Ga0207670_10163474 | Ga0207670_101634742 | 163 |
| 1124 | 3300025936 | Ga0207670_10250581 | Ga0207670_102505812 | 163 |
| 1125 | 3300025936 | Ga0207670_10639302 | Ga0207670_106393022 | 163 |
| 1126 | 3300025937 | Ga0207669_10322202 | Ga0207669_103222022 | 163 |
| 1127 | 3300025937 | Ga0207669_10702761 | Ga0207669_107027612 | 163 |
| 1128 | 3300025937 | Ga0207669_10889369 | Ga0207669_108893691 | 163 |
| 1129 | 3300025938 | Ga0207704_10001806 | Ga0207704_100018065 | 163 |
| 1130 | 3300025938 | Ga0207704_10022964 | Ga0207704_100229644 | 163 |
| 1131 | 3300025938 | Ga0207704_10095293 | Ga0207704_100952932 | 163 |
| 1132 | 3300025938 | Ga0207704_10668633 | Ga0207704_106686332 | 163 |
| 1133 | 3300025939 | Ga0207665_10090888 | Ga0207665_100908883 | 163 |
| 1134 | 3300025940 | Ga0207691_10018862 | Ga0207691_100188626 | 163 |
| 1135 | 3300025940 | Ga0207691_10045113 | Ga0207691_100451133 | 163 |
| 1136 | 3300025940 | Ga0207691_10070189 | Ga0207691_100701892 | 163 |
| 1137 | 3300025940 | Ga0207691_10122904 | Ga0207691_101229042 | 163 |
| 1138 | 3300025940 | Ga0207691_10538456 | Ga0207691_105384562 | 163 |
| 1139 | 3300025940 | Ga0207691_10642074 | Ga0207691_106420741 | 163 |
| 1140 | 3300025940 | Ga0207691_10649339 | Ga0207691_106493391 | 163 |
| 1141 | 3300025941 | Ga0207711_10006268 | Ga0207711_100062684 | 163 |
| 1142 | 3300025941 | Ga0207711_10027728 | Ga0207711_100277282 | 163 |
| 1143 | 3300025941 | Ga0207711_10082424 | Ga0207711_100824242 | 163 |
| 1144 | 3300025941 | Ga0207711_10141424 | Ga0207711_101414243 | 163 |
| 1145 | 3300025941 | Ga0207711_10379055 | Ga0207711_103790552 | 163 |
| 1146 | 3300025941 | Ga0207711_10584376 | Ga0207711_105843762 | 163 |
| 1147 | 3300025941 | Ga0207711_11097910 | Ga0207711_110979102 | 163 |
| 1148 | 3300025942 | Ga0207689_10000032 | Ga0207689_100000322 | 163 |
| 1149 | 3300025942 | Ga0207689_10045085 | Ga0207689_100450852 | 163 |
| 1150 | 3300025942 | Ga0207689_10081837 | Ga0207689_100818373 | 163 |
| 1151 | 3300025942 | Ga0207689_10125401 | Ga0207689_101254012 | 163 |
| 1152 | 3300025942 | Ga0207689_10228789 | Ga0207689_102287892 | 163 |
| 1153 | 3300025942 | Ga0207689_10323548 | Ga0207689_103235482 | 163 |
| 1154 | 3300025944 | Ga0207661_10334552 | Ga0207661_103345522 | 163 |
| 1155 | 3300025944 | Ga0207661_10342356 | Ga0207661_103423563 | 163 |
| 1156 | 3300025944 | Ga0207661_10795048 | Ga0207661_107950482 | 163 |
| 1157 | 3300025945 | Ga0207679_10073204 | Ga0207679_100732042 | 163 |
| 1158 | 3300025945 | Ga0207679_10686495 | Ga0207679_106864952 | 163 |
| 1159 | 3300025945 | Ga0207679_10744666 | Ga0207679_107446662 | 163 |
| 1160 | 3300025945 | Ga0207679_10801763 | Ga0207679_108017632 | 163 |
| 1161 | 3300025945 | Ga0207679_11371468 | Ga0207679_113714681 | 163 |
| 1162 | 3300025949 | Ga0207667_10104283 | Ga0207667_101042835 | 163 |
| 1163 | 3300025960 | Ga0207651_10010999 | Ga0207651_100109994 | 163 |
| 1164 | 3300025960 | Ga0207651_10048187 | Ga0207651_100481872 | 163 |
| 1165 | 3300025960 | Ga0207651_10342397 | Ga0207651_103423972 | 163 |
| 1166 | 3300025960 | Ga0207651_10524791 | Ga0207651_105247912 | 163 |
| 1167 | 3300025961 | Ga0207712_10073047 | Ga0207712_100730472 | 163 |
| 1168 | 3300025961 | Ga0207712_10260004 | Ga0207712_102600042 | 163 |
| 1169 | 3300025961 | Ga0207712_11279341 | Ga0207712_112793411 | 163 |
| 1170 | 3300025972 | Ga0207668_11564651 | Ga0207668_115646511 | 163 |
| 1171 | 3300025981 | Ga0207640_10873542 | Ga0207640_108735422 | 163 |
| 1172 | 3300025981 | Ga0207640_10910496 | Ga0207640_109104962 | 163 |
| 1173 | 3300025981 | Ga0207640_11062493 | Ga0207640_110624932 | 163 |
| 1174 | 3300026023 | Ga0207677_10201274 | Ga0207677_102012742 | 163 |
| 1175 | 3300026023 | Ga0207677_10270975 | Ga0207677_102709752 | 163 |
| 1176 | 3300026023 | Ga0207677_10331780 | Ga0207677_103317802 | 163 |
| 1177 | 3300026023 | Ga0207677_10557228 | Ga0207677_105572282 | 163 |
| 1178 | 3300026035 | Ga0207703_10008882 | Ga0207703_100088826 | 163 |
| 1179 | 3300026035 | Ga0207703_10045404 | Ga0207703_100454043 | 163 |
| 1180 | 3300026035 | Ga0207703_10049674 | Ga0207703_100496743 | 163 |
| 1181 | 3300026035 | Ga0207703_10065358 | Ga0207703_100653581 | 163 |
| 1182 | 3300026035 | Ga0207703_10167253 | Ga0207703_101672531 | 163 |
| 1183 | 3300026035 | Ga0207703_10227604 | Ga0207703_102276042 | 163 |
| 1184 | 3300026035 | Ga0207703_10838593 | Ga0207703_108385931 | 163 |
