F494707

General Info

Members Datasets Scaffolds Average Seq Length
1549 383 1548 171

Family's Representative Sequence

Representative Sequence 3300013306|Ga0163162_10947929|Ga0163162_109479291
Length 188
Sequence MSRSLHSSSQVHEHGDDRVSAAPDDDQRWFAIWTRSRHEQVVREQLLQKQIDTFLPTVTRWSRWKDRKKKIDWPLFPGYCFARFNPRERLPILKCTGVVTIISSQGGEPSAIPEHEIEGIRQLVQSDLAFDPCPMIREGTLVEVIHGPLKGVIGRLLRKSDKARLVLSVDLIGQAVSVEVDAADVRAY

Samples

Sample ID Description Type Environment
1 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
22 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
25 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
26 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
27 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
28 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
29 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
32 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
33 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
34 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
35 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
36 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
37 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
38 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
39 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
40 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
41 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
42 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
43 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
44 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
45 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
46 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
47 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
48 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
49 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
50 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
51 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
52 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
53 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
54 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
55 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
56 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
57 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
58 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
59 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
60 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
61 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
62 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
63 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
64 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
65 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
66 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
67 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
68 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
69 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
70 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
71 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
72 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
73 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
74 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
75 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
76 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
77 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
78 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
79 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
80 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
81 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
82 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
83 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
84 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
85 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
86 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
87 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
88 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
89 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
90 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
91 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
92 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
93 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
94 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
95 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
96 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
97 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
98 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
99 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
100 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
101 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
102 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
103 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
104 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
105 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
106 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
107 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
108 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
109 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
110 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
111 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
112 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
113 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
114 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
115 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
116 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
117 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
118 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
119 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
120 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
121 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
122 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
123 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
124 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
125 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
126 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
127 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
128 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
129 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
195 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
196 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
197 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
198 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
202 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
203 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
204 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
205 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
206 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
207 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
208 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
209 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
210 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
211 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
212 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
213 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
214 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
215 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
216 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
217 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
218 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
219 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
220 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
221 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
222 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
223 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
224 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
225 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
226 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
227 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
228 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
229 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
230 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
231 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
232 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
233 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
234 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
235 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
236 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
237 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
238 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
239 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
240 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
241 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
242 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
243 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
244 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
245 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
246 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
247 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
248 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
249 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
250 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
251 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
252 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
253 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
254 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
255 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
256 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
257 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
258 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
259 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
260 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
261 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
262 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
263 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
264 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
265 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
266 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
267 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
268 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
269 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
270 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
271 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
272 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
273 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
274 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
275 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
276 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
277 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
278 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
279 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
280 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
281 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
282 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
283 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
284 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
285 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
286 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
287 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
288 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
289 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
290 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
291 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
292 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
293 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
294 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
295 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
296 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
297 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
298 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
299 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
300 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
301 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
302 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
303 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
304 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
305 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
306 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
307 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
308 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
309 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
310 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
311 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
312 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
313 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
314 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
315 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
316 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
317 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
318 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
319 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
320 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
321 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
322 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
323 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
324 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
325 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
326 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
327 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
328 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
329 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
330 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
331 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
332 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
333 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
334 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
335 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
336 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
337 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
338 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
339 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
340 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
341 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
342 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
343 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
344 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
345 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
346 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
347 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
348 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
349 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
350 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
351 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
352 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
353 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
354 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
355 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
356 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
357 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
358 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
359 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
360 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
361 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
362 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
363 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
364 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
365 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
366 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
367 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
368 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
369 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
370 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
371 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
372 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
373 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
374 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
375 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
376 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
377 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
378 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
379 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
380 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
381 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
382 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
383 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.87
Metatranscriptomes 0.13
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.39
Nodule 0
Rhizoplane 2.97
Rhizosphere 96.45
Stem 0
Stem Tuber 0
Unclassified 0.19

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24033J26618_1016701 3300002155 Unclassified 914
2 JGI24751J29686_10013893 3300002459 Bacteria 1662
3 JGI25406J46586_10097873 3300003203 Bacteria 878
4 Ga0065714_10083408 3300005288 Bacteria 2244
5 Ga0065704_10148721 3300005289 Unclassified 1413
6 Ga0065704_10537012 3300005289 Bacteria 643
7 Ga0065712_10002622 3300005290 Bacteria 5006
8 Ga0065712_10067818 3300005290 Bacteria 29246
9 Ga0065712_10099576 3300005290 Unclassified 2087
10 Ga0065712_10149758 3300005290 Bacteria 1373
11 Ga0065712_10162315 3300005290 Bacteria 1294
12 Ga0065712_10319358 3300005290 Unclassified 831
13 Ga0065715_10103959 3300005293 Unclassified 2995
14 Ga0065715_10146880 3300005293 Unclassified 1771
15 Ga0065715_10147926 3300005293 Bacteria 1765
16 Ga0065715_10158966 3300005293 Bacteria 1648
17 Ga0065715_10168749 3300005293 Bacteria 1564
18 Ga0065715_10236028 3300005293 Bacteria 1216
19 Ga0065715_10279735 3300005293 Bacteria 1078
20 Ga0065715_10408396 3300005293 Unclassified 873
21 Ga0065707_10247239 3300005295 Bacteria 1133
22 Ga0065707_10289450 3300005295 Unclassified 1028
23 Ga0065707_10302678 3300005295 Bacteria 1001
24 Ga0065707_10412332 3300005295 Unclassified 840
25 Ga0065707_10484671 3300005295 Bacteria 770
26 Ga0070676_10026241 3300005328 Bacteria 3298
27 Ga0070676_10199862 3300005328 Unclassified 1310
28 Ga0070676_10297952 3300005328 Bacteria 1092
29 Ga0070676_10331366 3300005328 Bacteria 1041
30 Ga0070676_10357983 3300005328 Unclassified 1005
31 Ga0070676_10438005 3300005328 Unclassified 916
32 Ga0070676_10832927 3300005328 Unclassified 683
33 Ga0070683_100024470 3300005329 Bacteria 5409
34 Ga0070683_100338820 3300005329 Unclassified 1432
35 Ga0070690_100000920 3300005330 Bacteria 14972
36 Ga0070690_100166363 3300005330 Unclassified 1515
37 Ga0070690_100197332 3300005330 Bacteria 1399
38 Ga0070690_100922612 3300005330 Bacteria 684
39 Ga0070690_100946779 3300005330 Unclassified 676
40 Ga0070690_101430069 3300005330 Bacteria 557
41 Ga0070670_100015640 3300005331 Bacteria 6514
42 Ga0070670_100026375 3300005331 Bacteria 5001
43 Ga0070670_100052956 3300005331 Bacteria 3486
44 Ga0070670_100161978 3300005331 Unclassified 1939
45 Ga0070670_100300500 3300005331 Unclassified 1404
46 Ga0070670_100901418 3300005331 Unclassified 801
47 Ga0070677_10013312 3300005333 Bacteria 2875
48 Ga0070677_10044554 3300005333 Unclassified 1766
49 Ga0070677_10049012 3300005333 Bacteria 1699
50 Ga0070677_10279774 3300005333 Bacteria 840
51 Ga0070677_10284896 3300005333 Unclassified 834
52 Ga0070677_10422995 3300005333 Unclassified 707
53 Ga0068869_100002153 3300005334 Bacteria 11844
54 Ga0068869_100048862 3300005334 Bacteria 3061
55 Ga0068869_100092460 3300005334 Unclassified 2277
56 Ga0068869_100103497 3300005334 Bacteria 2157
57 Ga0068869_100174532 3300005334 Unclassified 1681
58 Ga0068869_100280507 3300005334 Bacteria 1340
59 Ga0068869_100536026 3300005334 Unclassified 981
60 Ga0068869_101215174 3300005334 Bacteria 663
61 Ga0070666_10196882 3300005335 Unclassified 1417
62 Ga0070666_10198726 3300005335 Bacteria 1410
63 Ga0070666_10729581 3300005335 Bacteria 728
64 Ga0070680_100025422 3300005336 Bacteria 4733
65 Ga0070680_100153630 3300005336 Unclassified 1933
66 Ga0070680_100630050 3300005336 Bacteria 921
67 Ga0070680_100866206 3300005336 Bacteria 779
68 Ga0070682_100900612 3300005337 Unclassified 727
69 Ga0070682_101072323 3300005337 Bacteria 673
70 Ga0070682_101249949 3300005337 Bacteria 629
71 Ga0068868_100034955 3300005338 Bacteria 3882
72 Ga0068868_100064048 3300005338 Unclassified 2918
73 Ga0068868_100291802 3300005338 Unclassified 1383
74 Ga0068868_100330401 3300005338 Bacteria 1301
75 Ga0068868_100352495 3300005338 Unclassified 1261
76 Ga0068868_100639711 3300005338 Unclassified 946
77 Ga0068868_100741312 3300005338 Bacteria 882
78 Ga0068868_101181271 3300005338 Unclassified 707
79 Ga0070660_100001092 3300005339 Bacteria 18217
80 Ga0070660_100441529 3300005339 Bacteria 1079
81 Ga0070689_100043202 3300005340 Bacteria 3463
82 Ga0070689_100065174 3300005340 Bacteria 2836
83 Ga0070689_100199760 3300005340 Unclassified 1632
84 Ga0070689_100215050 3300005340 Bacteria 1575
85 Ga0070689_100327105 3300005340 Unclassified 1281
86 Ga0070689_100340128 3300005340 Unclassified 1257
87 Ga0070689_100586620 3300005340 Unclassified 964
88 Ga0070689_100740161 3300005340 Bacteria 861
89 Ga0070691_10000892 3300005341 Bacteria 12096
90 Ga0070691_10043112 3300005341 Unclassified 2137
91 Ga0070691_10149628 3300005341 Unclassified 1196
92 Ga0070687_100038743 3300005343 Unclassified 2391
93 Ga0070687_100095286 3300005343 Bacteria 1655
94 Ga0070661_100265127 3300005344 Unclassified 1329
95 Ga0070661_100414251 3300005344 Bacteria 1067
96 Ga0070661_100608875 3300005344 Bacteria 884
97 Ga0070661_101372584 3300005344 Unclassified 594
98 Ga0070692_10035812 3300005345 Viruses 2515
99 Ga0070692_10458705 3300005345 Bacteria 817
100 Ga0070668_100105729 3300005347 Bacteria 2236
101 Ga0070668_100454436 3300005347 Unclassified 1102
102 Ga0070668_100735908 3300005347 Bacteria 872
103 Ga0070669_100003474 3300005353 Bacteria 11357
104 Ga0070669_100031310 3300005353 Viruses 3843
105 Ga0070669_100038193 3300005353 Bacteria 3485
106 Ga0070669_100092083 3300005353 Bacteria 2275
107 Ga0070669_100162925 3300005353 Unclassified 1734
108 Ga0070669_100313428 3300005353 Bacteria 1265
109 Ga0070669_100339396 3300005353 Bacteria 1217
110 Ga0070669_100423022 3300005353 Unclassified 1094
111 Ga0070669_100548837 3300005353 Bacteria 963
112 Ga0070669_100615765 3300005353 Bacteria 911
113 Ga0070669_100669953 3300005353 Unclassified 874
114 Ga0070669_100678850 3300005353 Unclassified 868
115 Ga0070675_100000433 3300005354 Bacteria 28442
116 Ga0070675_100001643 3300005354 Bacteria 16516
117 Ga0070675_100003018 3300005354 Bacteria 12707
118 Ga0070675_100007486 3300005354 Bacteria 8435
119 Ga0070675_100007803 3300005354 Bacteria 8291
120 Ga0070675_100022727 3300005354 Bacteria 5010
121 Ga0070675_100036669 3300005354 Bacteria 3991
122 Ga0070675_100205743 3300005354 Bacteria 1709
123 Ga0070675_100217685 3300005354 Bacteria 1662
124 Ga0070675_100313845 3300005354 Bacteria 1384
125 Ga0070675_100344667 3300005354 Bacteria 1320
126 Ga0070675_100439608 3300005354 Archaea 1168
127 Ga0070675_100539788 3300005354 Unclassified 1054
128 Ga0070671_100034834 3300005355 Bacteria 4169
129 Ga0070671_100048508 3300005355 Bacteria 3531
130 Ga0070671_100320519 3300005355 Bacteria 1321
131 Ga0070671_100354947 3300005355 Bacteria 1252
132 Ga0070671_100782269 3300005355 Bacteria 830
133 Ga0070674_100021951 3300005356 Bacteria 4110
134 Ga0070674_100044223 3300005356 Bacteria 3035
135 Ga0070674_100140019 3300005356 Unclassified 1815
136 Ga0070674_100241008 3300005356 Unclassified 1416
137 Ga0070674_100519194 3300005356 Unclassified 995
138 Ga0070674_100674351 3300005356 Bacteria 881
139 Ga0070674_100779800 3300005356 Unclassified 824
140 Ga0070674_101006082 3300005356 Unclassified 732
141 Ga0070674_101255596 3300005356 Unclassified 659
142 Ga0070674_101265879 3300005356 Unclassified 657
143 Ga0070674_101447295 3300005356 Unclassified 616
144 Ga0070673_100003132 3300005364 Bacteria 10234
145 Ga0070673_100043274 3300005364 Unclassified 3478
146 Ga0070673_100050178 3300005364 Bacteria 3261
147 Ga0070673_100058513 3300005364 Unclassified 3047
148 Ga0070673_100137316 3300005364 Unclassified 2059
149 Ga0070673_100171940 3300005364 Bacteria 1850
150 Ga0070673_100183156 3300005364 Unclassified 1794
151 Ga0070673_100196196 3300005364 Bacteria 1736
152 Ga0070673_100208212 3300005364 Unclassified 1687
153 Ga0070673_100549318 3300005364 Bacteria 1049
154 Ga0070673_100635366 3300005364 Bacteria 976
155 Ga0070688_100060927 3300005365 Bacteria 2384
156 Ga0070688_100098261 3300005365 Unclassified 1925
157 Ga0070688_100216235 3300005365 Unclassified 1348
158 Ga0070688_100476940 3300005365 Unclassified 937
159 Ga0070688_101083333 3300005365 Unclassified 640
160 Ga0070659_100197547 3300005366 Bacteria 1655
161 Ga0070667_100179209 3300005367 Unclassified 1873
162 Ga0070667_100414741 3300005367 Bacteria 1227
163 Ga0070667_100587289 3300005367 Unclassified 1026
164 Ga0070709_10007316 3300005434 Bacteria 6051
165 Ga0070709_10759539 3300005434 Bacteria 758
166 Ga0070714_100003070 3300005435 Bacteria 12391
167 Ga0070713_100004893 3300005436 Bacteria 9089
168 Ga0070713_100193518 3300005436 Bacteria 1834
169 Ga0070713_100900072 3300005436 Unclassified 851
170 Ga0070713_101253314 3300005436 Unclassified 718
171 Ga0070713_101716902 3300005436 Unclassified 609
172 Ga0070701_10080120 3300005438 Bacteria 1765
173 Ga0070701_10102714 3300005438 Unclassified 1586
174 Ga0070705_100001404 3300005440 Bacteria 12773
175 Ga0070705_100014875 3300005440 Bacteria 4013
176 Ga0070705_100053659 3300005440 Bacteria 2361
177 Ga0070705_100135726 3300005440 Bacteria 1611
178 Ga0070700_100000788 3300005441 Bacteria 15603
179 Ga0070700_100006082 3300005441 Bacteria 6427
180 Ga0070700_100059550 3300005441 Unclassified 2404
181 Ga0070700_100068953 3300005441 Unclassified 2250
182 Ga0070700_100274394 3300005441 Bacteria 1220
183 Ga0070700_100906779 3300005441 Bacteria 718
184 Ga0070694_100002894 3300005444 Bacteria 10201
185 Ga0070694_100005858 3300005444 Bacteria 7456
186 Ga0070694_100007026 3300005444 Bacteria 6848
187 Ga0070694_100172110 3300005444 Bacteria 1596
188 Ga0070694_100379711 3300005444 Bacteria 1102
189 Ga0070694_100502706 3300005444 Unclassified 965
190 Ga0070694_100802159 3300005444 Bacteria 772
191 Ga0070708_100032111 3300005445 Bacteria 4551
192 Ga0070708_100519664 3300005445 Bacteria 1123
193 Ga0070708_100607625 3300005445 Unclassified 1031
194 Ga0070708_100868844 3300005445 Bacteria 847
195 Ga0070663_100037019 3300005455 Bacteria 3394
196 Ga0070663_100878596 3300005455 Unclassified 773
197 Ga0070678_100109353 3300005456 Bacteria 2159
198 Ga0070678_100116947 3300005456 Bacteria 2096
199 Ga0070678_100130775 3300005456 Bacteria 1994
200 Ga0070678_100140021 3300005456 Bacteria 1935
201 Ga0070678_100494754 3300005456 Unclassified 1078
202 Ga0070678_100653885 3300005456 Unclassified 943
203 Ga0070678_100709470 3300005456 Bacteria 907
204 Ga0070662_100073576 3300005457 Bacteria 2525
205 Ga0070662_100203340 3300005457 Unclassified 1573
206 Ga0070662_100380504 3300005457 Bacteria 1162
207 Ga0070662_100593270 3300005457 Unclassified 931
208 Ga0070662_100874882 3300005457 Unclassified 766
209 Ga0070662_101063022 3300005457 Bacteria 694
210 Ga0070681_10386081 3300005458 Bacteria 1311
211 Ga0070681_11157304 3300005458 Bacteria 695
212 Ga0068867_100000380 3300005459 Bacteria 29556
213 Ga0068867_100115369 3300005459 Bacteria 2069
214 Ga0068867_100138704 3300005459 Bacteria 1898
215 Ga0068867_100139519 3300005459 Unclassified 1893
216 Ga0068867_100686917 3300005459 Bacteria 902
217 Ga0068867_100709371 3300005459 Bacteria 888
218 Ga0068867_100713581 3300005459 Unclassified 886
219 Ga0068867_100944408 3300005459 Unclassified 779
220 Ga0068867_101063118 3300005459 Bacteria 737
221 Ga0068867_101672557 3300005459 Bacteria 596
222 Ga0068867_101710127 3300005459 Unclassified 590
223 Ga0070685_10047159 3300005466 Bacteria 2477
224 Ga0070685_10050222 3300005466 Unclassified 2409
225 Ga0070685_10106243 3300005466 Bacteria 1722
226 Ga0070685_10197670 3300005466 Unclassified 1305
227 Ga0070685_10545954 3300005466 Unclassified 826
228 Ga0070706_100186401 3300005467 Bacteria 1939
229 Ga0070706_100236430 3300005467 Bacteria 1706
230 Ga0070706_100286210 3300005467 Bacteria 1538
231 Ga0070706_100774035 3300005467 Bacteria 889
232 Ga0070706_101121435 3300005467 Unclassified 724
233 Ga0070706_101226546 3300005467 Unclassified 689
234 Ga0070707_100442076 3300005468 Bacteria 1261
235 Ga0070707_100657285 3300005468 Bacteria 1011
236 Ga0070707_101094705 3300005468 Unclassified 763
237 Ga0070707_101286300 3300005468 Unclassified 698
238 Ga0070698_100003115 3300005471 Bacteria 18284
239 Ga0070698_100006640 3300005471 Bacteria 12545
240 Ga0070698_100011223 3300005471 Bacteria 9517
241 Ga0070698_100072413 3300005471 Bacteria 3454
242 Ga0070698_100138182 3300005471 Unclassified 2390
243 Ga0070698_100394572 3300005471 Bacteria 1317
244 Ga0070699_100003719 3300005518 Bacteria 13483
245 Ga0070699_100006814 3300005518 Bacteria 9942
246 Ga0070699_100100290 3300005518 Bacteria 2538
247 Ga0070699_100123199 3300005518 Unclassified 2281
248 Ga0070679_100010050 3300005530 Bacteria 8963
249 Ga0070679_100127817 3300005530 Unclassified 2523
250 Ga0070679_100548131 3300005530 Bacteria 1100
251 Ga0070679_100776591 3300005530 Unclassified 901
252 Ga0070684_100076110 3300005535 Bacteria 2962
253 Ga0070684_100179696 3300005535 Bacteria 1924
254 Ga0070684_100519127 3300005535 Bacteria 1104
255 Ga0070684_101199138 3300005535 Bacteria 714
256 Ga0068853_100611029 3300005539 Unclassified 1036
257 Ga0070672_100004404 3300005543 Bacteria 9223
258 Ga0070672_100005217 3300005543 Bacteria 8597
259 Ga0070672_100062004 3300005543 Bacteria 2950
260 Ga0070672_100157158 3300005543 Unclassified 1884
261 Ga0070672_100196808 3300005543 Bacteria 1684
262 Ga0070672_100213036 3300005543 Unclassified 1618
263 Ga0070672_100617737 3300005543 Bacteria 945
264 Ga0070672_100692814 3300005543 Bacteria 892
265 Ga0070672_100729197 3300005543 Unclassified 869
266 Ga0070672_101137246 3300005543 Unclassified 694
267 Ga0070686_100000153 3300005544 Bacteria 47434
268 Ga0070686_100030299 3300005544 Unclassified 3299
269 Ga0070686_100084274 3300005544 Bacteria 2111
270 Ga0070686_100188159 3300005544 Bacteria 1472
271 Ga0070686_100218647 3300005544 Bacteria 1376
272 Ga0070686_100313655 3300005544 Unclassified 1167
273 Ga0070686_100375621 3300005544 Unclassified 1075
274 Ga0070686_100537386 3300005544 Unclassified 912
275 Ga0070695_100016291 3300005545 Bacteria 4496
276 Ga0070695_100027664 3300005545 Bacteria 3515
277 Ga0070695_100170257 3300005545 Bacteria 1536
278 Ga0070695_100502552 3300005545 Unclassified 938
279 Ga0070695_100826694 3300005545 Unclassified 744
280 Ga0070695_100954808 3300005545 Unclassified 695
281 Ga0070696_100018169 3300005546 Bacteria 4750
282 Ga0070696_100039612 3300005546 Bacteria 3253
283 Ga0070696_100112265 3300005546 Unclassified 1964
284 Ga0070696_100552454 3300005546 Unclassified 923
285 Ga0070696_100587157 3300005546 Bacteria 897
286 Ga0070693_100169522 3300005547 Bacteria 1397
287 Ga0070693_100720868 3300005547 Bacteria 732
288 Ga0070693_100759909 3300005547 Unclassified 715
289 Ga0070693_100836877 3300005547 Unclassified 685
290 Ga0070665_100002502 3300005548 Bacteria 20209
291 Ga0070665_100010631 3300005548 Bacteria 9316
292 Ga0070665_100020086 3300005548 Bacteria 6706
293 Ga0070665_100078682 3300005548 Bacteria 3304
294 Ga0070665_100195381 3300005548 Unclassified 2024
295 Ga0070665_100950167 3300005548 Unclassified 872
296 Ga0070704_100000089 3300005549 Bacteria 31704
297 Ga0070704_100026609 3300005549 Unclassified 3825
298 Ga0070704_100032604 3300005549 Unclassified 3516
299 Ga0070704_100074989 3300005549 Bacteria 2469
300 Ga0070704_100134456 3300005549 Bacteria 1922
301 Ga0070704_100631855 3300005549 Unclassified 944
302 Ga0070704_100700314 3300005549 Unclassified 898
303 Ga0070704_101267826 3300005549 Unclassified 674
304 Ga0070704_101301510 3300005549 Unclassified 665
305 Ga0068855_100020680 3300005563 Bacteria 7892
306 Ga0068855_100238478 3300005563 Bacteria 2033
307 Ga0068855_100450881 3300005563 Unclassified 1404
308 Ga0068855_100492643 3300005563 Unclassified 1333
309 Ga0068855_100652639 3300005563 Bacteria 1130
310 Ga0068855_100798835 3300005563 Bacteria 1003
311 Ga0070664_100009603 3300005564 Bacteria 7847
312 Ga0070664_100097790 3300005564 Bacteria 2549
313 Ga0070664_100236671 3300005564 Bacteria 1638
314 Ga0070664_100346288 3300005564 Unclassified 1351
315 Ga0068857_100136211 3300005577 Unclassified 2217
316 Ga0068857_100358762 3300005577 Bacteria 1351
317 Ga0068857_100522165 3300005577 Bacteria 1116
318 Ga0068857_100639122 3300005577 Bacteria 1008
319 Ga0068854_100163499 3300005578 Unclassified 1726
320 Ga0068854_101120050 3300005578 Unclassified 702
321 Ga0068856_101833176 3300005614 Bacteria 618
322 Ga0068856_101950599 3300005614 Unclassified 598
323 Ga0070702_100003228 3300005615 Bacteria 7254
324 Ga0070702_100053993 3300005615 Unclassified 2310
325 Ga0070702_100357397 3300005615 Unclassified 1031
326 Ga0070702_100962764 3300005615 Bacteria 673
327 Ga0068852_100377942 3300005616 Bacteria 1389
328 Ga0068852_100746608 3300005616 Bacteria 991
329 Ga0068852_101897063 3300005616 Unclassified 618
330 Ga0068859_100025246 3300005617 Bacteria 5963
331 Ga0068859_100137975 3300005617 Bacteria 2512
332 Ga0068859_100191448 3300005617 Unclassified 2130
333 Ga0068859_100208366 3300005617 Bacteria 2041
334 Ga0068859_100504379 3300005617 Bacteria 1305
335 Ga0068859_100506815 3300005617 Bacteria 1302
336 Ga0068859_100714266 3300005617 Unclassified 1092
337 Ga0068859_100759169 3300005617 Bacteria 1059
338 Ga0068859_101723599 3300005617 Unclassified 692
339 Ga0068864_100002939 3300005618 Bacteria 14090
340 Ga0068864_100099244 3300005618 Unclassified 2579
341 Ga0068864_100201604 3300005618 Viruses 1828
342 Ga0068864_100207644 3300005618 Unclassified 1802
343 Ga0068864_100234303 3300005618 Bacteria 1699
344 Ga0068864_100234644 3300005618 Bacteria 1698
345 Ga0068864_100313810 3300005618 Unclassified 1471
346 Ga0068864_100391631 3300005618 Unclassified 1319
347 Ga0068864_100975212 3300005618 Bacteria 840
348 Ga0068866_10009441 3300005718 Bacteria 4142
349 Ga0068866_10024941 3300005718 Unclassified 2805
350 Ga0068866_10084161 3300005718 Unclassified 1716
351 Ga0068866_10085221 3300005718 Bacteria 1707
352 Ga0068861_100010565 3300005719 Bacteria 6410
353 Ga0068861_100079028 3300005719 Viruses 2571
354 Ga0068861_100091306 3300005719 Unclassified 2404
355 Ga0068861_100093769 3300005719 Bacteria 2374
356 Ga0068861_100129925 3300005719 Bacteria 2044
357 Ga0068861_100164360 3300005719 Unclassified 1834
358 Ga0068861_100253110 3300005719 Bacteria 1504
359 Ga0068861_100488257 3300005719 Unclassified 1111
360 Ga0068861_100823788 3300005719 Unclassified 873
361 Ga0068861_101454819 3300005719 Unclassified 671
362 Ga0068851_10033637 3300005834 Bacteria 2556
363 Ga0068851_10150437 3300005834 Unclassified 1272
364 Ga0068870_10002891 3300005840 Bacteria 7236
365 Ga0068870_10032435 3300005840 Bacteria 2656
366 Ga0068870_10034344 3300005840 Bacteria 2595
367 Ga0068870_10234070 3300005840 Bacteria 1131
368 Ga0068870_10616965 3300005840 Bacteria 739
369 Ga0068863_100062464 3300005841 Bacteria 3523
370 Ga0068863_100143458 3300005841 Unclassified 2283
371 Ga0068863_100184236 3300005841 Bacteria 2005
372 Ga0068863_100199173 3300005841 Unclassified 1926
373 Ga0068863_100300972 3300005841 Bacteria 1556
374 Ga0068863_100313525 3300005841 Unclassified 1523
375 Ga0068863_100650258 3300005841 Unclassified 1046
376 Ga0068863_101144537 3300005841 Unclassified 783
377 Ga0068858_100003255 3300005842 Bacteria 16182
378 Ga0068858_100017044 3300005842 Bacteria 6819
379 Ga0068858_100039216 3300005842 Bacteria 4393
380 Ga0068858_100075256 3300005842 Bacteria 3136
381 Ga0068858_100130019 3300005842 Bacteria 2360
382 Ga0068858_100206865 3300005842 Bacteria 1857
383 Ga0068858_100559154 3300005842 Unclassified 1108
384 Ga0068858_101037450 3300005842 Unclassified 804
385 Ga0068860_100017193 3300005843 Bacteria 7050
386 Ga0068860_100034523 3300005843 Unclassified 4852
387 Ga0068860_100219487 3300005843 Bacteria 1846
388 Ga0068860_100271636 3300005843 Unclassified 1655
389 Ga0068860_100347516 3300005843 Bacteria 1459
390 Ga0068860_100354361 3300005843 Unclassified 1445
391 Ga0068860_100356221 3300005843 Unclassified 1441
392 Ga0068860_100392211 3300005843 Bacteria 1372
393 Ga0068862_100021517 3300005844 Bacteria 5389
394 Ga0068862_100024869 3300005844 Bacteria 5025
395 Ga0068862_100040092 3300005844 Unclassified 3980
396 Ga0068862_100053094 3300005844 Bacteria 3469
397 Ga0068862_100260760 3300005844 Bacteria 1582
398 Ga0068862_100384271 3300005844 Bacteria 1310
399 Ga0068862_100429973 3300005844 Bacteria 1241
400 Ga0068862_100594903 3300005844 Bacteria 1061
401 Ga0068862_100636813 3300005844 Unclassified 1027
402 Ga0068862_100657343 3300005844 Bacteria 1011
403 Ga0068862_100746979 3300005844 Unclassified 951
404 Ga0081455_10008971 3300005937 Bacteria 10330
405 Ga0081455_10047875 3300005937 Bacteria 3698
406 Ga0081539_10002012 3300005985 Bacteria 30795
407 Ga0070717_11361300 3300006028 Bacteria 645
408 Ga0075365_10059942 3300006038 Bacteria 2538
409 Ga0070715_10045399 3300006163 Unclassified 1863
410 Ga0070715_10059729 3300006163 Unclassified 1669
411 Ga0070715_10370458 3300006163 Bacteria 788
412 Ga0070716_100007561 3300006173 Bacteria 5360
413 Ga0070716_100112531 3300006173 Bacteria 1690
414 Ga0070716_100520649 3300006173 Bacteria 881
415 Ga0070716_100865244 3300006173 Unclassified 705
416 Ga0070712_100031176 3300006175 Bacteria 3590
417 Ga0070712_100416201 3300006175 Unclassified 1113
418 Ga0097621_100000125 3300006237 Bacteria 44370
419 Ga0097621_100014893 3300006237 Bacteria 5835
420 Ga0097621_100017310 3300006237 Bacteria 5470
421 Ga0097621_100039658 3300006237 Bacteria 3784
422 Ga0097621_100069253 3300006237 Bacteria 2913
423 Ga0097621_100113414 3300006237 Unclassified 2293
424 Ga0097621_100126207 3300006237 Bacteria 2174
425 Ga0097621_100378715 3300006237 Bacteria 1263
426 Ga0097621_100616551 3300006237 Bacteria 993
427 Ga0097621_100643048 3300006237 Unclassified 973
428 Ga0097621_100724582 3300006237 Unclassified 917
429 Ga0097621_101182064 3300006237 Unclassified 720
430 Ga0068871_100000134 3300006358 Bacteria 47412
431 Ga0068871_100005587 3300006358 Bacteria 8816
432 Ga0068871_100039886 3300006358 Unclassified 3759
433 Ga0068871_100063808 3300006358 Bacteria 3014
434 Ga0068871_100069169 3300006358 Bacteria 2899
435 Ga0068871_100077391 3300006358 Bacteria 2749
436 Ga0068871_100146031 3300006358 Unclassified 2014
437 Ga0068871_100149927 3300006358 Bacteria 1988
438 Ga0068871_100193434 3300006358 Bacteria 1753
439 Ga0068871_100291605 3300006358 Bacteria 1430
440 Ga0068871_100497971 3300006358 Bacteria 1098
441 Ga0068871_100649783 3300006358 Bacteria 963
442 Ga0068871_100695008 3300006358 Unclassified 931
443 Ga0075428_100000497 3300006844 Bacteria 39844
444 Ga0075428_100006846 3300006844 Bacteria 12668
445 Ga0075428_100009506 3300006844 Bacteria 10796
446 Ga0075428_100026808 3300006844 Bacteria 6380
447 Ga0075428_100031650 3300006844 Bacteria 5845
448 Ga0075428_100057506 3300006844 Bacteria 4257
449 Ga0075428_100089732 3300006844 Bacteria 3352
450 Ga0075428_100121569 3300006844 Unclassified 2843
451 Ga0075428_100245232 3300006844 Bacteria 1932
452 Ga0075428_100310045 3300006844 Bacteria 1696
453 Ga0075428_100429732 3300006844 Unclassified 1415
454 Ga0075428_100602931 3300006844 Bacteria 1173
455 Ga0075428_101084827 3300006844 Bacteria 846
456 Ga0075428_101635840 3300006844 Bacteria 673
457 Ga0075430_100001681 3300006846 Bacteria 18091
458 Ga0075430_100002096 3300006846 Bacteria 16500
459 Ga0075430_100013822 3300006846 Bacteria 6877
460 Ga0075430_100019140 3300006846 Bacteria 5823
461 Ga0075430_100025839 3300006846 Bacteria 4997
462 Ga0075430_100028057 3300006846 Bacteria 4782
463 Ga0075430_100054894 3300006846 Unclassified 3351
464 Ga0075431_100001219 3300006847 Bacteria 23281
465 Ga0075431_100003323 3300006847 Bacteria 15578
466 Ga0075431_100023672 3300006847 Bacteria 6287
467 Ga0075431_100069493 3300006847 Unclassified 3633
468 Ga0075431_100079466 3300006847 Bacteria 3385
469 Ga0075431_100199916 3300006847 Bacteria 2045
470 Ga0075431_100215703 3300006847 Bacteria 1959
471 Ga0075431_100241070 3300006847 Bacteria 1839
472 Ga0075431_100486414 3300006847 Unclassified 1226
473 Ga0075431_100830336 3300006847 Bacteria 896
474 Ga0075433_10000157 3300006852 Bacteria 36577
475 Ga0075433_10116506 3300006852 Bacteria 2370
476 Ga0075433_10146790 3300006852 Bacteria 2097
477 Ga0075433_10177266 3300006852 Unclassified 1896
478 Ga0075433_10323195 3300006852 Bacteria 1365
479 Ga0075433_10336636 3300006852 Unclassified 1334
480 Ga0075433_10467641 3300006852 Bacteria 1111
481 Ga0075433_10615587 3300006852 Unclassified 953
482 Ga0075433_10789605 3300006852 Bacteria 830
483 Ga0075433_10835721 3300006852 Bacteria 804
484 Ga0075433_11039815 3300006852 Unclassified 713
485 Ga0075433_11078459 3300006852 Bacteria 699
486 Ga0075434_100002504 3300006871 Bacteria 16204
487 Ga0075434_100005743 3300006871 Bacteria 11328
488 Ga0075434_100006773 3300006871 Bacteria 10532
489 Ga0075434_100011771 3300006871 Bacteria 8264
490 Ga0075434_100017244 3300006871 Bacteria 6954
491 Ga0075434_100029295 3300006871 Bacteria 5414
492 Ga0075434_100065080 3300006871 Unclassified 3631
493 Ga0075434_100082673 3300006871 Bacteria 3209
494 Ga0075434_100151742 3300006871 Bacteria 2337
495 Ga0075434_100192229 3300006871 Bacteria 2061
496 Ga0075434_100302147 3300006871 Bacteria 1621
497 Ga0075434_100453363 3300006871 Bacteria 1304
498 Ga0075434_100476073 3300006871 Bacteria 1270
499 Ga0075434_100489240 3300006871 Bacteria 1251
500 Ga0075434_100524690 3300006871 Unclassified 1205
501 Ga0075429_100004479 3300006880 Bacteria 12017
502 Ga0075429_100005139 3300006880 Bacteria 11253
503 Ga0075429_100008026 3300006880 Bacteria 9173
504 Ga0075429_100019963 3300006880 Bacteria 5812
505 Ga0075429_100096081 3300006880 Bacteria 2584
506 Ga0075429_100122343 3300006880 Unclassified 2275
507 Ga0075429_100126374 3300006880 Bacteria 2236
508 Ga0075429_100239199 3300006880 Unclassified 1590
509 Ga0075429_100266863 3300006880 Bacteria 1499
510 Ga0075429_100314822 3300006880 Bacteria 1370
511 Ga0075429_100319622 3300006880 Unclassified 1359
512 Ga0068865_100002757 3300006881 Bacteria 10443
513 Ga0068865_100030248 3300006881 Bacteria 3601
514 Ga0068865_100076131 3300006881 Bacteria 2394
515 Ga0068865_100145708 3300006881 Bacteria 1791