| 1185 | 3300026035 | Ga0207703_10888294 | Ga0207703_108882942 | 163 |
| 1186 | 3300026035 | Ga0207703_11245904 | Ga0207703_112459042 | 163 |
| 1187 | 3300026067 | Ga0207678_10054360 | Ga0207678_100543602 | 163 |
| 1188 | 3300026075 | Ga0207708_10004043 | Ga0207708_100040433 | 163 |
| 1189 | 3300026075 | Ga0207708_10102480 | Ga0207708_101024802 | 163 |
| 1190 | 3300026075 | Ga0207708_10132107 | Ga0207708_101321072 | 163 |
| 1191 | 3300026075 | Ga0207708_10419909 | Ga0207708_104199092 | 163 |
| 1192 | 3300026078 | Ga0207702_10314643 | Ga0207702_103146432 | 163 |
| 1193 | 3300026088 | Ga0207641_10000955 | Ga0207641_1000095512 | 163 |
| 1194 | 3300026088 | Ga0207641_10106423 | Ga0207641_101064233 | 163 |
| 1195 | 3300026088 | Ga0207641_10329613 | Ga0207641_103296132 | 163 |
| 1196 | 3300026088 | Ga0207641_10341335 | Ga0207641_103413352 | 163 |
| 1197 | 3300026089 | Ga0207648_10001379 | Ga0207648_100013798 | 163 |
| 1198 | 3300026089 | Ga0207648_10053012 | Ga0207648_100530123 | 163 |
| 1199 | 3300026089 | Ga0207648_10139264 | Ga0207648_101392642 | 163 |
| 1200 | 3300026089 | Ga0207648_10211164 | Ga0207648_102111642 | 163 |
| 1201 | 3300026089 | Ga0207648_10254914 | Ga0207648_102549143 | 163 |
| 1202 | 3300026089 | Ga0207648_10334651 | Ga0207648_103346512 | 163 |
| 1203 | 3300026089 | Ga0207648_11467147 | Ga0207648_114671471 | 163 |
| 1204 | 3300026095 | Ga0207676_10014812 | Ga0207676_100148122 | 163 |
| 1205 | 3300026095 | Ga0207676_10032483 | Ga0207676_100324833 | 163 |
| 1206 | 3300026095 | Ga0207676_10034193 | Ga0207676_100341932 | 163 |
| 1207 | 3300026095 | Ga0207676_10109644 | Ga0207676_101096443 | 163 |
| 1208 | 3300026095 | Ga0207676_10150793 | Ga0207676_101507932 | 163 |
| 1209 | 3300026095 | Ga0207676_10307813 | Ga0207676_103078132 | 163 |
| 1210 | 3300026116 | Ga0207674_10707475 | Ga0207674_107074752 | 163 |
| 1211 | 3300026118 | Ga0207675_100087094 | Ga0207675_1000870943 | 163 |
| 1212 | 3300026118 | Ga0207675_100088170 | Ga0207675_1000881703 | 163 |
| 1213 | 3300026118 | Ga0207675_100115838 | Ga0207675_1001158382 | 163 |
| 1214 | 3300026118 | Ga0207675_100230505 | Ga0207675_1002305052 | 163 |
| 1215 | 3300026118 | Ga0207675_100254408 | Ga0207675_1002544082 | 163 |
| 1216 | 3300026118 | Ga0207675_100347885 | Ga0207675_1003478852 | 163 |
| 1217 | 3300026118 | Ga0207675_100385732 | Ga0207675_1003857321 | 163 |
| 1218 | 3300026118 | Ga0207675_100618544 | Ga0207675_1006185441 | 163 |
| 1219 | 3300026118 | Ga0207675_100857438 | Ga0207675_1008574382 | 163 |
| 1220 | 3300026118 | Ga0207675_101042915 | Ga0207675_1010429152 | 163 |
| 1221 | 3300026121 | Ga0207683_10033044 | Ga0207683_100330443 | 163 |
| 1222 | 3300026121 | Ga0207683_10206224 | Ga0207683_102062242 | 163 |
| 1223 | 3300026121 | Ga0207683_10313072 | Ga0207683_103130722 | 163 |
| 1224 | 3300026121 | Ga0207683_10414536 | Ga0207683_104145361 | 163 |
| 1225 | 3300026121 | Ga0207683_10558342 | Ga0207683_105583422 | 163 |
| 1226 | 3300026121 | Ga0207683_10800358 | Ga0207683_108003582 | 163 |
| 1227 | 3300026142 | Ga0207698_10400208 | Ga0207698_104002082 | 163 |
| 1228 | 3300027665 | Ga0209983_1106675 | Ga0209983_11066752 | 163 |
| 1229 | 3300027682 | Ga0209971_1026227 | Ga0209971_10262272 | 163 |
| 1230 | 3300027907 | Ga0207428_10000156 | Ga0207428_1000015646 | 163 |
| 1231 | 3300027907 | Ga0207428_10006617 | Ga0207428_100066173 | 163 |
| 1232 | 3300027907 | Ga0207428_10007795 | Ga0207428_100077953 | 163 |
| 1233 | 3300027907 | Ga0207428_10017798 | Ga0207428_100177983 | 163 |
| 1234 | 3300027907 | Ga0207428_10035587 | Ga0207428_100355873 | 163 |
| 1235 | 3300027907 | Ga0207428_10331834 | Ga0207428_103318342 | 163 |
| 1236 | 3300028379 | Ga0268266_10204191 | Ga0268266_102041912 | 163 |
| 1237 | 3300028380 | Ga0268265_10007655 | Ga0268265_100076553 | 163 |
| 1238 | 3300028380 | Ga0268265_10221870 | Ga0268265_102218702 | 163 |
| 1239 | 3300028380 | Ga0268265_10595829 | Ga0268265_105958292 | 163 |
| 1240 | 3300028381 | Ga0268264_10023300 | Ga0268264_100233002 | 163 |
| 1241 | 3300028381 | Ga0268264_10035080 | Ga0268264_100350803 | 163 |
| 1242 | 3300028381 | Ga0268264_10148355 | Ga0268264_101483552 | 163 |
| 1243 | 3300028381 | Ga0268264_10278405 | Ga0268264_102784051 | 163 |
| 1244 | 3300028381 | Ga0268264_10334699 | Ga0268264_103346992 | 163 |
| 1245 | 3300031344 | Ga0265316_10444674 | Ga0265316_104446742 | 163 |
| 1246 | 3300031548 | Ga0307408_100078365 | Ga0307408_1000783652 | 163 |
| 1247 | 3300031548 | Ga0307408_100081459 | Ga0307408_1000814593 | 163 |
| 1248 | 3300031548 | Ga0307408_100803021 | Ga0307408_1008030212 | 163 |
| 1249 | 3300031731 | Ga0307405_10079173 | Ga0307405_100791732 | 163 |
| 1250 | 3300031731 | Ga0307405_10112523 | Ga0307405_101125232 | 163 |
| 1251 | 3300031731 | Ga0307405_10597284 | Ga0307405_105972842 | 163 |
| 1252 | 3300031824 | Ga0307413_10100156 | Ga0307413_101001562 | 163 |
| 1253 | 3300031824 | Ga0307413_10927710 | Ga0307413_109277102 | 163 |
| 1254 | 3300031852 | Ga0307410_10124814 | Ga0307410_101248142 | 163 |
| 1255 | 3300031852 | Ga0307410_10835309 | Ga0307410_108353092 | 163 |
| 1256 | 3300031901 | Ga0307406_10343830 | Ga0307406_103438302 | 163 |
| 1257 | 3300031903 | Ga0307407_10084019 | Ga0307407_100840192 | 163 |
| 1258 | 3300031911 | Ga0307412_10542345 | Ga0307412_105423452 | 163 |
| 1259 | 3300031995 | Ga0307409_100074356 | Ga0307409_1000743563 | 163 |
| 1260 | 3300031995 | Ga0307409_100300793 | Ga0307409_1003007932 | 163 |
| 1261 | 3300032002 | Ga0307416_100028056 | Ga0307416_1000280564 | 163 |
| 1262 | 3300032002 | Ga0307416_100038313 | Ga0307416_1000383132 | 163 |
| 1263 | 3300032002 | Ga0307416_100059664 | Ga0307416_1000596641 | 163 |
| 1264 | 3300032002 | Ga0307416_100707017 | Ga0307416_1007070172 | 163 |
| 1265 | 3300032004 | Ga0307414_10129721 | Ga0307414_101297212 | 163 |
| 1266 | 3300032004 | Ga0307414_10349360 | Ga0307414_103493602 | 163 |
| 1267 | 3300032004 | Ga0307414_10615760 | Ga0307414_106157602 | 163 |
| 1268 | 3300032004 | Ga0307414_10640988 | Ga0307414_106409882 | 163 |
| 1269 | 3300032004 | Ga0307414_11121239 | Ga0307414_111212392 | 163 |
| 1270 | 3300032005 | Ga0307411_10114535 | Ga0307411_101145352 | 163 |
| 1271 | 3300032005 | Ga0307411_10117822 | Ga0307411_101178222 | 163 |
| 1272 | 3300032005 | Ga0307411_10460682 | Ga0307411_104606822 | 163 |
| 1273 | 3300032126 | Ga0307415_100010673 | Ga0307415_1000106733 | 163 |
| 1274 | 3300032126 | Ga0307415_100154027 | Ga0307415_1001540272 | 163 |
| 1275 | 3300032126 | Ga0307415_101172548 | Ga0307415_1011725482 | 163 |
| 1276 | 3300034816 | Ga0373930_0002854 | Ga0373930_0002854_1087_1692 | 163 |
| 1277 | 3300034817 | Ga0373948_0018575 | Ga0373948_0018575_273_878 | 163 |
| 1278 | 3300034818 | Ga0373950_0000492 | Ga0373950_0000492_1192_1797 | 163 |
| 1279 | 3300034819 | Ga0373958_0024338 | Ga0373958_0024338_501_1106 | 163 |
| 1280 | 3300035084 | Ga0373928_0006977 | Ga0373928_0006977_61_597 | 163 |
| 1281 | 3300035085 | Ga0373929_0000407 | Ga0373929_0000407_3871_4476 | 163 |
| 1282 | 3300035090 | Ga0373949_0000966 | Ga0373949_0000966_8263_8868 | 163 |
| 1283 | 3300035092 | Ga0373952_0000798 | Ga0373952_0000798_4450_5055 | 163 |
| 1284 | 3300035114 | Ga0373939_0030625 | Ga0373939_0030625_253_792 | 163 |
| 1285 | 3300035114 | Ga0373939_0109649 | Ga0373939_0109649_317_922 | 163 |
| 1286 | 3300035115 | Ga0373941_0013295 | Ga0373941_0013295_1595_2134 | 163 |
| 1287 | 3300035115 | Ga0373941_0183910 | Ga0373941_0183910_23_526 | 163 |
| 1288 | 3300035121 | Ga0373960_0217085 | Ga0373960_0217085_121_666 | 163 |
| 1289 | 3300035170 | Ga0373943_0224021 | Ga0373943_0224021_280_777 | 163 |
| 1290 | 3300035172 | Ga0373955_0046443 | Ga0373955_0046443_706_1209 | 163 |
| 1291 | 3300035172 | Ga0373955_0442855 | Ga0373955_0442855_127_624 | 163 |
| 1292 | 3300035172 | Ga0373955_0842861 | Ga0373955_0842861_12_509 | 163 |
| 1293 | 3300035207 | Ga0373942_0001566 | Ga0373942_0001566_4506_5111 | 163 |
| 1294 | 3300035691 | Ga0373931_0007480 | Ga0373931_0007480_3272_3877 | 163 |
| 1295 | 3300035692 | Ga0373935_0134413 | Ga0373935_0134413_865_1410 | 163 |
| 1296 | 3300035692 | Ga0373935_0185751 | Ga0373935_0185751_739_1236 | 163 |
| 1297 | 3300035724 | Ga0373933_0740285 | Ga0373933_0740285_22_519 | 163 |
| 1298 | 3300036401 | Ga0373937_0012405 | Ga0373937_0012405_6766_7269 | 163 |
| 1299 | 3300036401 | Ga0373937_0176206 | Ga0373937_0176206_447_944 | 163 |
| 1300 | 3300036401 | Ga0373937_0608866 | Ga0373937_0608866_395_904 | 163 |
| 1301 | 3300038996 | Ga0242420_027094 | Ga0242420_027094_437_949 | 163 |
| 1302 | 3300039437 | Ga0436365_1732685 | Ga0436365_1732685_694_1191 | 163 |
| 1303 | 3300041406 | Ga0439439_0093016 | Ga0439439_0093016_160_660 | 163 |