516 Ga0068865_100189475 3300006881 Unclassified 1589
517 Ga0068865_100576003 3300006881 Unclassified 948
518 Ga0068865_100760792 3300006881 Unclassified 833
519 Ga0068865_100834735 3300006881 Bacteria 797
520 Ga0075436_100004813 3300006914 Bacteria 9275
521 Ga0075436_100017704 3300006914 Bacteria 4877
522 Ga0075436_100017749 3300006914 Bacteria 4872
523 Ga0075436_100084710 3300006914 Unclassified 2200
524 Ga0075436_100104286 3300006914 Unclassified 1976
525 Ga0075436_100132881 3300006914 Bacteria 1746
526 Ga0075436_100241247 3300006914 Bacteria 1285
527 Ga0097620_100025246 3300006931 Bacteria 5963
528 Ga0097620_100137972 3300006931 Bacteria 2512
529 Ga0097620_100191442 3300006931 Unclassified 2130
530 Ga0097620_100208383 3300006931 Bacteria 2041
531 Ga0097620_100504446 3300006931 Bacteria 1305
532 Ga0097620_100506803 3300006931 Bacteria 1302
533 Ga0097620_100714267 3300006931 Unclassified 1092
534 Ga0097620_100759135 3300006931 Bacteria 1059
535 Ga0097620_100837173 3300006931 Bacteria 1006
536 Ga0097620_101723800 3300006931 Unclassified 692
537 Ga0075435_100000204 3300007076 Bacteria 35933
538 Ga0075435_100007928 3300007076 Bacteria 7601
539 Ga0075435_100015754 3300007076 Bacteria 5688
540 Ga0075435_100027042 3300007076 Bacteria 4484
541 Ga0075435_100065934 3300007076 Bacteria 2944
542 Ga0075435_100177038 3300007076 Bacteria 1801
543 Ga0075435_100212697 3300007076 Bacteria 1641
544 Ga0075435_100310333 3300007076 Bacteria 1350
545 Ga0075435_100494082 3300007076 Bacteria 1058
546 Ga0075435_100509157 3300007076 Bacteria 1041
547 Ga0105251_10096311 3300009011 Bacteria 1356
548 Ga0105244_10445466 3300009036 Unclassified 596
549 Ga0105240_10037691 3300009093 Bacteria 6211
550 Ga0105240_10170233 3300009093 Bacteria 2581
551 Ga0105240_10311990 3300009093 Unclassified 1796
552 Ga0105240_10450127 3300009093 Unclassified 1441
553 Ga0105240_10794797 3300009093 Bacteria 1025
554 Ga0105240_11465595 3300009093 Unclassified 716
555 Ga0111539_10000014 3300009094 Bacteria 307501
556 Ga0111539_10000134 3300009094 Bacteria 84765
557 Ga0111539_10001078 3300009094 Bacteria 36028
558 Ga0111539_10002632 3300009094 Bacteria 23770
559 Ga0111539_10004027 3300009094 Bacteria 19292
560 Ga0111539_10010143 3300009094 Bacteria 11870
561 Ga0111539_10015933 3300009094 Bacteria 9339
562 Ga0111539_10018505 3300009094 Bacteria 8629
563 Ga0111539_10066788 3300009094 Bacteria 4248
564 Ga0111539_10097678 3300009094 Bacteria 3450
565 Ga0111539_10187478 3300009094 Bacteria 2415
566 Ga0111539_10291782 3300009094 Unclassified 1898
567 Ga0111539_10321189 3300009094 Bacteria 1802
568 Ga0111539_10426199 3300009094 Bacteria 1545
569 Ga0111539_10510089 3300009094 Bacteria 1401
570 Ga0111539_10661077 3300009094 Bacteria 1217
571 Ga0111539_10806024 3300009094 Bacteria 1093
572 Ga0111539_11242735 3300009094 Unclassified 865
573 Ga0111539_11566589 3300009094 Unclassified 764
574 Ga0105245_10018654 3300009098 Bacteria 6068
575 Ga0105245_10046562 3300009098 Bacteria 3876
576 Ga0105245_10266120 3300009098 Bacteria 1670
577 Ga0105245_10518549 3300009098 Bacteria 1210
578 Ga0105245_10832324 3300009098 Unclassified 962
579 Ga0105245_11922539 3300009098 Unclassified 645
580 Ga0105247_10058133 3300009101 Bacteria 2392
581 Ga0105247_10159725 3300009101 Bacteria 1491
582 Ga0105247_10271953 3300009101 Bacteria 1166
583 Ga0114129_10000426 3300009147 Bacteria 50026
584 Ga0114129_10001213 3300009147 Bacteria 34237
585 Ga0114129_10004137 3300009147 Bacteria 20495
586 Ga0114129_10009181 3300009147 Bacteria 14099
587 Ga0114129_10009385 3300009147 Bacteria 13946
588 Ga0114129_10011201 3300009147 Bacteria 12784
589 Ga0114129_10016744 3300009147 Bacteria 10441
590 Ga0114129_10016919 3300009147 Bacteria 10383
591 Ga0114129_10029055 3300009147 Bacteria 7831
592 Ga0114129_10048963 3300009147 Bacteria 5939
593 Ga0114129_10051960 3300009147 Bacteria 5753
594 Ga0114129_10057730 3300009147 Bacteria 5430
595 Ga0114129_10064329 3300009147 Bacteria 5118
596 Ga0114129_10067793 3300009147 Bacteria 4975
597 Ga0114129_10072643 3300009147 Bacteria 4795
598 Ga0114129_10073868 3300009147 Bacteria 4750
599 Ga0114129_10095042 3300009147 Unclassified 4128
600 Ga0114129_10109022 3300009147 Bacteria 3822
601 Ga0114129_10143188 3300009147 Bacteria 3276
602 Ga0114129_10295970 3300009147 Bacteria 2159
603 Ga0114129_10566980 3300009147 Bacteria 1475
604 Ga0114129_11160523 3300009147 Bacteria 964
605 Ga0114129_11692215 3300009147 Unclassified 772
606 Ga0114129_12487459 3300009147 Unclassified 619
607 Ga0114129_12703291 3300009147 Unclassified 591
608 Ga0105243_10006934 3300009148 Bacteria 8724
609 Ga0105243_10010791 3300009148 Bacteria 6914
610 Ga0105243_10089689 3300009148 Bacteria 2529
611 Ga0105243_10175709 3300009148 Bacteria 1858
612 Ga0105243_10506248 3300009148 Bacteria 1145
613 Ga0105243_10771100 3300009148 Unclassified 945
614 Ga0105243_10923197 3300009148 Unclassified 870
615 Ga0105243_11471236 3300009148 Bacteria 704
616 Ga0105243_11608999 3300009148 Unclassified 676
617 Ga0105241_10026107 3300009174 Bacteria 4345
618 Ga0105241_10568860 3300009174 Bacteria 1020
619 Ga0105241_11039566 3300009174 Bacteria 768
620 Ga0105241_11892246 3300009174 Unclassified 584
621 Ga0105242_10022412 3300009176 Bacteria 4966
622 Ga0105242_10026817 3300009176 Unclassified 4569
623 Ga0105242_10268432 3300009176 Unclassified 1544
624 Ga0105242_10328003 3300009176 Bacteria 1406
625 Ga0105242_10366387 3300009176 Bacteria 1335
626 Ga0105242_10665893 3300009176 Bacteria 1014
627 Ga0105242_11024614 3300009176 Bacteria 835
628 Ga0105248_10002172 3300009177 Bacteria 21714
629 Ga0105248_10007536 3300009177 Bacteria 11949
630 Ga0105248_10043045 3300009177 Bacteria 5064
631 Ga0105248_10052710 3300009177 Bacteria 4565
632 Ga0105248_10059992 3300009177 Bacteria 4272
633 Ga0105248_10068556 3300009177 Bacteria 3982
634 Ga0105248_10107031 3300009177 Bacteria 3153
635 Ga0105248_10162200 3300009177 Unclassified 2521
636 Ga0105248_10200910 3300009177 Unclassified 2246
637 Ga0105248_10231761 3300009177 Unclassified 2079
638 Ga0105248_10320423 3300009177 Unclassified 1746
639 Ga0105248_10411347 3300009177 Unclassified 1523
640 Ga0105248_10495834 3300009177 Unclassified 1377
641 Ga0105248_11356672 3300009177 Bacteria 804
642 Ga0105248_12175856 3300009177 Unclassified 631
643 Ga0105237_10709398 3300009545 Bacteria 1012
644 Ga0105237_11273509 3300009545 Bacteria 742
645 Ga0105238_10036372 3300009551 Bacteria 5005
646 Ga0105238_10251909 3300009551 Unclassified 1744
647 Ga0105238_11837913 3300009551 Bacteria 638
648 Ga0105249_10025255 3300009553 Bacteria 5347
649 Ga0105249_10081617 3300009553 Bacteria 3006
650 Ga0105249_10272878 3300009553 Unclassified 1685
651 Ga0105249_10293297 3300009553 Unclassified 1629
652 Ga0105249_10350611 3300009553 Unclassified 1495
653 Ga0105249_10455199 3300009553 Unclassified 1319
654 Ga0105249_10867528 3300009553 Unclassified 969
655 Ga0105249_11977180 3300009553 Unclassified 656
656 Ga0105249_12262412 3300009553 Unclassified 616
657 Ga0105239_10699477 3300010375 Bacteria 1159
658 Ga0105239_10713110 3300010375 Bacteria 1147
659 Ga0105239_10815702 3300010375 Unclassified 1069
660 Ga0105246_10105238 3300011119 Unclassified 2062
661 Ga0105246_10467635 3300011119 Bacteria 1064
662 Ga0105246_10868449 3300011119 Unclassified 806
663 Ga0157373_11108636 3300013100 Unclassified 594
664 Ga0157370_10733794 3300013104 Unclassified 900
665 Ga0157374_10083773 3300013296 Bacteria 3030
666 Ga0157374_10104979 3300013296 Unclassified 2713
667 Ga0157374_10443606 3300013296 Bacteria 1299
668 Ga0157374_11656934 3300013296 Unclassified 664
669 Ga0157378_10009109 3300013297 Bacteria 8639
670 Ga0157378_10144928 3300013297 Bacteria 2208
671 Ga0157378_10561950 3300013297 Bacteria 1148
672 Ga0163162_10186185 3300013306 Unclassified 2203
673 Ga0163162_10549926 3300013306 Bacteria 1283
674 Ga0163162_10559856 3300013306 Bacteria 1271
675 Ga0163162_10609618 3300013306 Bacteria 1217
676 Ga0163162_10947929 3300013306 Unclassified 972
677 Ga0163162_11769678 3300013306 Bacteria 706
678 Ga0157372_10454180 3300013307 Bacteria 1493
679 Ga0157375_10055322 3300013308 Bacteria 3912
680 Ga0157375_10265853 3300013308 Unclassified 1877
681 Ga0157375_10340654 3300013308 Unclassified 1665
682 Ga0157375_10374552 3300013308 Unclassified 1590
683 Ga0157375_10587096 3300013308 Unclassified 1274
684 Ga0157375_10658352 3300013308 Unclassified 1203
685 Ga0157375_11224686 3300013308 Bacteria 881
686 Ga0163163_10006091 3300014325 Bacteria 10498
687 Ga0163163_10024951 3300014325 Bacteria 5693
688 Ga0163163_10033095 3300014325 Bacteria 4999
689 Ga0163163_10044334 3300014325 Bacteria 4363
690 Ga0163163_10049145 3300014325 Bacteria 4150
691 Ga0163163_10457893 3300014325 Unclassified 1336
692 Ga0163163_10662976 3300014325 Unclassified 1107
693 Ga0163163_11872649 3300014325 Bacteria 660
694 Ga0163163_12172974 3300014325 Unclassified 614
695 Ga0157380_10002946 3300014326 Bacteria 11577
696 Ga0157380_10008813 3300014326 Bacteria 7207
697 Ga0157380_10018744 3300014326 Bacteria 5145
698 Ga0157380_10048867 3300014326 Unclassified 3334
699 Ga0157380_10078622 3300014326 Unclassified 2692
700 Ga0157380_10088271 3300014326 Bacteria 2551
701 Ga0157380_10279419 3300014326 Bacteria 1527
702 Ga0157380_10417166 3300014326 Unclassified 1279
703 Ga0157380_10691176 3300014326 Unclassified 1024
704 Ga0157380_11418633 3300014326 Unclassified 745
705 Ga0157380_11524746 3300014326 Bacteria 722
706 Ga0157380_11547105 3300014326 Unclassified 717
707 Ga0157380_11772989 3300014326 Unclassified 676
708 Ga0182008_10291273 3300014497 Bacteria 852
709 Ga0157377_10066174 3300014745 Unclassified 2077
710 Ga0157377_10095762 3300014745 Bacteria 1760
711 Ga0157377_10155723 3300014745 Unclassified 1417
712 Ga0157377_10275103 3300014745 Bacteria 1101
713 Ga0157377_10331777 3300014745 Unclassified 1014
714 Ga0157377_10550822 3300014745 Unclassified 815
715 Ga0157379_10007040 3300014968 Bacteria 9721
716 Ga0157379_10007133 3300014968 Bacteria 9664
717 Ga0157379_10030765 3300014968 Bacteria 4780
718 Ga0157379_10037871 3300014968 Bacteria 4302
719 Ga0157379_10222767 3300014968 Bacteria 1709
720 Ga0157379_10304951 3300014968 Bacteria 1452
721 Ga0157379_10328355 3300014968 Bacteria 1397
722 Ga0157379_10640056 3300014968 Bacteria 995
723 Ga0157376_10024569 3300014969 Unclassified 4734
724 Ga0157376_10024693 3300014969 Bacteria 4724
725 Ga0157376_10086620 3300014969 Unclassified 2701
726 Ga0157376_10189607 3300014969 Bacteria 1885
727 Ga0157376_10366170 3300014969 Unclassified 1384
728 Ga0157376_10823342 3300014969 Bacteria 942
729 Ga0157376_11082052 3300014969 Unclassified 827
730 Ga0163161_10279799 3300017792 Bacteria 1308
731 Ga0163161_10379530 3300017792 Bacteria 1129
732 Ga0163161_10965245 3300017792 Unclassified 726
733 Ga0213876_10074971 3300021384 Bacteria 1787
734 Ga0207697_10024138 3300025315 Unclassified 2490
735 Ga0207697_10072296 3300025315 Bacteria 1446
736 Ga0207697_10274146 3300025315 Bacteria 747
737 Ga0207697_10357179 3300025315 Unclassified 649
738 Ga0207656_10097732 3300025321 Unclassified 1342
739 Ga0207653_10093372 3300025885 Unclassified 1056
740 Ga0207682_10004207 3300025893 Bacteria 6079
741 Ga0207682_10045366 3300025893 Unclassified 1803
742 Ga0207682_10048222 3300025893 Bacteria 1756
743 Ga0207682_10052586 3300025893 Unclassified 1688
744 Ga0207682_10064298 3300025893 Bacteria 1542
745 Ga0207682_10089494 3300025893 Unclassified 1332
746 Ga0207682_10093133 3300025893 Unclassified 1309
747 Ga0207682_10327128 3300025893 Unclassified 720
748 Ga0207692_10397454 3300025898 Bacteria 859
749 Ga0207642_10036643 3300025899 Bacteria 2107
750 Ga0207642_10101553 3300025899 Unclassified 1445
751 Ga0207710_10082088 3300025900 Bacteria 1497
752 Ga0207688_10348566 3300025901 Unclassified 912
753 Ga0207680_10023105 3300025903 Bacteria 3391
754 Ga0207680_10049583 3300025903 Unclassified 2500
755 Ga0207680_10132754 3300025903 Bacteria 1643
756 Ga0207680_10318152 3300025903 Unclassified 1088
757 Ga0207680_10792231 3300025903 Unclassified 679
758 Ga0207685_10174223 3300025905 Bacteria 992
759 Ga0207699_10026366 3300025906 Bacteria 3203
760 Ga0207699_10257100 3300025906 Bacteria 1206
761 Ga0207645_10001406 3300025907 Bacteria 19717
762 Ga0207645_10002286 3300025907 Bacteria 15200
763 Ga0207645_10065309 3300025907 Bacteria 2325
764 Ga0207645_10142585 3300025907 Unclassified 1561
765 Ga0207645_10148909 3300025907 Unclassified 1527
766 Ga0207643_10003202 3300025908 Bacteria 8817
767 Ga0207643_10042613 3300025908 Bacteria 2559
768 Ga0207643_10057393 3300025908 Bacteria 2216
769 Ga0207643_10077467 3300025908 Bacteria 1922
770 Ga0207643_10549995 3300025908 Unclassified 741
771 Ga0207684_10180841 3300025910 Unclassified 1818
772 Ga0207684_10189929 3300025910 Bacteria 1772
773 Ga0207684_10228661 3300025910 Bacteria 1605
774 Ga0207654_10301123 3300025911 Unclassified 1090
775 Ga0207707_10331947 3300025912 Bacteria 1312
776 Ga0207695_10151584 3300025913 Unclassified 2257
777 Ga0207695_10360308 3300025913 Unclassified 1341
778 Ga0207695_10428856 3300025913 Bacteria 1206
779 Ga0207695_10757082 3300025913 Bacteria 851
780 Ga0207671_10227660 3300025914 Bacteria 1462
781 Ga0207671_11049257 3300025914 Bacteria 641
782 Ga0207693_10139612 3300025915 Bacteria 1906
783 Ga0207693_10488325 3300025915 Unclassified 962
784 Ga0207693_10738222 3300025915 Unclassified 761
785 Ga0207663_10226206 3300025916 Unclassified 1364
786 Ga0207660_10085009 3300025917 Unclassified 2333
787 Ga0207660_10096368 3300025917 Bacteria 2202
788 Ga0207660_10165751 3300025917 Unclassified 1707
789 Ga0207660_10247169 3300025917 Bacteria 1407
790 Ga0207662_10007637 3300025918 Bacteria 5894
791 Ga0207662_10015889 3300025918 Bacteria 4241
792 Ga0207662_10099277 3300025918 Bacteria 1802
793 Ga0207662_10131006 3300025918 Unclassified 1581
794 Ga0207657_10006096 3300025919 Bacteria 12536
795 Ga0207657_10144559 3300025919 Bacteria 1941
796 Ga0207649_10073295 3300025920 Unclassified 2193
797 Ga0207649_10075530 3300025920 Unclassified 2166
798 Ga0207649_10727068 3300025920 Bacteria 771
799 Ga0207649_10857902 3300025920 Unclassified 711
800 Ga0207652_10052515 3300025921 Bacteria 3499
801 Ga0207652_10360643 3300025921 Unclassified 1312
802 Ga0207652_10399292 3300025921 Bacteria 1240
803 Ga0207652_10697637 3300025921 Unclassified 906
804 Ga0207652_10727255 3300025921 Bacteria 884
805 Ga0207646_10067972 3300025922 Bacteria 3182
806 Ga0207646_10146933 3300025922 Unclassified 2124
807 Ga0207646_10167580 3300025922 Bacteria 1983
808 Ga0207646_10658221 3300025922 Unclassified 938
809 Ga0207646_10771753 3300025922 Unclassified 857
810 Ga0207646_10980208 3300025922 Bacteria 747
811 Ga0207681_10009178 3300025923 Bacteria 6042
812 Ga0207681_10022038 3300025923 Bacteria 4059
813 Ga0207681_10025121 3300025923 Bacteria 3829
814 Ga0207681_10036364 3300025923 Bacteria 3248
815 Ga0207681_10051798 3300025923 Unclassified 2782
816 Ga0207681_10146109 3300025923 Bacteria 1767
817 Ga0207681_10438186 3300025923 Bacteria 1061
818 Ga0207694_10142401 3300025924 Unclassified 1929
819 Ga0207650_10002374 3300025925 Bacteria 13100
820 Ga0207650_10084901 3300025925 Bacteria 2407
821 Ga0207650_10121252 3300025925 Unclassified 2036
822 Ga0207650_10295594 3300025925 Unclassified 1322
823 Ga0207650_10549731 3300025925 Unclassified 968
824 Ga0207650_10801154 3300025925 Unclassified 798
825 Ga0207659_10000079 3300025926 Bacteria 60790
826 Ga0207659_10001272 3300025926 Bacteria 15110
827 Ga0207659_10001629 3300025926 Bacteria 13323
828 Ga0207659_10012585 3300025926 Bacteria 5389
829 Ga0207659_10029655 3300025926 Bacteria 3731
830 Ga0207659_10058294 3300025926 Bacteria 2772
831 Ga0207659_10097120 3300025926 Bacteria 2212
832 Ga0207659_10136365 3300025926 Bacteria 1900
833 Ga0207659_10163907 3300025926 Bacteria 1748
834 Ga0207659_10193963 3300025926 Bacteria 1618
835 Ga0207659_10235224 3300025926 Bacteria 1479
836 Ga0207659_10581384 3300025926 Bacteria 954
837 Ga0207687_10124628 3300025927 Bacteria 1932
838 Ga0207687_10136073 3300025927 Viruses 1858
839 Ga0207687_10263500 3300025927 Bacteria 1375
840 Ga0207687_11381762 3300025927 Unclassified 605
841 Ga0207700_10005583 3300025928 Bacteria 7549
842 Ga0207700_10006132 3300025928 Bacteria 7239
843 Ga0207700_10279505 3300025928 Bacteria 1436
844 Ga0207700_10438202 3300025928 Bacteria 1150
845 Ga0207700_11121973 3300025928 Bacteria 703
846 Ga0207664_10139643 3300025929 Bacteria 2048
847 Ga0207644_10098430 3300025931 Bacteria 2192
848 Ga0207644_10103306 3300025931 Bacteria 2144
849 Ga0207644_10464392 3300025931 Bacteria 1041
850 Ga0207644_11140984 3300025931 Unclassified 655
851 Ga0207690_10116446 3300025932 Bacteria 1933
852 Ga0207690_10159647 3300025932 Bacteria 1680
853 Ga0207706_10006050 3300025933 Bacteria 11253
854 Ga0207706_10101857 3300025933 Unclassified 2527
855 Ga0207706_10129500 3300025933 Unclassified 2219
856 Ga0207706_10134783 3300025933 Bacteria 2172
857 Ga0207706_10164552 3300025933 Bacteria 1949
858 Ga0207706_10167166 3300025933 Bacteria 1933
859 Ga0207706_10388096 3300025933 Unclassified 1211
860 Ga0207706_10418896 3300025933 Unclassified 1160
861 Ga0207706_10902198 3300025933 Unclassified 746
862 Ga0207686_10012850 3300025934 Bacteria 4615
863 Ga0207686_10020581 3300025934 Bacteria 3771
864 Ga0207686_10049693 3300025934 Bacteria 2604
865 Ga0207686_10238381 3300025934 Bacteria 1322
866 Ga0207686_10242409 3300025934 Bacteria 1313
867 Ga0207686_10647968 3300025934 Bacteria 835
868 Ga0207686_11249943 3300025934 Bacteria 609
869 Ga0207709_10004795 3300025935 Bacteria 7750
870 Ga0207709_10006292 3300025935 Bacteria 6666
871 Ga0207709_10194962 3300025935 Unclassified 1442
872 Ga0207709_10307838 3300025935 Bacteria 1181
873 Ga0207670_10002109 3300025936 Bacteria 10392
874 Ga0207670_10093752 3300025936 Unclassified 2128
875 Ga0207670_10163474 3300025936 Bacteria 1664
876 Ga0207670_10250581 3300025936 Bacteria 1368
877 Ga0207670_10341404 3300025936 Bacteria 1184
878 Ga0207670_10496198 3300025936 Bacteria 991
879 Ga0207670_10639302 3300025936 Bacteria 876
880 Ga0207670_10803123 3300025936 Unclassified 784
881 Ga0207669_10029033 3300025937 Bacteria 3052
882 Ga0207669_10322202 3300025937 Bacteria 1183
883 Ga0207669_10380953 3300025937 Unclassified 1099
884 Ga0207669_10612134 3300025937 Bacteria 886
885 Ga0207669_10702761 3300025937 Bacteria 831
886 Ga0207669_10807414 3300025937 Unclassified 778
887 Ga0207669_10889369 3300025937 Unclassified 743
888 Ga0207669_11210408 3300025937 Unclassified 640
889 Ga0207704_10001806 3300025938 Bacteria 9595
890 Ga0207704_10022964 3300025938 Bacteria 3353
891 Ga0207704_10095293 3300025938 Bacteria 1967
892 Ga0207704_10101794 3300025938 Bacteria 1917
893 Ga0207704_10141205 3300025938 Unclassified 1685
894 Ga0207704_10668633 3300025938 Bacteria 857
895 Ga0207665_10090888 3300025939 Unclassified 2116
896 Ga0207665_10553627 3300025939 Bacteria 894
897 Ga0207665_10852006 3300025939 Unclassified 722
898 Ga0207691_10018862 3300025940 Bacteria 6533
899 Ga0207691_10045113 3300025940 Bacteria 4054
900 Ga0207691_10070189 3300025940 Bacteria 3164
901 Ga0207691_10122904 3300025940 Bacteria 2298
902 Ga0207691_10176973 3300025940 Bacteria 1866
903 Ga0207691_10353247 3300025940 Bacteria 1257
904 Ga0207691_10428238 3300025940 Unclassified 1127
905 Ga0207691_10538456 3300025940 Bacteria 990
906 Ga0207691_10642074 3300025940 Unclassified 897
907 Ga0207691_10649339 3300025940 Unclassified 891
908 Ga0207711_10006268 3300025941 Bacteria 10036
909 Ga0207711_10027728 3300025941 Bacteria 4759
910 Ga0207711_10036902 3300025941 Bacteria 4148
911 Ga0207711_10057589 3300025941 Bacteria 3341
912 Ga0207711_10082424 3300025941 Bacteria 2811
913 Ga0207711_10141424 3300025941 Bacteria 2166
914 Ga0207711_10379055 3300025941 Bacteria 1312
915 Ga0207711_10584376 3300025941 Unclassified 1042
916 Ga0207711_10589809 3300025941 Bacteria 1037
917 Ga0207711_10821846 3300025941 Unclassified 865
918 Ga0207711_10920258 3300025941 Bacteria 813
919 Ga0207711_11097910 3300025941 Unclassified 736
920 Ga0207689_10000032 3300025942 Bacteria 96794
921 Ga0207689_10045085 3300025942 Bacteria 3647
922 Ga0207689_10081837 3300025942 Bacteria 2654
923 Ga0207689_10125401 3300025942 Bacteria 2112
924 Ga0207689_10228789 3300025942 Bacteria 1537
925 Ga0207689_10240049 3300025942 Bacteria 1498
926 Ga0207689_10323548 3300025942 Unclassified 1280
927 Ga0207661_10098786 3300025944 Viruses 2447
928 Ga0207661_10106732 3300025944 Unclassified 2361
929 Ga0207661_10334552 3300025944 Bacteria 1364
930 Ga0207661_10342356 3300025944 Bacteria 1348
931 Ga0207661_10396865 3300025944 Bacteria 1250
932 Ga0207661_10795048 3300025944 Bacteria 871
933 Ga0207679_10073204 3300025945 Bacteria 2591
934 Ga0207679_10686495 3300025945 Bacteria 928
935 Ga0207679_10744666 3300025945 Unclassified 891
936 Ga0207679_10801763 3300025945 Unclassified 858
937 Ga0207679_11371468 3300025945 Bacteria 649
938 Ga0207667_10104283 3300025949 Bacteria 2925
939 Ga0207667_10451829 3300025949 Bacteria 1306
940 Ga0207667_10866185 3300025949 Unclassified 897
941 Ga0207667_11025418 3300025949 Bacteria 811
942 Ga0207651_10010999 3300025960 Bacteria 5043
943 Ga0207651_10048187 3300025960 Unclassified 2878
944 Ga0207651_10110003 3300025960 Bacteria 2066
945 Ga0207651_10185688 3300025960 Bacteria 1654
946 Ga0207651_10342397 3300025960 Unclassified 1256
947 Ga0207651_10524791 3300025960 Bacteria 1027
948 Ga0207712_10073047 3300025961 Unclassified 2472
949 Ga0207712_10260004 3300025961 Bacteria 1407
950 Ga0207712_11240747 3300025961 Unclassified 666
951 Ga0207712_11279341 3300025961 Unclassified 655
952 Ga0207668_10085374 3300025972 Bacteria 2303
953 Ga0207668_10730246 3300025972 Bacteria 872
954 Ga0207668_11564651 3300025972 Unclassified 595
955 Ga0207640_10873542 3300025981 Unclassified 784
956 Ga0207640_10910496 3300025981 Unclassified 769
957 Ga0207640_11062493 3300025981 Unclassified 715
958 Ga0207677_10065710 3300026023 Unclassified 2532
959 Ga0207677_10201274 3300026023 Unclassified 1583
960 Ga0207677_10270975 3300026023 Bacteria 1389
961 Ga0207677_10331780 3300026023 Bacteria 1268
962 Ga0207677_10557228 3300026023 Unclassified 1000
963 Ga0207703_10008882 3300026035 Bacteria 7918
964 Ga0207703_10018977 3300026035 Bacteria 5372
965 Ga0207703_10045404 3300026035 Bacteria 3534
966 Ga0207703_10049674 3300026035 Bacteria 3392
967 Ga0207703_10065358 3300026035 Bacteria 2989
968 Ga0207703_10167253 3300026035 Unclassified 1931
969 Ga0207703_10227604 3300026035 Bacteria 1670
970 Ga0207703_10838593 3300026035 Bacteria 879
971 Ga0207703_10888294 3300026035 Unclassified 853
972 Ga0207703_11245904 3300026035 Unclassified 715
973 Ga0207639_10200242 3300026041 Bacteria 1712
974 Ga0207678_10054360 3300026067 Bacteria 3448
975 Ga0207678_10292250 3300026067 Bacteria 1400
976 Ga0207708_10004043 3300026075 Bacteria 10785
977 Ga0207708_10004337 3300026075 Bacteria 10446
978 Ga0207708_10102480 3300026075 Unclassified 2216
979 Ga0207708_10115449 3300026075 Unclassified 2088
980 Ga0207708_10132107 3300026075 Bacteria 1953
981 Ga0207708_10227810 3300026075 Bacteria 1495
982 Ga0207708_10231410 3300026075 Bacteria 1484
983 Ga0207708_10289983 3300026075 Bacteria 1328
984 Ga0207708_10419909 3300026075 Bacteria 1109
985 Ga0207702_10314643 3300026078 Unclassified 1489
986 Ga0207641_10000955 3300026088 Bacteria 29716
987 Ga0207641_10106423 3300026088 Bacteria 2479
988 Ga0207641_10329613 3300026088 Bacteria 1450
989 Ga0207641_10341335 3300026088 Unclassified 1425
990 Ga0207641_10790080 3300026088 Bacteria 938
991 Ga0207641_11598577 3300026088 Unclassified 654
992 Ga0207648_10001379 3300026089 Bacteria 26764
993 Ga0207648_10002536 3300026089 Bacteria 19594
994 Ga0207648_10053012 3300026089 Bacteria 3546
995 Ga0207648_10092785 3300026089 Bacteria 2640
996 Ga0207648_10099685 3300026089 Unclassified 2544
997 Ga0207648_10139264 3300026089 Bacteria 2138
998 Ga0207648_10211164 3300026089 Bacteria 1723
999 Ga0207648_10254914 3300026089 Unclassified 1565
1000 Ga0207648_10281533 3300026089 Unclassified 1487
1001 Ga0207648_10334651 3300026089 Unclassified 1362
1002 Ga0207648_11322834 3300026089 Bacteria 677
1003 Ga0207648_11467147 3300026089 Bacteria 641
1004 Ga0207676_10014812 3300026095 Bacteria 5618
1005 Ga0207676_10032483 3300026095 Bacteria 3934
1006 Ga0207676_10034193 3300026095 Bacteria 3847
1007 Ga0207676_10109644 3300026095 Unclassified 2307
1008 Ga0207676_10150793 3300026095 Bacteria 2002
1009 Ga0207676_10180475 3300026095 Viruses 1848
1010 Ga0207676_10307813 3300026095 Unclassified 1449
1011 Ga0207676_10525687 3300026095 Bacteria 1127
1012 Ga0207674_10061584 3300026116 Bacteria 3792
1013 Ga0207674_10592894 3300026116 Bacteria 1070
1014 Ga0207674_10656898 3300026116 Bacteria 1013
1015 Ga0207674_10707475 3300026116 Unclassified 972
1016 Ga0207675_100087094 3300026118 Unclassified 2933
1017 Ga0207675_100088170 3300026118 Bacteria 2914
1018 Ga0207675_100115838 3300026118 Unclassified 2532
1019 Ga0207675_100116172 3300026118 Bacteria 2529
1020 Ga0207675_100230505 3300026118 Bacteria 1787
1021 Ga0207675_100254408 3300026118 Bacteria 1701
1022 Ga0207675_100278637 3300026118 Bacteria 1624
1023 Ga0207675_100347885 3300026118 Unclassified 1452
1024 Ga0207675_100385732 3300026118 Bacteria 1378
1025 Ga0207675_100595480 3300026118 Bacteria 1108
1026 Ga0207675_100618544 3300026118 Bacteria 1087
1027 Ga0207675_100857438 3300026118 Unclassified 923
1028 Ga0207675_101042915 3300026118 Bacteria 837
1029 Ga0207683_10033044 3300026121 Bacteria 4493
1030 Ga0207683_10157417 3300026121 Bacteria 2052
1031 Ga0207683_10206224 3300026121 Bacteria 1788
1032 Ga0207683_10313072 3300026121 Unclassified 1437
1033 Ga0207683_10414536 3300026121 Bacteria 1240
1034 Ga0207683_10433160 3300026121 Bacteria 1212
1035 Ga0207683_10558342 3300026121 Bacteria 1059
1036 Ga0207683_10688106 3300026121 Unclassified 948