| 1304 | 3300041408 | Ga0439453_0017767 | Ga0439453_0017767_442_963 | 163 |
| 1305 | 3300041408 | Ga0439453_0026277 | Ga0439453_0026277_566_1057 | 163 |
| 1306 | 3300041997 | Ga0439431_0006753 | Ga0439431_0006753_505_1002 | 163 |
| 1307 | 3300041999 | Ga0439433_0001889 | Ga0439433_0001889_1555_2052 | 163 |
| 1308 | 3300042000 | Ga0439437_014446 | Ga0439437_014446_138_680 | 163 |
| 1309 | 3300042015 | Ga0439462_0051606 | Ga0439462_0051606_532_1035 | 163 |
| 1310 | 3300042156 | Ga0439446_0028655 | Ga0439446_0028655_338_838 | 163 |
| 1311 | 3300042156 | Ga0439446_0095397 | Ga0439446_0095397_242_739 | 163 |
| 1312 | 3300042156 | Ga0439446_0251776 | Ga0439446_0251776_18_554 | 163 |
| 1313 | 3300042157 | Ga0439458_0092357 | Ga0439458_0092357_197_688 | 163 |
| 1314 | 3300042439 | Ga0439464_0061668 | Ga0439464_0061668_430_960 | 163 |
| 1315 | 3300042461 | Ga0439460_0063976 | Ga0439460_0063976_72_602 | 163 |
| 1316 | 3300042461 | Ga0439460_0123444 | Ga0439460_0123444_325_819 | 163 |
| 1317 | 3300042876 | Ga0451577_0424665 | Ga0451577_0424665_401_919 | 163 |
| 1318 | 3300042993 | Ga0439440_0033118 | Ga0439440_0033118_17_508 | 163 |
| 1319 | 3300042993 | Ga0439440_0098351 | Ga0439440_0098351_131_628 | 163 |
| 1320 | 3300044694 | Ga0466963_0239302 | Ga0466963_0239302_357_872 | 163 |
| 1321 | 3300045051 | Ga0451576_0301734 | Ga0451576_0301734_66_665 | 163 |
| 1322 | 3300046454 | Ga0495592_0139872 | Ga0495592_0139872_1092_1595 | 163 |
| 1323 | 3300046455 | Ga0495603_0028319 | Ga0495603_0028319_810_1355 | 163 |
| 1324 | 3300046459 | Ga0495629_0085053 | Ga0495629_0085053_453_956 | 163 |
| 1325 | 3300046459 | Ga0495629_0206389 | Ga0495629_0206389_823_1326 | 163 |
| 1326 | 3300046472 | Ga0495580_0316248 | Ga0495580_0316248_255_764 | 163 |
| 1327 | 3300046473 | Ga0495582_0472333 | Ga0495582_0472333_172_675 | 163 |
| 1328 | 3300046475 | Ga0495639_0076786 | Ga0495639_0076786_395_898 | 163 |
| 1329 | 3300046491 | Ga0495584_0025210 | Ga0495584_0025210_2058_2606 | 163 |
| 1330 | 3300046491 | Ga0495584_0410163 | Ga0495584_0410163_90_605 | 163 |
| 1331 | 3300046499 | Ga0495594_0066860 | Ga0495594_0066860_1336_1881 | 163 |
| 1332 | 3300046514 | Ga0495618_0617134 | Ga0495618_0617134_20_565 | 163 |
| 1333 | 3300046517 | Ga0495630_1022797 | Ga0495630_1022797_44_547 | 163 |
| 1334 | 3300046522 | Ga0495643_0009097 | Ga0495643_0009097_4303_4842 | 163 |
| 1335 | 3300046523 | Ga0495644_0096332 | Ga0495644_0096332_248_796 | 163 |
| 1336 | 3300046525 | Ga0495663_0017329 | Ga0495663_0017329_1131_1679 | 163 |
| 1337 | 3300046529 | Ga0495652_0635473 | Ga0495652_0635473_23_526 | 163 |
| 1338 | 3300046530 | Ga0495654_0322069 | Ga0495654_0322069_97_609 | 163 |
| 1339 | 3300046533 | Ga0495640_0047607 | Ga0495640_0047607_1457_1960 | 163 |
| 1340 | 3300046536 | Ga0495587_0176508 | Ga0495587_0176508_619_1122 | 163 |
| 1341 | 3300046537 | Ga0495598_0012654 | Ga0495598_0012654_1112_1660 | 163 |
| 1342 | 3300046537 | Ga0495598_0117596 | Ga0495598_0117596_202_729 | 163 |
| 1343 | 3300046537 | Ga0495598_0146081 | Ga0495598_0146081_100_648 | 163 |
| 1344 | 3300046538 | Ga0495609_0019629 | Ga0495609_0019629_2390_2938 | 163 |
| 1345 | 3300046539 | Ga0495621_0109503 | Ga0495621_0109503_505_1032 | 163 |
| 1346 | 3300046539 | Ga0495621_0116445 | Ga0495621_0116445_406_897 | 163 |
| 1347 | 3300046543 | Ga0495645_0000450 | Ga0495645_0000450_23785_24288 | 163 |
| 1348 | 3300046558 | Ga0495633_0093088 | Ga0495633_0093088_126_668 | 163 |
| 1349 | 3300046648 | Ga0495611_0197354 | Ga0495611_0197354_325_828 | 163 |
| 1350 | 3300046664 | Ga0495659_0015579 | Ga0495659_0015579_1237_1782 | 163 |
| 1351 | 3300046664 | Ga0495659_0191227 | Ga0495659_0191227_90_638 | 163 |
| 1352 | 3300046674 | Ga0495588_0057859 | Ga0495588_0057859_992_1537 | 163 |
| 1353 | 3300046675 | Ga0495657_0311723 | Ga0495657_0311723_75_578 | 163 |
| 1354 | 3300046683 | Ga0495658_0025322 | Ga0495658_0025322_1258_1797 | 163 |
| 1355 | 3300046683 | Ga0495658_0090500 | Ga0495658_0090500_496_999 | 163 |
| 1356 | 3300046683 | Ga0495658_0168637 | Ga0495658_0168637_833_1336 | 163 |
| 1357 | 3300046683 | Ga0495658_0580717 | Ga0495658_0580717_99_644 | 163 |
| 1358 | 3300046684 | Ga0495669_0103649 | Ga0495669_0103649_510_1058 | 163 |
| 1359 | 3300047318 | Ga0495636_0043766 | Ga0495636_0043766_97_642 | 163 |
| 1360 | 3300047319 | Ga0495674_0082858 | Ga0495674_0082858_604_1107 | 163 |