1037 Ga0207683_10800358 3300026121 Bacteria 875
1038 Ga0207683_11067291 3300026121 Unclassified 749
1039 Ga0207683_11146007 3300026121 Bacteria 721
1040 Ga0207698_10400208 3300026142 Unclassified 1312
1041 Ga0209983_1106675 3300027665 Unclassified 636
1042 Ga0209971_1026227 3300027682 Unclassified 1393
1043 Ga0209974_10063480 3300027876 Bacteria 1252
1044 Ga0207428_10000005 3300027907 Bacteria 520045
1045 Ga0207428_10000156 3300027907 Bacteria 93294
1046 Ga0207428_10003214 3300027907 Bacteria 15966
1047 Ga0207428_10006617 3300027907 Bacteria 10661
1048 Ga0207428_10007795 3300027907 Bacteria 9748
1049 Ga0207428_10017798 3300027907 Bacteria 6093
1050 Ga0207428_10032828 3300027907 Bacteria 4269
1051 Ga0207428_10035587 3300027907 Bacteria 4069
1052 Ga0207428_10331834 3300027907 Unclassified 1121
1053 Ga0207428_10630272 3300027907 Bacteria 771
1054 Ga0268266_10076315 3300028379 Bacteria 2912
1055 Ga0268266_10148463 3300028379 Bacteria 2110
1056 Ga0268266_10204191 3300028379 Bacteria 1810
1057 Ga0268266_10400322 3300028379 Unclassified 1298
1058 Ga0268265_10007655 3300028380 Bacteria 7289
1059 Ga0268265_10080399 3300028380 Bacteria 2570
1060 Ga0268265_10151383 3300028380 Unclassified 1957
1061 Ga0268265_10192637 3300028380 Bacteria 1762
1062 Ga0268265_10221870 3300028380 Unclassified 1655
1063 Ga0268265_10533288 3300028380 Bacteria 1111
1064 Ga0268265_10595829 3300028380 Unclassified 1055
1065 Ga0268264_10023300 3300028381 Bacteria 5051
1066 Ga0268264_10035080 3300028381 Bacteria 4130
1067 Ga0268264_10148355 3300028381 Bacteria 2100
1068 Ga0268264_10278405 3300028381 Bacteria 1566
1069 Ga0268264_10282422 3300028381 Unclassified 1556
1070 Ga0268264_10334699 3300028381 Unclassified 1436
1071 Ga0268264_10473607 3300028381 Unclassified 1217
1072 Ga0265316_10444674 3300031344 Bacteria 930
1073 Ga0307408_100078365 3300031548 Bacteria 2463
1074 Ga0307408_100081459 3300031548 Bacteria 2420
1075 Ga0307408_100392206 3300031548 Bacteria 1190
1076 Ga0307408_100803021 3300031548 Bacteria 854
1077 Ga0265314_10033286 3300031711 Bacteria 3782
1078 Ga0307405_10079173 3300031731 Unclassified 2141
1079 Ga0307405_10112523 3300031731 Unclassified 1847
1080 Ga0307405_10133043 3300031731 Bacteria 1722
1081 Ga0307405_10482364 3300031731 Unclassified 990
1082 Ga0307405_10597284 3300031731 Unclassified 900
1083 Ga0307413_10100156 3300031824 Unclassified 1912
1084 Ga0307413_10463454 3300031824 Unclassified 1009
1085 Ga0307413_10927710 3300031824 Unclassified 741
1086 Ga0307410_10051926 3300031852 Unclassified 2766
1087 Ga0307410_10079408 3300031852 Bacteria 2299
1088 Ga0307410_10116868 3300031852 Unclassified 1939
1089 Ga0307410_10124814 3300031852 Bacteria 1883
1090 Ga0307410_10835309 3300031852 Unclassified 785
1091 Ga0307406_10343830 3300031901 Bacteria 1163
1092 Ga0307407_10084019 3300031903 Unclassified 1933
1093 Ga0307412_10194730 3300031911 Bacteria 1535
1094 Ga0307412_10542345 3300031911 Bacteria 975
1095 Ga0307409_100074356 3300031995 Unclassified 2715
1096 Ga0307409_100300793 3300031995 Bacteria 1492
1097 Ga0307416_100028056 3300032002 Bacteria 4180
1098 Ga0307416_100038313 3300032002 Bacteria 3698
1099 Ga0307416_100059664 3300032002 Bacteria 3101
1100 Ga0307416_100300829 3300032002 Bacteria 1594
1101 Ga0307416_100374617 3300032002 Unclassified 1451
1102 Ga0307416_100707017 3300032002 Bacteria 1097
1103 Ga0307414_10097706 3300032004 Bacteria 2201
1104 Ga0307414_10129721 3300032004 Bacteria 1955
1105 Ga0307414_10349360 3300032004 Bacteria 1269
1106 Ga0307414_10615760 3300032004 Unclassified 975
1107 Ga0307414_10640988 3300032004 Unclassified 957
1108 Ga0307414_11121239 3300032004 Bacteria 727
1109 Ga0307411_10114535 3300032005 Unclassified 1937
1110 Ga0307411_10117822 3300032005 Unclassified 1914
1111 Ga0307411_10202710 3300032005 Bacteria 1525
1112 Ga0307411_10435962 3300032005 Bacteria 1092
1113 Ga0307411_10460682 3300032005 Unclassified 1066
1114 Ga0307415_100010673 3300032126 Bacteria 5213
1115 Ga0307415_100154027 3300032126 Bacteria 1773
1116 Ga0307415_100668424 3300032126 Unclassified 933
1117 Ga0307415_101172548 3300032126 Unclassified 722
1118 Ga0373930_0002854 3300034816 Bacteria 2711
1119 Ga0373948_0018575 3300034817 Unclassified 1307
1120 Ga0373950_0000492 3300034818 Bacteria 4841
1121 Ga0373958_0024338 3300034819 Bacteria 1145
1122 Ga0373928_0006977 3300035084 Bacteria 2177
1123 Ga0373929_0000407 3300035085 Bacteria 8103
1124 Ga0373949_0000966 3300035090 Bacteria 8928
1125 Ga0373952_0000798 3300035092 Bacteria 5659
1126 Ga0373923_0079124 3300035111 Unclassified 1424
1127 Ga0373939_0030625 3300035114 Bacteria 1549
1128 Ga0373939_0109649 3300035114 Unclassified 959
1129 Ga0373941_0013295 3300035115 Bacteria 2173
1130 Ga0373941_0183910 3300035115 Unclassified 786
1131 Ga0373953_0220071 3300035117 Bacteria 822
1132 Ga0373954_0051964 3300035118 Bacteria 1926
1133 Ga0373954_0184461 3300035118 Bacteria 1024
1134 Ga0373960_0217085 3300035121 Unclassified 683
1135 Ga0373943_0021226 3300035170 Bacteria 2997
1136 Ga0373943_0185733 3300035170 Bacteria 1145
1137 Ga0373943_0217615 3300035170 Unclassified 1063
1138 Ga0373943_0224021 3300035170 Bacteria 1048
1139 Ga0373946_0029315 3300035171 Bacteria 2190
1140 Ga0373946_0318098 3300035171 Bacteria 773
1141 Ga0373955_0003019 3300035172 Bacteria 7378
1142 Ga0373955_0046443 3300035172 Unclassified 2348
1143 Ga0373955_0076519 3300035172 Bacteria 1883
1144 Ga0373955_0442855 3300035172 Unclassified 791
1145 Ga0373955_0842861 3300035172 Unclassified 564
1146 Ga0373942_0001566 3300035207 Bacteria 5861
1147 Ga0373924_0021449 3300035410 Unclassified 2520
1148 Ga0373924_0140817 3300035410 Unclassified 1052
1149 Ga0373931_0007480 3300035691 Bacteria 5143
1150 Ga0373935_0083599 3300035692 Bacteria 2078
1151 Ga0373935_0134413 3300035692 Bacteria 1665
1152 Ga0373935_0164017 3300035692 Unclassified 1516
1153 Ga0373935_0185751 3300035692 Bacteria 1429
1154 Ga0373927_0155381 3300035695 Unclassified 1498
1155 Ga0373933_0418322 3300035724 Bacteria 875
1156 Ga0373933_0740285 3300035724 Unclassified 647
1157 Ga0373947_0003818 3300035725 Bacteria 8873
1158 Ga0373937_0012405 3300036401 Bacteria 7495
1159 Ga0373937_0176206 3300036401 Bacteria 2007
1160 Ga0373937_0381356 3300036401 Bacteria 1337
1161 Ga0373937_0393320 3300036401 Unclassified 1315
1162 Ga0373937_0608866 3300036401 Unclassified 1037
1163 Ga0373937_1823949 3300036401 Bacteria 555
1164 Ga0373925_0266622 3300037068 Bacteria 1377
1165 Ga0373925_0482653 3300037068 Bacteria 1017
1166 Ga0373925_0542746 3300037068 Bacteria 956
1167 Ga0373925_1199410 3300037068 Bacteria 624
1168 Ga0395900_0459263 3300037418 Unclassified 1229
1169 Ga0395905_0197773 3300037471 Bacteria 1885
1170 Ga0242420_027094 3300038996 Unclassified 1049
1171 Ga0436365_0956175 3300039437 Bacteria 2742
1172 Ga0436365_1732685 3300039437 Bacteria 2188
1173 Ga0439439_0093016 3300041406 Bacteria 825
1174 Ga0439453_0017767 3300041408 Bacteria 1252
1175 Ga0439453_0026277 3300041408 Bacteria 1078
1176 Ga0439431_0006753 3300041997 Unclassified 2547
1177 Ga0439433_0001889 3300041999 Bacteria 4381
1178 Ga0439437_014446 3300042000 Unclassified 923
1179 Ga0439462_0051606 3300042015 Bacteria 1106
1180 Ga0450892_007492 3300042130 Bacteria 921
1181 Ga0439446_0028655 3300042156 Bacteria 1604
1182 Ga0439446_0095397 3300042156 Unclassified 935
1183 Ga0439446_0251776 3300042156 Bacteria 609
1184 Ga0439458_0092357 3300042157 Bacteria 780
1185 Ga0439434_0099914 3300042435 Bacteria 934
1186 Ga0439435_0052341 3300042436 Bacteria 1172
1187 Ga0439435_0069724 3300042436 Bacteria 1039
1188 Ga0439464_0061668 3300042439 Bacteria 1098
1189 Ga0439460_0040424 3300042461 Bacteria 1366
1190 Ga0439460_0063976 3300042461 Bacteria 1128
1191 Ga0439460_0123444 3300042461 Bacteria 849
1192 Ga0450916_034769 3300042530 Bacteria 747
1193 Ga0451577_0424665 3300042876 Unclassified 1207
1194 Ga0439440_0033118 3300042993 Bacteria 1230
1195 Ga0439440_0098351 3300042993 Unclassified 793
1196 Ga0466963_0184194 3300044694 Bacteria 1458
1197 Ga0466963_0239302 3300044694 Bacteria 1273
1198 Ga0466957_0155932 3300044842 Bacteria 1480
1199 Ga0451576_0003703 3300045051 Bacteria 20672
1200 Ga0451576_0301734 3300045051 Bacteria 1675
1201 Ga0466967_0493469 3300045976 Bacteria 1201
1202 Ga0495592_0025040 3300046454 Bacteria 4532
1203 Ga0495592_0139872 3300046454 Bacteria 1685
1204 Ga0495603_0028319 3300046455 Unclassified 3379
1205 Ga0495603_0042909 3300046455 Unclassified 2702
1206 Ga0495603_0358636 3300046455 Bacteria 836
1207 Ga0495629_0085053 3300046459 Unclassified 2207
1208 Ga0495629_0206389 3300046459 Unclassified 1358
1209 Ga0495580_0316248 3300046472 Viruses 1061
1210 Ga0495582_0181798 3300046473 Bacteria 1198
1211 Ga0495582_0472333 3300046473 Bacteria 725
1212 Ga0495639_0076786 3300046475 Unclassified 1550
1213 Ga0495664_0171598 3300046477 Bacteria 1316
1214 Ga0495664_0296679 3300046477 Bacteria 976
1215 Ga0495584_0025210 3300046491 Bacteria 3014
1216 Ga0495584_0410163 3300046491 Unclassified 689
1217 Ga0495594_0029180 3300046499 Unclassified 2981
1218 Ga0495594_0066860 3300046499 Bacteria 1994
1219 Ga0495594_0252872 3300046499 Bacteria 1004
1220 Ga0495594_0353963 3300046499 Bacteria 836
1221 Ga0495608_0003942 3300046511 Bacteria 10667
1222 Ga0495618_0086045 3300046514 Bacteria 2010
1223 Ga0495618_0617134 3300046514 Bacteria 644
1224 Ga0495630_0009709 3300046517 Bacteria 6922
1225 Ga0495630_1022797 3300046517 Unclassified 628
1226 Ga0495643_0009097 3300046522 Bacteria 6222
1227 Ga0495644_0096332 3300046523 Unclassified 1118
1228 Ga0495663_0017329 3300046525 Bacteria 2043
1229 Ga0495652_0245893 3300046529 Unclassified 1328
1230 Ga0495652_0635473 3300046529 Unclassified 724
1231 Ga0495654_0322069 3300046530 Unclassified 627
1232 Ga0495665_0483848 3300046531 Bacteria 624
1233 Ga0495640_0047607 3300046533 Bacteria 2967
1234 Ga0495640_0078023 3300046533 Unclassified 2207
1235 Ga0495640_0416169 3300046533 Bacteria 824
1236 Ga0495587_0051732 3300046536 Bacteria 2427
1237 Ga0495587_0176508 3300046536 Bacteria 1212
1238 Ga0495598_0012654 3300046537 Unclassified 2076
1239 Ga0495598_0117596 3300046537 Bacteria 898
1240 Ga0495598_0146081 3300046537 Unclassified 822
1241 Ga0495609_0019629 3300046538 Bacteria 3125
1242 Ga0495621_0003364 3300046539 Bacteria 4412
1243 Ga0495621_0037939 3300046539 Bacteria 1678
1244 Ga0495621_0109503 3300046539 Unclassified 1058
1245 Ga0495621_0116445 3300046539 Unclassified 1029
1246 Ga0495645_0000450 3300046543 Bacteria 28247
1247 Ga0495633_0093088 3300046558 Unclassified 1401
1248 Ga0495667_0040064 3300046559 Bacteria 3112
1249 Ga0495634_0081249 3300046642 Bacteria 2120
1250 Ga0495634_0326616 3300046642 Bacteria 923
1251 Ga0495634_0422055 3300046642 Bacteria 790
1252 Ga0495611_0197354 3300046648 Bacteria 939
1253 Ga0495635_0053736 3300046663 Bacteria 2775
1254 Ga0495635_0088667 3300046663 Bacteria 2117
1255 Ga0495659_0015579 3300046664 Bacteria 2501
1256 Ga0495659_0191227 3300046664 Unclassified 836
1257 Ga0495588_0057859 3300046674 Bacteria 2003
1258 Ga0495657_0311723 3300046675 Bacteria 937
1259 Ga0495623_0047499 3300046679 Unclassified 2725
1260 Ga0495647_0214209 3300046681 Bacteria 848
1261 Ga0495658_0025322 3300046683 Bacteria 3170
1262 Ga0495658_0090500 3300046683 Bacteria 1811
1263 Ga0495658_0168637 3300046683 Unclassified 1354
1264 Ga0495658_0580717 3300046683 Bacteria 718
1265 Ga0495669_0004081 3300046684 Bacteria 6006
1266 Ga0495669_0007347 3300046684 Bacteria 4616
1267 Ga0495669_0103649 3300046684 Unclassified 1323
1268 Ga0495669_0333198 3300046684 Unclassified 733
1269 Ga0495613_0001676 3300046689 Bacteria 16870
1270 Ga0495670_0077989 3300046691 Bacteria 1685
1271 Ga0495600_0092987 3300046809 Unclassified 1967
1272 Ga0495600_0332280 3300046809 Bacteria 954
1273 Ga0495636_0043766 3300047318 Bacteria 1863
1274 Ga0495674_0082858 3300047319 Unclassified 2750
1275 Ga0495674_0091091 3300047319 Bacteria 2605
1276 Ga0495674_0233224 3300047319 Unclassified 1518
1277 Ga0495676_0071461 3300047321 Unclassified 2668
1278 Ga0495675_0452837 3300047444 Unclassified 742
1279 Ga0495675_0476815 3300047444 Bacteria 719
1280 Ga0495677_0021678 3300047445 Bacteria 2329
1281 Ga0495685_063483 3300047447 Unclassified 1243
1282 Ga0495684_0002679 3300047471 Bacteria 14108
1283 Ga0495684_0025447 3300047471 Unclassified 4548
1284 Ga0495593_0174023 3300047673 Bacteria 1085
1285 Ga0495602_0401247 3300048088 Unclassified 978
1286 Ga0496100_0005315 3300048903 Bacteria 6921
1287 Ga0496100_1547020 3300048903 Unclassified 524
1288 Ga0496101_0000338 3300048904 Bacteria 31903
1289 Ga0496101_0163598 3300048904 Bacteria 1708
1290 Ga0496101_0504818 3300048904 Bacteria 955
1291 Ga0496102_0120104 3300048905 Unclassified 2454
1292 Ga0496102_0365200 3300048905 Bacteria 1359
1293 Ga0496104_0011885 3300048907 Bacteria 7814
1294 Ga0496104_0063755 3300048907 Bacteria 3496
1295 Ga0496104_0116270 3300048907 Bacteria 2567
1296 Ga0496104_0641105 3300048907 Bacteria 971
1297 Ga0496104_0791916 3300048907 Unclassified 854
1298 Ga0496105_0027444 3300048908 Bacteria 4652
1299 Ga0496105_0263662 3300048908 Bacteria 1393
1300 Ga0496105_0522093 3300048908 Bacteria 930
1301 Ga0496105_0534097 3300048908 Unclassified 917
1302 Ga0496106_0080483 3300048909 Unclassified 2502
1303 Ga0496107_0007329 3300048910 Bacteria 7605
1304 Ga0496108_0228402 3300048911 Bacteria 1618
1305 Ga0496108_0685751 3300048911 Bacteria 889
1306 Ga0496108_0934304 3300048911 Bacteria 743
1307 Ga0496109_0079029 3300048912 Bacteria 3030
1308 Ga0496109_0165002 3300048912 Bacteria 2076
1309 Ga0496109_0585075 3300048912 Bacteria 1052
1310 Ga0496109_0689410 3300048912 Bacteria 959
1311 Ga0496110_0659312 3300048913 Unclassified 947
1312 Ga0496111_0221188 3300048914 Bacteria 1407
1313 Ga0496111_1030007 3300048914 Bacteria 589
1314 Ga0496112_0002810 3300048915 Bacteria 14131
1315 Ga0496112_0086620 3300048915 Bacteria 3099
1316 Ga0496112_0167090 3300048915 Bacteria 2166
1317 Ga0496112_0216587 3300048915 Bacteria 1871
1318 Ga0496112_0242980 3300048915 Bacteria 1753
1319 Ga0496112_0422774 3300048915 Bacteria 1271
1320 Ga0496112_0456036 3300048915 Unclassified 1216
1321 Ga0496112_0741276 3300048915 Bacteria 909
1322 Ga0496113_0379672 3300048916 Bacteria 1134
1323 Ga0496114_0001212 3300048917 Bacteria 19503
1324 Ga0496114_0050503 3300048917 Bacteria 3462
1325 Ga0496114_0084214 3300048917 Bacteria 2692
1326 Ga0496114_0124083 3300048917 Bacteria 2224
1327 Ga0496114_0198014 3300048917 Bacteria 1759
1328 Ga0496114_0222524 3300048917 Unclassified 1657
1329 Ga0496114_0357960 3300048917 Bacteria 1291
1330 Ga0496114_0508159 3300048917 Unclassified 1066
1331 Ga0496115_0125497 3300048918 Bacteria 2114
1332 Ga0501299_060055 3300049522 Unclassified 804
1333 Ga0501031_0169692 3300049568 Bacteria 1426
1334 Ga0501031_0245236 3300049568 Bacteria 1164
1335 Ga0501031_0281248 3300049568 Bacteria 1079
1336 Ga0501034_0158536 3300049571 Bacteria 2236
1337 Ga0501036_0258953 3300049572 Bacteria 1457
1338 Ga0501036_0316407 3300049572 Bacteria 1304
1339 Ga0501036_0355452 3300049572 Bacteria 1223
1340 Ga0501036_0632035 3300049572 Unclassified 887
1341 Ga0501037_0177620 3300049573 Bacteria 1512
1342 Ga0501037_0531813 3300049573 Bacteria 795
1343 Ga0501038_0043210 3300049574 Bacteria 3920
1344 Ga0501038_0134017 3300049574 Bacteria 2031
1345 Ga0501039_0005083 3300049575 Bacteria 9967
1346 Ga0501040_0009144 3300049576 Bacteria 6452
1347 Ga0501040_0021727 3300049576 Bacteria 4290
1348 Ga0501040_0049618 3300049576 Bacteria 2870
1349 Ga0501040_0422137 3300049576 Bacteria 959
1350 Ga0501040_0617110 3300049576 Bacteria 784
1351 Ga0501041_0080818 3300049577 Bacteria 2001
1352 Ga0501041_0944903 3300049577 Unclassified 554
1353 Ga0501042_0003809 3300049578 Bacteria 9538
1354 Ga0501042_0085038 3300049578 Bacteria 2268
1355 Ga0501043_0038916 3300049579 Bacteria 3739
1356 Ga0501046_0047476 3300049580 Bacteria 3404
1357 Ga0501046_0054245 3300049580 Bacteria 3154
1358 Ga0501047_0453613 3300049581 Bacteria 1111
1359 Ga0501048_0049799 3300049582 Bacteria 2985
1360 Ga0501048_0279882 3300049582 Unclassified 1186
1361 Ga0501048_1149577 3300049582 Bacteria 558
1362 Ga0501068_0082561 3300049584 Bacteria 1974
1363 Ga0501068_0511945 3300049584 Bacteria 779
1364 Ga0501071_0015832 3300049587 Bacteria 5179
1365 Ga0501071_0192495 3300049587 Bacteria 1530
1366 Ga0501071_0934381 3300049587 Bacteria 669
1367 Ga0501072_0006572 3300049588 Bacteria 8854
1368 Ga0501072_0026593 3300049588 Bacteria 4511
1369 Ga0501073_0326630 3300049589 Bacteria 1059
1370 Ga0501075_0023042 3300049591 Bacteria 4555
1371 Ga0501075_0110545 3300049591 Bacteria 2089
1372 Ga0501075_0468852 3300049591 Unclassified 960
1373 Ga0501076_0040773 3300049592 Bacteria 3650
1374 Ga0501076_0136177 3300049592 Bacteria 1994
1375 Ga0501076_0423239 3300049592 Bacteria 1096
1376 Ga0501076_0656617 3300049592 Bacteria 865
1377 Ga0501077_0047177 3300049593 Bacteria 2737
1378 Ga0501077_0072533 3300049593 Bacteria 2182
1379 Ga0501216_072708 3300049660 Unclassified 714
1380 Ga0501221_035984 3300049704 Unclassified 1059
1381 Ga0501079_0005197 3300049741 Bacteria 9676
1382 Ga0501079_0087472 3300049741 Bacteria 2412
1383 Ga0501079_0669540 3300049741 Bacteria 817
1384 Ga0501080_0425907 3300049742 Bacteria 1192
1385 Ga0501081_0008696 3300049743 Bacteria 6598
1386 Ga0501081_0041776 3300049743 Bacteria 3141
1387 Ga0501081_0588644 3300049743 Unclassified 832
1388 Ga0501083_0073605 3300049744 Bacteria 2271
1389 Ga0501035_0192170 3300049822 Bacteria 1755
1390 Ga0501035_0933073 3300049822 Unclassified 686
1391 Ga0501035_0961356 3300049822 Bacteria 673
1392 Ga0501044_0092948 3300049823 Bacteria 3042
1393 Ga0501044_1290198 3300049823 Unclassified 597
1394 Ga0501045_0004657 3300049824 Bacteria 9472
1395 Ga0501045_0241444 3300049824 Unclassified 1345
1396 Ga0501045_0264909 3300049824 Bacteria 1279
1397 nmdc:mga03683_1149_c1 3300050489 Bacteria 7787
1398 nmdc:mga00v17_7255_c1 3300050491 Bacteria 5906
1399 nmdc:mga0yw44_555493_c1 3300050492 Unclassified 780
1400 nmdc:mga05p37_11071_c1 3300050507 Bacteria 10716
1401 nmdc:mga05p37_138803_c1 3300050507 Bacteria 2979
1402 nmdc:mga05p37_139331_c1 3300050507 Unclassified 2973
1403 nmdc:mga05p37_158861_c1 3300050507 Bacteria 2761
1404 nmdc:mga05p37_1965492_c1 3300050507 Unclassified 555
1405 nmdc:mga05p37_1997_c1 3300050507 Bacteria 23815
1406 nmdc:mga05p37_20363_c1 3300050507 Bacteria 8026
1407 nmdc:mga05p37_23209_c1 3300050507 Bacteria 7526
1408 nmdc:mga05p37_24698_c1 3300050507 Bacteria 7305
1409 nmdc:mga05p37_25595_c1 3300050507 Bacteria 7178
1410 nmdc:mga05p37_26118_c2 3300050507 Bacteria 5344
1411 nmdc:mga05p37_34921_c1 3300050507 Bacteria 6162
1412 nmdc:mga05p37_37736_c1 3300050507 Bacteria 5926
1413 nmdc:mga05p37_43651_c1 3300050507 Bacteria 5516
1414 nmdc:mga05p37_44023_c1 3300050507 Bacteria 5492
1415 nmdc:mga05p37_48901_c1 3300050507 Bacteria 5200
1416 nmdc:mga05p37_5217_c1 3300050507 Bacteria 15249
1417 nmdc:mga05p37_73083_c1 3300050507 Bacteria 4220
1418 nmdc:mga05p37_91576_c1 3300050507 Bacteria 3747
1419 nmdc:mga05p37_967626_c1 3300050507 Bacteria 909
1420 nmdc:mga09592_1189676_c1 3300050508 Bacteria 630
1421 nmdc:mga09592_13559_c1 3300050508 Bacteria 6657
1422 nmdc:mga09592_139923_c1 3300050508 Unclassified 2086
1423 nmdc:mga09592_149535_c1 3300050508 Unclassified 2014
1424 nmdc:mga09592_19921_c1 3300050508 Bacteria 5511
1425 nmdc:mga09592_201873_c1 3300050508 Bacteria 1722
1426 nmdc:mga09592_23513_c1 3300050508 Bacteria 5090
1427 nmdc:mga09592_26276_c1 3300050508 Bacteria 4822
1428 nmdc:mga09592_38159_c1 3300050508 Bacteria 4031
1429 nmdc:mga09592_456600_c1 3300050508 Bacteria 1102
1430 nmdc:mga09592_68792_c1 3300050508 Bacteria 3003
1431 nmdc:mga0qj67_194295_c1 3300050509 Bacteria 1649
1432 nmdc:mga0qj67_245188_c1 3300050509 Bacteria 1454
1433 nmdc:mga0qj67_255819_c1 3300050509 Bacteria 1421
1434 nmdc:mga0qj67_27328_c1 3300050509 Bacteria 4422
1435 nmdc:mga0qj67_7153_c1 3300050509 Bacteria 8234
1436 nmdc:mga0qj67_7629_c1 3300050509 Bacteria 7992
1437 nmdc:mga06r32_1076344_c1 3300050510 Bacteria 754
1438 nmdc:mga06r32_132439_c1 3300050510 Bacteria 2466
1439 nmdc:mga06r32_14936_c1 3300050510 Bacteria 7048
1440 nmdc:mga06r32_270474_c1 3300050510 Unclassified 1687
1441 nmdc:mga06r32_29574_c1 3300050510 Bacteria 5137
1442 nmdc:mga06r32_616343_c1 3300050510 Unclassified 1055
1443 nmdc:mga06r32_655429_c1 3300050510 Unclassified 1018
1444 nmdc:mga06r32_86132_c1 3300050510 Bacteria 3064
1445 nmdc:mga06r32_9476_c1 3300050510 Bacteria 8790
1446 nmdc:mga08y16_108808_c1 3300050511 Bacteria 2886
1447 nmdc:mga08y16_116259_c1 3300050511 Unclassified 2784
1448 nmdc:mga08y16_1178584_c1 3300050511 Bacteria 738
1449 nmdc:mga08y16_1367_c1 3300050511 Bacteria 24369
1450 nmdc:mga08y16_1568_c1 3300050511 Bacteria 23067
1451 nmdc:mga08y16_227293_c1 3300050511 Unclassified 1931
1452 nmdc:mga08y16_2507_c1 3300050511 Bacteria 18886
1453 nmdc:mga08y16_2643_c1 3300050511 Bacteria 18424
1454 nmdc:mga08y16_266469_c1 3300050511 Bacteria 1769
1455 nmdc:mga08y16_273804_c1 3300050511 Unclassified 1742
1456 nmdc:mga08y16_2862_c1 3300050511 Bacteria 17748
1457 nmdc:mga08y16_352547_c1 3300050511 Bacteria 1511
1458 nmdc:mga08y16_390387_c1 3300050511 Bacteria 1426
1459 nmdc:mga08y16_449722_c1 3300050511 Bacteria 1314
1460 nmdc:mga08y16_4998_c1 3300050511 Bacteria 13866
1461 nmdc:mga08y16_658_c1 3300050511 Bacteria 32511
1462 nmdc:mga08y16_67477_c1 3300050511 Unclassified 3731
1463 nmdc:mga08y16_9_c1 3300050511 Bacteria 566088
1464 nmdc:mga0n895_1037810_c1 3300050512 Unclassified 799
1465 nmdc:mga0n895_13596_c1 3300050512 Bacteria 7353
1466 nmdc:mga0n895_141_c1 3300050512 Bacteria 43611
1467 nmdc:mga0n895_166078_c1 3300050512 Bacteria 2239
1468 nmdc:mga0n895_19824_c1 3300050512 Bacteria 6259
1469 nmdc:mga0n895_267490_c1 3300050512 Bacteria 1734
1470 nmdc:mga0n895_304759_c1 3300050512 Bacteria 1615
1471 nmdc:mga0n895_343217_c1 3300050512 Unclassified 1512
1472 nmdc:mga0n895_35782_c1 3300050512 Bacteria 4790
1473 nmdc:mga0n895_472679_c1 3300050512 Bacteria 1265
1474 nmdc:mga0n895_476418_c1 3300050512 Bacteria 1259
1475 nmdc:mga0n895_546195_c1 3300050512 Unclassified 1165
1476 nmdc:mga0n895_58404_c1 3300050512 Bacteria 3804
1477 nmdc:mga0n895_602783_c1 3300050512 Bacteria 1100
1478 nmdc:mga0n895_72372_c1 3300050512 Bacteria 3420
1479 nmdc:mga0n895_737660_c1 3300050512 Bacteria 979
1480 nmdc:mga0n895_81880_c1 3300050512 Unclassified 3217
1481 nmdc:mga0rr50_1006114_c1 3300050513 Bacteria 710
1482 nmdc:mga0rr50_12990_c1 3300050513 Bacteria 5404
1483 nmdc:mga0rr50_14183_c1 3300050513 Bacteria 5218
1484 nmdc:mga0rr50_176227_c1 3300050513 Bacteria 1745
1485 nmdc:mga0rr50_1_c1 3300050513 Bacteria 558123
1486 nmdc:mga0rr50_316066_c1 3300050513 Bacteria 1309
1487 nmdc:mga0rr50_398071_c1 3300050513 Bacteria 1163
1488 nmdc:mga0rr50_539301_c1 3300050513 Unclassified 993
1489 nmdc:mga0rr50_560727_c1 3300050513 Unclassified 973
1490 nmdc:mga0rr50_682119_c1 3300050513 Bacteria 877
1491 nmdc:mga0rr50_761091_c1 3300050513 Bacteria 827
1492 nmdc:mga0rr50_8550_c1 3300050513 Bacteria 6378
1493 nmdc:mga0rr50_8679_c1 3300050513 Bacteria 6338
1494 nmdc:mga08x19_148053_c1 3300050514 Unclassified 1589
1495 nmdc:mga08x19_153311_c1 3300050514 Bacteria 1562
1496 nmdc:mga08x19_191333_c1 3300050514 Bacteria 1400
1497 nmdc:mga08x19_3155_c1 3300050514 Bacteria 9893
1498 nmdc:mga08x19_34798_c1 3300050514 Unclassified 3185
1499 nmdc:mga08x19_416343_c1 3300050514 Unclassified 944
1500 nmdc:mga08x19_92_c1 3300050514 Bacteria 80986
1501 nmdc:mga0a205_112707_c2 3300050515 Bacteria 2158
1502 nmdc:mga0a205_120196_c1 3300050515 Unclassified 2526
1503 nmdc:mga0a205_12067_c2 3300050515 Bacteria 5976
1504 nmdc:mga0a205_1225776_c1 3300050515 Bacteria 598
1505 nmdc:mga0a205_131663_c1 3300050515 Bacteria 2401
1506 nmdc:mga0a205_132875_c1 3300050515 Unclassified 2389
1507 nmdc:mga0a205_151535_c1 3300050515 Unclassified 2218
1508 nmdc:mga0a205_167404_c1 3300050515 Unclassified 2094
1509 nmdc:mga0a205_219892_c1 3300050515 Bacteria 1785
1510 nmdc:mga0a205_2573_c1 3300050515 Bacteria 15998
1511 nmdc:mga0a205_281542_c1 3300050515 Unclassified 1538
1512 nmdc:mga0a205_370522_c1 3300050515 Bacteria 1298
1513 nmdc:mga0a205_394862_c1 3300050515 Bacteria 1247
1514 nmdc:mga0a205_532506_c1 3300050515 Bacteria 1031
1515 nmdc:mga0a205_649189_c1 3300050515 Bacteria 907
1516 nmdc:mga0a205_676287_c1 3300050515 Bacteria 883
1517 nmdc:mga0sz30_222545_c1 3300050516 Bacteria 839
1518 Ga0495601_0003730 3300053077 Bacteria 8770
1519 Ga0495601_0068407 3300053077 Bacteria 2264
1520 Ga0495601_0135362 3300053077 Bacteria 1606
1521 Ga0495595_0012548 3300053084 Bacteria 3564
1522 Ga0495595_0405849 3300053084 Bacteria 691
1523 Ga0495619_0006567 3300053085 Bacteria 7357
1524 Ga0495619_0280366 3300053085 Bacteria 1155
1525 Ga0495619_0433888 3300053085 Bacteria 906
1526 Ga0495619_0769263 3300053085 Unclassified 652
1527 Ga0500628_043052 3300053129 Bacteria 1040
1528 Ga0501084_0009574 3300054114 Bacteria 8018
1529 Ga0501084_0043281 3300054114 Bacteria 3767
1530 Ga0501084_0359012 3300054114 Unclassified 1231
1531 Ga0501084_1006567 3300054114 Unclassified 700
1532 Ga0590071_000739 3300059421 Bacteria 9160
1533 Ga0590071_005043 3300059421 Bacteria 3187
1534 Ga0590074_003587 3300059423 Bacteria 2570
1535 Ga0590074_042319 3300059423 Unclassified 821
1536 Ga0590075_001312 3300059424 Bacteria 6243
1537 Ga0590075_002211 3300059424 Bacteria 4679
1538 Ga0590075_057765 3300059424 Unclassified 999
1539 Ga0590075_113661 3300059424 Bacteria 707
1540 Ga0590077_000747 3300059426 Bacteria 8520
1541 Ga0587091_100514 3300059511 Bacteria 678
1542 Ga0587114_031768 3300059655 Unclassified 811
1543 Ga0501082_0163480 3300060353 Bacteria 1934
1544 Ga0501082_0444785 3300060353 Unclassified 1132
1545 Ga0501082_0818939 3300060353 Bacteria 814
1546 Ga0530510_0009184 3300061734 Bacteria 6928
1547 Ga0530510_0062078 3300061734 Bacteria 2705
1548 Ga0530510_0289552 3300061734 Unclassified 1224

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025315 Ga0207697_10072296 Ga0207697_100722963 144
2 3300049568 Ga0501031_0169692 Ga0501031_0169692_711_1154 147
3 3300049572 Ga0501036_0355452 Ga0501036_0355452_45_488 147
4 3300049582 Ga0501048_1149577 Ga0501048_1149577_90_533 147
5 3300049592 Ga0501076_0423239 Ga0501076_0423239_297_740 147
6 3300005458 Ga0070681_11157304 Ga0070681_111573042 152
7 3300025915 Ga0207693_10139612 Ga0207693_101396123 153
8 3300049744 Ga0501083_0073605 Ga0501083_0073605_804_1322 156
9 3300050511 nmdc:mga08y16_1178584_c1 nmdc:mga08y16_1178584_c1_251_721 156
10 3300005347 Ga0070668_100735908 Ga0070668_1007359081 158
11 3300005459 Ga0068867_101672557 Ga0068867_1016725571 158
12 3300005844 Ga0068862_100594903 Ga0068862_1005949032 158
13 3300006844 Ga0075428_101635840 Ga0075428_1016358401 158
14 3300009094 Ga0111539_10426199 Ga0111539_104261993 158
15 3300025936 Ga0207670_10496198 Ga0207670_104961981 158
16 3300025961 Ga0207712_11240747 Ga0207712_112407471 158
17 3300025972 Ga0207668_10730246 Ga0207668_107302461 158
18 3300005289 Ga0065704_10537012 Ga0065704_105370121 159
19 3300005290 Ga0065712_10162315 Ga0065712_101623153 159
20 3300005293 Ga0065715_10408396 Ga0065715_104083961 159
21 3300005295 Ga0065707_10247239 Ga0065707_102472391 159
22 3300005295 Ga0065707_10302678 Ga0065707_103026782 159
23 3300005295 Ga0065707_10484671 Ga0065707_104846711 159
24 3300005328 Ga0070676_10026241 Ga0070676_100262412 159
25 3300005328 Ga0070676_10199862 Ga0070676_101998621 159
26 3300005328 Ga0070676_10357983 Ga0070676_103579832 159
27 3300005331 Ga0070670_100052956 Ga0070670_1000529563 159
28 3300005334 Ga0068869_101215174 Ga0068869_1012151741 159
29 3300005335 Ga0070666_10198726 Ga0070666_101987261 159
30 3300005337 Ga0070682_100900612 Ga0070682_1009006121 159
31 3300005337 Ga0070682_101072323 Ga0070682_1010723231 159
32 3300005338 Ga0068868_100064048 Ga0068868_1000640483 159
33 3300005338 Ga0068868_100330401 Ga0068868_1003304012 159
34 3300005340 Ga0070689_100586620 Ga0070689_1005866202 159
35 3300005341 Ga0070691_10000892 Ga0070691_100008923 159
36 3300005345 Ga0070692_10035812 Ga0070692_100358122 159
37 3300005347 Ga0070668_100105729 Ga0070668_1001057292 159
38 3300005353 Ga0070669_100031310 Ga0070669_1000313102 159
39 3300005353 Ga0070669_100615765 Ga0070669_1006157651 159
40 3300005353 Ga0070669_100669953 Ga0070669_1006699532 159
41 3300005353 Ga0070669_100678850 Ga0070669_1006788501 159
42 3300005354 Ga0070675_100217685 Ga0070675_1002176852 159
43 3300005354 Ga0070675_100313845 Ga0070675_1003138452 159
44 3300005355 Ga0070671_100320519 Ga0070671_1003205192 159
45 3300005355 Ga0070671_100354947 Ga0070671_1003549471 159
46 3300005356 Ga0070674_100044223 Ga0070674_1000442233 159
47 3300005356 Ga0070674_100140019 Ga0070674_1001400192 159
48 3300005356 Ga0070674_100241008 Ga0070674_1002410082 159
49 3300005356 Ga0070674_100779800 Ga0070674_1007798002 159
50 3300005356 Ga0070674_101255596 Ga0070674_1012555961 159
51 3300005434 Ga0070709_10007316 Ga0070709_100073162 159
52 3300005434 Ga0070709_10759539 Ga0070709_107595392 159
53 3300005435 Ga0070714_100003070 Ga0070714_1000030702 159
54 3300005436 Ga0070713_100004893 Ga0070713_1000048935 159
55 3300005436 Ga0070713_100193518 Ga0070713_1001935182 159
56 3300005440 Ga0070705_100001404 Ga0070705_10000140410 159
57 3300005441 Ga0070700_100000788 Ga0070700_1000007888 159
58 3300005441 Ga0070700_100068953 Ga0070700_1000689532 159
59 3300005441 Ga0070700_100274394 Ga0070700_1002743941 159
60 3300005444 Ga0070694_100007026 Ga0070694_1000070263 159
61 3300005445 Ga0070708_100032111 Ga0070708_1000321113 159
62 3300005456 Ga0070678_100116947 Ga0070678_1001169472 159
63 3300005456 Ga0070678_100140021 Ga0070678_1001400212 159
64 3300005456 Ga0070678_100653885 Ga0070678_1006538851 159
65 3300005457 Ga0070662_100073576 Ga0070662_1000735763 159
66 3300005457 Ga0070662_100203340 Ga0070662_1002033401 159
67 3300005457 Ga0070662_101063022 Ga0070662_1010630221 159
68 3300005458 Ga0070681_10386081 Ga0070681_103860812 159
69 3300005459 Ga0068867_100115369 Ga0068867_1001153692 159
70 3300005459 Ga0068867_100139519 Ga0068867_1001395192 159
71 3300005466 Ga0070685_10047159 Ga0070685_100471593 159
72 3300005466 Ga0070685_10106243 Ga0070685_101062431 159
73 3300005467 Ga0070706_100236430 Ga0070706_1002364302 159
74 3300005467 Ga0070706_100286210 Ga0070706_1002862101 159
75 3300005468 Ga0070707_100657285 Ga0070707_1006572852 159
76 3300005471 Ga0070698_100011223 Ga0070698_1000112233 159
77 3300005471 Ga0070698_100138182 Ga0070698_1001381821 159
78 3300005530 Ga0070679_100127817 Ga0070679_1001278173 159
79 3300005535 Ga0070684_100179696 Ga0070684_1001796963 159
80 3300005543 Ga0070672_100196808 Ga0070672_1001968081 159
81 3300005543 Ga0070672_100617737 Ga0070672_1006177372 159
82 3300005545 Ga0070695_100016291 Ga0070695_1000162913 159
83 3300005546 Ga0070696_100039612 Ga0070696_1000396123 159
84 3300005547 Ga0070693_100169522 Ga0070693_1001695222 159
85 3300005548 Ga0070665_100020086 Ga0070665_1000200864 159
86 3300005548 Ga0070665_100195381 Ga0070665_1001953811 159
87 3300005549 Ga0070704_100026609 Ga0070704_1000266092 159
88 3300005563 Ga0068855_100238478 Ga0068855_1002384782 159
89 3300005614 Ga0068856_101833176 Ga0068856_1018331761 159
90 3300005615 Ga0070702_100003228 Ga0070702_1000032282 159
91 3300005615 Ga0070702_100962764 Ga0070702_1009627642 159
92 3300005616 Ga0068852_101897063 Ga0068852_1018970631 159
93 3300005617 Ga0068859_100208366 Ga0068859_1002083662 159
94 3300005618 Ga0068864_100201604 Ga0068864_1002016043 159
95 3300005718 Ga0068866_10024941 Ga0068866_100249413 159
96 3300005718 Ga0068866_10085221 Ga0068866_100852212 159
97 3300005719 Ga0068861_100010565 Ga0068861_1000105652 159
98 3300005719 Ga0068861_100079028 Ga0068861_1000790282 159
99 3300005719 Ga0068861_100164360 Ga0068861_1001643602 159
100 3300005719 Ga0068861_100823788 Ga0068861_1008237882 159
101 3300005834 Ga0068851_10033637 Ga0068851_100336372 159
102 3300005841 Ga0068863_100062464 Ga0068863_1000624643 159
103 3300005841 Ga0068863_100184236 Ga0068863_1001842363 159
104 3300005843 Ga0068860_100219487 Ga0068860_1002194872 159
105 3300005844 Ga0068862_100021517 Ga0068862_1000215172 159
106 3300005844 Ga0068862_100040092 Ga0068862_1000400923 159
107 3300005844 Ga0068862_100053094 Ga0068862_1000530942 159
108 3300005844 Ga0068862_100260760 Ga0068862_1002607602 159
109 3300005844 Ga0068862_100636813 Ga0068862_1006368132 159
110 3300005844 Ga0068862_100657343 Ga0068862_1006573432 159
111 3300005844 Ga0068862_100746979 Ga0068862_1007469791 159
112 3300006163 Ga0070715_10045399 Ga0070715_100453992 159
113 3300006163 Ga0070715_10059729 Ga0070715_100597292 159
114 3300006163 Ga0070715_10370458 Ga0070715_103704582 159
115 3300006173 Ga0070716_100520649 Ga0070716_1005206492 159
116 3300006173 Ga0070716_100865244 Ga0070716_1008652442 159
117 3300006237 Ga0097621_100000125 Ga0097621_10000012526 159
118 3300006237 Ga0097621_100014893 Ga0097621_1000148933 159
119 3300006237 Ga0097621_100017310 Ga0097621_1000173103 159
120 3300006237 Ga0097621_100113414 Ga0097621_1001134143 159
121 3300006358 Ga0068871_100000134 Ga0068871_10000013437 159
122 3300006358 Ga0068871_100005587 Ga0068871_1000055873 159
123 3300006358 Ga0068871_100039886 Ga0068871_1000398863 159
124 3300006358 Ga0068871_100149927 Ga0068871_1001499272 159
125 3300006358 Ga0068871_100291605 Ga0068871_1002916052 159
126 3300006844 Ga0075428_100000497 Ga0075428_10000049722 159
127 3300006847 Ga0075431_100199916 Ga0075431_1001999162 159
128 3300006852 Ga0075433_10177266 Ga0075433_101772662 159
129 3300006852 Ga0075433_10467641 Ga0075433_104676412 159
130 3300006852 Ga0075433_11039815 Ga0075433_110398152 159
131 3300006871 Ga0075434_100005743 Ga0075434_1000057434 159
132 3300006871 Ga0075434_100082673 Ga0075434_1000826733 159
133 3300006881 Ga0068865_100030248 Ga0068865_1000302482 159
134 3300006881 Ga0068865_100145708 Ga0068865_1001457082 159
135 3300006881 Ga0068865_100189475 Ga0068865_1001894753 159
136 3300006881 Ga0068865_100576003 Ga0068865_1005760031 159
137 3300006914 Ga0075436_100084710 Ga0075436_1000847103 159
138 3300006931 Ga0097620_100208383 Ga0097620_1002083832 159
139 3300007076 Ga0075435_100065934 Ga0075435_1000659343 159
140 3300007076 Ga0075435_100509157 Ga0075435_1005091572 159
141 3300009093 Ga0105240_10170233 Ga0105240_101702333 159
142 3300009094 Ga0111539_10000014 Ga0111539_10000014141 159
143 3300009094 Ga0111539_10004027 Ga0111539_100040279 159
144 3300009094 Ga0111539_10018505 Ga0111539_100185055 159
145 3300009094 Ga0111539_10806024 Ga0111539_108060241 159
146 3300009098 Ga0105245_10518549 Ga0105245_105185492 159
147 3300009147 Ga0114129_11160523 Ga0114129_111605231 159
148 3300009148 Ga0105243_10010791 Ga0105243_100107912 159
149 3300009148 Ga0105243_10089689 Ga0105243_100896893 159
150 3300009174 Ga0105241_11892246 Ga0105241_118922461 159
151 3300009176 Ga0105242_10026817 Ga0105242_100268174 159
152 3300009176 Ga0105242_10268432 Ga0105242_102684322 159
153 3300009176 Ga0105242_10665893 Ga0105242_106658931 159
154 3300009177 Ga0105248_10200910 Ga0105248_102009102 159
155 3300009177 Ga0105248_10411347 Ga0105248_104113472 159
156 3300009177 Ga0105248_12175856 Ga0105248_121758562 159
157 3300009551 Ga0105238_10036372 Ga0105238_100363722 159
158 3300009551 Ga0105238_10251909 Ga0105238_102519091 159
159 3300009551 Ga0105238_11837913 Ga0105238_118379131 159
160 3300009553 Ga0105249_10025255 Ga0105249_100252554 159
161 3300009553 Ga0105249_10293297 Ga0105249_102932972 159
162 3300010375 Ga0105239_10699477 Ga0105239_106994772 159
163 3300013104 Ga0157370_10733794 Ga0157370_107337941 159
164 3300013296 Ga0157374_10443606 Ga0157374_104436061 159
165 3300013297 Ga0157378_10009109 Ga0157378_100091092 159
166 3300013297 Ga0157378_10144928 Ga0157378_101449282 159
167 3300013306 Ga0163162_10186185 Ga0163162_101861852 159
168 3300013308 Ga0157375_11224686 Ga0157375_112246862 159
169 3300014325 Ga0163163_11872649 Ga0163163_118726492 159
170 3300014325 Ga0163163_12172974 Ga0163163_121729741 159
171 3300014326 Ga0157380_10008813 Ga0157380_100088136 159
172 3300014326 Ga0157380_10417166 Ga0157380_104171662 159
173 3300014326 Ga0157380_11772989 Ga0157380_117729891 159
174 3300014968 Ga0157379_10304951 Ga0157379_103049512 159
175 3300014969 Ga0157376_10024569 Ga0157376_100245696 159
176 3300014969 Ga0157376_10024693 Ga0157376_100246933 159
177 3300014969 Ga0157376_10823342 Ga0157376_108233422 159
178 3300014969 Ga0157376_11082052 Ga0157376_110820521 159
179 3300017792 Ga0163161_10279799 Ga0163161_102797992 159
180 3300025315 Ga0207697_10024138 Ga0207697_100241383 159
181 3300025315 Ga0207697_10274146 Ga0207697_102741462 159
182 3300025885 Ga0207653_10093372 Ga0207653_100933722 159
183 3300025893 Ga0207682_10052586 Ga0207682_100525862 159
184 3300025893 Ga0207682_10089494 Ga0207682_100894942 159
185 3300025898 Ga0207692_10397454 Ga0207692_103974542 159
186 3300025899 Ga0207642_10101553 Ga0207642_101015532 159
187 3300025903 Ga0207680_10132754 Ga0207680_101327542 159
188 3300025905 Ga0207685_10174223 Ga0207685_101742232 159
189 3300025906 Ga0207699_10026366 Ga0207699_100263662 159
190 3300025907 Ga0207645_10001406 Ga0207645_100014063 159
191 3300025907 Ga0207645_10065309 Ga0207645_100653093 159
192 3300025907 Ga0207645_10142585 Ga0207645_101425852 159
193 3300025910 Ga0207684_10180841 Ga0207684_101808412 159
194 3300025910 Ga0207684_10189929 Ga0207684_101899292 159
195 3300025912 Ga0207707_10331947 Ga0207707_103319472 159
196 3300025915 Ga0207693_10488325 Ga0207693_104883252 159
197 3300025920 Ga0207649_10727068 Ga0207649_107270681 159
198 3300025921 Ga0207652_10360643 Ga0207652_103606432 159
199 3300025923 Ga0207681_10025121 Ga0207681_100251212 159
200 3300025923 Ga0207681_10146109 Ga0207681_101461092 159
201 3300025924 Ga0207694_10142401 Ga0207694_101424012 159
202 3300025925 Ga0207650_10084901 Ga0207650_100849012 159
203 3300025926 Ga0207659_10136365 Ga0207659_101363652 159
204 3300025926 Ga0207659_10193963 Ga0207659_101939632 159
205 3300025927 Ga0207687_10124628 Ga0207687_101246283 159
206 3300025928 Ga0207700_10005583 Ga0207700_100055833 159
207 3300025928 Ga0207700_10279505 Ga0207700_102795052 159
208 3300025928 Ga0207700_10438202 Ga0207700_104382022 159
209 3300025929 Ga0207664_10139643 Ga0207664_101396432 159
210 3300025933 Ga0207706_10129500 Ga0207706_101295003 159
211 3300025933 Ga0207706_10167166 Ga0207706_101671661 159
212 3300025933 Ga0207706_10388096 Ga0207706_103880962 159
213 3300025934 Ga0207686_10049693 Ga0207686_100496932 159
214 3300025934 Ga0207686_10238381 Ga0207686_102383812 159
215 3300025934 Ga0207686_10242409 Ga0207686_102424093 159
216 3300025935 Ga0207709_10004795 Ga0207709_100047952 159
217 3300025935 Ga0207709_10307838 Ga0207709_103078381 159
218 3300025936 Ga0207670_10341404 Ga0207670_103414042 159
219 3300025937 Ga0207669_10029033 Ga0207669_100290333 159
220 3300025937 Ga0207669_10380953 Ga0207669_103809531 159
221 3300025938 Ga0207704_10101794 Ga0207704_101017942 159
222 3300025938 Ga0207704_10141205 Ga0207704_101412052 159
223 3300025939 Ga0207665_10553627 Ga0207665_105536272 159
224 3300025939 Ga0207665_10852006 Ga0207665_108520062 159
225 3300025940 Ga0207691_10176973 Ga0207691_101769732 159
226 3300025940 Ga0207691_10353247 Ga0207691_103532472 159
227 3300025941 Ga0207711_10036902 Ga0207711_100369023 159
228 3300025941 Ga0207711_10589809 Ga0207711_105898092 159
229 3300025941 Ga0207711_10821846 Ga0207711_108218462 159
230 3300025941 Ga0207711_10920258 Ga0207711_109202581 159
231 3300025942 Ga0207689_10240049 Ga0207689_102400492 159
232 3300025944 Ga0207661_10098786 Ga0207661_100987863 159
233 3300025944 Ga0207661_10106732 Ga0207661_101067322 159
234 3300025949 Ga0207667_11025418 Ga0207667_110254182 159
235 3300025960 Ga0207651_10110003 Ga0207651_101100032 159
236 3300025960 Ga0207651_10185688 Ga0207651_101856883 159
237 3300025972 Ga0207668_10085374 Ga0207668_100853742 159
238 3300026023 Ga0207677_10065710 Ga0207677_100657103 159
239 3300026075 Ga0207708_10004337 Ga0207708_100043372 159
240 3300026075 Ga0207708_10115449 Ga0207708_101154492 159
241 3300026075 Ga0207708_10231410 Ga0207708_102314101 159
242 3300026088 Ga0207641_10790080 Ga0207641_107900802 159
243 3300026088 Ga0207641_11598577 Ga0207641_115985772 159
244 3300026089 Ga0207648_10002536 Ga0207648_100025362 159
245 3300026089 Ga0207648_10092785 Ga0207648_100927853 159
246 3300026089 Ga0207648_10099685 Ga0207648_100996852 159
247 3300026089 Ga0207648_11322834 Ga0207648_113228342 159
248 3300026095 Ga0207676_10180475 Ga0207676_101804752 159
249 3300026118 Ga0207675_100116172 Ga0207675_1001161722 159
250 3300026118 Ga0207675_100595480 Ga0207675_1005954802 159
251 3300026121 Ga0207683_10157417 Ga0207683_101574172 159
252 3300026121 Ga0207683_10433160 Ga0207683_104331602 159
253 3300027876 Ga0209974_10063480 Ga0209974_100634802 159
254 3300027907 Ga0207428_10000005 Ga0207428_10000005105 159
255 3300027907 Ga0207428_10003214 Ga0207428_1000321412 159
256 3300027907 Ga0207428_10032828 Ga0207428_100328284 159
257 3300028379 Ga0268266_10076315 Ga0268266_100763153 159
258 3300028379 Ga0268266_10400322 Ga0268266_104003222 159
259 3300028380 Ga0268265_10080399 Ga0268265_100803991 159
260 3300028380 Ga0268265_10151383 Ga0268265_101513832 159
261 3300028380 Ga0268265_10192637 Ga0268265_101926372 159
262 3300028380 Ga0268265_10533288 Ga0268265_105332881 159
263 3300028381 Ga0268264_10473607 Ga0268264_104736072 159
264 3300031548 Ga0307408_100392206 Ga0307408_1003922062 159
265 3300031711 Ga0265314_10033286 Ga0265314_100332862 159
266 3300031731 Ga0307405_10482364 Ga0307405_104823642 159
267 3300031852 Ga0307410_10116868 Ga0307410_101168682 159
268 3300032005 Ga0307411_10435962 Ga0307411_104359621 159
269 3300035111 Ga0373923_0079124 Ga0373923_0079124_487_987 159
270 3300035117 Ga0373953_0220071 Ga0373953_0220071_113_613 159
271 3300035118 Ga0373954_0051964 Ga0373954_0051964_694_1194 159
272 3300035118 Ga0373954_0184461 Ga0373954_0184461_86_586 159
273 3300035170 Ga0373943_0021226 Ga0373943_0021226_2227_2727 159
274 3300035170 Ga0373943_0217615 Ga0373943_0217615_147_641 159
275 3300035171 Ga0373946_0029315 Ga0373946_0029315_1655_2155 159
276 3300035171 Ga0373946_0318098 Ga0373946_0318098_34_528 159
277 3300035172 Ga0373955_0003019 Ga0373955_0003019_1404_1904 159
278 3300035172 Ga0373955_0076519 Ga0373955_0076519_798_1292 159
279 3300035692 Ga0373935_0083599 Ga0373935_0083599_305_805 159
280 3300035692 Ga0373935_0164017 Ga0373935_0164017_217_717 159
281 3300035695 Ga0373927_0155381 Ga0373927_0155381_488_988 159
282 3300035724 Ga0373933_0418322 Ga0373933_0418322_275_775 159
283 3300035725 Ga0373947_0003818 Ga0373947_0003818_4437_4937 159
284 3300036401 Ga0373937_0381356 Ga0373937_0381356_807_1307 159
285 3300036401 Ga0373937_0393320 Ga0373937_0393320_105_605 159
286 3300036401 Ga0373937_1823949 Ga0373937_1823949_30_530 159
287 3300037068 Ga0373925_0266622 Ga0373925_0266622_278_772 159
288 3300037068 Ga0373925_0542746 Ga0373925_0542746_30_530 159
289 3300039437 Ga0436365_0956175 Ga0436365_0956175_1136_1639 159
290 3300042130 Ga0450892_007492 Ga0450892_007492_323_814 159
291 3300042435 Ga0439434_0099914 Ga0439434_0099914_261_752 159
292 3300042436 Ga0439435_0052341 Ga0439435_0052341_657_1151 159
293 3300042436 Ga0439435_0069724 Ga0439435_0069724_513_1004 159
294 3300044842 Ga0466957_0155932 Ga0466957_0155932_103_609 159
295 3300045051 Ga0451576_0003703 Ga0451576_0003703_13618_14103 159
296 3300045976 Ga0466967_0493469 Ga0466967_0493469_180_668 159
297 3300046454 Ga0495592_0025040 Ga0495592_0025040_1570_2070 159
298 3300046455 Ga0495603_0358636 Ga0495603_0358636_278_781 159
299 3300046473 Ga0495582_0181798 Ga0495582_0181798_398_898 159
300 3300046477 Ga0495664_0171598 Ga0495664_0171598_244_738 159
301 3300046477 Ga0495664_0296679 Ga0495664_0296679_187_687 159
302 3300046499 Ga0495594_0252872 Ga0495594_0252872_478_978 159
303 3300046511 Ga0495608_0003942 Ga0495608_0003942_10090_10590 159
304 3300046514 Ga0495618_0086045 Ga0495618_0086045_931_1431 159
305 3300046517 Ga0495630_0009709 Ga0495630_0009709_5295_5795 159
306 3300046529 Ga0495652_0245893 Ga0495652_0245893_349_849 159
307 3300046531 Ga0495665_0483848 Ga0495665_0483848_37_537 159
308 3300046533 Ga0495640_0078023 Ga0495640_0078023_236_736 159
309 3300046536 Ga0495587_0051732 Ga0495587_0051732_1833_2333 159
310 3300046539 Ga0495621_0037939 Ga0495621_0037939_405_905 159
311 3300046559 Ga0495667_0040064 Ga0495667_0040064_57_557 159
312 3300046642 Ga0495634_0081249 Ga0495634_0081249_1160_1660 159
313 3300046642 Ga0495634_0326616 Ga0495634_0326616_318_818 159
314 3300046642 Ga0495634_0422055 Ga0495634_0422055_240_743 159
315 3300046663 Ga0495635_0088667 Ga0495635_0088667_202_696 159
316 3300046679 Ga0495623_0047499 Ga0495623_0047499_1529_2029 159
317 3300046681 Ga0495647_0214209 Ga0495647_0214209_31_534 159
318 3300046684 Ga0495669_0004081 Ga0495669_0004081_4045_4548 159
319 3300046684 Ga0495669_0007347 Ga0495669_0007347_2509_3009 159
320 3300046684 Ga0495669_0333198 Ga0495669_0333198_22_576 159
321 3300046689 Ga0495613_0001676 Ga0495613_0001676_8233_8733 159
322 3300046809 Ga0495600_0332280 Ga0495600_0332280_92_592 159
323 3300047319 Ga0495674_0233224 Ga0495674_0233224_78_578 159
324 3300047444 Ga0495675_0452837 Ga0495675_0452837_25_525 159
325 3300047471 Ga0495684_0002679 Ga0495684_0002679_12160_12660 159
326 3300048088 Ga0495602_0401247 Ga0495602_0401247_425_925 159
327 3300048903 Ga0496100_0005315 Ga0496100_0005315_4754_5254 159
328 3300048904 Ga0496101_0000338 Ga0496101_0000338_1159_1659 159
329 3300048904 Ga0496101_0504818 Ga0496101_0504818_11_511 159
330 3300048905 Ga0496102_0120104 Ga0496102_0120104_587_1087 159
331 3300048907 Ga0496104_0011885 Ga0496104_0011885_614_1114 159
332 3300048907 Ga0496104_0063755 Ga0496104_0063755_2984_3484 159
333 3300048907 Ga0496104_0791916 Ga0496104_0791916_71_571 159
334 3300048908 Ga0496105_0027444 Ga0496105_0027444_485_985 159
335 3300048908 Ga0496105_0263662 Ga0496105_0263662_463_963 159
336 3300048910 Ga0496107_0007329 Ga0496107_0007329_6624_7124 159
337 3300048917 Ga0496114_0001212 Ga0496114_0001212_15311_15811 159
338 3300048917 Ga0496114_0222524 Ga0496114_0222524_730_1230 159
339 3300049576 Ga0501040_0422137 Ga0501040_0422137_442_933 159
340 3300049576 Ga0501040_0617110 Ga0501040_0617110_262_756 159
341 3300050511 nmdc:mga08y16_352547_c1 nmdc:mga08y16_352547_c1_654_1154 159
342 3300050511 nmdc:mga08y16_4998_c1 nmdc:mga08y16_4998_c1_2078_2584 159
343 3300050511 nmdc:mga08y16_9_c1 nmdc:mga08y16_9_c1_433241_433732 159
344 3300050512 nmdc:mga0n895_472679_c1 nmdc:mga0n895_472679_c1_593_1084 159
345 3300050512 nmdc:mga0n895_72372_c1 nmdc:mga0n895_72372_c1_1308_1823 159
346 3300050513 nmdc:mga0rr50_682119_c1 nmdc:mga0rr50_682119_c1_124_627 159
347 3300050513 nmdc:mga0rr50_761091_c1 nmdc:mga0rr50_761091_c1_245_736 159
348 3300050514 nmdc:mga08x19_416343_c1 nmdc:mga08x19_416343_c1_112_603 159
349 3300050515 nmdc:mga0a205_112707_c2 nmdc:mga0a205_112707_c2_1031_1540 159
350 3300050515 nmdc:mga0a205_120196_c1 nmdc:mga0a205_120196_c1_1687_2187 159
351 3300050515 nmdc:mga0a205_167404_c1 nmdc:mga0a205_167404_c1_1530_2045 159
352 3300050515 nmdc:mga0a205_370522_c1 nmdc:mga0a205_370522_c1_666_1157 159
353 3300053077 Ga0495601_0003730 Ga0495601_0003730_7591_8091 159
354 3300053077 Ga0495601_0068407 Ga0495601_0068407_319_813 159
355 3300053084 Ga0495595_0405849 Ga0495595_0405849_33_533 159
356 3300053085 Ga0495619_0006567 Ga0495619_0006567_6126_6626 159
357 3300053085 Ga0495619_0280366 Ga0495619_0280366_206_706 159
358 3300005356 Ga0070674_101447295 Ga0070674_1014472951 160
359 3300005455 Ga0070663_100878596 Ga0070663_1008785962 160
360 3300005548 Ga0070665_100950167 Ga0070665_1009501671 160
361 3300005563 Ga0068855_100450881 Ga0068855_1004508812 160
362 3300005614 Ga0068856_101950599 Ga0068856_1019505991 160
363 3300009093 Ga0105240_10037691 Ga0105240_100376914 160
364 3300009147 Ga0114129_10009181 Ga0114129_100091813 160
365 3300014326 Ga0157380_10018744 Ga0157380_100187445 160
366 3300025893 Ga0207682_10093133 Ga0207682_100931332 160
367 3300025913 Ga0207695_10151584 Ga0207695_101515842 160
368 3300025926 Ga0207659_10001629 Ga0207659_100016293 160
369 3300025937 Ga0207669_11210408 Ga0207669_112104081 160
370 3300025949 Ga0207667_10866185 Ga0207667_108661852 160
371 3300026067 Ga0207678_10292250 Ga0207678_102922502 160
372 3300026121 Ga0207683_11146007 Ga0207683_111460071 160
373 3300035170 Ga0373943_0185733 Ga0373943_0185733_534_1022 160
374 3300037418 Ga0395900_0459263 Ga0395900_0459263_82_570 160
375 3300037471 Ga0395905_0197773 Ga0395905_0197773_504_992 160
376 3300005288 Ga0065714_10083408 Ga0065714_100834081 161
377 3300005290 Ga0065712_10099576 Ga0065712_100995762 161
378 3300005290 Ga0065712_10149758 Ga0065712_101497582 161
379 3300005290 Ga0065712_10319358 Ga0065712_103193581 161
380 3300005293 Ga0065715_10103959 Ga0065715_101039592 161
381 3300005293 Ga0065715_10146880 Ga0065715_101468802 161
382 3300005293 Ga0065715_10236028 Ga0065715_102360282 161
383 3300005328 Ga0070676_10331366 Ga0070676_103313662 161
384 3300005329 Ga0070683_100024470 Ga0070683_1000244703 161
385 3300005330 Ga0070690_100166363 Ga0070690_1001663632 161
386 3300005331 Ga0070670_100026375 Ga0070670_1000263753 161
387 3300005335 Ga0070666_10196882 Ga0070666_101968822 161
388 3300005338 Ga0068868_100034955 Ga0068868_1000349553 161
389 3300005339 Ga0070660_100441529 Ga0070660_1004415291 161
390 3300005340 Ga0070689_100215050 Ga0070689_1002150502 161
391 3300005340 Ga0070689_100340128 Ga0070689_1003401283 161
392 3300005343 Ga0070687_100038743 Ga0070687_1000387432 161
393 3300005344 Ga0070661_100265127 Ga0070661_1002651272 161
394 3300005353 Ga0070669_100092083 Ga0070669_1000920832 161
395 3300005353 Ga0070669_100162925 Ga0070669_1001629252 161
396 3300005354 Ga0070675_100022727 Ga0070675_1000227272 161
397 3300005364 Ga0070673_100208212 Ga0070673_1002082122 161
398 3300005365 Ga0070688_100060927 Ga0070688_1000609272 161
399 3300005365 Ga0070688_100098261 Ga0070688_1000982612 161
400 3300005366 Ga0070659_100197547 Ga0070659_1001975472 161
401 3300005367 Ga0070667_100587289 Ga0070667_1005872892 161
402 3300005436 Ga0070713_101253314 Ga0070713_1012533141 161
403 3300005436 Ga0070713_101716902 Ga0070713_1017169021 161
404 3300005444 Ga0070694_100502706 Ga0070694_1005027061 161
405 3300005456 Ga0070678_100130775 Ga0070678_1001307752 161
406 3300005457 Ga0070662_100593270 Ga0070662_1005932702 161
407 3300005466 Ga0070685_10197670 Ga0070685_101976701 161
408 3300005535 Ga0070684_100076110 Ga0070684_1000761103 161
409 3300005543 Ga0070672_100157158 Ga0070672_1001571582 161
410 3300005544 Ga0070686_100537386 Ga0070686_1005373861 161
411 3300005546 Ga0070696_100587157 Ga0070696_1005871572 161
412 3300005547 Ga0070693_100759909 Ga0070693_1007599091 161
413 3300005548 Ga0070665_100002502 Ga0070665_10000250221 161
414 3300005549 Ga0070704_101267826 Ga0070704_1012678261 161
415 3300005577 Ga0068857_100136211 Ga0068857_1001362112 161
416 3300005577 Ga0068857_100639122 Ga0068857_1006391222 161
417 3300005615 Ga0070702_100357397 Ga0070702_1003573972 161
418 3300005618 Ga0068864_100099244 Ga0068864_1000992442 161
419 3300005718 Ga0068866_10009441 Ga0068866_100094412 161
420 3300005841 Ga0068863_101144537 Ga0068863_1011445372 161
421 3300005842 Ga0068858_100017044 Ga0068858_1000170445 161
422 3300005843 Ga0068860_100354361 Ga0068860_1003543612 161
423 3300006237 Ga0097621_100039658 Ga0097621_1000396585 161
424 3300006237 Ga0097621_100643048 Ga0097621_1006430482 161
425 3300006358 Ga0068871_100063808 Ga0068871_1000638082 161
426 3300006358 Ga0068871_100146031 Ga0068871_1001460313 161
427 3300006844 Ga0075428_100245232 Ga0075428_1002452321 161
428 3300006844 Ga0075428_100310045 Ga0075428_1003100452 161
429 3300006846 Ga0075430_100001681 Ga0075430_10000168114 161
430 3300006846 Ga0075430_100013822 Ga0075430_1000138224 161
431 3300006846 Ga0075430_100028057 Ga0075430_1000280577 161
432 3300006847 Ga0075431_100001219 Ga0075431_1000012195 161
433 3300006847 Ga0075431_100079466 Ga0075431_1000794665 161
434 3300006847 Ga0075431_100486414 Ga0075431_1004864142 161
435 3300006847 Ga0075431_100830336 Ga0075431_1008303362 161
436 3300006852 Ga0075433_11078459 Ga0075433_110784592 161
437 3300006871 Ga0075434_100192229 Ga0075434_1001922292 161
438 3300006880 Ga0075429_100019963 Ga0075429_1000199635 161
439 3300006880 Ga0075429_100096081 Ga0075429_1000960813 161
440 3300006880 Ga0075429_100122343 Ga0075429_1001223432 161
441 3300006880 Ga0075429_100266863 Ga0075429_1002668632 161
442 3300006881 Ga0068865_100834735 Ga0068865_1008347351 161
443 3300006914 Ga0075436_100104286 Ga0075436_1001042862 161
444 3300009093 Ga0105240_10311990 Ga0105240_103119902 161
445 3300009093 Ga0105240_10450127 Ga0105240_104501272 161
446 3300009094 Ga0111539_10066788 Ga0111539_100667882 161
447 3300009094 Ga0111539_10097678 Ga0111539_100976783 161
448 3300009094 Ga0111539_10661077 Ga0111539_106610772 161
449 3300009098 Ga0105245_10046562 Ga0105245_100465622 161
450 3300009147 Ga0114129_10004137 Ga0114129_100041375 161
451 3300009147 Ga0114129_10009385 Ga0114129_100093855 161
452 3300009147 Ga0114129_10072643 Ga0114129_100726432 161
453 3300009147 Ga0114129_11692215 Ga0114129_116922152 161
454 3300009147 Ga0114129_12487459 Ga0114129_124874591 161
455 3300009174 Ga0105241_10568860 Ga0105241_105688602 161
456 3300009176 Ga0105242_10022412 Ga0105242_100224123 161
457 3300009177 Ga0105248_10007536 Ga0105248_100075362 161
458 3300009177 Ga0105248_10059992 Ga0105248_100599922 161
459 3300009553 Ga0105249_12262412 Ga0105249_122624121 161
460 3300010375 Ga0105239_10713110 Ga0105239_107131102 161
461 3300010375 Ga0105239_10815702 Ga0105239_108157022 161
462 3300011119 Ga0105246_10868449 Ga0105246_108684492 161
463 3300013296 Ga0157374_10083773 Ga0157374_100837732 161
464 3300013296 Ga0157374_10104979 Ga0157374_101049792 161
465 3300013296 Ga0157374_11656934 Ga0157374_116569341 161
466 3300013306 Ga0163162_10559856 Ga0163162_105598562 161
467 3300013308 Ga0157375_10340654 Ga0157375_103406542 161
468 3300013308 Ga0157375_10658352 Ga0157375_106583522 161
469 3300014325 Ga0163163_10006091 Ga0163163_100060915 161
470 3300014326 Ga0157380_11418633 Ga0157380_114186331 161
471 3300014968 Ga0157379_10030765 Ga0157379_100307653 161
472 3300014969 Ga0157376_10086620 Ga0157376_100866203 161
473 3300014969 Ga0157376_10366170 Ga0157376_103661702 161
474 3300025321 Ga0207656_10097732 Ga0207656_100977322 161
475 3300025899 Ga0207642_10036643 Ga0207642_100366432 161
476 3300025903 Ga0207680_10023105 Ga0207680_100231054 161
477 3300025911 Ga0207654_10301123 Ga0207654_103011232 161
478 3300025913 Ga0207695_10360308 Ga0207695_103603082 161
479 3300025918 Ga0207662_10015889 Ga0207662_100158893 161
480 3300025919 Ga0207657_10144559 Ga0207657_101445592 161
481 3300025920 Ga0207649_10075530 Ga0207649_100755302 161
482 3300025923 Ga0207681_10022038 Ga0207681_100220384 161
483 3300025925 Ga0207650_10121252 Ga0207650_101212523 161
484 3300025926 Ga0207659_10097120 Ga0207659_100971202 161
485 3300025932 Ga0207690_10159647 Ga0207690_101596472 161
486 3300025933 Ga0207706_10418896 Ga0207706_104188961 161
487 3300025934 Ga0207686_10012850 Ga0207686_100128503 161
488 3300025936 Ga0207670_10093752 Ga0207670_100937522 161
489 3300025936 Ga0207670_10803123 Ga0207670_108031231 161
490 3300025937 Ga0207669_10807414 Ga0207669_108074141 161
491 3300025940 Ga0207691_10428238 Ga0207691_104282382 161
492 3300025941 Ga0207711_10057589 Ga0207711_100575892 161
493 3300025944 Ga0207661_10396865 Ga0207661_103968652 161
494 3300025949 Ga0207667_10451829 Ga0207667_104518292 161
495 3300026035 Ga0207703_10018977 Ga0207703_100189772 161
496 3300026041 Ga0207639_10200242 Ga0207639_102002423 161
497 3300026075 Ga0207708_10227810 Ga0207708_102278101 161
498 3300026075 Ga0207708_10289983 Ga0207708_102899832 161
499 3300026089 Ga0207648_10281533 Ga0207648_102815333 161
500 3300026095 Ga0207676_10525687 Ga0207676_105256872 161
501 3300026116 Ga0207674_10061584 Ga0207674_100615843 161
502 3300026116 Ga0207674_10656898 Ga0207674_106568982 161
503 3300026121 Ga0207683_10688106 Ga0207683_106881062 161
504 3300026121 Ga0207683_11067291 Ga0207683_110672912 161
505 3300027907 Ga0207428_10630272 Ga0207428_106302721 161
506 3300028379 Ga0268266_10148463 Ga0268266_101484632 161
507 3300028381 Ga0268264_10282422 Ga0268264_102824222 161
508 3300031731 Ga0307405_10133043 Ga0307405_101330433 161
509 3300031824 Ga0307413_10463454 Ga0307413_104634542 161
510 3300031852 Ga0307410_10079408 Ga0307410_100794082 161
511 3300031911 Ga0307412_10194730 Ga0307412_101947302 161
512 3300032002 Ga0307416_100300829 Ga0307416_1003008292 161
513 3300032002 Ga0307416_100374617 Ga0307416_1003746172 161
514 3300032004 Ga0307414_10097706 Ga0307414_100977063 161
515 3300032005 Ga0307411_10202710 Ga0307411_102027102 161
516 3300032126 Ga0307415_100668424 Ga0307415_1006684242 161
517 3300035410 Ga0373924_0021449 Ga0373924_0021449_1593_2093 161
518 3300035410 Ga0373924_0140817 Ga0373924_0140817_536_1033 161
519 3300037068 Ga0373925_0482653 Ga0373925_0482653_373_870 161
520 3300037068 Ga0373925_1199410 Ga0373925_1199410_45_542 161
521 3300042461 Ga0439460_0040424 Ga0439460_0040424_276_785 161
522 3300042530 Ga0450916_034769 Ga0450916_034769_229_720 161
523 3300044694 Ga0466963_0184194 Ga0466963_0184194_297_791 161
524 3300046499 Ga0495594_0353963 Ga0495594_0353963_299_817 161
525 3300046533 Ga0495640_0416169 Ga0495640_0416169_312_809 161
526 3300046663 Ga0495635_0053736 Ga0495635_0053736_1980_2477 161
527 3300046691 Ga0495670_0077989 Ga0495670_0077989_662_1153 161
528 3300046809 Ga0495600_0092987 Ga0495600_0092987_1257_1790 161