| 1361 | 3300047319 | Ga0495674_0091091 | Ga0495674_0091091_1566_2063 | 163 |
| 1362 | 3300047445 | Ga0495677_0021678 | Ga0495677_0021678_1095_1643 | 163 |
| 1363 | 3300047447 | Ga0495685_063483 | Ga0495685_063483_202_750 | 163 |
| 1364 | 3300047471 | Ga0495684_0025447 | Ga0495684_0025447_2593_3096 | 163 |
| 1365 | 3300047673 | Ga0495593_0174023 | Ga0495593_0174023_114_617 | 163 |
| 1366 | 3300048904 | Ga0496101_0163598 | Ga0496101_0163598_103_642 | 163 |
| 1367 | 3300048905 | Ga0496102_0365200 | Ga0496102_0365200_648_1151 | 163 |
| 1368 | 3300048908 | Ga0496105_0534097 | Ga0496105_0534097_51_599 | 163 |
| 1369 | 3300048909 | Ga0496106_0080483 | Ga0496106_0080483_560_1126 | 163 |
| 1370 | 3300048911 | Ga0496108_0228402 | Ga0496108_0228402_121_612 | 163 |
| 1371 | 3300048911 | Ga0496108_0685751 | Ga0496108_0685751_75_614 | 163 |
| 1372 | 3300048911 | Ga0496108_0934304 | Ga0496108_0934304_180_677 | 163 |
| 1373 | 3300048912 | Ga0496109_0079029 | Ga0496109_0079029_921_1418 | 163 |
| 1374 | 3300048912 | Ga0496109_0165002 | Ga0496109_0165002_722_1213 | 163 |
| 1375 | 3300048912 | Ga0496109_0585075 | Ga0496109_0585075_232_771 | 163 |
| 1376 | 3300048913 | Ga0496110_0659312 | Ga0496110_0659312_14_553 | 163 |
| 1377 | 3300048914 | Ga0496111_0221188 | Ga0496111_0221188_250_762 | 163 |
| 1378 | 3300048914 | Ga0496111_1030007 | Ga0496111_1030007_19_522 | 163 |
| 1379 | 3300048915 | Ga0496112_0002810 | Ga0496112_0002810_11391_11894 | 163 |
| 1380 | 3300048915 | Ga0496112_0216587 | Ga0496112_0216587_1193_1699 | 163 |
| 1381 | 3300048915 | Ga0496112_0242980 | Ga0496112_0242980_403_906 | 163 |
| 1382 | 3300048915 | Ga0496112_0456036 | Ga0496112_0456036_565_1062 | 163 |
| 1383 | 3300048915 | Ga0496112_0741276 | Ga0496112_0741276_308_811 | 163 |
| 1384 | 3300048916 | Ga0496113_0379672 | Ga0496113_0379672_202_705 | 163 |
| 1385 | 3300048917 | Ga0496114_0050503 | Ga0496114_0050503_2300_2803 | 163 |
| 1386 | 3300048917 | Ga0496114_0124083 | Ga0496114_0124083_537_1043 | 163 |
| 1387 | 3300048917 | Ga0496114_0198014 | Ga0496114_0198014_484_987 | 163 |
| 1388 | 3300048917 | Ga0496114_0357960 | Ga0496114_0357960_546_1079 | 163 |
| 1389 | 3300048917 | Ga0496114_0508159 | Ga0496114_0508159_329_832 | 163 |
| 1390 | 3300049568 | Ga0501031_0245236 | Ga0501031_0245236_160_651 | 163 |
| 1391 | 3300049568 | Ga0501031_0281248 | Ga0501031_0281248_212_724 | 163 |
| 1392 | 3300049571 | Ga0501034_0158536 | Ga0501034_0158536_1066_1599 | 163 |
| 1393 | 3300049572 | Ga0501036_0258953 | Ga0501036_0258953_64_612 | 163 |
| 1394 | 3300049572 | Ga0501036_0316407 | Ga0501036_0316407_75_566 | 163 |
| 1395 | 3300049572 | Ga0501036_0632035 | Ga0501036_0632035_288_815 | 163 |
| 1396 | 3300049573 | Ga0501037_0177620 | Ga0501037_0177620_918_1466 | 163 |
| 1397 | 3300049573 | Ga0501037_0531813 | Ga0501037_0531813_79_612 | 163 |
| 1398 | 3300049574 | Ga0501038_0043210 | Ga0501038_0043210_1350_1898 | 163 |
| 1399 | 3300049574 | Ga0501038_0134017 | Ga0501038_0134017_1484_1975 | 163 |
| 1400 | 3300049575 | Ga0501039_0005083 | Ga0501039_0005083_1155_1646 | 163 |
| 1401 | 3300049576 | Ga0501040_0009144 | Ga0501040_0009144_92_640 | 163 |
| 1402 | 3300049576 | Ga0501040_0021727 | Ga0501040_0021727_1669_2160 | 163 |
| 1403 | 3300049576 | Ga0501040_0049618 | Ga0501040_0049618_1727_2218 | 163 |
| 1404 | 3300049577 | Ga0501041_0080818 | Ga0501041_0080818_1027_1518 | 163 |
| 1405 | 3300049577 | Ga0501041_0944903 | Ga0501041_0944903_28_519 | 163 |
| 1406 | 3300049578 | Ga0501042_0003809 | Ga0501042_0003809_2563_3054 | 163 |
| 1407 | 3300049578 | Ga0501042_0085038 | Ga0501042_0085038_1243_1734 | 163 |
| 1408 | 3300049579 | Ga0501043_0038916 | Ga0501043_0038916_942_1490 | 163 |
| 1409 | 3300049580 | Ga0501046_0047476 | Ga0501046_0047476_938_1429 | 163 |
| 1410 | 3300049580 | Ga0501046_0054245 | Ga0501046_0054245_1325_1816 | 163 |
| 1411 | 3300049581 | Ga0501047_0453613 | Ga0501047_0453613_15_548 | 163 |
| 1412 | 3300049582 | Ga0501048_0049799 | Ga0501048_0049799_1399_1947 | 163 |
| 1413 | 3300049582 | Ga0501048_0279882 | Ga0501048_0279882_579_1070 | 163 |
| 1414 | 3300049584 | Ga0501068_0082561 | Ga0501068_0082561_484_1032 | 163 |
| 1415 | 3300049584 | Ga0501068_0511945 | Ga0501068_0511945_173_664 | 163 |
| 1416 | 3300049587 | Ga0501071_0015832 | Ga0501071_0015832_1447_1995 | 163 |
| 1417 | 3300049587 | Ga0501071_0934381 | Ga0501071_0934381_53_544 | 163 |