529 3300048903 Ga0496100_1547020 Ga0496100_1547020_13_510 161
530 3300048907 Ga0496104_0116270 Ga0496104_0116270_1226_1723 161
531 3300048908 Ga0496105_0522093 Ga0496105_0522093_304_792 161
532 3300048912 Ga0496109_0689410 Ga0496109_0689410_233_730 161
533 3300048915 Ga0496112_0086620 Ga0496112_0086620_1450_1947 161
534 3300048915 Ga0496112_0167090 Ga0496112_0167090_614_1111 161
535 3300048915 Ga0496112_0422774 Ga0496112_0422774_322_819 161
536 3300048917 Ga0496114_0084214 Ga0496114_0084214_865_1362 161
537 3300048918 Ga0496115_0125497 Ga0496115_0125497_674_1171 161
538 3300049522 Ga0501299_060055 Ga0501299_060055_38_571 161
539 3300049587 Ga0501071_0192495 Ga0501071_0192495_1013_1510 161
540 3300049589 Ga0501073_0326630 Ga0501073_0326630_33_530 161
541 3300049592 Ga0501076_0656617 Ga0501076_0656617_309_806 161
542 3300049741 Ga0501079_0669540 Ga0501079_0669540_74_571 161
543 3300049824 Ga0501045_0241444 Ga0501045_0241444_660_1205 161
544 3300050507 nmdc:mga05p37_138803_c1 nmdc:mga05p37_138803_c1_1846_2355 161
545 3300050507 nmdc:mga05p37_1965492_c1 nmdc:mga05p37_1965492_c1_12_521 161
546 3300050507 nmdc:mga05p37_23209_c1 nmdc:mga05p37_23209_c1_5175_5684 161
547 3300050507 nmdc:mga05p37_73083_c1 nmdc:mga05p37_73083_c1_3273_3773 161
548 3300050508 nmdc:mga09592_149535_c1 nmdc:mga09592_149535_c1_692_1210 161
549 3300050508 nmdc:mga09592_201873_c1 nmdc:mga09592_201873_c1_153_662 161
550 3300050508 nmdc:mga09592_38159_c1 nmdc:mga09592_38159_c1_19_519 161
551 3300050508 nmdc:mga09592_456600_c1 nmdc:mga09592_456600_c1_480_992 161
552 3300050509 nmdc:mga0qj67_245188_c1 nmdc:mga0qj67_245188_c1_86_586 161
553 3300050509 nmdc:mga0qj67_7153_c1 nmdc:mga0qj67_7153_c1_67_576 161
554 3300050509 nmdc:mga0qj67_7629_c1 nmdc:mga0qj67_7629_c1_1950_2498 161
555 3300050510 nmdc:mga06r32_1076344_c1 nmdc:mga06r32_1076344_c1_87_596 161
556 3300050510 nmdc:mga06r32_616343_c1 nmdc:mga06r32_616343_c1_346_837 161
557 3300050510 nmdc:mga06r32_86132_c1 nmdc:mga06r32_86132_c1_2211_2711 161
558 3300050511 nmdc:mga08y16_108808_c1 nmdc:mga08y16_108808_c1_1595_2095 161
559 3300050511 nmdc:mga08y16_116259_c1 nmdc:mga08y16_116259_c1_1921_2412 161
560 3300050511 nmdc:mga08y16_227293_c1 nmdc:mga08y16_227293_c1_1180_1689 161
561 3300050511 nmdc:mga08y16_449722_c1 nmdc:mga08y16_449722_c1_533_1042 161
562 3300050512 nmdc:mga0n895_737660_c1 nmdc:mga0n895_737660_c1_38_547 161
563 3300050514 nmdc:mga08x19_3155_c1 nmdc:mga08x19_3155_c1_2044_2541 161
564 3300050515 nmdc:mga0a205_131663_c1 nmdc:mga0a205_131663_c1_1178_1687 161
565 3300050515 nmdc:mga0a205_219892_c1 nmdc:mga0a205_219892_c1_125_634 161
566 3300053085 Ga0495619_0433888 Ga0495619_0433888_392_889 161
567 3300054114 Ga0501084_0359012 Ga0501084_0359012_80_577 161
568 3300054114 Ga0501084_1006567 Ga0501084_1006567_45_551 161
569 3300059424 Ga0590075_057765 Ga0590075_057765_399_905 161
570 3300005328 Ga0070676_10297952 Ga0070676_102979522 162
571 3300005333 Ga0070677_10279774 Ga0070677_102797742 162
572 3300005354 Ga0070675_100539788 Ga0070675_1005397881 162
573 3300005356 Ga0070674_100674351 Ga0070674_1006743512 162
574 3300006358 Ga0068871_100193434 Ga0068871_1001934343 162
575 3300025934 Ga0207686_11249943 Ga0207686_112499431 162
576 3300025937 Ga0207669_10612134 Ga0207669_106121342 162
577 3300026116 Ga0207674_10592894 Ga0207674_105928942 162
578 3300026118 Ga0207675_100278637 Ga0207675_1002786371 162
579 3300031852 Ga0307410_10051926 Ga0307410_100519263 162
580 3300046455 Ga0495603_0042909 Ga0495603_0042909_621_1109 162
581 3300046499 Ga0495594_0029180 Ga0495594_0029180_1642_2130 162
582 3300046539 Ga0495621_0003364 Ga0495621_0003364_446_934 162
583 3300047321 Ga0495676_0071461 Ga0495676_0071461_464_952 162
584 3300047444 Ga0495675_0476815 Ga0495675_0476815_31_537 162
585 3300048907 Ga0496104_0641105 Ga0496104_0641105_356_853 162
586 3300002155 JGI24033J26618_1016701 JGI24033J26618_10167012 163
587 3300002459 JGI24751J29686_10013893 JGI24751J29686_100138932 163
588 3300003203 JGI25406J46586_10097873 JGI25406J46586_100978731 163
589 3300005289 Ga0065704_10148721 Ga0065704_101487212 163
590 3300005290 Ga0065712_10002622 Ga0065712_100026222 163
591 3300005290 Ga0065712_10067818 Ga0065712_1006781818 163
592 3300005293 Ga0065715_10147926 Ga0065715_101479262 163
593 3300005293 Ga0065715_10158966 Ga0065715_101589662 163
594 3300005293 Ga0065715_10168749 Ga0065715_101687492 163
595 3300005293 Ga0065715_10279735 Ga0065715_102797352 163
596 3300005295 Ga0065707_10289450 Ga0065707_102894502 163
597 3300005295 Ga0065707_10412332 Ga0065707_104123321 163
598 3300005328 Ga0070676_10438005 Ga0070676_104380052 163
599 3300005328 Ga0070676_10832927 Ga0070676_108329271 163
600 3300005329 Ga0070683_100338820 Ga0070683_1003388202 163
601 3300005330 Ga0070690_100000920 Ga0070690_1000009202 163
602 3300005330 Ga0070690_100197332 Ga0070690_1001973322 163
603 3300005330 Ga0070690_100922612 Ga0070690_1009226122 163
604 3300005330 Ga0070690_100946779 Ga0070690_1009467791 163
605 3300005330 Ga0070690_101430069 Ga0070690_1014300691 163
606 3300005331 Ga0070670_100015640 Ga0070670_1000156405 163
607 3300005331 Ga0070670_100161978 Ga0070670_1001619783 163
608 3300005331 Ga0070670_100300500 Ga0070670_1003005002 163
609 3300005331 Ga0070670_100901418 Ga0070670_1009014181 163
610 3300005333 Ga0070677_10013312 Ga0070677_100133122 163
611 3300005333 Ga0070677_10044554 Ga0070677_100445542 163
612 3300005333 Ga0070677_10049012 Ga0070677_100490122 163
613 3300005333 Ga0070677_10284896 Ga0070677_102848961 163
614 3300005333 Ga0070677_10422995 Ga0070677_104229951 163
615 3300005334 Ga0068869_100002153 Ga0068869_1000021533 163
616 3300005334 Ga0068869_100048862 Ga0068869_1000488623 163
617 3300005334 Ga0068869_100092460 Ga0068869_1000924603 163
618 3300005334 Ga0068869_100103497 Ga0068869_1001034972 163
619 3300005334 Ga0068869_100174532 Ga0068869_1001745322 163
620 3300005334 Ga0068869_100280507 Ga0068869_1002805072 163
621 3300005334 Ga0068869_100536026 Ga0068869_1005360262 163
622 3300005335 Ga0070666_10729581 Ga0070666_107295811 163
623 3300005336 Ga0070680_100025422 Ga0070680_1000254226 163
624 3300005336 Ga0070680_100153630 Ga0070680_1001536303 163
625 3300005336 Ga0070680_100630050 Ga0070680_1006300502 163
626 3300005336 Ga0070680_100866206 Ga0070680_1008662062 163
627 3300005337 Ga0070682_101249949 Ga0070682_1012499491 163
628 3300005338 Ga0068868_100291802 Ga0068868_1002918022 163
629 3300005338 Ga0068868_100352495 Ga0068868_1003524952 163
630 3300005338 Ga0068868_100639711 Ga0068868_1006397111 163
631 3300005338 Ga0068868_100741312 Ga0068868_1007413121 163
632 3300005338 Ga0068868_101181271 Ga0068868_1011812711 163
633 3300005339 Ga0070660_100001092 Ga0070660_10000109215 163
634 3300005340 Ga0070689_100043202 Ga0070689_1000432022 163
635 3300005340 Ga0070689_100065174 Ga0070689_1000651741 163
636 3300005340 Ga0070689_100199760 Ga0070689_1001997601 163
637 3300005340 Ga0070689_100327105 Ga0070689_1003271052 163
638 3300005340 Ga0070689_100740161 Ga0070689_1007401612 163
639 3300005341 Ga0070691_10043112 Ga0070691_100431122 163
640 3300005341 Ga0070691_10149628 Ga0070691_101496282 163
641 3300005343 Ga0070687_100095286 Ga0070687_1000952861 163
642 3300005344 Ga0070661_100414251 Ga0070661_1004142511 163
643 3300005344 Ga0070661_100608875 Ga0070661_1006088751 163
644 3300005344 Ga0070661_101372584 Ga0070661_1013725841 163
645 3300005345 Ga0070692_10458705 Ga0070692_104587051 163
646 3300005347 Ga0070668_100454436 Ga0070668_1004544362 163
647 3300005353 Ga0070669_100003474 Ga0070669_1000034743 163
648 3300005353 Ga0070669_100038193 Ga0070669_1000381933 163
649 3300005353 Ga0070669_100313428 Ga0070669_1003134282 163
650 3300005353 Ga0070669_100339396 Ga0070669_1003393961 163
651 3300005353 Ga0070669_100423022 Ga0070669_1004230221 163
652 3300005353 Ga0070669_100548837 Ga0070669_1005488372 163
653 3300005354 Ga0070675_100000433 Ga0070675_1000004339 163
654 3300005354 Ga0070675_100001643 Ga0070675_1000016438 163
655 3300005354 Ga0070675_100003018 Ga0070675_1000030184 163
656 3300005354 Ga0070675_100007486 Ga0070675_1000074866 163
657 3300005354 Ga0070675_100007803 Ga0070675_1000078037 163
658 3300005354 Ga0070675_100036669 Ga0070675_1000366693 163
659 3300005354 Ga0070675_100205743 Ga0070675_1002057432 163
660 3300005354 Ga0070675_100344667 Ga0070675_1003446671 163
661 3300005354 Ga0070675_100439608 Ga0070675_1004396081 163
662 3300005355 Ga0070671_100034834 Ga0070671_1000348342 163
663 3300005355 Ga0070671_100048508 Ga0070671_1000485082 163
664 3300005355 Ga0070671_100782269 Ga0070671_1007822691 163
665 3300005356 Ga0070674_100021951 Ga0070674_1000219513 163
666 3300005356 Ga0070674_100519194 Ga0070674_1005191942 163
667 3300005356 Ga0070674_101006082 Ga0070674_1010060821 163
668 3300005356 Ga0070674_101265879 Ga0070674_1012658791 163
669 3300005364 Ga0070673_100003132 Ga0070673_1000031323 163
670 3300005364 Ga0070673_100043274 Ga0070673_1000432742 163
671 3300005364 Ga0070673_100050178 Ga0070673_1000501782 163
672 3300005364 Ga0070673_100058513 Ga0070673_1000585133 163
673 3300005364 Ga0070673_100137316 Ga0070673_1001373162 163
674 3300005364 Ga0070673_100171940 Ga0070673_1001719401 163
675 3300005364 Ga0070673_100183156 Ga0070673_1001831562 163
676 3300005364 Ga0070673_100196196 Ga0070673_1001961961 163
677 3300005364 Ga0070673_100549318 Ga0070673_1005493182 163
678 3300005364 Ga0070673_100635366 Ga0070673_1006353662 163
679 3300005365 Ga0070688_100216235 Ga0070688_1002162352 163
680 3300005365 Ga0070688_100476940 Ga0070688_1004769401 163
681 3300005365 Ga0070688_101083333 Ga0070688_1010833331 163
682 3300005367 Ga0070667_100179209 Ga0070667_1001792092 163
683 3300005367 Ga0070667_100414741 Ga0070667_1004147412 163
684 3300005436 Ga0070713_100900072 Ga0070713_1009000722 163
685 3300005438 Ga0070701_10080120 Ga0070701_100801202 163
686 3300005438 Ga0070701_10102714 Ga0070701_101027142 163
687 3300005440 Ga0070705_100014875 Ga0070705_1000148752 163
688 3300005440 Ga0070705_100053659 Ga0070705_1000536593 163
689 3300005440 Ga0070705_100135726 Ga0070705_1001357262 163
690 3300005441 Ga0070700_100006082 Ga0070700_1000060823 163
691 3300005441 Ga0070700_100059550 Ga0070700_1000595503 163
692 3300005441 Ga0070700_100906779 Ga0070700_1009067791 163
693 3300005444 Ga0070694_100002894 Ga0070694_10000289410 163
694 3300005444 Ga0070694_100005858 Ga0070694_1000058582 163
695 3300005444 Ga0070694_100172110 Ga0070694_1001721101 163
696 3300005444 Ga0070694_100379711 Ga0070694_1003797112 163
697 3300005444 Ga0070694_100802159 Ga0070694_1008021592 163
698 3300005445 Ga0070708_100519664 Ga0070708_1005196642 163
699 3300005445 Ga0070708_100607625 Ga0070708_1006076252 163
700 3300005445 Ga0070708_100868844 Ga0070708_1008688442 163
701 3300005455 Ga0070663_100037019 Ga0070663_1000370192 163
702 3300005456 Ga0070678_100109353 Ga0070678_1001093532 163
703 3300005456 Ga0070678_100494754 Ga0070678_1004947542 163
704 3300005456 Ga0070678_100709470 Ga0070678_1007094701 163
705 3300005457 Ga0070662_100380504 Ga0070662_1003805041 163
706 3300005457 Ga0070662_100874882 Ga0070662_1008748821 163
707 3300005459 Ga0068867_100000380 Ga0068867_10000038023 163
708 3300005459 Ga0068867_100138704 Ga0068867_1001387042 163
709 3300005459 Ga0068867_100686917 Ga0068867_1006869172 163
710 3300005459 Ga0068867_100709371 Ga0068867_1007093712 163
711 3300005459 Ga0068867_100713581 Ga0068867_1007135812 163
712 3300005459 Ga0068867_100944408 Ga0068867_1009444082 163
713 3300005459 Ga0068867_101063118 Ga0068867_1010631181 163
714 3300005459 Ga0068867_101710127 Ga0068867_1017101271 163
715 3300005466 Ga0070685_10050222 Ga0070685_100502223 163
716 3300005466 Ga0070685_10545954 Ga0070685_105459541 163
717 3300005467 Ga0070706_100186401 Ga0070706_1001864012 163
718 3300005467 Ga0070706_100774035 Ga0070706_1007740352 163
719 3300005467 Ga0070706_101121435 Ga0070706_1011214351 163
720 3300005467 Ga0070706_101226546 Ga0070706_1012265461 163
721 3300005468 Ga0070707_100442076 Ga0070707_1004420762 163
722 3300005468 Ga0070707_101094705 Ga0070707_1010947051 163
723 3300005468 Ga0070707_101286300 Ga0070707_1012863002 163
724 3300005471 Ga0070698_100003115 Ga0070698_1000031153 163
725 3300005471 Ga0070698_100006640 Ga0070698_1000066402 163
726 3300005471 Ga0070698_100072413 Ga0070698_1000724132 163
727 3300005471 Ga0070698_100394572 Ga0070698_1003945722 163
728 3300005518 Ga0070699_100003719 Ga0070699_1000037191 163
729 3300005518 Ga0070699_100006814 Ga0070699_1000068143 163
730 3300005518 Ga0070699_100100290 Ga0070699_1001002902 163
731 3300005518 Ga0070699_100123199 Ga0070699_1001231992 163
732 3300005530 Ga0070679_100010050 Ga0070679_1000100502 163
733 3300005530 Ga0070679_100548131 Ga0070679_1005481312 163
734 3300005530 Ga0070679_100776591 Ga0070679_1007765911 163
735 3300005535 Ga0070684_100519127 Ga0070684_1005191272 163
736 3300005535 Ga0070684_101199138 Ga0070684_1011991381 163
737 3300005539 Ga0068853_100611029 Ga0068853_1006110292 163
738 3300005543 Ga0070672_100004404 Ga0070672_1000044045 163
739 3300005543 Ga0070672_100005217 Ga0070672_1000052178 163
740 3300005543 Ga0070672_100062004 Ga0070672_1000620042 163
741 3300005543 Ga0070672_100213036 Ga0070672_1002130361 163
742 3300005543 Ga0070672_100692814 Ga0070672_1006928141 163
743 3300005543 Ga0070672_100729197 Ga0070672_1007291972 163
744 3300005543 Ga0070672_101137246 Ga0070672_1011372461 163
745 3300005544 Ga0070686_100000153 Ga0070686_1000001533 163
746 3300005544 Ga0070686_100030299 Ga0070686_1000302993 163
747 3300005544 Ga0070686_100084274 Ga0070686_1000842742 163
748 3300005544 Ga0070686_100188159 Ga0070686_1001881592 163
749 3300005544 Ga0070686_100218647 Ga0070686_1002186472 163
750 3300005544 Ga0070686_100313655 Ga0070686_1003136552 163
751 3300005544 Ga0070686_100375621 Ga0070686_1003756212 163
752 3300005545 Ga0070695_100027664 Ga0070695_1000276643 163
753 3300005545 Ga0070695_100170257 Ga0070695_1001702572 163
754 3300005545 Ga0070695_100502552 Ga0070695_1005025522 163
755 3300005545 Ga0070695_100826694 Ga0070695_1008266942 163
756 3300005545 Ga0070695_100954808 Ga0070695_1009548081 163
757 3300005546 Ga0070696_100018169 Ga0070696_1000181693 163
758 3300005546 Ga0070696_100112265 Ga0070696_1001122651 163
759 3300005546 Ga0070696_100552454 Ga0070696_1005524542 163
760 3300005547 Ga0070693_100720868 Ga0070693_1007208681 163
761 3300005547 Ga0070693_100836877 Ga0070693_1008368771 163
762 3300005548 Ga0070665_100010631 Ga0070665_1000106315 163
763 3300005548 Ga0070665_100078682 Ga0070665_1000786822 163
764 3300005549 Ga0070704_100000089 Ga0070704_1000000896 163
765 3300005549 Ga0070704_100032604 Ga0070704_1000326043 163
766 3300005549 Ga0070704_100074989 Ga0070704_1000749893 163
767 3300005549 Ga0070704_100134456 Ga0070704_1001344562 163
768 3300005549 Ga0070704_100631855 Ga0070704_1006318552 163
769 3300005549 Ga0070704_100700314 Ga0070704_1007003142 163
770 3300005549 Ga0070704_101301510 Ga0070704_1013015101 163
771 3300005563 Ga0068855_100020680 Ga0068855_10002068010 163
772 3300005563 Ga0068855_100492643 Ga0068855_1004926431 163
773 3300005563 Ga0068855_100652639 Ga0068855_1006526391 163
774 3300005563 Ga0068855_100798835 Ga0068855_1007988351 163
775 3300005564 Ga0070664_100009603 Ga0070664_1000096033 163
776 3300005564 Ga0070664_100097790 Ga0070664_1000977902 163
777 3300005564 Ga0070664_100236671 Ga0070664_1002366712 163
778 3300005564 Ga0070664_100346288 Ga0070664_1003462882 163
779 3300005577 Ga0068857_100358762 Ga0068857_1003587621 163
780 3300005577 Ga0068857_100522165 Ga0068857_1005221652 163
781 3300005578 Ga0068854_100163499 Ga0068854_1001634992 163
782 3300005578 Ga0068854_101120050 Ga0068854_1011200502 163
783 3300005615 Ga0070702_100053993 Ga0070702_1000539932 163
784 3300005616 Ga0068852_100377942 Ga0068852_1003779422 163
785 3300005616 Ga0068852_100746608 Ga0068852_1007466082 163
786 3300005617 Ga0068859_100025246 Ga0068859_1000252463 163
787 3300005617 Ga0068859_100137975 Ga0068859_1001379751 163
788 3300005617 Ga0068859_100191448 Ga0068859_1001914483 163
789 3300005617 Ga0068859_100504379 Ga0068859_1005043791 163
790 3300005617 Ga0068859_100506815 Ga0068859_1005068152 163
791 3300005617 Ga0068859_100714266 Ga0068859_1007142662 163
792 3300005617 Ga0068859_100759169 Ga0068859_1007591692 163
793 3300005617 Ga0068859_101723599 Ga0068859_1017235992 163
794 3300005618 Ga0068864_100002939 Ga0068864_10000293912 163
795 3300005618 Ga0068864_100207644 Ga0068864_1002076442 163
796 3300005618 Ga0068864_100234303 Ga0068864_1002343033 163
797 3300005618 Ga0068864_100234644 Ga0068864_1002346442 163
798 3300005618 Ga0068864_100313810 Ga0068864_1003138102 163
799 3300005618 Ga0068864_100391631 Ga0068864_1003916312 163
800 3300005618 Ga0068864_100975212 Ga0068864_1009752122 163
801 3300005718 Ga0068866_10084161 Ga0068866_100841612 163
802 3300005719 Ga0068861_100091306 Ga0068861_1000913062 163
803 3300005719 Ga0068861_100093769 Ga0068861_1000937693 163
804 3300005719 Ga0068861_100129925 Ga0068861_1001299252 163
805 3300005719 Ga0068861_100253110 Ga0068861_1002531102 163
806 3300005719 Ga0068861_100488257 Ga0068861_1004882572 163
807 3300005719 Ga0068861_101454819 Ga0068861_1014548192 163
808 3300005834 Ga0068851_10150437 Ga0068851_101504372 163
809 3300005840 Ga0068870_10002891 Ga0068870_100028913 163
810 3300005840 Ga0068870_10032435 Ga0068870_100324352 163
811 3300005840 Ga0068870_10034344 Ga0068870_100343442 163
812 3300005840 Ga0068870_10234070 Ga0068870_102340701 163
813 3300005840 Ga0068870_10616965 Ga0068870_106169652 163
814 3300005841 Ga0068863_100143458 Ga0068863_1001434582 163
815 3300005841 Ga0068863_100199173 Ga0068863_1001991732 163
816 3300005841 Ga0068863_100300972 Ga0068863_1003009722 163
817 3300005841 Ga0068863_100313525 Ga0068863_1003135252 163
818 3300005841 Ga0068863_100650258 Ga0068863_1006502581 163
819 3300005842 Ga0068858_100003255 Ga0068858_10000325517 163
820 3300005842 Ga0068858_100039216 Ga0068858_1000392163 163
821 3300005842 Ga0068858_100075256 Ga0068858_1000752562 163
822 3300005842 Ga0068858_100130019 Ga0068858_1001300192 163
823 3300005842 Ga0068858_100206865 Ga0068858_1002068652 163
824 3300005842 Ga0068858_100559154 Ga0068858_1005591543 163
825 3300005842 Ga0068858_101037450 Ga0068858_1010374502 163
826 3300005843 Ga0068860_100017193 Ga0068860_1000171931 163
827 3300005843 Ga0068860_100034523 Ga0068860_1000345233 163
828 3300005843 Ga0068860_100271636 Ga0068860_1002716362 163
829 3300005843 Ga0068860_100347516 Ga0068860_1003475162 163
830 3300005843 Ga0068860_100356221 Ga0068860_1003562212 163
831 3300005843 Ga0068860_100392211 Ga0068860_1003922112 163
832 3300005844 Ga0068862_100024869 Ga0068862_1000248693 163
833 3300005844 Ga0068862_100384271 Ga0068862_1003842712 163
834 3300005844 Ga0068862_100429973 Ga0068862_1004299732 163
835 3300005937 Ga0081455_10008971 Ga0081455_100089718 163
836 3300005937 Ga0081455_10047875 Ga0081455_100478753 163
837 3300005985 Ga0081539_10002012 Ga0081539_1000201224 163
838 3300006028 Ga0070717_11361300 Ga0070717_113613001 163
839 3300006038 Ga0075365_10059942 Ga0075365_100599422 163
840 3300006173 Ga0070716_100007561 Ga0070716_1000075612 163
841 3300006173 Ga0070716_100112531 Ga0070716_1001125312 163
842 3300006175 Ga0070712_100031176 Ga0070712_1000311763 163
843 3300006175 Ga0070712_100416201 Ga0070712_1004162011 163
844 3300006237 Ga0097621_100069253 Ga0097621_1000692532 163
845 3300006237 Ga0097621_100126207 Ga0097621_1001262072 163
846 3300006237 Ga0097621_100378715 Ga0097621_1003787152 163
847 3300006237 Ga0097621_100616551 Ga0097621_1006165512 163
848 3300006237 Ga0097621_100724582 Ga0097621_1007245822 163
849 3300006237 Ga0097621_101182064 Ga0097621_1011820641 163
850 3300006358 Ga0068871_100069169 Ga0068871_1000691691 163
851 3300006358 Ga0068871_100077391 Ga0068871_1000773913 163
852 3300006358 Ga0068871_100497971 Ga0068871_1004979712 163
853 3300006358 Ga0068871_100649783 Ga0068871_1006497832 163
854 3300006358 Ga0068871_100695008 Ga0068871_1006950082 163
855 3300006844 Ga0075428_100006846 Ga0075428_10000684614 163
856 3300006844 Ga0075428_100009506 Ga0075428_1000095068 163
857 3300006844 Ga0075428_100026808 Ga0075428_1000268083 163
858 3300006844 Ga0075428_100031650 Ga0075428_1000316502 163
859 3300006844 Ga0075428_100057506 Ga0075428_1000575064 163
860 3300006844 Ga0075428_100089732 Ga0075428_1000897322 163
861 3300006844 Ga0075428_100121569 Ga0075428_1001215693 163
862 3300006844 Ga0075428_100429732 Ga0075428_1004297322 163
863 3300006844 Ga0075428_100602931 Ga0075428_1006029312 163
864 3300006844 Ga0075428_101084827 Ga0075428_1010848272 163
865 3300006846 Ga0075430_100002096 Ga0075430_1000020967 163
866 3300006846 Ga0075430_100019140 Ga0075430_1000191402 163
867 3300006846 Ga0075430_100025839 Ga0075430_1000258393 163
868 3300006846 Ga0075430_100054894 Ga0075430_1000548943 163
869 3300006847 Ga0075431_100003323 Ga0075431_1000033235 163
870 3300006847 Ga0075431_100023672 Ga0075431_1000236724 163
871 3300006847 Ga0075431_100069493 Ga0075431_1000694933 163
872 3300006847 Ga0075431_100215703 Ga0075431_1002157032 163
873 3300006847 Ga0075431_100241070 Ga0075431_1002410702 163
874 3300006852 Ga0075433_10000157 Ga0075433_100001572 163
875 3300006852 Ga0075433_10116506 Ga0075433_101165062 163
876 3300006852 Ga0075433_10146790 Ga0075433_101467902 163
877 3300006852 Ga0075433_10323195 Ga0075433_103231952 163
878 3300006852 Ga0075433_10336636 Ga0075433_103366362 163
879 3300006852 Ga0075433_10615587 Ga0075433_106155871 163
880 3300006852 Ga0075433_10789605 Ga0075433_107896052 163
881 3300006852 Ga0075433_10835721 Ga0075433_108357211 163
882 3300006871 Ga0075434_100002504 Ga0075434_10000250414 163
883 3300006871 Ga0075434_100006773 Ga0075434_1000067737 163
884 3300006871 Ga0075434_100011771 Ga0075434_1000117713 163
885 3300006871 Ga0075434_100017244 Ga0075434_1000172448 163
886 3300006871 Ga0075434_100029295 Ga0075434_1000292953 163
887 3300006871 Ga0075434_100065080 Ga0075434_1000650804 163
888 3300006871 Ga0075434_100151742 Ga0075434_1001517422 163
889 3300006871 Ga0075434_100302147 Ga0075434_1003021472 163
890 3300006871 Ga0075434_100453363 Ga0075434_1004533632 163
891 3300006871 Ga0075434_100476073 Ga0075434_1004760732 163
892 3300006871 Ga0075434_100489240 Ga0075434_1004892402 163
893 3300006871 Ga0075434_100524690 Ga0075434_1005246902 163
894 3300006880 Ga0075429_100004479 Ga0075429_1000044794 163
895 3300006880 Ga0075429_100005139 Ga0075429_1000051398 163
896 3300006880 Ga0075429_100008026 Ga0075429_1000080264 163
897 3300006880 Ga0075429_100126374 Ga0075429_1001263742 163
898 3300006880 Ga0075429_100239199 Ga0075429_1002391992 163
899 3300006880 Ga0075429_100314822 Ga0075429_1003148222 163
900 3300006880 Ga0075429_100319622 Ga0075429_1003196221 163
901 3300006881 Ga0068865_100002757 Ga0068865_1000027574 163
902 3300006881 Ga0068865_100076131 Ga0068865_1000761313 163
903 3300006881 Ga0068865_100760792 Ga0068865_1007607922 163
904 3300006914 Ga0075436_100004813 Ga0075436_1000048132 163
905 3300006914 Ga0075436_100017704 Ga0075436_1000177043 163
906 3300006914 Ga0075436_100017749 Ga0075436_1000177493 163
907 3300006914 Ga0075436_100132881 Ga0075436_1001328812 163
908 3300006914 Ga0075436_100241247 Ga0075436_1002412472 163
909 3300006931 Ga0097620_100025246 Ga0097620_1000252463 163
910 3300006931 Ga0097620_100137972 Ga0097620_1001379721 163
911 3300006931 Ga0097620_100191442 Ga0097620_1001914423 163
912 3300006931 Ga0097620_100504446 Ga0097620_1005044461 163
913 3300006931 Ga0097620_100506803 Ga0097620_1005068032 163
914 3300006931 Ga0097620_100714267 Ga0097620_1007142672 163
915 3300006931 Ga0097620_100759135 Ga0097620_1007591352 163
916 3300006931 Ga0097620_100837173 Ga0097620_1008371732 163
917 3300006931 Ga0097620_101723800 Ga0097620_1017238002 163
918 3300007076 Ga0075435_100000204 Ga0075435_10000020426 163
919 3300007076 Ga0075435_100007928 Ga0075435_1000079283 163
920 3300007076 Ga0075435_100015754 Ga0075435_1000157543 163
921 3300007076 Ga0075435_100027042 Ga0075435_1000270423 163
922 3300007076 Ga0075435_100177038 Ga0075435_1001770382 163
923 3300007076 Ga0075435_100212697 Ga0075435_1002126972 163
924 3300007076 Ga0075435_100310333 Ga0075435_1003103332 163
925 3300007076 Ga0075435_100494082 Ga0075435_1004940822 163
926 3300009011 Ga0105251_10096311 Ga0105251_100963112 163
927 3300009036 Ga0105244_10445466 Ga0105244_104454661 163
928 3300009093 Ga0105240_10794797 Ga0105240_107947972 163
929 3300009093 Ga0105240_11465595 Ga0105240_114655951 163
930 3300009094 Ga0111539_10000134 Ga0111539_1000013415 163
931 3300009094 Ga0111539_10001078 Ga0111539_1000107815 163
932 3300009094 Ga0111539_10002632 Ga0111539_100026323 163
933 3300009094 Ga0111539_10010143 Ga0111539_1001014310 163
934 3300009094 Ga0111539_10015933 Ga0111539_100159333 163
935 3300009094 Ga0111539_10187478 Ga0111539_101874783 163
936 3300009094 Ga0111539_10291782 Ga0111539_102917822 163
937 3300009094 Ga0111539_10321189 Ga0111539_103211892 163
938 3300009094 Ga0111539_10510089 Ga0111539_105100892 163
939 3300009094 Ga0111539_11242735 Ga0111539_112427352 163
940 3300009094 Ga0111539_11566589 Ga0111539_115665892 163
941 3300009098 Ga0105245_10018654 Ga0105245_100186545 163
942 3300009098 Ga0105245_10266120 Ga0105245_102661202 163
943 3300009098 Ga0105245_10832324 Ga0105245_108323241 163
944 3300009098 Ga0105245_11922539 Ga0105245_119225391 163
945 3300009101 Ga0105247_10058133 Ga0105247_100581333 163
946 3300009101 Ga0105247_10159725 Ga0105247_101597252 163
947 3300009101 Ga0105247_10271953 Ga0105247_102719532 163
948 3300009147 Ga0114129_10000426 Ga0114129_1000042613 163
949 3300009147 Ga0114129_10001213 Ga0114129_1000121310 163
950 3300009147 Ga0114129_10011201 Ga0114129_100112015 163
951 3300009147 Ga0114129_10016744 Ga0114129_100167444 163
952 3300009147 Ga0114129_10016919 Ga0114129_100169195 163
953 3300009147 Ga0114129_10029055 Ga0114129_100290552 163
954 3300009147 Ga0114129_10048963 Ga0114129_100489633 163
955 3300009147 Ga0114129_10051960 Ga0114129_100519604 163
956 3300009147 Ga0114129_10057730 Ga0114129_100577303 163
957 3300009147 Ga0114129_10064329 Ga0114129_100643293 163
958 3300009147 Ga0114129_10067793 Ga0114129_100677932 163
959 3300009147 Ga0114129_10073868 Ga0114129_100738688 163
960 3300009147 Ga0114129_10095042 Ga0114129_100950423 163
961 3300009147 Ga0114129_10109022 Ga0114129_101090223 163
962 3300009147 Ga0114129_10143188 Ga0114129_101431883 163
963 3300009147 Ga0114129_10295970 Ga0114129_102959701 163
964 3300009147 Ga0114129_10566980 Ga0114129_105669801 163
965 3300009147 Ga0114129_12703291 Ga0114129_127032911 163
966 3300009148 Ga0105243_10006934 Ga0105243_100069346 163
967 3300009148 Ga0105243_10175709 Ga0105243_101757092 163
968 3300009148 Ga0105243_10506248 Ga0105243_105062482 163
969 3300009148 Ga0105243_10771100 Ga0105243_107711002 163
970 3300009148 Ga0105243_10923197 Ga0105243_109231972 163
971 3300009148 Ga0105243_11471236 Ga0105243_114712362 163
972 3300009148 Ga0105243_11608999 Ga0105243_116089991 163
973 3300009174 Ga0105241_10026107 Ga0105241_100261072 163
974 3300009174 Ga0105241_11039566 Ga0105241_110395661 163
975 3300009176 Ga0105242_10328003 Ga0105242_103280032 163
976 3300009176 Ga0105242_10366387 Ga0105242_103663872 163
977 3300009176 Ga0105242_11024614 Ga0105242_110246142 163
978 3300009177 Ga0105248_10002172 Ga0105248_1000217211 163
979 3300009177 Ga0105248_10043045 Ga0105248_100430454 163
980 3300009177 Ga0105248_10052710 Ga0105248_100527102 163
981 3300009177 Ga0105248_10068556 Ga0105248_100685561 163
982 3300009177 Ga0105248_10107031 Ga0105248_101070313 163
983 3300009177 Ga0105248_10162200 Ga0105248_101622003 163
984 3300009177 Ga0105248_10231761 Ga0105248_102317612 163
985 3300009177 Ga0105248_10231761 Ga0105248_102317614 163
986 3300009177 Ga0105248_10320423 Ga0105248_103204231 163
987 3300009177 Ga0105248_10495834 Ga0105248_104958342 163
988 3300009177 Ga0105248_11356672 Ga0105248_113566721 163
989 3300009545 Ga0105237_10709398 Ga0105237_107093982 163
990 3300009545 Ga0105237_11273509 Ga0105237_112735092 163
991 3300009553 Ga0105249_10081617 Ga0105249_100816172 163
992 3300009553 Ga0105249_10272878 Ga0105249_102728782 163
993 3300009553 Ga0105249_10350611 Ga0105249_103506112 163
994 3300009553 Ga0105249_10455199 Ga0105249_104551992 163
995 3300009553 Ga0105249_10867528 Ga0105249_108675282 163
996 3300009553 Ga0105249_11977180 Ga0105249_119771801 163
997 3300011119 Ga0105246_10105238 Ga0105246_101052382 163
998 3300011119 Ga0105246_10467635 Ga0105246_104676352 163
999 3300013100 Ga0157373_11108636 Ga0157373_111086361 163
1000 3300013297 Ga0157378_10561950 Ga0157378_105619502 163
1001 3300013306 Ga0163162_10549926 Ga0163162_105499262 163
1002 3300013306 Ga0163162_10609618 Ga0163162_106096182 163
1003 3300013306 Ga0163162_10947929 Ga0163162_109479291 163
1004 3300013306 Ga0163162_11769678 Ga0163162_117696781 163
1005 3300013307 Ga0157372_10454180 Ga0157372_104541801 163
1006 3300013308 Ga0157375_10055322 Ga0157375_100553222 163
1007 3300013308 Ga0157375_10265853 Ga0157375_102658532 163
1008 3300013308 Ga0157375_10374552 Ga0157375_103745522 163
1009 3300013308 Ga0157375_10587096 Ga0157375_105870962 163
1010 3300014325 Ga0163163_10024951 Ga0163163_100249514 163
1011 3300014325 Ga0163163_10033095 Ga0163163_100330953 163
1012 3300014325 Ga0163163_10044334 Ga0163163_100443342 163
1013 3300014325 Ga0163163_10049145 Ga0163163_100491454 163
1014 3300014325 Ga0163163_10457893 Ga0163163_104578932 163
1015 3300014325 Ga0163163_10662976 Ga0163163_106629762 163
1016 3300014326 Ga0157380_10002946 Ga0157380_100029469 163
1017 3300014326 Ga0157380_10048867 Ga0157380_100488672 163
1018 3300014326 Ga0157380_10078622 Ga0157380_100786222 163
1019 3300014326 Ga0157380_10088271 Ga0157380_100882713 163
1020 3300014326 Ga0157380_10279419 Ga0157380_102794192 163
1021 3300014326 Ga0157380_10691176 Ga0157380_106911762 163
1022 3300014326 Ga0157380_11524746 Ga0157380_115247461 163
1023 3300014326 Ga0157380_11547105 Ga0157380_115471052 163
1024 3300014497 Ga0182008_10291273 Ga0182008_102912731 163
1025 3300014745 Ga0157377_10066174 Ga0157377_100661743 163
1026 3300014745 Ga0157377_10095762 Ga0157377_100957621 163
1027 3300014745 Ga0157377_10155723 Ga0157377_101557232 163
1028 3300014745 Ga0157377_10275103 Ga0157377_102751032 163
1029 3300014745 Ga0157377_10331777 Ga0157377_103317772 163
1030 3300014745 Ga0157377_10550822 Ga0157377_105508221 163
1031 3300014968 Ga0157379_10007040 Ga0157379_100070405 163
1032 3300014968 Ga0157379_10007133 Ga0157379_100071332 163
1033 3300014968 Ga0157379_10037871 Ga0157379_100378712 163
1034 3300014968 Ga0157379_10222767 Ga0157379_102227672 163
1035 3300014968 Ga0157379_10328355 Ga0157379_103283552 163
1036 3300014968 Ga0157379_10640056 Ga0157379_106400561 163
1037 3300014969 Ga0157376_10189607 Ga0157376_101896072 163
1038 3300017792 Ga0163161_10379530 Ga0163161_103795302 163
1039 3300017792 Ga0163161_10965245 Ga0163161_109652452 163
1040 3300021384 Ga0213876_10074971 Ga0213876_100749712 163
1041 3300025315 Ga0207697_10357179 Ga0207697_103571792 163
1042 3300025893 Ga0207682_10004207 Ga0207682_100042073 163
1043 3300025893 Ga0207682_10045366 Ga0207682_100453662 163
1044 3300025893 Ga0207682_10048222 Ga0207682_100482221 163
1045 3300025893 Ga0207682_10064298 Ga0207682_100642982 163
1046 3300025893 Ga0207682_10327128 Ga0207682_103271281 163
1047 3300025900 Ga0207710_10082088 Ga0207710_100820882 163
1048 3300025901 Ga0207688_10348566 Ga0207688_103485661 163
1049 3300025903 Ga0207680_10049583 Ga0207680_100495832 163
1050 3300025903 Ga0207680_10318152 Ga0207680_103181522 163
1051 3300025903 Ga0207680_10792231 Ga0207680_107922312 163
1052 3300025906 Ga0207699_10257100 Ga0207699_102571002 163
1053 3300025907 Ga0207645_10002286 Ga0207645_100022864 163
1054 3300025907 Ga0207645_10148909 Ga0207645_101489093 163
1055 3300025908 Ga0207643_10003202 Ga0207643_100032023 163
1056 3300025908 Ga0207643_10042613 Ga0207643_100426132 163
1057 3300025908 Ga0207643_10057393 Ga0207643_100573932 163
1058 3300025908 Ga0207643_10077467 Ga0207643_100774672 163
1059 3300025908 Ga0207643_10549995 Ga0207643_105499952 163
1060 3300025910 Ga0207684_10228661 Ga0207684_102286612 163
1061 3300025913 Ga0207695_10428856 Ga0207695_104288562 163
1062 3300025913 Ga0207695_10757082 Ga0207695_107570822 163
1063 3300025914 Ga0207671_10227660 Ga0207671_102276602 163
1064 3300025914 Ga0207671_11049257 Ga0207671_110492571 163
1065 3300025915 Ga0207693_10738222 Ga0207693_107382221 163
1066 3300025916 Ga0207663_10226206 Ga0207663_102262062 163
1067 3300025917 Ga0207660_10085009 Ga0207660_100850093 163
1068 3300025917 Ga0207660_10096368 Ga0207660_100963683 163
1069 3300025917 Ga0207660_10165751 Ga0207660_101657512 163
1070 3300025917 Ga0207660_10247169 Ga0207660_102471691 163
1071 3300025918 Ga0207662_10007637 Ga0207662_100076373 163
1072 3300025918 Ga0207662_10099277 Ga0207662_100992772 163
1073 3300025918 Ga0207662_10131006 Ga0207662_101310062 163
1074 3300025919 Ga0207657_10006096 Ga0207657_100060965 163
1075 3300025920 Ga0207649_10073295 Ga0207649_100732952 163
1076 3300025920 Ga0207649_10857902 Ga0207649_108579022 163
1077 3300025921 Ga0207652_10052515 Ga0207652_100525154 163
1078 3300025921 Ga0207652_10399292 Ga0207652_103992922 163
1079 3300025921 Ga0207652_10697637 Ga0207652_106976372 163
1080 3300025921 Ga0207652_10727255 Ga0207652_107272551 163
1081 3300025922 Ga0207646_10067972 Ga0207646_100679723 163
1082 3300025922 Ga0207646_10146933 Ga0207646_101469333 163
1083 3300025922 Ga0207646_10167580 Ga0207646_101675802 163
1084 3300025922 Ga0207646_10658221 Ga0207646_106582212 163
1085 3300025922 Ga0207646_10771753 Ga0207646_107717532 163
1086 3300025922 Ga0207646_10980208 Ga0207646_109802081 163
1087 3300025923 Ga0207681_10009178 Ga0207681_100091782 163
1088 3300025923 Ga0207681_10036364 Ga0207681_100363643 163
1089 3300025923 Ga0207681_10051798 Ga0207681_100517982 163
1090 3300025923 Ga0207681_10438186 Ga0207681_104381862 163
1091 3300025925 Ga0207650_10002374 Ga0207650_100023749 163
1092 3300025925 Ga0207650_10295594 Ga0207650_102955942 163
1093 3300025925 Ga0207650_10549731 Ga0207650_105497311 163
1094 3300025925 Ga0207650_10801154 Ga0207650_108011542 163
1095 3300025926 Ga0207659_10000079 Ga0207659_1000007930 163
1096 3300025926 Ga0207659_10001272 Ga0207659_100012723 163
1097 3300025926 Ga0207659_10012585 Ga0207659_100125853 163
1098 3300025926 Ga0207659_10029655 Ga0207659_100296552 163
1099 3300025926 Ga0207659_10058294 Ga0207659_100582942 163
1100 3300025926 Ga0207659_10163907 Ga0207659_101639072 163
1101 3300025926 Ga0207659_10235224 Ga0207659_102352241 163
1102 3300025926 Ga0207659_10581384 Ga0207659_105813842 163
1103 3300025927 Ga0207687_10136073 Ga0207687_101360732 163
1104 3300025927 Ga0207687_10263500 Ga0207687_102635002 163
1105 3300025927 Ga0207687_11381762 Ga0207687_113817622 163
1106 3300025928 Ga0207700_10006132 Ga0207700_100061322 163
1107 3300025928 Ga0207700_11121973 Ga0207700_111219731 163
1108 3300025931 Ga0207644_10098430 Ga0207644_100984302 163
1109 3300025931 Ga0207644_10103306 Ga0207644_101033062 163
1110 3300025931 Ga0207644_10464392 Ga0207644_104643922 163
1111 3300025931 Ga0207644_11140984 Ga0207644_111409842 163
1112 3300025932 Ga0207690_10116446 Ga0207690_101164462 163
1113 3300025933 Ga0207706_10006050 Ga0207706_100060509 163
1114 3300025933 Ga0207706_10101857 Ga0207706_101018572 163
1115 3300025933 Ga0207706_10134783 Ga0207706_101347832 163
1116 3300025933 Ga0207706_10164552 Ga0207706_101645522 163
1117 3300025933 Ga0207706_10902198 Ga0207706_109021982 163
1118 3300025934 Ga0207686_10020581 Ga0207686_100205812 163
1119 3300025934 Ga0207686_10647968 Ga0207686_106479681 163
1120 3300025935 Ga0207709_10006292 Ga0207709_100062923 163
1121 3300025935 Ga0207709_10194962 Ga0207709_101949622 163
1122 3300025936 Ga0207670_10002109 Ga0207670_100021098 163
1123 3300025936 Ga0207670_10163474 Ga0207670_101634742 163
1124 3300025936 Ga0207670_10250581 Ga0207670_102505812 163
1125 3300025936 Ga0207670_10639302 Ga0207670_106393022 163
1126 3300025937 Ga0207669_10322202 Ga0207669_103222022 163
1127 3300025937 Ga0207669_10702761 Ga0207669_107027612 163
1128 3300025937 Ga0207669_10889369 Ga0207669_108893691 163
1129 3300025938 Ga0207704_10001806 Ga0207704_100018065 163
1130 3300025938 Ga0207704_10022964 Ga0207704_100229644 163
1131 3300025938 Ga0207704_10095293 Ga0207704_100952932 163
1132 3300025938 Ga0207704_10668633 Ga0207704_106686332 163
1133 3300025939 Ga0207665_10090888 Ga0207665_100908883 163
1134 3300025940 Ga0207691_10018862 Ga0207691_100188626 163
1135 3300025940 Ga0207691_10045113 Ga0207691_100451133 163
1136 3300025940 Ga0207691_10070189 Ga0207691_100701892 163
1137 3300025940 Ga0207691_10122904 Ga0207691_101229042 163
1138 3300025940 Ga0207691_10538456 Ga0207691_105384562 163
1139 3300025940 Ga0207691_10642074 Ga0207691_106420741 163
1140 3300025940 Ga0207691_10649339 Ga0207691_106493391 163
1141 3300025941 Ga0207711_10006268 Ga0207711_100062684 163
1142 3300025941 Ga0207711_10027728 Ga0207711_100277282 163
1143 3300025941 Ga0207711_10082424 Ga0207711_100824242 163
1144 3300025941 Ga0207711_10141424 Ga0207711_101414243 163
1145 3300025941 Ga0207711_10379055 Ga0207711_103790552 163
1146 3300025941 Ga0207711_10584376 Ga0207711_105843762 163
1147 3300025941 Ga0207711_11097910 Ga0207711_110979102 163
1148 3300025942 Ga0207689_10000032 Ga0207689_100000322 163
1149 3300025942 Ga0207689_10045085 Ga0207689_100450852 163
1150 3300025942 Ga0207689_10081837 Ga0207689_100818373 163
1151 3300025942 Ga0207689_10125401 Ga0207689_101254012 163
1152 3300025942 Ga0207689_10228789 Ga0207689_102287892 163
1153 3300025942 Ga0207689_10323548 Ga0207689_103235482 163
1154 3300025944 Ga0207661_10334552 Ga0207661_103345522 163
1155 3300025944 Ga0207661_10342356 Ga0207661_103423563 163
1156 3300025944 Ga0207661_10795048 Ga0207661_107950482 163
1157 3300025945 Ga0207679_10073204 Ga0207679_100732042 163
1158 3300025945 Ga0207679_10686495 Ga0207679_106864952 163
1159 3300025945 Ga0207679_10744666 Ga0207679_107446662 163
1160 3300025945 Ga0207679_10801763 Ga0207679_108017632 163
1161 3300025945 Ga0207679_11371468 Ga0207679_113714681 163
1162 3300025949 Ga0207667_10104283 Ga0207667_101042835 163
1163 3300025960 Ga0207651_10010999 Ga0207651_100109994 163
1164 3300025960 Ga0207651_10048187 Ga0207651_100481872 163
1165 3300025960 Ga0207651_10342397 Ga0207651_103423972 163
1166 3300025960 Ga0207651_10524791 Ga0207651_105247912 163
1167 3300025961 Ga0207712_10073047 Ga0207712_100730472 163
1168 3300025961 Ga0207712_10260004 Ga0207712_102600042 163
1169 3300025961 Ga0207712_11279341 Ga0207712_112793411 163
1170 3300025972 Ga0207668_11564651 Ga0207668_115646511 163
1171 3300025981 Ga0207640_10873542 Ga0207640_108735422 163
1172 3300025981 Ga0207640_10910496 Ga0207640_109104962 163
1173 3300025981 Ga0207640_11062493 Ga0207640_110624932 163
1174 3300026023 Ga0207677_10201274 Ga0207677_102012742 163
1175 3300026023 Ga0207677_10270975 Ga0207677_102709752 163
1176 3300026023 Ga0207677_10331780 Ga0207677_103317802 163
1177 3300026023 Ga0207677_10557228 Ga0207677_105572282 163
1178 3300026035 Ga0207703_10008882 Ga0207703_100088826 163
1179 3300026035 Ga0207703_10045404 Ga0207703_100454043 163
1180 3300026035 Ga0207703_10049674 Ga0207703_100496743 163
1181 3300026035 Ga0207703_10065358 Ga0207703_100653581 163
1182 3300026035 Ga0207703_10167253 Ga0207703_101672531 163
1183 3300026035 Ga0207703_10227604 Ga0207703_102276042 163
1184 3300026035 Ga0207703_10838593 Ga0207703_108385931 163
1185 3300026035 Ga0207703_10888294 Ga0207703_108882942 163
1186 3300026035 Ga0207703_11245904 Ga0207703_112459042 163
1187 3300026067 Ga0207678_10054360 Ga0207678_100543602 163
1188 3300026075 Ga0207708_10004043 Ga0207708_100040433 163
1189 3300026075 Ga0207708_10102480 Ga0207708_101024802 163
1190 3300026075 Ga0207708_10132107 Ga0207708_101321072 163
1191 3300026075 Ga0207708_10419909 Ga0207708_104199092 163
1192 3300026078 Ga0207702_10314643 Ga0207702_103146432 163
1193 3300026088 Ga0207641_10000955 Ga0207641_1000095512 163
1194 3300026088 Ga0207641_10106423 Ga0207641_101064233 163
1195 3300026088 Ga0207641_10329613 Ga0207641_103296132 163
1196 3300026088 Ga0207641_10341335 Ga0207641_103413352 163
1197 3300026089 Ga0207648_10001379 Ga0207648_100013798 163
1198 3300026089 Ga0207648_10053012 Ga0207648_100530123 163
1199 3300026089 Ga0207648_10139264 Ga0207648_101392642 163
1200 3300026089 Ga0207648_10211164 Ga0207648_102111642 163
1201 3300026089 Ga0207648_10254914 Ga0207648_102549143 163
1202 3300026089 Ga0207648_10334651 Ga0207648_103346512 163
1203 3300026089 Ga0207648_11467147 Ga0207648_114671471 163
1204 3300026095 Ga0207676_10014812 Ga0207676_100148122 163
1205 3300026095 Ga0207676_10032483 Ga0207676_100324833 163
1206 3300026095 Ga0207676_10034193 Ga0207676_100341932 163
1207 3300026095 Ga0207676_10109644 Ga0207676_101096443 163
1208 3300026095 Ga0207676_10150793 Ga0207676_101507932 163
1209 3300026095 Ga0207676_10307813 Ga0207676_103078132 163
1210 3300026116 Ga0207674_10707475 Ga0207674_107074752 163
1211 3300026118 Ga0207675_100087094 Ga0207675_1000870943 163
1212 3300026118 Ga0207675_100088170 Ga0207675_1000881703 163
1213 3300026118 Ga0207675_100115838 Ga0207675_1001158382 163
1214 3300026118 Ga0207675_100230505 Ga0207675_1002305052 163
1215 3300026118 Ga0207675_100254408 Ga0207675_1002544082 163
1216 3300026118 Ga0207675_100347885 Ga0207675_1003478852 163
1217 3300026118 Ga0207675_100385732 Ga0207675_1003857321 163
1218 3300026118 Ga0207675_100618544 Ga0207675_1006185441 163
1219 3300026118 Ga0207675_100857438 Ga0207675_1008574382 163
1220 3300026118 Ga0207675_101042915 Ga0207675_1010429152 163
1221 3300026121 Ga0207683_10033044 Ga0207683_100330443 163
1222 3300026121 Ga0207683_10206224 Ga0207683_102062242 163
1223 3300026121 Ga0207683_10313072 Ga0207683_103130722 163
1224 3300026121 Ga0207683_10414536 Ga0207683_104145361 163
1225 3300026121 Ga0207683_10558342 Ga0207683_105583422 163
1226 3300026121 Ga0207683_10800358 Ga0207683_108003582 163
1227 3300026142 Ga0207698_10400208 Ga0207698_104002082 163
1228 3300027665 Ga0209983_1106675 Ga0209983_11066752 163
1229 3300027682 Ga0209971_1026227 Ga0209971_10262272 163
1230 3300027907 Ga0207428_10000156 Ga0207428_1000015646 163
1231 3300027907 Ga0207428_10006617 Ga0207428_100066173 163
1232 3300027907 Ga0207428_10007795 Ga0207428_100077953 163
1233 3300027907 Ga0207428_10017798 Ga0207428_100177983 163
1234 3300027907 Ga0207428_10035587 Ga0207428_100355873 163
1235 3300027907 Ga0207428_10331834 Ga0207428_103318342 163
1236 3300028379 Ga0268266_10204191 Ga0268266_102041912 163
1237 3300028380 Ga0268265_10007655 Ga0268265_100076553 163
1238 3300028380 Ga0268265_10221870 Ga0268265_102218702 163
1239 3300028380 Ga0268265_10595829 Ga0268265_105958292 163
1240 3300028381 Ga0268264_10023300 Ga0268264_100233002 163
1241 3300028381 Ga0268264_10035080 Ga0268264_100350803 163
1242 3300028381 Ga0268264_10148355 Ga0268264_101483552 163
1243 3300028381 Ga0268264_10278405 Ga0268264_102784051 163
1244 3300028381 Ga0268264_10334699 Ga0268264_103346992 163
1245 3300031344 Ga0265316_10444674 Ga0265316_104446742 163
1246 3300031548 Ga0307408_100078365 Ga0307408_1000783652 163
1247 3300031548 Ga0307408_100081459 Ga0307408_1000814593 163
1248 3300031548 Ga0307408_100803021 Ga0307408_1008030212 163
1249 3300031731 Ga0307405_10079173 Ga0307405_100791732 163
1250 3300031731 Ga0307405_10112523 Ga0307405_101125232 163
1251 3300031731 Ga0307405_10597284 Ga0307405_105972842 163
1252 3300031824 Ga0307413_10100156 Ga0307413_101001562 163
1253 3300031824 Ga0307413_10927710 Ga0307413_109277102 163
1254 3300031852 Ga0307410_10124814 Ga0307410_101248142 163
1255 3300031852 Ga0307410_10835309 Ga0307410_108353092 163
1256 3300031901 Ga0307406_10343830 Ga0307406_103438302 163
1257 3300031903 Ga0307407_10084019 Ga0307407_100840192 163
1258 3300031911 Ga0307412_10542345 Ga0307412_105423452 163
1259 3300031995 Ga0307409_100074356 Ga0307409_1000743563 163
1260 3300031995 Ga0307409_100300793 Ga0307409_1003007932 163
1261 3300032002 Ga0307416_100028056 Ga0307416_1000280564 163
1262 3300032002 Ga0307416_100038313 Ga0307416_1000383132 163
1263 3300032002 Ga0307416_100059664 Ga0307416_1000596641 163
1264 3300032002 Ga0307416_100707017 Ga0307416_1007070172 163
1265 3300032004 Ga0307414_10129721 Ga0307414_101297212 163
1266 3300032004 Ga0307414_10349360 Ga0307414_103493602 163
1267 3300032004 Ga0307414_10615760 Ga0307414_106157602 163
1268 3300032004 Ga0307414_10640988 Ga0307414_106409882 163
1269 3300032004 Ga0307414_11121239 Ga0307414_111212392 163
1270 3300032005 Ga0307411_10114535 Ga0307411_101145352 163
1271 3300032005 Ga0307411_10117822 Ga0307411_101178222 163
1272 3300032005 Ga0307411_10460682 Ga0307411_104606822 163
1273 3300032126 Ga0307415_100010673 Ga0307415_1000106733 163
1274 3300032126 Ga0307415_100154027 Ga0307415_1001540272 163
1275 3300032126 Ga0307415_101172548 Ga0307415_1011725482 163
1276 3300034816 Ga0373930_0002854 Ga0373930_0002854_1087_1692 163
1277 3300034817 Ga0373948_0018575 Ga0373948_0018575_273_878 163
1278 3300034818 Ga0373950_0000492 Ga0373950_0000492_1192_1797 163
1279 3300034819 Ga0373958_0024338 Ga0373958_0024338_501_1106 163
1280 3300035084 Ga0373928_0006977 Ga0373928_0006977_61_597 163
1281 3300035085 Ga0373929_0000407 Ga0373929_0000407_3871_4476 163
1282 3300035090 Ga0373949_0000966 Ga0373949_0000966_8263_8868 163
1283 3300035092 Ga0373952_0000798 Ga0373952_0000798_4450_5055 163
1284 3300035114 Ga0373939_0030625 Ga0373939_0030625_253_792 163
1285 3300035114 Ga0373939_0109649 Ga0373939_0109649_317_922 163
1286 3300035115 Ga0373941_0013295 Ga0373941_0013295_1595_2134 163
1287 3300035115 Ga0373941_0183910 Ga0373941_0183910_23_526 163
1288 3300035121 Ga0373960_0217085 Ga0373960_0217085_121_666 163
1289 3300035170 Ga0373943_0224021 Ga0373943_0224021_280_777 163
1290 3300035172 Ga0373955_0046443 Ga0373955_0046443_706_1209 163
1291 3300035172 Ga0373955_0442855 Ga0373955_0442855_127_624 163
1292 3300035172 Ga0373955_0842861 Ga0373955_0842861_12_509 163
1293 3300035207 Ga0373942_0001566 Ga0373942_0001566_4506_5111 163
1294 3300035691 Ga0373931_0007480 Ga0373931_0007480_3272_3877 163
1295 3300035692 Ga0373935_0134413 Ga0373935_0134413_865_1410 163
1296 3300035692 Ga0373935_0185751 Ga0373935_0185751_739_1236 163
1297 3300035724 Ga0373933_0740285 Ga0373933_0740285_22_519 163
1298 3300036401 Ga0373937_0012405 Ga0373937_0012405_6766_7269 163
1299 3300036401 Ga0373937_0176206 Ga0373937_0176206_447_944 163
1300 3300036401 Ga0373937_0608866 Ga0373937_0608866_395_904 163
1301 3300038996 Ga0242420_027094 Ga0242420_027094_437_949 163
1302 3300039437 Ga0436365_1732685 Ga0436365_1732685_694_1191 163
1303 3300041406 Ga0439439_0093016 Ga0439439_0093016_160_660 163
1304 3300041408 Ga0439453_0017767 Ga0439453_0017767_442_963 163
1305 3300041408 Ga0439453_0026277 Ga0439453_0026277_566_1057 163
1306 3300041997 Ga0439431_0006753 Ga0439431_0006753_505_1002 163
1307 3300041999 Ga0439433_0001889 Ga0439433_0001889_1555_2052 163
1308 3300042000 Ga0439437_014446 Ga0439437_014446_138_680 163
1309 3300042015 Ga0439462_0051606 Ga0439462_0051606_532_1035 163
1310 3300042156 Ga0439446_0028655 Ga0439446_0028655_338_838 163
1311 3300042156 Ga0439446_0095397 Ga0439446_0095397_242_739 163
1312 3300042156 Ga0439446_0251776 Ga0439446_0251776_18_554 163
1313 3300042157 Ga0439458_0092357 Ga0439458_0092357_197_688 163
1314 3300042439 Ga0439464_0061668 Ga0439464_0061668_430_960 163
1315 3300042461 Ga0439460_0063976 Ga0439460_0063976_72_602 163
1316 3300042461 Ga0439460_0123444 Ga0439460_0123444_325_819 163
1317 3300042876 Ga0451577_0424665 Ga0451577_0424665_401_919 163
1318 3300042993 Ga0439440_0033118 Ga0439440_0033118_17_508 163
1319 3300042993 Ga0439440_0098351 Ga0439440_0098351_131_628 163
1320 3300044694 Ga0466963_0239302 Ga0466963_0239302_357_872 163
1321 3300045051 Ga0451576_0301734 Ga0451576_0301734_66_665 163
1322 3300046454 Ga0495592_0139872 Ga0495592_0139872_1092_1595 163
1323 3300046455 Ga0495603_0028319 Ga0495603_0028319_810_1355 163
1324 3300046459 Ga0495629_0085053 Ga0495629_0085053_453_956 163
1325 3300046459 Ga0495629_0206389 Ga0495629_0206389_823_1326 163
1326 3300046472 Ga0495580_0316248 Ga0495580_0316248_255_764 163
1327 3300046473 Ga0495582_0472333 Ga0495582_0472333_172_675 163
1328 3300046475 Ga0495639_0076786 Ga0495639_0076786_395_898 163
1329 3300046491 Ga0495584_0025210 Ga0495584_0025210_2058_2606 163
1330 3300046491 Ga0495584_0410163 Ga0495584_0410163_90_605 163
1331 3300046499 Ga0495594_0066860 Ga0495594_0066860_1336_1881 163
1332 3300046514 Ga0495618_0617134 Ga0495618_0617134_20_565 163
1333 3300046517 Ga0495630_1022797 Ga0495630_1022797_44_547 163
1334 3300046522 Ga0495643_0009097 Ga0495643_0009097_4303_4842 163
1335 3300046523 Ga0495644_0096332 Ga0495644_0096332_248_796 163
1336 3300046525 Ga0495663_0017329 Ga0495663_0017329_1131_1679 163
1337 3300046529 Ga0495652_0635473 Ga0495652_0635473_23_526 163
1338 3300046530 Ga0495654_0322069 Ga0495654_0322069_97_609 163
1339 3300046533 Ga0495640_0047607 Ga0495640_0047607_1457_1960 163
1340 3300046536 Ga0495587_0176508 Ga0495587_0176508_619_1122 163
1341 3300046537 Ga0495598_0012654 Ga0495598_0012654_1112_1660 163
1342 3300046537 Ga0495598_0117596 Ga0495598_0117596_202_729 163
1343 3300046537 Ga0495598_0146081 Ga0495598_0146081_100_648 163
1344 3300046538 Ga0495609_0019629 Ga0495609_0019629_2390_2938 163
1345 3300046539 Ga0495621_0109503 Ga0495621_0109503_505_1032 163
1346 3300046539 Ga0495621_0116445 Ga0495621_0116445_406_897 163
1347 3300046543 Ga0495645_0000450 Ga0495645_0000450_23785_24288 163
1348 3300046558 Ga0495633_0093088 Ga0495633_0093088_126_668 163
1349 3300046648 Ga0495611_0197354 Ga0495611_0197354_325_828 163
1350 3300046664 Ga0495659_0015579 Ga0495659_0015579_1237_1782 163
1351 3300046664 Ga0495659_0191227 Ga0495659_0191227_90_638 163
1352 3300046674 Ga0495588_0057859 Ga0495588_0057859_992_1537 163
1353 3300046675 Ga0495657_0311723 Ga0495657_0311723_75_578 163
1354 3300046683 Ga0495658_0025322 Ga0495658_0025322_1258_1797 163
1355 3300046683 Ga0495658_0090500 Ga0495658_0090500_496_999 163
1356 3300046683 Ga0495658_0168637 Ga0495658_0168637_833_1336 163
1357 3300046683 Ga0495658_0580717 Ga0495658_0580717_99_644 163
1358 3300046684 Ga0495669_0103649 Ga0495669_0103649_510_1058 163
1359 3300047318 Ga0495636_0043766 Ga0495636_0043766_97_642 163
1360 3300047319 Ga0495674_0082858 Ga0495674_0082858_604_1107 163
1361 3300047319 Ga0495674_0091091 Ga0495674_0091091_1566_2063 163
1362 3300047445 Ga0495677_0021678 Ga0495677_0021678_1095_1643 163
1363 3300047447 Ga0495685_063483 Ga0495685_063483_202_750 163
1364 3300047471 Ga0495684_0025447 Ga0495684_0025447_2593_3096 163
1365 3300047673 Ga0495593_0174023 Ga0495593_0174023_114_617 163
1366 3300048904 Ga0496101_0163598 Ga0496101_0163598_103_642 163
1367 3300048905 Ga0496102_0365200 Ga0496102_0365200_648_1151 163
1368 3300048908 Ga0496105_0534097 Ga0496105_0534097_51_599 163
1369 3300048909 Ga0496106_0080483 Ga0496106_0080483_560_1126 163
1370 3300048911 Ga0496108_0228402 Ga0496108_0228402_121_612 163
1371 3300048911 Ga0496108_0685751 Ga0496108_0685751_75_614 163
1372 3300048911 Ga0496108_0934304 Ga0496108_0934304_180_677 163
1373 3300048912 Ga0496109_0079029 Ga0496109_0079029_921_1418 163
1374 3300048912 Ga0496109_0165002 Ga0496109_0165002_722_1213 163
1375 3300048912 Ga0496109_0585075 Ga0496109_0585075_232_771 163
1376 3300048913 Ga0496110_0659312 Ga0496110_0659312_14_553 163
1377 3300048914 Ga0496111_0221188 Ga0496111_0221188_250_762 163
1378 3300048914 Ga0496111_1030007 Ga0496111_1030007_19_522 163
1379 3300048915 Ga0496112_0002810 Ga0496112_0002810_11391_11894 163
1380 3300048915 Ga0496112_0216587 Ga0496112_0216587_1193_1699 163
1381 3300048915 Ga0496112_0242980 Ga0496112_0242980_403_906 163
1382 3300048915 Ga0496112_0456036 Ga0496112_0456036_565_1062 163
1383 3300048915 Ga0496112_0741276 Ga0496112_0741276_308_811 163
1384 3300048916 Ga0496113_0379672 Ga0496113_0379672_202_705 163
1385 3300048917 Ga0496114_0050503 Ga0496114_0050503_2300_2803 163
1386 3300048917 Ga0496114_0124083 Ga0496114_0124083_537_1043 163
1387 3300048917 Ga0496114_0198014 Ga0496114_0198014_484_987 163
1388 3300048917 Ga0496114_0357960 Ga0496114_0357960_546_1079 163
1389 3300048917 Ga0496114_0508159 Ga0496114_0508159_329_832 163
1390 3300049568 Ga0501031_0245236 Ga0501031_0245236_160_651 163
1391 3300049568 Ga0501031_0281248 Ga0501031_0281248_212_724 163
1392 3300049571 Ga0501034_0158536 Ga0501034_0158536_1066_1599 163
1393 3300049572 Ga0501036_0258953 Ga0501036_0258953_64_612 163
1394 3300049572 Ga0501036_0316407 Ga0501036_0316407_75_566 163
1395 3300049572 Ga0501036_0632035 Ga0501036_0632035_288_815 163
1396 3300049573 Ga0501037_0177620 Ga0501037_0177620_918_1466 163
1397 3300049573 Ga0501037_0531813 Ga0501037_0531813_79_612 163
1398 3300049574 Ga0501038_0043210 Ga0501038_0043210_1350_1898 163
1399 3300049574 Ga0501038_0134017 Ga0501038_0134017_1484_1975 163
1400 3300049575 Ga0501039_0005083 Ga0501039_0005083_1155_1646 163
1401 3300049576 Ga0501040_0009144 Ga0501040_0009144_92_640 163
1402 3300049576 Ga0501040_0021727 Ga0501040_0021727_1669_2160 163
1403 3300049576 Ga0501040_0049618 Ga0501040_0049618_1727_2218 163
1404 3300049577 Ga0501041_0080818 Ga0501041_0080818_1027_1518 163
1405 3300049577 Ga0501041_0944903 Ga0501041_0944903_28_519 163
1406 3300049578 Ga0501042_0003809 Ga0501042_0003809_2563_3054 163
1407 3300049578 Ga0501042_0085038 Ga0501042_0085038_1243_1734 163
1408 3300049579 Ga0501043_0038916 Ga0501043_0038916_942_1490 163
1409 3300049580 Ga0501046_0047476 Ga0501046_0047476_938_1429 163
1410 3300049580 Ga0501046_0054245 Ga0501046_0054245_1325_1816 163
1411 3300049581 Ga0501047_0453613 Ga0501047_0453613_15_548 163
1412 3300049582 Ga0501048_0049799 Ga0501048_0049799_1399_1947 163
1413 3300049582 Ga0501048_0279882 Ga0501048_0279882_579_1070 163
1414 3300049584 Ga0501068_0082561 Ga0501068_0082561_484_1032 163
1415 3300049584 Ga0501068_0511945 Ga0501068_0511945_173_664 163
1416 3300049587 Ga0501071_0015832 Ga0501071_0015832_1447_1995 163
1417 3300049587 Ga0501071_0934381 Ga0501071_0934381_53_544 163
1418 3300049588 Ga0501072_0006572 Ga0501072_0006572_5086_5577 163
1419 3300049588 Ga0501072_0026593 Ga0501072_0026593_1320_1811 163
1420 3300049591 Ga0501075_0023042 Ga0501075_0023042_3579_4070 163
1421 3300049591 Ga0501075_0110545 Ga0501075_0110545_408_899 163
1422 3300049591 Ga0501075_0468852 Ga0501075_0468852_169_717 163
1423 3300049592 Ga0501076_0040773 Ga0501076_0040773_10_501 163
1424 3300049592 Ga0501076_0136177 Ga0501076_0136177_1273_1782 163
1425 3300049593 Ga0501077_0047177 Ga0501077_0047177_943_1491 163
1426 3300049593 Ga0501077_0072533 Ga0501077_0072533_745_1254 163
1427 3300049660 Ga0501216_072708 Ga0501216_072708_27_524 163
1428 3300049704 Ga0501221_035984 Ga0501221_035984_109_606 163
1429 3300049741 Ga0501079_0005197 Ga0501079_0005197_8060_8608 163
1430 3300049741 Ga0501079_0087472 Ga0501079_0087472_921_1412 163
1431 3300049742 Ga0501080_0425907 Ga0501080_0425907_628_1119 163
1432 3300049743 Ga0501081_0008696 Ga0501081_0008696_3764_4255 163
1433 3300049743 Ga0501081_0041776 Ga0501081_0041776_2349_2897 163
1434 3300049743 Ga0501081_0588644 Ga0501081_0588644_236_727 163
1435 3300049822 Ga0501035_0192170 Ga0501035_0192170_1181_1729 163
1436 3300049822 Ga0501035_0933073 Ga0501035_0933073_41_574 163
1437 3300049822 Ga0501035_0961356 Ga0501035_0961356_94_585 163
1438 3300049823 Ga0501044_0092948 Ga0501044_0092948_1911_2444 163
1439 3300049823 Ga0501044_1290198 Ga0501044_1290198_65_556 163
1440 3300049824 Ga0501045_0004657 Ga0501045_0004657_1447_1995 163
1441 3300049824 Ga0501045_0264909 Ga0501045_0264909_241_732 163
1442 3300050489 nmdc:mga03683_1149_c1 nmdc:mga03683_1149_c1_2061_2585 163
1443 3300050491 nmdc:mga00v17_7255_c1 nmdc:mga00v17_7255_c1_35_541 163
1444 3300050492 nmdc:mga0yw44_555493_c1 nmdc:mga0yw44_555493_c1_80_577 163
1445 3300050507 nmdc:mga05p37_11071_c1 nmdc:mga05p37_11071_c1_8800_9345 163
1446 3300050507 nmdc:mga05p37_139331_c1 nmdc:mga05p37_139331_c1_721_1269 163
1447 3300050507 nmdc:mga05p37_158861_c1 nmdc:mga05p37_158861_c1_320_811 163
1448 3300050507 nmdc:mga05p37_1997_c1 nmdc:mga05p37_1997_c1_7928_8473 163
1449 3300050507 nmdc:mga05p37_20363_c1 nmdc:mga05p37_20363_c1_2511_3047 163
1450 3300050507 nmdc:mga05p37_24698_c1 nmdc:mga05p37_24698_c1_3673_4206 163
1451 3300050507 nmdc:mga05p37_25595_c1 nmdc:mga05p37_25595_c1_5984_6526 163
1452 3300050507 nmdc:mga05p37_26118_c2 nmdc:mga05p37_26118_c2_2946_3491 163
1453 3300050507 nmdc:mga05p37_34921_c1 nmdc:mga05p37_34921_c1_1405_1896 163
1454 3300050507 nmdc:mga05p37_37736_c1 nmdc:mga05p37_37736_c1_134_679 163
1455 3300050507 nmdc:mga05p37_43651_c1 nmdc:mga05p37_43651_c1_4126_4668 163
1456 3300050507 nmdc:mga05p37_44023_c1 nmdc:mga05p37_44023_c1_2323_2862 163
1457 3300050507 nmdc:mga05p37_48901_c1 nmdc:mga05p37_48901_c1_4213_4704 163
1458 3300050507 nmdc:mga05p37_5217_c1 nmdc:mga05p37_5217_c1_8021_8560 163
1459 3300050507 nmdc:mga05p37_91576_c1 nmdc:mga05p37_91576_c1_445_939 163
1460 3300050507 nmdc:mga05p37_967626_c1 nmdc:mga05p37_967626_c1_122_670 163
1461 3300050508 nmdc:mga09592_1189676_c1 nmdc:mga09592_1189676_c1_94_600 163
1462 3300050508 nmdc:mga09592_13559_c1 nmdc:mga09592_13559_c1_2843_3334 163
1463 3300050508 nmdc:mga09592_139923_c1 nmdc:mga09592_139923_c1_1229_1771 163
1464 3300050508 nmdc:mga09592_19921_c1 nmdc:mga09592_19921_c1_4294_4788 163
1465 3300050508 nmdc:mga09592_23513_c1 nmdc:mga09592_23513_c1_4401_4892 163
1466 3300050508 nmdc:mga09592_26276_c1 nmdc:mga09592_26276_c1_467_1012 163
1467 3300050508 nmdc:mga09592_68792_c1 nmdc:mga09592_68792_c1_376_867 163
1468 3300050509 nmdc:mga0qj67_194295_c1 nmdc:mga0qj67_194295_c1_78_569 163
1469 3300050509 nmdc:mga0qj67_255819_c1 nmdc:mga0qj67_255819_c1_313_804 163
1470 3300050509 nmdc:mga0qj67_27328_c1 nmdc:mga0qj67_27328_c1_782_1273 163
1471 3300050510 nmdc:mga06r32_132439_c1 nmdc:mga06r32_132439_c1_1394_1885 163
1472 3300050510 nmdc:mga06r32_14936_c1 nmdc:mga06r32_14936_c1_4915_5409 163
1473 3300050510 nmdc:mga06r32_270474_c1 nmdc:mga06r32_270474_c1_950_1492 163
1474 3300050510 nmdc:mga06r32_29574_c1 nmdc:mga06r32_29574_c1_853_1344 163
1475 3300050510 nmdc:mga06r32_655429_c1 nmdc:mga06r32_655429_c1_130_663 163
1476 3300050510 nmdc:mga06r32_9476_c1 nmdc:mga06r32_9476_c1_2396_2887 163
1477 3300050511 nmdc:mga08y16_1367_c1 nmdc:mga08y16_1367_c1_2935_3480 163
1478 3300050511 nmdc:mga08y16_1568_c1 nmdc:mga08y16_1568_c1_20058_20600 163
1479 3300050511 nmdc:mga08y16_2507_c1 nmdc:mga08y16_2507_c1_962_1471 163
1480 3300050511 nmdc:mga08y16_2643_c1 nmdc:mga08y16_2643_c1_881_1372 163
1481 3300050511 nmdc:mga08y16_266469_c1 nmdc:mga08y16_266469_c1_62_553 163
1482 3300050511 nmdc:mga08y16_273804_c1 nmdc:mga08y16_273804_c1_262_759 163
1483 3300050511 nmdc:mga08y16_2862_c1 nmdc:mga08y16_2862_c1_4574_5113 163
1484 3300050511 nmdc:mga08y16_390387_c1 nmdc:mga08y16_390387_c1_731_1231 163
1485 3300050511 nmdc:mga08y16_658_c1 nmdc:mga08y16_658_c1_13302_13793 163
1486 3300050511 nmdc:mga08y16_67477_c1 nmdc:mga08y16_67477_c1_1654_2181 163
1487 3300050512 nmdc:mga0n895_1037810_c1 nmdc:mga0n895_1037810_c1_149_685 163
1488 3300050512 nmdc:mga0n895_13596_c1 nmdc:mga0n895_13596_c1_2525_3088 163
1489 3300050512 nmdc:mga0n895_141_c1 nmdc:mga0n895_141_c1_7040_7558 163
1490 3300050512 nmdc:mga0n895_166078_c1 nmdc:mga0n895_166078_c1_1285_1824 163
1491 3300050512 nmdc:mga0n895_19824_c1 nmdc:mga0n895_19824_c1_130_648 163
1492 3300050512 nmdc:mga0n895_267490_c1 nmdc:mga0n895_267490_c1_769_1374 163
1493 3300050512 nmdc:mga0n895_304759_c1 nmdc:mga0n895_304759_c1_748_1239 163
1494 3300050512 nmdc:mga0n895_343217_c1 nmdc:mga0n895_343217_c1_714_1256 163
1495 3300050512 nmdc:mga0n895_35782_c1 nmdc:mga0n895_35782_c1_4156_4701 163
1496 3300050512 nmdc:mga0n895_476418_c1 nmdc:mga0n895_476418_c1_689_1219 163
1497 3300050512 nmdc:mga0n895_546195_c1 nmdc:mga0n895_546195_c1_524_1045 163
1498 3300050512 nmdc:mga0n895_58404_c1 nmdc:mga0n895_58404_c1_34_579 163
1499 3300050512 nmdc:mga0n895_602783_c1 nmdc:mga0n895_602783_c1_55_654 163
1500 3300050512 nmdc:mga0n895_81880_c1 nmdc:mga0n895_81880_c1_1589_2128 163
1501 3300050513 nmdc:mga0rr50_1006114_c1 nmdc:mga0rr50_1006114_c1_13_561 163
1502 3300050513 nmdc:mga0rr50_12990_c1 nmdc:mga0rr50_12990_c1_2200_2745 163
1503 3300050513 nmdc:mga0rr50_14183_c1 nmdc:mga0rr50_14183_c1_3011_3574 163
1504 3300050513 nmdc:mga0rr50_176227_c1 nmdc:mga0rr50_176227_c1_288_851 163
1505 3300050513 nmdc:mga0rr50_1_c1 nmdc:mga0rr50_1_c1_551162_551680 163
1506 3300050513 nmdc:mga0rr50_316066_c1 nmdc:mga0rr50_316066_c1_257_775 163
1507 3300050513 nmdc:mga0rr50_398071_c1 nmdc:mga0rr50_398071_c1_114_653 163
1508 3300050513 nmdc:mga0rr50_539301_c1 nmdc:mga0rr50_539301_c1_330_866 163
1509 3300050513 nmdc:mga0rr50_560727_c1 nmdc:mga0rr50_560727_c1_60_599 163
1510 3300050513 nmdc:mga0rr50_8550_c1 nmdc:mga0rr50_8550_c1_3130_3651 163
1511 3300050513 nmdc:mga0rr50_8679_c1 nmdc:mga0rr50_8679_c1_2121_2726 163
1512 3300050514 nmdc:mga08x19_148053_c1 nmdc:mga08x19_148053_c1_490_1005 163
1513 3300050514 nmdc:mga08x19_153311_c1 nmdc:mga08x19_153311_c1_671_1189 163
1514 3300050514 nmdc:mga08x19_191333_c1 nmdc:mga08x19_191333_c1_703_1224 163
1515 3300050514 nmdc:mga08x19_34798_c1 nmdc:mga08x19_34798_c1_1049_1546 163
1516 3300050514 nmdc:mga08x19_92_c1 nmdc:mga08x19_92_c1_74263_74781 163
1517 3300050515 nmdc:mga0a205_12067_c2 nmdc:mga0a205_12067_c2_5026_5565 163
1518 3300050515 nmdc:mga0a205_1225776_c1 nmdc:mga0a205_1225776_c1_16_546 163
1519 3300050515 nmdc:mga0a205_132875_c1 nmdc:mga0a205_132875_c1_1841_2359 163
1520 3300050515 nmdc:mga0a205_151535_c1 nmdc:mga0a205_151535_c1_1491_2054 163
1521 3300050515 nmdc:mga0a205_2573_c1 nmdc:mga0a205_2573_c1_12324_12869 163
1522 3300050515 nmdc:mga0a205_281542_c1 nmdc:mga0a205_281542_c1_267_809 163
1523 3300050515 nmdc:mga0a205_394862_c1 nmdc:mga0a205_394862_c1_296_838 163
1524 3300050515 nmdc:mga0a205_532506_c1 nmdc:mga0a205_532506_c1_367_906 163
1525 3300050515 nmdc:mga0a205_649189_c1 nmdc:mga0a205_649189_c1_263_811 163
1526 3300050515 nmdc:mga0a205_676287_c1 nmdc:mga0a205_676287_c1_253_744 163
1527 3300050516 nmdc:mga0sz30_222545_c1 nmdc:mga0sz30_222545_c1_191_697 163
1528 3300053077 Ga0495601_0135362 Ga0495601_0135362_605_1102 163
1529 3300053084 Ga0495595_0012548 Ga0495595_0012548_2507_3010 163
1530 3300053085 Ga0495619_0769263 Ga0495619_0769263_68_568 163
1531 3300053129 Ga0500628_043052 Ga0500628_043052_109_606 163
1532 3300054114 Ga0501084_0009574 Ga0501084_0009574_6016_6507 163
1533 3300054114 Ga0501084_0043281 Ga0501084_0043281_974_1465 163
1534 3300059421 Ga0590071_000739 Ga0590071_000739_3496_4029 163
1535 3300059421 Ga0590071_005043 Ga0590071_005043_1097_1630 163
1536 3300059423 Ga0590074_003587 Ga0590074_003587_1559_2092 163
1537 3300059423 Ga0590074_042319 Ga0590074_042319_37_570 163
1538 3300059424 Ga0590075_001312 Ga0590075_001312_1986_2519 163
1539 3300059424 Ga0590075_002211 Ga0590075_002211_1035_1568 163
1540 3300059424 Ga0590075_113661 Ga0590075_113661_68_580 163
1541 3300059426 Ga0590077_000747 Ga0590077_000747_4117_4650 163
1542 3300059511 Ga0587091_100514 Ga0587091_100514_117_614 163
1543 3300059655 Ga0587114_031768 Ga0587114_031768_44_541 163
1544 3300060353 Ga0501082_0163480 Ga0501082_0163480_649_1140 163
1545 3300060353 Ga0501082_0444785 Ga0501082_0444785_600_1091 163
1546 3300060353 Ga0501082_0818939 Ga0501082_0818939_88_597 163
1547 3300061734 Ga0530510_0009184 Ga0530510_0009184_3236_3727 163
1548 3300061734 Ga0530510_0062078 Ga0530510_0062078_1396_1944 163
1549 3300061734 Ga0530510_0289552 Ga0530510_0289552_181_729 163