| 1418 | 3300049588 | Ga0501072_0006572 | Ga0501072_0006572_5086_5577 | 163 |
| 1419 | 3300049588 | Ga0501072_0026593 | Ga0501072_0026593_1320_1811 | 163 |
| 1420 | 3300049591 | Ga0501075_0023042 | Ga0501075_0023042_3579_4070 | 163 |
| 1421 | 3300049591 | Ga0501075_0110545 | Ga0501075_0110545_408_899 | 163 |
| 1422 | 3300049591 | Ga0501075_0468852 | Ga0501075_0468852_169_717 | 163 |
| 1423 | 3300049592 | Ga0501076_0040773 | Ga0501076_0040773_10_501 | 163 |
| 1424 | 3300049592 | Ga0501076_0136177 | Ga0501076_0136177_1273_1782 | 163 |
| 1425 | 3300049593 | Ga0501077_0047177 | Ga0501077_0047177_943_1491 | 163 |
| 1426 | 3300049593 | Ga0501077_0072533 | Ga0501077_0072533_745_1254 | 163 |
| 1427 | 3300049660 | Ga0501216_072708 | Ga0501216_072708_27_524 | 163 |
| 1428 | 3300049704 | Ga0501221_035984 | Ga0501221_035984_109_606 | 163 |
| 1429 | 3300049741 | Ga0501079_0005197 | Ga0501079_0005197_8060_8608 | 163 |
| 1430 | 3300049741 | Ga0501079_0087472 | Ga0501079_0087472_921_1412 | 163 |
| 1431 | 3300049742 | Ga0501080_0425907 | Ga0501080_0425907_628_1119 | 163 |
| 1432 | 3300049743 | Ga0501081_0008696 | Ga0501081_0008696_3764_4255 | 163 |
| 1433 | 3300049743 | Ga0501081_0041776 | Ga0501081_0041776_2349_2897 | 163 |
| 1434 | 3300049743 | Ga0501081_0588644 | Ga0501081_0588644_236_727 | 163 |
| 1435 | 3300049822 | Ga0501035_0192170 | Ga0501035_0192170_1181_1729 | 163 |
| 1436 | 3300049822 | Ga0501035_0933073 | Ga0501035_0933073_41_574 | 163 |
| 1437 | 3300049822 | Ga0501035_0961356 | Ga0501035_0961356_94_585 | 163 |
| 1438 | 3300049823 | Ga0501044_0092948 | Ga0501044_0092948_1911_2444 | 163 |
| 1439 | 3300049823 | Ga0501044_1290198 | Ga0501044_1290198_65_556 | 163 |
| 1440 | 3300049824 | Ga0501045_0004657 | Ga0501045_0004657_1447_1995 | 163 |
| 1441 | 3300049824 | Ga0501045_0264909 | Ga0501045_0264909_241_732 | 163 |
| 1442 | 3300050489 | nmdc:mga03683_1149_c1 | nmdc:mga03683_1149_c1_2061_2585 | 163 |
| 1443 | 3300050491 | nmdc:mga00v17_7255_c1 | nmdc:mga00v17_7255_c1_35_541 | 163 |
| 1444 | 3300050492 | nmdc:mga0yw44_555493_c1 | nmdc:mga0yw44_555493_c1_80_577 | 163 |
| 1445 | 3300050507 | nmdc:mga05p37_11071_c1 | nmdc:mga05p37_11071_c1_8800_9345 | 163 |
| 1446 | 3300050507 | nmdc:mga05p37_139331_c1 | nmdc:mga05p37_139331_c1_721_1269 | 163 |
| 1447 | 3300050507 | nmdc:mga05p37_158861_c1 | nmdc:mga05p37_158861_c1_320_811 | 163 |
| 1448 | 3300050507 | nmdc:mga05p37_1997_c1 | nmdc:mga05p37_1997_c1_7928_8473 | 163 |
| 1449 | 3300050507 | nmdc:mga05p37_20363_c1 | nmdc:mga05p37_20363_c1_2511_3047 | 163 |
| 1450 | 3300050507 | nmdc:mga05p37_24698_c1 | nmdc:mga05p37_24698_c1_3673_4206 | 163 |
| 1451 | 3300050507 | nmdc:mga05p37_25595_c1 | nmdc:mga05p37_25595_c1_5984_6526 | 163 |
| 1452 | 3300050507 | nmdc:mga05p37_26118_c2 | nmdc:mga05p37_26118_c2_2946_3491 | 163 |
| 1453 | 3300050507 | nmdc:mga05p37_34921_c1 | nmdc:mga05p37_34921_c1_1405_1896 | 163 |
| 1454 | 3300050507 | nmdc:mga05p37_37736_c1 | nmdc:mga05p37_37736_c1_134_679 | 163 |
| 1455 | 3300050507 | nmdc:mga05p37_43651_c1 | nmdc:mga05p37_43651_c1_4126_4668 | 163 |
| 1456 | 3300050507 | nmdc:mga05p37_44023_c1 | nmdc:mga05p37_44023_c1_2323_2862 | 163 |
| 1457 | 3300050507 | nmdc:mga05p37_48901_c1 | nmdc:mga05p37_48901_c1_4213_4704 | 163 |
| 1458 | 3300050507 | nmdc:mga05p37_5217_c1 | nmdc:mga05p37_5217_c1_8021_8560 | 163 |
| 1459 | 3300050507 | nmdc:mga05p37_91576_c1 | nmdc:mga05p37_91576_c1_445_939 | 163 |
| 1460 | 3300050507 | nmdc:mga05p37_967626_c1 | nmdc:mga05p37_967626_c1_122_670 | 163 |
| 1461 | 3300050508 | nmdc:mga09592_1189676_c1 | nmdc:mga09592_1189676_c1_94_600 | 163 |
| 1462 | 3300050508 | nmdc:mga09592_13559_c1 | nmdc:mga09592_13559_c1_2843_3334 | 163 |
| 1463 | 3300050508 | nmdc:mga09592_139923_c1 | nmdc:mga09592_139923_c1_1229_1771 | 163 |
| 1464 | 3300050508 | nmdc:mga09592_19921_c1 | nmdc:mga09592_19921_c1_4294_4788 | 163 |
| 1465 | 3300050508 | nmdc:mga09592_23513_c1 | nmdc:mga09592_23513_c1_4401_4892 | 163 |
| 1466 | 3300050508 | nmdc:mga09592_26276_c1 | nmdc:mga09592_26276_c1_467_1012 | 163 |
| 1467 | 3300050508 | nmdc:mga09592_68792_c1 | nmdc:mga09592_68792_c1_376_867 | 163 |
| 1468 | 3300050509 | nmdc:mga0qj67_194295_c1 | nmdc:mga0qj67_194295_c1_78_569 | 163 |
| 1469 | 3300050509 | nmdc:mga0qj67_255819_c1 | nmdc:mga0qj67_255819_c1_313_804 | 163 |
| 1470 | 3300050509 | nmdc:mga0qj67_27328_c1 | nmdc:mga0qj67_27328_c1_782_1273 | 163 |
| 1471 | 3300050510 | nmdc:mga06r32_132439_c1 | nmdc:mga06r32_132439_c1_1394_1885 | 163 |
| 1472 | 3300050510 | nmdc:mga06r32_14936_c1 | nmdc:mga06r32_14936_c1_4915_5409 | 163 |
| 1473 | 3300050510 | nmdc:mga06r32_270474_c1 | nmdc:mga06r32_270474_c1_950_1492 | 163 |
| 1474 | 3300050510 | nmdc:mga06r32_29574_c1 | nmdc:mga06r32_29574_c1_853_1344 | 163 |
| 1475 | 3300050510 | nmdc:mga06r32_655429_c1 | nmdc:mga06r32_655429_c1_130_663 | 163 |
| 1476 | 3300050510 | nmdc:mga06r32_9476_c1 | nmdc:mga06r32_9476_c1_2396_2887 | 163 |
| 1477 | 3300050511 | nmdc:mga08y16_1367_c1 | nmdc:mga08y16_1367_c1_2935_3480 | 163 |
| 1478 | 3300050511 | nmdc:mga08y16_1568_c1 | nmdc:mga08y16_1568_c1_20058_20600 | 163 |
| 1479 | 3300050511 | nmdc:mga08y16_2507_c1 | nmdc:mga08y16_2507_c1_962_1471 | 163 |
| 1480 | 3300050511 | nmdc:mga08y16_2643_c1 | nmdc:mga08y16_2643_c1_881_1372 | 163 |
| 1481 | 3300050511 | nmdc:mga08y16_266469_c1 | nmdc:mga08y16_266469_c1_62_553 | 163 |
| 1482 | 3300050511 | nmdc:mga08y16_273804_c1 | nmdc:mga08y16_273804_c1_262_759 | 163 |
| 1483 | 3300050511 | nmdc:mga08y16_2862_c1 | nmdc:mga08y16_2862_c1_4574_5113 | 163 |
| 1484 | 3300050511 | nmdc:mga08y16_390387_c1 | nmdc:mga08y16_390387_c1_731_1231 | 163 |
| 1485 | 3300050511 | nmdc:mga08y16_658_c1 | nmdc:mga08y16_658_c1_13302_13793 | 163 |
| 1486 | 3300050511 | nmdc:mga08y16_67477_c1 | nmdc:mga08y16_67477_c1_1654_2181 | 163 |
| 1487 | 3300050512 | nmdc:mga0n895_1037810_c1 | nmdc:mga0n895_1037810_c1_149_685 | 163 |
| 1488 | 3300050512 | nmdc:mga0n895_13596_c1 | nmdc:mga0n895_13596_c1_2525_3088 | 163 |
| 1489 | 3300050512 | nmdc:mga0n895_141_c1 | nmdc:mga0n895_141_c1_7040_7558 | 163 |
| 1490 | 3300050512 | nmdc:mga0n895_166078_c1 | nmdc:mga0n895_166078_c1_1285_1824 | 163 |
| 1491 | 3300050512 | nmdc:mga0n895_19824_c1 | nmdc:mga0n895_19824_c1_130_648 | 163 |
| 1492 | 3300050512 | nmdc:mga0n895_267490_c1 | nmdc:mga0n895_267490_c1_769_1374 | 163 |
| 1493 | 3300050512 | nmdc:mga0n895_304759_c1 | nmdc:mga0n895_304759_c1_748_1239 | 163 |
| 1494 | 3300050512 | nmdc:mga0n895_343217_c1 | nmdc:mga0n895_343217_c1_714_1256 | 163 |
| 1495 | 3300050512 | nmdc:mga0n895_35782_c1 | nmdc:mga0n895_35782_c1_4156_4701 | 163 |
| 1496 | 3300050512 | nmdc:mga0n895_476418_c1 | nmdc:mga0n895_476418_c1_689_1219 | 163 |
| 1497 | 3300050512 | nmdc:mga0n895_546195_c1 | nmdc:mga0n895_546195_c1_524_1045 | 163 |
| 1498 | 3300050512 | nmdc:mga0n895_58404_c1 | nmdc:mga0n895_58404_c1_34_579 | 163 |
| 1499 | 3300050512 | nmdc:mga0n895_602783_c1 | nmdc:mga0n895_602783_c1_55_654 | 163 |
| 1500 | 3300050512 | nmdc:mga0n895_81880_c1 | nmdc:mga0n895_81880_c1_1589_2128 | 163 |
| 1501 | 3300050513 | nmdc:mga0rr50_1006114_c1 | nmdc:mga0rr50_1006114_c1_13_561 | 163 |
| 1502 | 3300050513 | nmdc:mga0rr50_12990_c1 | nmdc:mga0rr50_12990_c1_2200_2745 | 163 |
| 1503 | 3300050513 | nmdc:mga0rr50_14183_c1 | nmdc:mga0rr50_14183_c1_3011_3574 | 163 |
| 1504 | 3300050513 | nmdc:mga0rr50_176227_c1 | nmdc:mga0rr50_176227_c1_288_851 | 163 |
| 1505 | 3300050513 | nmdc:mga0rr50_1_c1 | nmdc:mga0rr50_1_c1_551162_551680 | 163 |
| 1506 | 3300050513 | nmdc:mga0rr50_316066_c1 | nmdc:mga0rr50_316066_c1_257_775 | 163 |
| 1507 | 3300050513 | nmdc:mga0rr50_398071_c1 | nmdc:mga0rr50_398071_c1_114_653 | 163 |
| 1508 | 3300050513 | nmdc:mga0rr50_539301_c1 | nmdc:mga0rr50_539301_c1_330_866 | 163 |
| 1509 | 3300050513 | nmdc:mga0rr50_560727_c1 | nmdc:mga0rr50_560727_c1_60_599 | 163 |
| 1510 | 3300050513 | nmdc:mga0rr50_8550_c1 | nmdc:mga0rr50_8550_c1_3130_3651 | 163 |
| 1511 | 3300050513 | nmdc:mga0rr50_8679_c1 | nmdc:mga0rr50_8679_c1_2121_2726 | 163 |
| 1512 | 3300050514 | nmdc:mga08x19_148053_c1 | nmdc:mga08x19_148053_c1_490_1005 | 163 |
| 1513 | 3300050514 | nmdc:mga08x19_153311_c1 | nmdc:mga08x19_153311_c1_671_1189 | 163 |
| 1514 | 3300050514 | nmdc:mga08x19_191333_c1 | nmdc:mga08x19_191333_c1_703_1224 | 163 |
| 1515 | 3300050514 | nmdc:mga08x19_34798_c1 | nmdc:mga08x19_34798_c1_1049_1546 | 163 |
| 1516 | 3300050514 | nmdc:mga08x19_92_c1 | nmdc:mga08x19_92_c1_74263_74781 | 163 |
| 1517 | 3300050515 | nmdc:mga0a205_12067_c2 | nmdc:mga0a205_12067_c2_5026_5565 | 163 |
| 1518 | 3300050515 | nmdc:mga0a205_1225776_c1 | nmdc:mga0a205_1225776_c1_16_546 | 163 |
| 1519 | 3300050515 | nmdc:mga0a205_132875_c1 | nmdc:mga0a205_132875_c1_1841_2359 | 163 |