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02357

NusG

Transcription termination factor nusG

27

121

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
8ej3-assembly1.cif.gz_G m. tuberculosis rnap pause escaped complex with bacillus subtilis nusg and gmpcpp 0.8273 4 97
6c6t-assembly1.cif.gz_D cryoem structure of e.coli rna polymerase elongation complex bound with rfah 0.8099 4 93
2oug-assembly4.cif.gz_D crystal structure of the rfah transcription factor at 2.1a resolution 0.7971 4 93
5ond-assembly1.cif.gz_A rfah from escherichia coli in complex with ops dna 0.7917 3 95
8exy-assembly1.cif.gz_G m. tuberculosis rnap paused complex with b. subtilis nusg and gmpcpp 0.782 4 96
ID Description Score Start End Superfamily
af_P9WIU9_43_152_3.30.70.940 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;NusG, N-terminal domain 0.8525 3 93 3.30.70.940
af_O13936_718_779_2.30.30.30 Mainly Beta;Roll;SH3 type barrels.; 0.803 114 163 2.30.30.30
af_I1J750_105_222_3.30.70.940 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;NusG, N-terminal domain 0.8002 4 101 3.30.70.940
2ougC00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;NusG, N-terminal domain 0.7995 4 93 3.30.70.940
af_P0AFG0_1_117_3.30.70.940 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;NusG, N-terminal domain 0.7717 2 101 3.30.70.940
ID Description Score Start End GO Terms
AF-A0A2U3QDJ7-F1-model_v4 Transcription termination factor NusG domain protein 0.9505 2 163 GO:0031564
GO:0140673
AF-A0A2H6FC29-F1-model_v4 Transcriptional activator RfaH 0.9485 2 163 GO:0031564
GO:0140673
AF-A0A6N6S5U6-F1-model_v4 UpxY family transcription antiterminator 0.9394 1 163 GO:0031564
GO:0140673
AF-A0A2U3QDJ7-F1-model_v4 Transcription termination factor NusG domain protein 0.9393 2 163 GO:0031564
GO:0140673
AF-A0A2H6FC29-F1-model_v4 Transcriptional activator RfaH 0.9374 2 163 GO:0031564
GO:0140673

Feature Viewer

pLDDT pTM Quality
88.25 0.8 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map