| 1520 | 3300050515 | nmdc:mga0a205_151535_c1 | nmdc:mga0a205_151535_c1_1491_2054 | 163 |
| 1521 | 3300050515 | nmdc:mga0a205_2573_c1 | nmdc:mga0a205_2573_c1_12324_12869 | 163 |
| 1522 | 3300050515 | nmdc:mga0a205_281542_c1 | nmdc:mga0a205_281542_c1_267_809 | 163 |
| 1523 | 3300050515 | nmdc:mga0a205_394862_c1 | nmdc:mga0a205_394862_c1_296_838 | 163 |
| 1524 | 3300050515 | nmdc:mga0a205_532506_c1 | nmdc:mga0a205_532506_c1_367_906 | 163 |
| 1525 | 3300050515 | nmdc:mga0a205_649189_c1 | nmdc:mga0a205_649189_c1_263_811 | 163 |
| 1526 | 3300050515 | nmdc:mga0a205_676287_c1 | nmdc:mga0a205_676287_c1_253_744 | 163 |
| 1527 | 3300050516 | nmdc:mga0sz30_222545_c1 | nmdc:mga0sz30_222545_c1_191_697 | 163 |
| 1528 | 3300053077 | Ga0495601_0135362 | Ga0495601_0135362_605_1102 | 163 |
| 1529 | 3300053084 | Ga0495595_0012548 | Ga0495595_0012548_2507_3010 | 163 |
| 1530 | 3300053085 | Ga0495619_0769263 | Ga0495619_0769263_68_568 | 163 |
| 1531 | 3300053129 | Ga0500628_043052 | Ga0500628_043052_109_606 | 163 |
| 1532 | 3300054114 | Ga0501084_0009574 | Ga0501084_0009574_6016_6507 | 163 |
| 1533 | 3300054114 | Ga0501084_0043281 | Ga0501084_0043281_974_1465 | 163 |
| 1534 | 3300059421 | Ga0590071_000739 | Ga0590071_000739_3496_4029 | 163 |
| 1535 | 3300059421 | Ga0590071_005043 | Ga0590071_005043_1097_1630 | 163 |
| 1536 | 3300059423 | Ga0590074_003587 | Ga0590074_003587_1559_2092 | 163 |
| 1537 | 3300059423 | Ga0590074_042319 | Ga0590074_042319_37_570 | 163 |
| 1538 | 3300059424 | Ga0590075_001312 | Ga0590075_001312_1986_2519 | 163 |
| 1539 | 3300059424 | Ga0590075_002211 | Ga0590075_002211_1035_1568 | 163 |
| 1540 | 3300059424 | Ga0590075_113661 | Ga0590075_113661_68_580 | 163 |
| 1541 | 3300059426 | Ga0590077_000747 | Ga0590077_000747_4117_4650 | 163 |
| 1542 | 3300059511 | Ga0587091_100514 | Ga0587091_100514_117_614 | 163 |
| 1543 | 3300059655 | Ga0587114_031768 | Ga0587114_031768_44_541 | 163 |
| 1544 | 3300060353 | Ga0501082_0163480 | Ga0501082_0163480_649_1140 | 163 |
| 1545 | 3300060353 | Ga0501082_0444785 | Ga0501082_0444785_600_1091 | 163 |
| 1546 | 3300060353 | Ga0501082_0818939 | Ga0501082_0818939_88_597 | 163 |
| 1547 | 3300061734 | Ga0530510_0009184 | Ga0530510_0009184_3236_3727 | 163 |
| 1548 | 3300061734 | Ga0530510_0062078 | Ga0530510_0062078_1396_1944 | 163 |
| 1549 | 3300061734 | Ga0530510_0289552 | Ga0530510_0289552_181_729 | 163 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8ej3-assembly1.cif.gz_G | m. tuberculosis rnap pause escaped complex with bacillus subtilis nusg and gmpcpp | 0.8273 | 4 | 97 |
| 6c6t-assembly1.cif.gz_D | cryoem structure of e.coli rna polymerase elongation complex bound with rfah | 0.8099 | 4 | 93 |
| 2oug-assembly4.cif.gz_D | crystal structure of the rfah transcription factor at 2.1a resolution | 0.7971 | 4 | 93 |
| 5ond-assembly1.cif.gz_A | rfah from escherichia coli in complex with ops dna | 0.7917 | 3 | 95 |
| 8exy-assembly1.cif.gz_G | m. tuberculosis rnap paused complex with b. subtilis nusg and gmpcpp | 0.782 | 4 | 96 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WIU9_43_152_3.30.70.940 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;NusG, N-terminal domain | 0.8525 | 3 | 93 | 3.30.70.940 |
| af_O13936_718_779_2.30.30.30 | Mainly Beta;Roll;SH3 type barrels.; | 0.803 | 114 | 163 | 2.30.30.30 |
| af_I1J750_105_222_3.30.70.940 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;NusG, N-terminal domain | 0.8002 | 4 | 101 | 3.30.70.940 |
| 2ougC00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;NusG, N-terminal domain | 0.7995 | 4 | 93 | 3.30.70.940 |
| af_P0AFG0_1_117_3.30.70.940 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;NusG, N-terminal domain | 0.7717 | 2 | 101 | 3.30.70.940 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2U3QDJ7-F1-model_v4 | Transcription termination factor NusG domain protein | 0.9505 | 2 | 163 |
GO:0031564
GO:0140673 |
| AF-A0A2H6FC29-F1-model_v4 | Transcriptional activator RfaH | 0.9485 | 2 | 163 |
GO:0031564
GO:0140673 |
| AF-A0A6N6S5U6-F1-model_v4 | UpxY family transcription antiterminator | 0.9394 | 1 | 163 |
GO:0031564
GO:0140673 |
| AF-A0A2U3QDJ7-F1-model_v4 | Transcription termination factor NusG domain protein | 0.9393 | 2 | 163 |
GO:0031564
GO:0140673 |
| AF-A0A2H6FC29-F1-model_v4 | Transcriptional activator RfaH | 0.9374 | 2 | 163 |
GO:0031564
GO:0140673 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar