F494600

General Info

Members Datasets Scaffolds Average Seq Length
1531 407 3062 122

Family's Representative Sequence

Representative Sequence 3300017792|Ga0163161_10155684|Ga0163161_101556841
Length 128
Sequence MWHCFEREHHQNRKALQTSRWEAVMSKAVISLTTGLEDAEKVTVAFLVAVGAAEQGRPTLMFLTKEAVRLATQGIQRFATAGGTYLVCPICFTAKHLAERTLVENASLGGTVPMWQWIGDDPATTFSY

Samples

Sample ID Description Type Environment
1 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
5 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
32 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
33 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
34 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
35 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
36 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
37 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
38 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
39 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
40 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
41 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
42 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
43 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
44 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
45 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
46 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
47 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
48 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
49 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
50 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
51 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
52 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
53 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
54 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
55 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
56 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
57 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
58 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
59 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
60 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
61 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
62 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
63 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
64 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
65 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
66 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
67 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
68 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
69 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
70 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
71 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
72 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
73 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
74 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
75 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
76 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
77 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
78 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
79 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
80 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
81 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
82 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
83 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
84 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
85 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
86 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
87 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
89 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
90 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
91 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
92 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
93 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
94 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
95 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
96 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
97 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
98 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
99 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
100 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
101 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
102 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
103 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
104 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
105 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
106 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
107 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
108 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
109 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
110 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
111 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
112 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
113 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
114 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
115 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
116 3300012477 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.3.yng.040610 Metagenome Rhizosphere
117 3300012481 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.1.yng.040610 Metagenome Rhizosphere
118 3300012505 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 Metagenome Rhizosphere
119 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
120 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
121 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
122 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
123 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
124 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
125 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
126 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
127 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
128 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
129 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
130 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
131 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
132 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
133 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
134 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
135 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
136 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
137 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
138 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
139 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
140 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
205 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
209 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
210 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
211 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
212 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
213 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
214 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
215 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
216 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
217 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
218 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
219 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
220 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
221 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
222 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
223 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
224 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
225 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
226 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
227 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
228 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
229 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
230 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
231 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
232 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
233 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
234 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
235 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
236 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
237 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
238 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
239 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
240 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
241 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
242 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
243 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
244 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
245 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
246 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
247 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
248 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
249 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
250 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
251 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
252 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
253 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
254 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
255 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
256 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
257 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
258 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
259 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
260 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
261 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
262 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
263 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
264 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
265 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
266 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
267 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
268 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
269 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
270 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
271 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
272 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
273 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
274 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
275 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
276 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
277 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
278 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
279 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
280 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
281 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
282 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
283 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
284 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
285 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
286 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
287 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
288 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
289 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
290 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
291 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
292 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
293 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
294 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
295 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
296 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
297 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
298 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
299 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
300 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
301 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
302 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
303 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
304 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
305 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
306 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
307 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
308 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
309 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
310 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
311 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
312 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
313 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
314 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
315 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
316 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
317 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
318 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
319 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
320 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
321 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
322 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
323 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
324 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
325 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
326 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
327 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
328 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
329 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
330 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
331 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
332 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
333 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
334 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
335 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
336 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
337 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
338 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
339 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
340 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
341 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
342 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
343 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
344 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
345 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
346 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
347 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
348 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
349 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
350 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
351 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
352 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
353 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
354 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
355 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
356 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
357 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
358 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
359 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
360 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
361 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
362 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
363 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
364 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
365 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
366 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
367 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
368 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
369 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
370 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
371 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
372 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
373 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
374 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
375 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
376 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
377 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
378 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
379 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
380 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
381 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
382 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
383 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
384 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
385 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
386 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
387 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
388 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
389 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
390 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
391 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
392 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
393 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
394 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
395 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
396 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
397 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
398 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
399 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
400 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
401 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
402 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
403 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
404 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
405 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
406 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
407 2855386786 Nocardioides ferulae EGI 63112 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.09
Metatranscriptomes 0.85
Isolates 0.07

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.44
Nodule 0
Rhizoplane 8.3
Rhizosphere 88.57
Stem 0
Stem Tuber 0
Unclassified 4.57

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0163161_10155684 3300017792 Bacteria 1740
2 LJQas_1011961 3300000549 Bacteria 1029
3 LJQas_1023097 3300000549 Bacteria 723
4 JGI24735J21928_10251130 3300002067 Bacteria 516
5 JGI24738J21930_10064619 3300002075 Bacteria 753
6 Ga0058863_10612682 3300004799 Bacteria 766
7 Ga0058860_11186195 3300004801 Bacteria 680
8 Ga0070658_10023397 3300005327 Bacteria 4960
9 Ga0070658_10037521 3300005327 Bacteria 3907
10 Ga0070658_10121585 3300005327 Bacteria 2169
11 Ga0070658_10528685 3300005327 Bacteria 1020
12 Ga0070676_10060352 3300005328 Bacteria 2252
13 Ga0070676_10593529 3300005328 Bacteria 798
14 Ga0070683_100001699 3300005329 Bacteria 17118
15 Ga0070683_100047697 3300005329 Bacteria 3958
16 Ga0070683_100427781 3300005329 Bacteria 1263
17 Ga0070683_101338792 3300005329 Unclassified 688
18 Ga0070690_100027487 3300005330 Bacteria 3517
19 Ga0070670_100023461 3300005331 Bacteria 5311
20 Ga0070670_101876058 3300005331 Bacteria 552
21 Ga0068869_100392894 3300005334 Bacteria 1139
22 Ga0068869_100510938 3300005334 Bacteria 1004
23 Ga0068869_100695163 3300005334 Bacteria 867
24 Ga0070666_10021818 3300005335 Bacteria 4151
25 Ga0070666_10825669 3300005335 Unclassified 683
26 Ga0070666_11096202 3300005335 Bacteria 592
27 Ga0070680_100014339 3300005336 Bacteria 6190
28 Ga0070680_100076787 3300005336 Bacteria 2750
29 Ga0070680_100991985 3300005336 Unclassified 725
30 Ga0070682_100026024 3300005337 Bacteria 3497
31 Ga0070682_100206474 3300005337 Bacteria 1389
32 Ga0070682_100700046 3300005337 Unclassified 812
33 Ga0070682_101213558 3300005337 Bacteria 637
34 Ga0068868_100029180 3300005338 Bacteria 4224
35 Ga0068868_100057865 3300005338 Bacteria 3063
36 Ga0068868_100065392 3300005338 Bacteria 2889
37 Ga0068868_100123876 3300005338 Bacteria 2110
38 Ga0068868_100389601 3300005338 Bacteria 1200
39 Ga0070660_100068951 3300005339 Bacteria 2757
40 Ga0070660_100204138 3300005339 Bacteria 1604
41 Ga0070689_100063700 3300005340 Bacteria 2869
42 Ga0070689_102096378 3300005340 Bacteria 518
43 Ga0070691_10040534 3300005341 Bacteria 2201
44 Ga0070691_10080353 3300005341 Bacteria 1595
45 Ga0070691_10083867 3300005341 Bacteria 1564
46 Ga0070691_10299174 3300005341 Bacteria 878
47 Ga0070687_100034994 3300005343 Bacteria 2490
48 Ga0070687_100422943 3300005343 Bacteria 879
49 Ga0070687_101391130 3300005343 Unclassified 524
50 Ga0070661_100025495 3300005344 Bacteria 4250
51 Ga0070661_100219953 3300005344 Bacteria 1456
52 Ga0070661_101159897 3300005344 Bacteria 645
53 Ga0070692_10010845 3300005345 Bacteria 4166
54 Ga0070692_10024048 3300005345 Bacteria 2990
55 Ga0070692_10546143 3300005345 Bacteria 758
56 Ga0070668_100072162 3300005347 Bacteria 2690
57 Ga0070668_100161098 3300005347 Bacteria 1821
58 Ga0070668_100248225 3300005347 Bacteria 1476
59 Ga0070669_101949841 3300005353 Bacteria 513
60 Ga0070675_100055064 3300005354 Bacteria 3273
61 Ga0070675_101746010 3300005354 Bacteria 574
62 Ga0070671_100014133 3300005355 Bacteria 6446
63 Ga0070671_100025639 3300005355 Bacteria 4839
64 Ga0070671_100132376 3300005355 Unclassified 2101
65 Ga0070671_101052211 3300005355 Unclassified 714
66 Ga0070674_100548365 3300005356 Bacteria 970
67 Ga0070673_100688571 3300005364 Bacteria 938
68 Ga0070673_100945666 3300005364 Bacteria 800
69 Ga0070673_101474045 3300005364 Bacteria 641
70 Ga0070659_100044719 3300005366 Bacteria 3468
71 Ga0070659_100373154 3300005366 Bacteria 1200
72 Ga0070659_100377429 3300005366 Bacteria 1194
73 Ga0070667_100009304 3300005367 Bacteria 8144
74 Ga0070667_100130116 3300005367 Bacteria 2196
75 Ga0070667_100387130 3300005367 Bacteria 1271
76 Ga0070667_101232172 3300005367 Unclassified 700
77 Ga0070667_101485304 3300005367 Unclassified 636
78 Ga0070667_101749621 3300005367 Bacteria 585
79 Ga0070703_10010592 3300005406 Bacteria 2600
80 Ga0070709_10006365 3300005434 Bacteria 6430
81 Ga0070709_10082800 3300005434 Bacteria 2097
82 Ga0070709_10160532 3300005434 Bacteria 1562
83 Ga0070709_10558753 3300005434 Bacteria 876
84 Ga0070709_10710757 3300005434 Bacteria 782
85 Ga0070714_100014992 3300005435 Bacteria 6230
86 Ga0070714_100018039 3300005435 Bacteria 5725
87 Ga0070714_100021082 3300005435 Bacteria 5328
88 Ga0070714_100104434 3300005435 Bacteria 2500
89 Ga0070714_100155256 3300005435 Bacteria 2065
90 Ga0070714_100169380 3300005435 Bacteria 1981
91 Ga0070714_101035457 3300005435 Bacteria 799
92 Ga0070714_101097391 3300005435 Bacteria 775
93 Ga0070714_101195841 3300005435 Bacteria 741
94 Ga0070714_101239510 3300005435 Bacteria 728
95 Ga0070714_101382371 3300005435 Unclassified 687
96 Ga0070714_101399915 3300005435 Unclassified 683
97 Ga0070714_102373108 3300005435 Bacteria 515
98 Ga0070713_100021596 3300005436 Bacteria 4955
99 Ga0070713_100053924 3300005436 Bacteria 3333
100 Ga0070713_100147268 3300005436 Bacteria 2091
101 Ga0070713_100164782 3300005436 Bacteria 1981
102 Ga0070713_100233325 3300005436 Bacteria 1673
103 Ga0070713_100355728 3300005436 Bacteria 1359
104 Ga0070713_100385556 3300005436 Bacteria 1306
105 Ga0070713_101050503 3300005436 Unclassified 786
106 Ga0070713_101100519 3300005436 Bacteria 768
107 Ga0070713_101345798 3300005436 Bacteria 692
108 Ga0070713_101550399 3300005436 Bacteria 643
109 Ga0070713_102130804 3300005436 Bacteria 543
110 Ga0070710_10013207 3300005437 Bacteria 4128
111 Ga0070710_10034114 3300005437 Bacteria 2767
112 Ga0070710_10043312 3300005437 Bacteria 2492
113 Ga0070710_10047882 3300005437 Bacteria 2386
114 Ga0070710_10783120 3300005437 Bacteria 680
115 Ga0070710_11437229 3300005437 Bacteria 516
116 Ga0070701_10143340 3300005438 Bacteria 1369
117 Ga0070711_100003686 3300005439 Bacteria 8968
118 Ga0070711_100020537 3300005439 Bacteria 4258
119 Ga0070711_100099044 3300005439 Bacteria 2117
120 Ga0070711_100704354 3300005439 Bacteria 850
121 Ga0070711_100949517 3300005439 Bacteria 736
122 Ga0070711_100971678 3300005439 Bacteria 728
123 Ga0070705_100229804 3300005440 Bacteria 1290
124 Ga0070700_100158026 3300005441 Bacteria 1557
125 Ga0070700_102022028 3300005441 Bacteria 500
126 Ga0070708_100029283 3300005445 Bacteria 4747
127 Ga0070708_100151681 3300005445 Bacteria 2155
128 Ga0070708_100458527 3300005445 Bacteria 1202
129 Ga0070708_100473609 3300005445 Bacteria 1181
130 Ga0070708_100582522 3300005445 Bacteria 1055
131 Ga0070708_100863972 3300005445 Bacteria 850
132 Ga0070708_100877258 3300005445 Unclassified 843
133 Ga0070663_100016089 3300005455 Bacteria 4845
134 Ga0070663_101278054 3300005455 Bacteria 647
135 Ga0070663_101722833 3300005455 Bacteria 561
136 Ga0070678_100003251 3300005456 Bacteria 9027
137 Ga0070678_100029449 3300005456 Bacteria 3759
138 Ga0070678_100058715 3300005456 Bacteria 2825
139 Ga0070678_100120237 3300005456 Bacteria 2070
140 Ga0070678_101278727 3300005456 Bacteria 682
141 Ga0070662_100453507 3300005457 Bacteria 1065
142 Ga0070662_100581614 3300005457 Bacteria 941
143 Ga0070662_101435214 3300005457 Bacteria 595
144 Ga0070681_10051750 3300005458 Bacteria 4096
145 Ga0070681_10051977 3300005458 Bacteria 4086
146 Ga0070681_10068358 3300005458 Bacteria 3519
147 Ga0070681_10239215 3300005458 Bacteria 1729
148 Ga0070685_10103221 3300005466 Bacteria 1744
149 Ga0070685_10171648 3300005466 Bacteria 1390
150 Ga0070685_10386349 3300005466 Bacteria 966
151 Ga0070706_100009432 3300005467 Bacteria 9083
152 Ga0070706_100035692 3300005467 Bacteria 4590
153 Ga0070706_100041553 3300005467 Bacteria 4244
154 Ga0070706_100050552 3300005467 Unclassified 3835
155 Ga0070706_100141316 3300005467 Bacteria 2247
156 Ga0070706_101258310 3300005467 Bacteria 679
157 Ga0070707_100003621 3300005468 Bacteria 14571
158 Ga0070707_100007443 3300005468 Bacteria 10169
159 Ga0070707_100015400 3300005468 Bacteria 7175
160 Ga0070707_100018081 3300005468 Bacteria 6631
161 Ga0070707_100025227 3300005468 Bacteria 5638
162 Ga0070707_100032684 3300005468 Bacteria 4957
163 Ga0070707_100375396 3300005468 Bacteria 1381
164 Ga0070707_100408752 3300005468 Bacteria 1318
165 Ga0070707_100954413 3300005468 Bacteria 822
166 Ga0070698_100000262 3300005471 Bacteria 53087
167 Ga0070698_100024451 3300005471 Bacteria 6303
168 Ga0070698_100053117 3300005471 Unclassified 4118
169 Ga0070698_100189414 3300005471 Bacteria 1995
170 Ga0070698_100508614 3300005471 Bacteria 1143
171 Ga0070698_100819929 3300005471 Bacteria 875
172 Ga0070699_100006212 3300005518 Bacteria 10428
173 Ga0070699_100325971 3300005518 Bacteria 1381
174 Ga0070699_100399782 3300005518 Bacteria 1242
175 Ga0070699_101110480 3300005518 Bacteria 725
176 Ga0070679_100029664 3300005530 Bacteria 5396
177 Ga0070679_100126085 3300005530 Bacteria 2542
178 Ga0070679_100162246 3300005530 Bacteria 2209
179 Ga0070679_100474944 3300005530 Bacteria 1195
180 Ga0070679_100553417 3300005530 Bacteria 1094
181 Ga0070684_100010847 3300005535 Bacteria 7239
182 Ga0070684_100067546 3300005535 Bacteria 3141
183 Ga0070684_100089352 3300005535 Bacteria 2738
184 Ga0070684_100161050 3300005535 Bacteria 2036
185 Ga0070684_100275777 3300005535 Bacteria 1540
186 Ga0070684_100286539 3300005535 Bacteria 1510
187 Ga0070684_100341981 3300005535 Bacteria 1375
188 Ga0070684_100633115 3300005535 Bacteria 995
189 Ga0070697_100048257 3300005536 Bacteria 3452
190 Ga0070697_100081954 3300005536 Bacteria 2659
191 Ga0070697_100088613 3300005536 Bacteria 2556
192 Ga0068853_100052879 3300005539 Bacteria 3497
193 Ga0068853_100096222 3300005539 Bacteria 2612
194 Ga0068853_100250633 3300005539 Bacteria 1624
195 Ga0068853_100598158 3300005539 Bacteria 1047
196 Ga0070672_100100915 3300005543 Bacteria 2341
197 Ga0070672_100127991 3300005543 Bacteria 2085
198 Ga0070686_100030199 3300005544 Bacteria 3304
199 Ga0070686_100225219 3300005544 Bacteria 1357
200 Ga0070686_101883889 3300005544 Bacteria 510
201 Ga0070695_100039229 3300005545 Bacteria 2992
202 Ga0070695_100769828 3300005545 Bacteria 769
203 Ga0070696_100008840 3300005546 Bacteria 6736
204 Ga0070696_100086709 3300005546 Bacteria 2223
205 Ga0070696_100232544 3300005546 Bacteria 1387
206 Ga0070693_100016669 3300005547 Bacteria 3806
207 Ga0070693_100085929 3300005547 Bacteria 1886
208 Ga0070693_100105242 3300005547 Bacteria 1726
209 Ga0070693_100415535 3300005547 Bacteria 936
210 Ga0070665_100233385 3300005548 Bacteria 1840
211 Ga0070665_100411187 3300005548 Bacteria 1361
212 Ga0070665_100535380 3300005548 Bacteria 1183
213 Ga0070665_101057528 3300005548 Bacteria 823
214 Ga0070704_100102286 3300005549 Bacteria 2162
215 Ga0070704_102157184 3300005549 Bacteria 518
216 Ga0068855_100172514 3300005563 Bacteria 2449
217 Ga0068855_100205543 3300005563 Bacteria 2215
218 Ga0068855_100477447 3300005563 Bacteria 1357
219 Ga0070664_100110586 3300005564 Bacteria 2398
220 Ga0070664_100471042 3300005564 Bacteria 1155
221 Ga0070664_101455283 3300005564 Bacteria 648
222 Ga0068857_100019129 3300005577 Bacteria 6011
223 Ga0068857_100022281 3300005577 Bacteria 5572
224 Ga0068857_100194944 3300005577 Bacteria 1846
225 Ga0068857_100230967 3300005577 Bacteria 1692
226 Ga0068857_100584706 3300005577 Bacteria 1054
227 Ga0068857_100687925 3300005577 Bacteria 971
228 Ga0068857_100871910 3300005577 Unclassified 862
229 Ga0068857_101792343 3300005577 Bacteria 601
230 Ga0068857_102029479 3300005577 Bacteria 564
231 Ga0068854_100033477 3300005578 Bacteria 3583
232 Ga0068854_100078421 3300005578 Bacteria 2433
233 Ga0068854_101157063 3300005578 Bacteria 691
234 Ga0068856_100067952 3300005614 Bacteria 3522
235 Ga0068856_100111697 3300005614 Bacteria 2730
236 Ga0068856_100148722 3300005614 Bacteria 2350
237 Ga0068856_100154766 3300005614 Bacteria 2302
238 Ga0068856_101586865 3300005614 Unclassified 668
239 Ga0070702_100020073 3300005615 Bacteria 3495
240 Ga0070702_100039107 3300005615 Bacteria 2645
241 Ga0070702_100258063 3300005615 Unclassified 1185
242 Ga0070702_101148672 3300005615 Bacteria 623
243 Ga0068852_100081963 3300005616 Bacteria 2865
244 Ga0068852_100082781 3300005616 Bacteria 2852
245 Ga0068852_100264409 3300005616 Bacteria 1653
246 Ga0068859_100089435 3300005617 Bacteria 3129
247 Ga0068859_100126800 3300005617 Bacteria 2622
248 Ga0068864_100025629 3300005618 Bacteria 4968
249 Ga0068864_100092462 3300005618 Bacteria 2670
250 Ga0068864_100204212 3300005618 Bacteria 1817
251 Ga0068864_100267272 3300005618 Bacteria 1593
252 Ga0068864_100342424 3300005618 Bacteria 1409
253 Ga0068866_10206312 3300005718 Unclassified 1177
254 Ga0068866_10932820 3300005718 Unclassified 613
255 Ga0068861_100646322 3300005719 Bacteria 977
256 Ga0068851_10562354 3300005834 Bacteria 690
257 Ga0068851_10595832 3300005834 Bacteria 672
258 Ga0068851_10644273 3300005834 Bacteria 648
259 Ga0068851_10998933 3300005834 Bacteria 528
260 Ga0068870_10003463 3300005840 Bacteria 6687
261 Ga0068870_10005323 3300005840 Bacteria 5611
262 Ga0068870_10720294 3300005840 Bacteria 690
263 Ga0068863_100022113 3300005841 Bacteria 6071
264 Ga0068863_100028645 3300005841 Bacteria 5317
265 Ga0068863_100063677 3300005841 Bacteria 3488
266 Ga0068863_100071316 3300005841 Bacteria 3286
267 Ga0068863_100168023 3300005841 Bacteria 2104
268 Ga0068863_100437274 3300005841 Bacteria 1283
269 Ga0068863_100617686 3300005841 Bacteria 1074
270 Ga0068863_102152782 3300005841 Bacteria 568
271 Ga0068858_100107944 3300005842 Bacteria 2599
272 Ga0068858_100300408 3300005842 Bacteria 1532
273 Ga0068858_100562251 3300005842 Bacteria 1105
274 Ga0068858_100577306 3300005842 Bacteria 1089
275 Ga0068858_101399681 3300005842 Bacteria 689
276 Ga0068860_100001468 3300005843 Bacteria 25481
277 Ga0068860_100185759 3300005843 Bacteria 2010
278 Ga0068860_101207576 3300005843 Unclassified 776
279 Ga0068862_100971209 3300005844 Bacteria 839
280 Ga0068862_101668719 3300005844 Bacteria 645
281 Ga0081538_10130157 3300005981 Bacteria 1185
282 Ga0070717_10016568 3300006028 Bacteria 5716
283 Ga0070717_10025821 3300006028 Bacteria 4679
284 Ga0070717_10038313 3300006028 Bacteria 3897
285 Ga0070717_10061149 3300006028 Bacteria 3120
286 Ga0070717_10098289 3300006028 Bacteria 2481
287 Ga0070717_10128119 3300006028 Bacteria 2180
288 Ga0070717_10158654 3300006028 Bacteria 1961
289 Ga0070717_10166346 3300006028 Bacteria 1916
290 Ga0070717_10184794 3300006028 Bacteria 1818
291 Ga0070717_10293858 3300006028 Bacteria 1443
292 Ga0070717_10311782 3300006028 Bacteria 1400
293 Ga0070717_10451570 3300006028 Bacteria 1158
294 Ga0070717_10556589 3300006028 Bacteria 1039
295 Ga0070717_10557911 3300006028 Bacteria 1037
296 Ga0070717_10567354 3300006028 Bacteria 1028
297 Ga0070717_10581320 3300006028 Bacteria 1016
298 Ga0070717_11817588 3300006028 Bacteria 551
299 Ga0075363_100028144 3300006048 Unclassified 2888
300 Ga0075363_100108468 3300006048 Unclassified 1541
301 Ga0075363_100427993 3300006048 Bacteria 780
302 Ga0075364_10029866 3300006051 Bacteria 3497
303 Ga0075364_10455844 3300006051 Bacteria 874
304 Ga0075364_11037452 3300006051 Bacteria 557
305 Ga0075432_10047480 3300006058 Bacteria 1509
306 Ga0070715_10033349 3300006163 Bacteria 2104
307 Ga0070715_10041650 3300006163 Bacteria 1926
308 Ga0070715_10398135 3300006163 Bacteria 765
309 Ga0070716_100003620 3300006173 Bacteria 7302
310 Ga0070716_100007387 3300006173 Bacteria 5406
311 Ga0070716_100054172 3300006173 Bacteria 2290
312 Ga0070716_100181400 3300006173 Bacteria 1382
313 Ga0070716_100397085 3300006173 Bacteria 990
314 Ga0070712_100009737 3300006175 Bacteria 6058
315 Ga0070712_100200191 3300006175 Bacteria 1568
316 Ga0070712_100266989 3300006175 Bacteria 1373
317 Ga0070712_100350238 3300006175 Bacteria 1208
318 Ga0070712_100365167 3300006175 Bacteria 1185
319 Ga0070712_100459541 3300006175 Bacteria 1061
320 Ga0070712_100690582 3300006175 Bacteria 869
321 Ga0070712_101372186 3300006175 Bacteria 616
322 Ga0075367_10048648 3300006178 Bacteria 2498
323 Ga0075367_10082423 3300006178 Bacteria 1947
324 Ga0075367_10292508 3300006178 Bacteria 1025
325 Ga0097621_100240462 3300006237 Bacteria 1582
326 Ga0097621_100603165 3300006237 Bacteria 1004
327 Ga0097621_102164511 3300006237 Bacteria 532
328 Ga0075370_10086526 3300006353 Unclassified 1805
329 Ga0075370_10161801 3300006353 Bacteria 1314
330 Ga0075370_10867557 3300006353 Bacteria 551
331 Ga0068871_100053754 3300006358 Bacteria 3265
332 Ga0068871_100113760 3300006358 Bacteria 2279
333 Ga0068871_100575869 3300006358 Bacteria 1022
334 Ga0068871_100947099 3300006358 Bacteria 800
335 Ga0075428_100310957 3300006844 Unclassified 1694
336 Ga0075428_100494663 3300006844 Bacteria 1308
337 Ga0075428_100986690 3300006844 Bacteria 892
338 Ga0075428_102178692 3300006844 Bacteria 572
339 Ga0075431_100492855 3300006847 Bacteria 1217
340 Ga0075431_101781862 3300006847 Bacteria 572
341 Ga0075431_102166248 3300006847 Bacteria 510
342 Ga0075434_100118657 3300006871 Bacteria 2659
343 Ga0075434_100741802 3300006871 Bacteria 999
344 Ga0075434_101115835 3300006871 Bacteria 802
345 Ga0075429_100643607 3300006880 Bacteria 929
346 Ga0075429_100938535 3300006880 Bacteria 757
347 Ga0068865_100216770 3300006881 Bacteria 1494
348 Ga0075436_100001878 3300006914 Bacteria 14437
349 Ga0075436_100131148 3300006914 Bacteria 1758
350 Ga0075436_100474941 3300006914 Bacteria 913
351 Ga0075436_100688778 3300006914 Bacteria 757
352 Ga0097620_100089437 3300006931 Bacteria 3129
353 Ga0097620_100126798 3300006931 Bacteria 2622
354 Ga0075435_100002133 3300007076 Bacteria 13029
355 Ga0075435_101020311 3300007076 Bacteria 722
356 Ga0075435_101625626 3300007076 Bacteria 567
357 Ga0099795_10525849 3300007788 Bacteria 554
358 Ga0105251_10022638 3300009011 Bacteria 3257
359 Ga0105251_10110317 3300009011 Bacteria 1254
360 Ga0105250_10055736 3300009092 Bacteria 1586
361 Ga0105250_10217289 3300009092 Bacteria 810
362 Ga0105240_10774981 3300009093 Bacteria 1041
363 Ga0105240_11158502 3300009093 Bacteria 820
364 Ga0111539_10409735 3300009094 Bacteria 1579
365 Ga0111539_10420477 3300009094 Bacteria 1557
366 Ga0111539_10541486 3300009094 Bacteria 1356
367 Ga0111539_10606475 3300009094 Bacteria 1275
368 Ga0111539_12315768 3300009094 Bacteria 623
369 Ga0111539_12754439 3300009094 Bacteria 570
370 Ga0111539_13150617 3300009094 Bacteria 532
371 Ga0105245_10021795 3300009098 Bacteria 5623
372 Ga0105245_10102903 3300009098 Bacteria 2645
373 Ga0105245_10103666 3300009098 Bacteria 2636
374 Ga0105245_10370565 3300009098 Bacteria 1424
375 Ga0105245_10605173 3300009098 Bacteria 1123
376 Ga0105245_10876152 3300009098 Unclassified 939
377 Ga0105245_11093216 3300009098 Bacteria 843
378 Ga0105245_11643832 3300009098 Bacteria 694
379 Ga0105247_10041719 3300009101 Bacteria 2808
380 Ga0105247_10197533 3300009101 Bacteria 1350
381 Ga0105247_10210203 3300009101 Bacteria 1312
382 Ga0105247_10236431 3300009101 Unclassified 1243
383 Ga0105247_10355641 3300009101 Bacteria 1031
384 Ga0105247_11250042 3300009101 Bacteria 594
385 Ga0114129_11083433 3300009147 Bacteria 1004
386 Ga0105243_10053779 3300009148 Bacteria 3195
387 Ga0105243_10144776 3300009148 Unclassified 2032
388 Ga0105241_10004425 3300009174 Bacteria 10390
389 Ga0105241_11537861 3300009174 Bacteria 642
390 Ga0105242_10055810 3300009176 Bacteria 3232
391 Ga0105242_11050691 3300009176 Unclassified 825
392 Ga0105248_10037443 3300009177 Bacteria 5427
393 Ga0105248_10117068 3300009177 Bacteria 3005
394 Ga0105248_10295438 3300009177 Unclassified 1824
395 Ga0105248_10425492 3300009177 Bacteria 1495
396 Ga0105248_10453208 3300009177 Bacteria 1445
397 Ga0105248_10494595 3300009177 Bacteria 1379
398 Ga0105237_10089102 3300009545 Bacteria 3075
399 Ga0105237_10099944 3300009545 Bacteria 2892
400 Ga0105237_10555669 3300009545 Bacteria 1154
401 Ga0105237_10772052 3300009545 Bacteria 968
402 Ga0105237_10999299 3300009545 Bacteria 843
403 Ga0105238_10092785 3300009551 Bacteria 3007
404 Ga0105238_10195691 3300009551 Bacteria 1997
405 Ga0105238_10212597 3300009551 Bacteria 1910
406 Ga0105238_11401670 3300009551 Bacteria 726
407 Ga0105238_11754631 3300009551 Bacteria 652
408 Ga0105249_10174447 3300009553 Bacteria 2087
409 Ga0105249_10446733 3300009553 Bacteria 1331
410 Ga0099796_10142736 3300010159 Unclassified 937
411 Ga0099796_10436141 3300010159 Bacteria 580
412 Ga0105239_10015531 3300010375 Bacteria 8433
413 Ga0105239_10412884 3300010375 Bacteria 1529
414 Ga0105239_10462196 3300010375 Bacteria 1440
415 Ga0105239_10953153 3300010375 Bacteria 986
416 Ga0105239_11135665 3300010375 Bacteria 900
417 Ga0105246_10000911 3300011119 Bacteria 16930
418 Ga0105246_10002762 3300011119 Bacteria 10621
419 Ga0105246_10334884 3300011119 Bacteria 1235
420 Ga0105246_10511030 3300011119 Bacteria 1022
421 Ga0105246_11158464 3300011119 Unclassified 709
422 Ga0157336_1035932 3300012477 Unclassified 515
423 Ga0157320_1021744 3300012481 Bacteria 590
424 Ga0157339_1032692 3300012505 Bacteria 617
425 Ga0157373_10016278 3300013100 Bacteria 5426
426 Ga0157371_10022649 3300013102 Bacteria 4597
427 Ga0157371_10179736 3300013102 Bacteria 1513
428 Ga0157371_10515940 3300013102 Bacteria 884
429 Ga0157370_10030999 3300013104 Bacteria 5235
430 Ga0157370_10116677 3300013104 Bacteria 2494
431 Ga0157370_10869847 3300013104 Bacteria 819
432 Ga0157370_11055178 3300013104 Bacteria 735
433 Ga0157370_11858056 3300013104 Bacteria 540
434 Ga0157369_10144321 3300013105 Bacteria 2517
435 Ga0157369_10232574 3300013105 Bacteria 1927
436 Ga0157369_11400628 3300013105 Bacteria 712
437 Ga0157374_10114888 3300013296 Bacteria 2592
438 Ga0157374_10330021 3300013296 Bacteria 1513
439 Ga0157374_10353147 3300013296 Bacteria 1461
440 Ga0157374_10666033 3300013296 Unclassified 1053
441 Ga0157374_10786400 3300013296 Bacteria 967
442 Ga0157374_11470969 3300013296 Bacteria 704
443 Ga0157374_11806333 3300013296 Bacteria 637
444 Ga0157378_10061143 3300013297 Bacteria 3360
445 Ga0163162_10013188 3300013306 Bacteria 8071
446 Ga0163162_10091111 3300013306 Bacteria 3131
447 Ga0163162_10281421 3300013306 Bacteria 1795
448 Ga0163162_10406105 3300013306 Bacteria 1495
449 Ga0163162_12989434 3300013306 Bacteria 543
450 Ga0157372_10015898 3300013307 Bacteria 8074
451 Ga0157372_10378416 3300013307 Bacteria 1650
452 Ga0157372_10509917 3300013307 Bacteria 1402
453 Ga0157372_10575568 3300013307 Bacteria 1313
454 Ga0157372_10966833 3300013307 Bacteria 987
455 Ga0157372_11285556 3300013307 Bacteria 844
456 Ga0157372_11975650 3300013307 Bacteria 670
457 Ga0157375_10105486 3300013308 Bacteria 2908
458 Ga0157375_10130023 3300013308 Bacteria 2636
459 Ga0157375_10399179 3300013308 Bacteria 1542
460 Ga0157375_10501827 3300013308 Bacteria 1377
461 Ga0157375_12229913 3300013308 Bacteria 653
462 Ga0157375_12945296 3300013308 Bacteria 569
463 Ga0163163_10006286 3300014325 Bacteria 10370
464 Ga0163163_10018303 3300014325 Bacteria 6553
465 Ga0163163_10066480 3300014325 Bacteria 3580
466 Ga0163163_10105620 3300014325 Bacteria 2842
467 Ga0163163_10307075 3300014325 Bacteria 1639
468 Ga0163163_10512402 3300014325 Bacteria 1262
469 Ga0163163_10822136 3300014325 Bacteria 992
470 Ga0163163_10838706 3300014325 Bacteria 983
471 Ga0157380_10062530 3300014326 Bacteria 2982
472 Ga0157380_12813348 3300014326 Bacteria 553
473 Ga0182008_10404538 3300014497 Bacteria 734
474 Ga0157377_10022293 3300014745 Bacteria 3341
475 Ga0157377_10034766 3300014745 Bacteria 2759
476 Ga0157377_10924745 3300014745 Bacteria 654
477 Ga0157379_10029876 3300014968 Bacteria 4847
478 Ga0157379_10045799 3300014968 Bacteria 3904
479 Ga0157379_10906899 3300014968 Bacteria 836
480 Ga0157379_12632932 3300014968 Bacteria 504
481 Ga0157376_10195773 3300014969 Bacteria 1856
482 Ga0157376_10298688 3300014969 Bacteria 1523
483 Ga0157376_10953560 3300014969 Bacteria 878
484 Ga0157376_11019454 3300014969 Unclassified 851
485 Ga0157376_11293753 3300014969 Bacteria 759
486 Ga0163161_10274120 3300017792 Unclassified 1321
487 Ga0163161_10519693 3300017792 Bacteria 972
488 Ga0163161_11860860 3300017792 Bacteria 536
489 Ga0206356_10176058 3300020070 Bacteria 1972
490 Ga0206356_10740431 3300020070 Bacteria 1192
491 Ga0206350_10816149 3300020080 Bacteria 941
492 Ga0206354_10405810 3300020081 Bacteria 2572
493 Ga0206354_10777851 3300020081 Bacteria 3442
494 Ga0206354_11274633 3300020081 Bacteria 1571
495 Ga0206353_10425410 3300020082 Bacteria 4949
496 Ga0206353_10452870 3300020082 Bacteria 2512
497 Ga0206353_10710564 3300020082 Bacteria 1803
498 Ga0206353_10787633 3300020082 Bacteria 528
499 Ga0206353_11644540 3300020082 Bacteria 1132
500 Ga0213875_10065940 3300021388 Bacteria 1692
501 Ga0224572_1088459 3300024225 Bacteria 571
502 Ga0207656_10272398 3300025321 Bacteria 833
503 Ga0207656_10399755 3300025321 Bacteria 690
504 Ga0207713_1122559 3300025735 Bacteria 870
505 Ga0207653_10007655 3300025885 Bacteria 3369
506 Ga0207682_10162617 3300025893 Bacteria 1012
507 Ga0207692_10006312 3300025898 Bacteria 4803
508 Ga0207692_10007738 3300025898 Bacteria 4415
509 Ga0207692_10019386 3300025898 Bacteria 3073
510 Ga0207692_10033931 3300025898 Bacteria 2467
511 Ga0207692_10045357 3300025898 Bacteria 2198
512 Ga0207692_11024196 3300025898 Bacteria 545
513 Ga0207710_10051115 3300025900 Bacteria 1856
514 Ga0207710_10088489 3300025900 Bacteria 1446
515 Ga0207710_10161269 3300025900 Bacteria 1092
516 Ga0207710_10355049 3300025900 Unclassified 747
517 Ga0207688_10010832 3300025901 Bacteria 4960
518 Ga0207688_10022892 3300025901 Bacteria 3420
519 Ga0207680_10203512 3300025903 Bacteria 1350
520 Ga0207647_10105804 3300025904 Bacteria 1666
521 Ga0207647_10144274 3300025904 Bacteria 1394
522 Ga0207647_10289066 3300025904 Bacteria 935
523 Ga0207647_10409557 3300025904 Bacteria 763
524 Ga0207685_10047409 3300025905 Bacteria 1640
525 Ga0207685_10252940 3300025905 Unclassified 853
526 Ga0207685_10780676 3300025905 Bacteria 525
527 Ga0207685_10785239 3300025905 Unclassified 524
528 Ga0207699_10002728 3300025906 Bacteria 8353
529 Ga0207699_10003786 3300025906 Bacteria 7220
530 Ga0207699_10013262 3300025906 Bacteria 4214
531 Ga0207699_10048280 3300025906 Bacteria 2500
532 Ga0207699_10048764 3300025906 Bacteria 2489
533 Ga0207699_10050166 3300025906 Bacteria 2459
534 Ga0207699_10069771 3300025906 Bacteria 2144
535 Ga0207699_10275547 3300025906 Bacteria 1167
536 Ga0207699_10850360 3300025906 Bacteria 672
537 Ga0207645_10060893 3300025907 Bacteria 2411
538 Ga0207643_10000496 3300025908 Bacteria 25178
539 Ga0207643_10020391 3300025908 Bacteria 3638
540 Ga0207705_10010928 3300025909 Bacteria 6591
541 Ga0207705_10090058 3300025909 Bacteria 2245
542 Ga0207705_11539525 3300025909 Bacteria 503
543 Ga0207684_10001614 3300025910 Bacteria 23943
544 Ga0207684_10035004 3300025910 Bacteria 4265
545 Ga0207684_10125552 3300025910 Bacteria 2202
546 Ga0207684_10363047 3300025910 Unclassified 1246
547 Ga0207684_10523733 3300025910 Bacteria 1015
548 Ga0207684_11067101 3300025910 Unclassified 673
549 Ga0207654_10034578 3300025911 Bacteria 2809
550 Ga0207707_10162644 3300025912 Bacteria 1951
551 Ga0207707_10362759 3300025912 Bacteria 1247
552 Ga0207707_10878196 3300025912 Bacteria 742
553 Ga0207695_10193541 3300025913 Bacteria 1950
554 Ga0207695_10568317 3300025913 Bacteria 1015
555 Ga0207695_10901219 3300025913 Bacteria 764
556 Ga0207671_10031423 3300025914 Bacteria 3957
557 Ga0207671_10034855 3300025914 Bacteria 3739
558 Ga0207671_10040115 3300025914 Bacteria 3466
559 Ga0207671_11342194 3300025914 Bacteria 556
560 Ga0207671_11491873 3300025914 Unclassified 522
561 Ga0207693_10009761 3300025915 Bacteria 7815
562 Ga0207693_10015285 3300025915 Bacteria 6160
563 Ga0207693_10016363 3300025915 Bacteria 5928
564 Ga0207693_10056142 3300025915 Bacteria 3088
565 Ga0207693_10281884 3300025915 Bacteria 1302
566 Ga0207693_10765227 3300025915 Bacteria 746
567 Ga0207693_10943401 3300025915 Bacteria 661
568 Ga0207663_10014592 3300025916 Bacteria 4307
569 Ga0207663_10023610 3300025916 Bacteria 3531
570 Ga0207663_10030578 3300025916 Bacteria 3177
571 Ga0207663_10038132 3300025916 Bacteria 2902
572 Ga0207663_10081774 3300025916 Bacteria 2117
573 Ga0207663_10157445 3300025916 Bacteria 1599
574 Ga0207663_10299864 3300025916 Bacteria 1200
575 Ga0207663_10679136 3300025916 Bacteria 814
576 Ga0207660_10057642 3300025917 Bacteria 2782
577 Ga0207660_10750913 3300025917 Bacteria 796
578 Ga0207662_10036568 3300025918 Bacteria 2870
579 Ga0207662_10069250 3300025918 Bacteria 2132
580 Ga0207657_10001570 3300025919 Bacteria 24516
581 Ga0207657_10003201 3300025919 Bacteria 17523
582 Ga0207649_10051809 3300025920 Bacteria 2543
583 Ga0207649_10219069 3300025920 Bacteria 1354
584 Ga0207652_10102775 3300025921 Bacteria 2526
585 Ga0207652_10351536 3300025921 Bacteria 1330
586 Ga0207652_10529532 3300025921 Bacteria 1060
587 Ga0207652_10548320 3300025921 Bacteria 1039
588 Ga0207652_11200975 3300025921 Bacteria 660
589 Ga0207646_10000730 3300025922 Bacteria 42664
590 Ga0207646_10004440 3300025922 Bacteria 15223
591 Ga0207646_10025590 3300025922 Bacteria 5398
592 Ga0207646_10030829 3300025922 Bacteria 4858
593 Ga0207646_10034104 3300025922 Bacteria 4600
594 Ga0207646_10536770 3300025922 Bacteria 1052
595 Ga0207646_10891710 3300025922 Bacteria 789
596 Ga0207646_10905292 3300025922 Bacteria 782
597 Ga0207646_11323635 3300025922 Bacteria 628
598 Ga0207681_10325822 3300025923 Bacteria 1223
599 Ga0207694_10091265 3300025924 Bacteria 2404
600 Ga0207694_10114650 3300025924 Bacteria 2146
601 Ga0207650_10047958 3300025925 Bacteria 3149
602 Ga0207650_11914005 3300025925 Bacteria 501
603 Ga0207659_10042494 3300025926 Bacteria 3188
604 Ga0207659_11026881 3300025926 Bacteria 709
605 Ga0207687_10028626 3300025927 Bacteria 3743
606 Ga0207687_10029737 3300025927 Bacteria 3677
607 Ga0207687_10136910 3300025927 Bacteria 1853
608 Ga0207687_10699495 3300025927 Bacteria 860
609 Ga0207687_10740131 3300025927 Bacteria 836
610 Ga0207687_10793132 3300025927 Unclassified 808
611 Ga0207700_10005381 3300025928 Bacteria 7647
612 Ga0207700_10015658 3300025928 Bacteria 5011
613 Ga0207700_10019874 3300025928 Bacteria 4546
614 Ga0207700_10049185 3300025928 Bacteria 3135
615 Ga0207700_10085867 3300025928 Bacteria 2471
616 Ga0207700_10104226 3300025928 Bacteria 2269
617 Ga0207700_10169506 3300025928 Bacteria 1820
618 Ga0207700_10250792 3300025928 Bacteria 1512
619 Ga0207700_10392918 3300025928 Bacteria 1214
620 Ga0207700_10393011 3300025928 Bacteria 1214
621 Ga0207700_10393533 3300025928 Bacteria 1213
622 Ga0207700_10397068 3300025928 Bacteria 1208
623 Ga0207700_10853689 3300025928 Bacteria 815
624 Ga0207700_10962249 3300025928 Bacteria 764
625 Ga0207700_11052637 3300025928 Bacteria 728
626 Ga0207700_11268885 3300025928 Bacteria 657
627 Ga0207664_10003798 3300025929 Bacteria 10139
628 Ga0207664_10006386 3300025929 Bacteria 8107
629 Ga0207664_10019371 3300025929 Bacteria 5028
630 Ga0207664_10020570 3300025929 Bacteria 4894
631 Ga0207664_10026600 3300025929 Bacteria 4375
632 Ga0207664_10028683 3300025929 Bacteria 4232
633 Ga0207664_10036385 3300025929 Bacteria 3805
634 Ga0207664_10038300 3300025929 Bacteria 3717
635 Ga0207664_10049665 3300025929 Bacteria 3304
636 Ga0207664_10122625 3300025929 Bacteria 2177
637 Ga0207664_10143552 3300025929 Bacteria 2022
638 Ga0207664_10204908 3300025929 Bacteria 1704
639 Ga0207664_10436927 3300025929 Bacteria 1167
640 Ga0207664_10448756 3300025929 Bacteria 1151
641 Ga0207664_10453379 3300025929 Bacteria 1145
642 Ga0207664_10503611 3300025929 Bacteria 1084
643 Ga0207664_10592752 3300025929 Bacteria 995
644 Ga0207664_11064488 3300025929 Bacteria 724
645 Ga0207664_11284839 3300025929 Unclassified 651
646 Ga0207664_11601984 3300025929 Bacteria 573
647 Ga0207644_10006975 3300025931 Bacteria 7357
648 Ga0207644_10146563 3300025931 Unclassified 1823
649 Ga0207644_10163812 3300025931 Bacteria 1730
650 Ga0207644_11387039 3300025931 Bacteria 590
651 Ga0207690_10090943 3300025932 Bacteria 2156
652 Ga0207706_10283643 3300025933 Bacteria 1444
653 Ga0207686_10163599 3300025934 Bacteria 1562
654 Ga0207686_10233310 3300025934 Bacteria 1335
655 Ga0207686_10931356 3300025934 Unclassified 702
656 Ga0207709_10027447 3300025935 Bacteria 3280
657 Ga0207709_10071468 3300025935 Bacteria 2204
658 Ga0207709_10162519 3300025935 Unclassified 1559
659 Ga0207670_11241618 3300025936 Unclassified 631
660 Ga0207704_10144598 3300025938 Bacteria 1668
661 Ga0207704_11181954 3300025938 Bacteria 652
662 Ga0207665_10025878 3300025939 Bacteria 3871
663 Ga0207665_10041787 3300025939 Bacteria 3064
664 Ga0207665_10042368 3300025939 Bacteria 3043
665 Ga0207665_10062747 3300025939 Bacteria 2522
666 Ga0207665_10109286 3300025939 Bacteria 1941
667 Ga0207691_10023810 3300025940 Bacteria 5763
668 Ga0207691_10090998 3300025940 Bacteria 2734
669 Ga0207691_10597842 3300025940 Bacteria 934
670 Ga0207711_10064839 3300025941 Bacteria 3156
671 Ga0207711_10466795 3300025941 Bacteria 1175
672 Ga0207711_10508054 3300025941 Bacteria 1123
673 Ga0207711_10516961 3300025941 Bacteria 1113
674 Ga0207711_11529205 3300025941 Unclassified 610
675 Ga0207689_10003762 3300025942 Bacteria 13821
676 Ga0207689_10011201 3300025942 Bacteria 7695
677 Ga0207689_10403932 3300025942 Bacteria 1139
678 Ga0207689_11257662 3300025942 Bacteria 622
679 Ga0207661_10005461 3300025944 Bacteria 8963
680 Ga0207661_10008656 3300025944 Bacteria 7272
681 Ga0207661_10025595 3300025944 Bacteria 4488
682 Ga0207661_10276564 3300025944 Bacteria 1500
683 Ga0207661_10471709 3300025944 Bacteria 1145
684 Ga0207661_11592882 3300025944 Bacteria 598
685 Ga0207679_10051928 3300025945 Bacteria 3004
686 Ga0207679_10324926 3300025945 Bacteria 1333
687 Ga0207679_10693691 3300025945 Bacteria 923
688 Ga0207667_10055804 3300025949 Bacteria 4151
689 Ga0207667_10173637 3300025949 Bacteria 2215
690 Ga0207667_10180185 3300025949 Bacteria 2170
691 Ga0207667_10453567 3300025949 Bacteria 1303
692 Ga0207712_11221743 3300025961 Bacteria 671
693 Ga0207712_12015271 3300025961 Bacteria 517
694 Ga0207668_10001182 3300025972 Bacteria 15503
695 Ga0207668_10039018 3300025972 Bacteria 3193
696 Ga0207668_10106177 3300025972 Bacteria 2097
697 Ga0207640_10165330 3300025981 Bacteria 1642
698 Ga0207658_10091618 3300025986 Bacteria 2359
699 Ga0207658_10108260 3300025986 Bacteria 2192
700 Ga0207658_10301720 3300025986 Bacteria 1380
701 Ga0207677_10057222 3300026023 Bacteria 2676
702 Ga0207677_10613299 3300026023 Bacteria 956
703 Ga0207677_10622459 3300026023 Bacteria 949
704 Ga0207677_11444875 3300026023 Unclassified 634
705 Ga0207703_10050602 3300026035 Bacteria 3364
706 Ga0207703_10514207 3300026035 Bacteria 1125
707 Ga0207639_10089364 3300026041 Bacteria 2461
708 Ga0207639_10161702 3300026041 Bacteria 1887
709 Ga0207639_10248352 3300026041 Bacteria 1550
710 Ga0207639_11054359 3300026041 Bacteria 762
711 Ga0207678_10053854 3300026067 Bacteria 3466
712 Ga0207678_10056882 3300026067 Bacteria 3366
713 Ga0207678_10483575 3300026067 Bacteria 1078
714 Ga0207708_10058212 3300026075 Bacteria 2949
715 Ga0207702_10027472 3300026078 Bacteria 4725
716 Ga0207702_10054053 3300026078 Bacteria 3402
717 Ga0207702_10060477 3300026078 Bacteria 3230
718 Ga0207702_10089831 3300026078 Bacteria 2687
719 Ga0207702_10201222 3300026078 Bacteria 1846
720 Ga0207702_10221259 3300026078 Bacteria 1764
721 Ga0207641_10007880 3300026088 Bacteria 8834
722 Ga0207641_10055263 3300026088 Bacteria 3371
723 Ga0207641_10056959 3300026088 Bacteria 3323
724 Ga0207641_10081297 3300026088 Bacteria 2813
725 Ga0207641_10592076 3300026088 Bacteria 1085
726 Ga0207641_11366517 3300026088 Unclassified 709
727 Ga0207641_11441176 3300026088 Bacteria 690
728 Ga0207641_12165341 3300026088 Bacteria 556
729 Ga0207676_10003083 3300026095 Bacteria 11896
730 Ga0207676_10014092 3300026095 Bacteria 5743
731 Ga0207676_10118467 3300026095 Bacteria 2228
732 Ga0207676_10319024 3300026095 Bacteria 1426
733 Ga0207676_10619312 3300026095 Bacteria 1041
734 Ga0207674_10022331 3300026116 Bacteria 6794
735 Ga0207674_10022506 3300026116 Bacteria 6766
736 Ga0207674_10066111 3300026116 Bacteria 3643
737 Ga0207674_10432859 3300026116 Bacteria 1271
738 Ga0207674_10594597 3300026116 Bacteria 1069
739 Ga0207674_10611184 3300026116 Bacteria 1053
740 Ga0207675_100001740 3300026118 Bacteria 21802
741 Ga0207683_10004433 3300026121 Bacteria 12130
742 Ga0207683_10011795 3300026121 Bacteria 7456
743 Ga0207683_10165305 3300026121 Bacteria 2002
744 Ga0207683_10270732 3300026121 Bacteria 1551
745 Ga0207683_11098119 3300026121 Unclassified 738
746 Ga0207698_10076121 3300026142 Bacteria 2685
747 Ga0207698_10118353 3300026142 Bacteria 2237
748 Ga0207698_10209342 3300026142 Bacteria 1753
749 Ga0207698_10742368 3300026142 Bacteria 980
750 Ga0207428_10052605 3300027907 Bacteria 3251
751 Ga0268266_10106230 3300028379 Bacteria 2481
752 Ga0268266_10120641 3300028379 Bacteria 2333
753 Ga0268266_10457401 3300028379 Bacteria 1214
754 Ga0268266_10711657 3300028379 Unclassified 968
755 Ga0268265_10075896 3300028380 Bacteria 2635
756 Ga0268265_10910648 3300028380 Bacteria 864
757 Ga0268264_10000238 3300028381 Bacteria 105229
758 Ga0268264_10134098 3300028381 Bacteria 2200
759 Ga0268264_11166542 3300028381 Bacteria 779
760 Ga0268264_11604674 3300028381 Unclassified 661
761 Ga0265320_10525712 3300031240 Unclassified 523
762 Ga0307509_10156849 3300031507 Bacteria 2180
763 Ga0307405_11315969 3300031731 Bacteria 629
764 Ga0307405_12151490 3300031731 Bacteria 501
765 Ga0307410_10348187 3300031852 Bacteria 1183
766 Ga0307410_11530923 3300031852 Bacteria 588
767 Ga0307407_10357581 3300031903 Bacteria 1036
768 Ga0307412_10219717 3300031911 Bacteria 1456
769 Ga0307409_100116660 3300031995 Bacteria 2251
770 Ga0307409_100921345 3300031995 Bacteria 888
771 Ga0307409_101072303 3300031995 Bacteria 826
772 Ga0307409_102546171 3300031995 Bacteria 540
773 Ga0307416_100175445 3300032002 Bacteria 2001
774 Ga0307416_100286658 3300032002 Bacteria 1627
775 Ga0307416_100766228 3300032002 Bacteria 1059
776 Ga0307411_10795039 3300032005 Bacteria 832
777 Ga0307415_100217386 3300032126 Bacteria 1529
778 Ga0307415_100239463 3300032126 Bacteria 1467
779 Ga0307415_100530416 3300032126 Bacteria 1035
780 Ga0307415_101729472 3300032126 Bacteria 604
781 Ga0373930_0008208 3300034816 Bacteria 1823
782 Ga0373948_0013610 3300034817 Bacteria 1471
783 Ga0373948_0074181 3300034817 Bacteria 767
784 Ga0373950_0021245 3300034818 Bacteria 1148
785 Ga0373959_0104072 3300034820 Bacteria 678
786 Ga0373938_0007289 3300034957 Bacteria 1942
787 Ga0373926_0001366 3300035083 Bacteria 7388
788 Ga0373926_0010578 3300035083 Bacteria 3094
789 Ga0373926_0024539 3300035083 Bacteria 2100
790 Ga0373926_0291350 3300035083 Bacteria 636
791 Ga0373928_0061507 3300035084 Bacteria 909
792 Ga0373934_0000680 3300035086 Bacteria 12062
793 Ga0373934_0001711 3300035086 Bacteria 8060
794 Ga0373934_0012797 3300035086 Bacteria 3169
795 Ga0373934_0083000 3300035086 Bacteria 1288
796 Ga0373940_0022878 3300035088 Bacteria 1609
797 Ga0373944_0001086 3300035089 Bacteria 6746
798 Ga0373944_0001504 3300035089 Bacteria 5896
799 Ga0373944_0002339 3300035089 Bacteria 4823
800 Ga0373944_0257508 3300035089 Bacteria 646
801 Ga0373923_0000434 3300035111 Bacteria 9829
802 Ga0373923_0002713 3300035111 Bacteria 5515
803 Ga0373923_0026414 3300035111 Bacteria 2310
804 Ga0373923_0090156 3300035111 Bacteria 1340
805 Ga0373923_0118427 3300035111 Bacteria 1181
806 Ga0373923_0201102 3300035111 Bacteria 921
807 Ga0373923_0308029 3300035111 Bacteria 750
808 Ga0373932_0023305 3300035112 Bacteria 1654
809 Ga0373932_0024965 3300035112 Bacteria 1613
810 Ga0373932_0351546 3300035112 Bacteria 561
811 Ga0373936_0000112 3300035113 Bacteria 28228
812 Ga0373936_0004092 3300035113 Bacteria 5491
813 Ga0373936_0007615 3300035113 Bacteria 4069
814 Ga0373936_0015947 3300035113 Bacteria 2883
815 Ga0373936_0076603 3300035113 Bacteria 1386
816 Ga0373936_0140831 3300035113 Bacteria 1041
817 Ga0373936_0182791 3300035113 Bacteria 920
818 Ga0373936_0633492 3300035113 Bacteria 503
819 Ga0373939_0018781 3300035114 Bacteria 1857
820 Ga0373941_0169116 3300035115 Bacteria 814
821 Ga0373945_0000364 3300035116 Bacteria 12998
822 Ga0373945_0006002 3300035116 Bacteria 3904
823 Ga0373945_0006387 3300035116 Bacteria 3802
824 Ga0373945_0294920 3300035116 Bacteria 693
825 Ga0373953_0000043 3300035117 Bacteria 32688
826 Ga0373953_0000407 3300035117 Bacteria 11668
827 Ga0373953_0015371 3300035117 Bacteria 2772
828 Ga0373953_0062791 3300035117 Bacteria 1521
829 Ga0373953_0137938 3300035117 Bacteria 1042
830 Ga0373953_0217399 3300035117 Bacteria 828
831 Ga0373953_0296985 3300035117 Bacteria 705
832 Ga0373954_0001380 3300035118 Bacteria 9814
833 Ga0373954_0004326 3300035118 Bacteria 6105
834 Ga0373954_0017809 3300035118 Bacteria 3193
835 Ga0373954_0084765 3300035118 Bacteria 1517
836 Ga0373954_0155871 3300035118 Bacteria 1117
837 Ga0373954_0661706 3300035118 Bacteria 518
838 Ga0373956_0000761 3300035119 Bacteria 13331
839 Ga0373956_0002268 3300035119 Bacteria 7917
840 Ga0373956_0035502 3300035119 Bacteria 2199
841 Ga0373956_0187820 3300035119 Bacteria 978
842 Ga0373957_0000905 3300035120 Bacteria 7740
843 Ga0373957_0001292 3300035120 Bacteria 6715
844 Ga0373957_0014284 3300035120 Bacteria 2711
845 Ga0373957_0018571 3300035120 Bacteria 2438
846 Ga0373957_0106341 3300035120 Bacteria 1127
847 Ga0373957_0214874 3300035120 Bacteria 804
848 Ga0373957_0272654 3300035120 Bacteria 714
849 Ga0373957_0305855 3300035120 Bacteria 675
850 Ga0373960_0002454 3300035121 Bacteria 4169
851 Ga0373943_0000118 3300035170 Bacteria 29527
852 Ga0373943_0003604 3300035170 Bacteria 7047
853 Ga0373943_0016594 3300035170 Bacteria 3359
854 Ga0373943_0024198 3300035170 Bacteria 2830
855 Ga0373943_0146481 3300035170 Bacteria 1276
856 Ga0373943_0261476 3300035170 Bacteria 974
857 Ga0373943_0482366 3300035170 Bacteria 723
858 Ga0373946_0000064 3300035171 Bacteria 28039
859 Ga0373946_0005696 3300035171 Bacteria 4504
860 Ga0373946_0016415 3300035171 Bacteria 2820
861 Ga0373946_0068120 3300035171 Bacteria 1530
862 Ga0373946_0150745 3300035171 Bacteria 1085
863 Ga0373946_0307039 3300035171 Bacteria 786
864 Ga0373946_0432100 3300035171 Bacteria 668
865 Ga0373955_0000307 3300035172 Bacteria 20276
866 Ga0373955_0001389 3300035172 Bacteria 10289
867 Ga0373955_0010704 3300035172 Bacteria 4343
868 Ga0373955_0061176 3300035172 Bacteria 2079
869 Ga0373955_0070377 3300035172 Bacteria 1954
870 Ga0373955_0101368 3300035172 Bacteria 1653
871 Ga0373955_0109320 3300035172 Bacteria 1597
872 Ga0373942_0005328 3300035207 Bacteria 2983
873 Ga0373942_0058021 3300035207 Bacteria 1103
874 Ga0373942_0114991 3300035207 Bacteria 835
875 Ga0373961_0195971 3300035241 Bacteria 710
876 Ga0373962_0011303 3300035242 Bacteria 2237
877 Ga0373962_0190467 3300035242 Bacteria 690
878 Ga0373924_0000805 3300035410 Bacteria 9792
879 Ga0373924_0002180 3300035410 Bacteria 6559
880 Ga0373924_0004825 3300035410 Bacteria 4740
881 Ga0373924_0047025 3300035410 Bacteria 1779
882 Ga0373924_0536455 3300035410 Bacteria 526
883 Ga0373924_0552032 3300035410 Bacteria 519
884 Ga0373931_0000023 3300035691 Bacteria 130307
885 Ga0373931_0005176 3300035691 Bacteria 6013
886 Ga0373931_0216668 3300035691 Bacteria 1151
887 Ga0373935_0001398 3300035692 Bacteria 13351
888 Ga0373935_0010150 3300035692 Bacteria 5640
889 Ga0373935_0011246 3300035692 Bacteria 5374
890 Ga0373935_0042060 3300035692 Bacteria 2872
891 Ga0373935_0120688 3300035692 Bacteria 1751
892 Ga0373935_0137292 3300035692 Bacteria 1648
893 Ga0373935_0287869 3300035692 Bacteria 1158
894 Ga0373935_0916350 3300035692 Bacteria 649
895 Ga0373927_0003100 3300035695 Bacteria 12031
896 Ga0373927_0015337 3300035695 Bacteria 5061
897 Ga0373927_0017869 3300035695 Bacteria 4663
898 Ga0373927_0090858 3300035695 Bacteria 1983
899 Ga0373927_0218993 3300035695 Bacteria 1250
900 Ga0373933_0000283 3300035724 Bacteria 32966
901 Ga0373933_0003663 3300035724 Bacteria 8507
902 Ga0373933_0014917 3300035724 Bacteria 4327
903 Ga0373933_0017730 3300035724 Bacteria 3994
904 Ga0373933_0019180 3300035724 Bacteria 3858
905 Ga0373933_0230626 3300035724 Bacteria 1189
906 Ga0373933_0304885 3300035724 Unclassified 1031
907 Ga0373933_0630398 3300035724 Bacteria 704
908 Ga0373947_0012001 3300035725 Bacteria 4961
909 Ga0373947_0016714 3300035725 Bacteria 4215
910 Ga0373947_0046936 3300035725 Bacteria 2587
911 Ga0373947_0133035 3300035725 Bacteria 1589
912 Ga0373947_0161788 3300035725 Bacteria 1448
913 Ga0373947_0295495 3300035725 Bacteria 1079
914 Ga0373947_0414923 3300035725 Bacteria 909
915 Ga0373947_0625596 3300035725 Bacteria 734
916 Ga0373937_0000560 3300036401 Bacteria 32978
917 Ga0373937_0005931 3300036401 Bacteria 10515
918 Ga0373937_0011035 3300036401 Bacteria 7921
919 Ga0373937_0014488 3300036401 Bacteria 6963
920 Ga0373937_0017147 3300036401 Bacteria 6444
921 Ga0373937_0144616 3300036401 Bacteria 2225
922 Ga0373937_0261363 3300036401 Bacteria 1632
923 Ga0373937_0455953 3300036401 Bacteria 1214
924 Ga0373937_0715116 3300036401 Bacteria 948
925 Ga0373937_1285264 3300036401 Bacteria 680
926 Ga0373937_1494159 3300036401 Bacteria 623
927 Ga0373937_2123881 3300036401 Bacteria 508
928 Ga0373925_0003688 3300037068 Bacteria 11769
929 Ga0373925_0004201 3300037068 Bacteria 10930
930 Ga0373925_0006891 3300037068 Bacteria 8318
931 Ga0373925_0014026 3300037068 Bacteria 5800
932 Ga0373925_0077222 3300037068 Bacteria 2527
933 Ga0373925_0098261 3300037068 Bacteria 2246
934 Ga0373925_0447777 3300037068 Bacteria 1057
935 Ga0373925_0649229 3300037068 Bacteria 869
936 Ga0373925_0754924 3300037068 Bacteria 802
937 Ga0373925_0816855 3300037068 Bacteria 769
938 Ga0373925_1229663 3300037068 Bacteria 615
939 Ga0395899_0927176 3300037312 Bacteria 529
940 Ga0395900_0463885 3300037418 Bacteria 1221
941 Ga0395900_1012615 3300037418 Bacteria 750
942 Ga0395898_0053505 3300037466 Bacteria 3943
943 Ga0395898_0168316 3300037466 Bacteria 2095
944 Ga0395898_1480528 3300037466 Bacteria 605
945 Ga0395905_0061892 3300037471 Bacteria 3501
946 Ga0395905_0095805 3300037471 Bacteria 2786
947 Ga0395905_0202688 3300037471 Bacteria 1860
948 Ga0436364_0626442 3300037853 Bacteria 1679
949 Ga0395901_0003209 3300038443 Bacteria 16464
950 Ga0395901_0010731 3300038443 Bacteria 9287
951 Ga0395901_0022908 3300038443 Bacteria 6403
952 Ga0395901_0033608 3300038443 Bacteria 5296
953 Ga0395901_0349181 3300038443 Bacteria 1527
954 Ga0395901_0892814 3300038443 Bacteria 871
955 Ga0436365_0904426 3300039437 Bacteria 1042
956 Ga0451787_591939 3300041441 Bacteria 542
957 Ga0451789_0523819 3300041443 Bacteria 2348
958 Ga0451791_0166158 3300041451 Bacteria 5040
959 Ga0451791_0622792 3300041451 Unclassified 1699
960 Ga0451793_0118808 3300041452 Bacteria 12202
961 Ga0451793_1419480 3300041452 Bacteria 607
962 Ga0451797_0328055 3300041453 Bacteria 1863
963 Ga0451800_0789169 3300041459 Bacteria 2179
964 Ga0451833_1106457 3300041491 Bacteria 1247
965 Ga0451833_1447573 3300041491 Bacteria 1926
966 Ga0451839_1460976 3300041496 Bacteria 2774
967 Ga0451849_0857468 3300041505 Bacteria 2053
968 Ga0451851_0216177 3300041507 Bacteria 998
969 Ga0451843_0852902 3300041509 Bacteria 2169
970 Ga0451853_3758868 3300041512 Bacteria 2443
971 Ga0439448_0146704 3300042005 Bacteria 818
972 Ga0466969_0586825 3300044656 Bacteria 511
973 Ga0466966_0124347 3300044684 Bacteria 1583
974 Ga0466963_0068227 3300044694 Bacteria 2388
975 Ga0466963_0262770 3300044694 Bacteria 1212
976 Ga0466963_0803224 3300044694 Bacteria 663
977 Ga0466960_0797287 3300044901 Bacteria 572
978 Ga0466959_0272089 3300045049 Bacteria 1164
979 Ga0466958_0227802 3300045836 Bacteria 1190
980 Ga0466958_0244552 3300045836 Bacteria 1147
981 Ga0466958_0275866 3300045836 Bacteria 1077
982 Ga0466958_0611728 3300045836 Bacteria 709
983 Ga0466967_0002837 3300045976 Bacteria 10995
984 Ga0466967_0034625 3300045976 Bacteria 4289
985 Ga0466967_0036093 3300045976 Bacteria 4217
986 Ga0466967_0616530 3300045976 Bacteria 1071
987 Ga0466967_0815095 3300045976 Bacteria 927
988 Ga0466967_1686854 3300045976 Bacteria 631
989 Ga0495592_0000403 3300046454 Bacteria 32941
990 Ga0495592_0004793 3300046454 Bacteria 9936
991 Ga0495592_0007493 3300046454 Bacteria 8171
992 Ga0495592_0011572 3300046454 Bacteria 6680
993 Ga0495592_0032960 3300046454 Bacteria 3908
994 Ga0495592_0140351 3300046454 Bacteria 1682
995 Ga0495603_0344594 3300046455 Bacteria 855
996 Ga0495603_0496127 3300046455 Bacteria 699
997 Ga0495629_0006468 3300046459 Bacteria 8678
998 Ga0495629_0006516 3300046459 Bacteria 8650
999 Ga0495629_0021000 3300046459 Bacteria 4660
1000 Ga0495629_0027475 3300046459 Bacteria 4040
1001 Ga0495629_0177274 3300046459 Bacteria 1478
1002 Ga0495629_0179305 3300046459 Bacteria 1468
1003 Ga0495641_0001329 3300046461 Bacteria 21138
1004 Ga0495641_0008248 3300046461 Bacteria 6377
1005 Ga0495641_0037010 3300046461 Bacteria 2289
1006 Ga0495641_0064419 3300046461 Bacteria 1651
1007 Ga0495651_0000499 3300046462 Bacteria 30439
1008 Ga0495651_0000629 3300046462 Bacteria 27312
1009 Ga0495651_0008111 3300046462 Bacteria 8050
1010 Ga0495651_0008484 3300046462 Bacteria 7874
1011 Ga0495651_0031929 3300046462 Bacteria 4106
1012 Ga0495651_0110928 3300046462 Bacteria 2028
1013 Ga0495651_0345015 3300046462 Bacteria 985
1014 Ga0495653_0000784 3300046463 Bacteria 24398
1015 Ga0495653_0001785 3300046463 Bacteria 16960
1016 Ga0495653_0006323 3300046463 Bacteria 9720
1017 Ga0495653_0010486 3300046463 Bacteria 7582
1018 Ga0495653_0017714 3300046463 Bacteria 5791
1019 Ga0495653_0018669 3300046463 Bacteria 5630
1020 Ga0495653_0023443 3300046463 Bacteria 4985
1021 Ga0495653_0028193 3300046463 Bacteria 4491
1022 Ga0495653_0176303 3300046463 Bacteria 1471
1023 Ga0495653_0226269 3300046463 Bacteria 1254
1024 Ga0495653_0379975 3300046463 Bacteria 902
1025 Ga0495653_0485614 3300046463 Bacteria 772
1026 Ga0495580_0010540 3300046472 Bacteria 7195
1027 Ga0495580_0731998 3300046472 Bacteria 645
1028 Ga0495582_0004671 3300046473 Bacteria 7703
1029 Ga0495582_0026415 3300046473 Bacteria 3183
1030 Ga0495582_0030798 3300046473 Bacteria 2947
1031 Ga0495582_0040194 3300046473 Bacteria 2575
1032 Ga0495582_0051612 3300046473 Bacteria 2267
1033 Ga0495605_0400083 3300046474 Bacteria 571
1034 Ga0495639_0113720 3300046475 Bacteria 1286
1035 Ga0495639_0435760 3300046475 Bacteria 665
1036 Ga0495639_0608007 3300046475 Bacteria 562
1037 Ga0495639_0610811 3300046475 Bacteria 561
1038 Ga0495662_0000450 3300046476 Bacteria 18519
1039 Ga0495662_0011923 3300046476 Bacteria 4248
1040 Ga0495662_0013265 3300046476 Bacteria 4011
1041 Ga0495662_0013987 3300046476 Bacteria 3907
1042 Ga0495662_0041720 3300046476 Bacteria 2215
1043 Ga0495662_0080753 3300046476 Bacteria 1581
1044 Ga0495664_0002021 3300046477 Bacteria 10830
1045 Ga0495664_0012667 3300046477 Bacteria 4776
1046 Ga0495664_0022552 3300046477 Bacteria 3650
1047 Ga0495664_0035870 3300046477 Bacteria 2921
1048 Ga0495664_0045276 3300046477 Bacteria 2609
1049 Ga0495664_0056990 3300046477 Bacteria 2324
1050 Ga0495664_0145399 3300046477 Bacteria 1437
1051 Ga0495664_0145489 3300046477 Bacteria 1437
1052 Ga0495664_0214734 3300046477 Bacteria 1165
1053 Ga0495664_0873330 3300046477 Bacteria 527
1054 Ga0495584_0363344 3300046491 Bacteria 735
1055 Ga0495585_0304231 3300046492 Bacteria 783
1056 Ga0495594_0003675 3300046499 Bacteria 7879
1057 Ga0495594_0134358 3300046499 Bacteria 1402
1058 Ga0495607_0469941 3300046501 Bacteria 562
1059 Ga0495583_0157298 3300046506 Bacteria 939
1060 Ga0495608_0000310 3300046511 Bacteria 34155
1061 Ga0495608_0001991 3300046511 Bacteria 14646
1062 Ga0495608_0013836 3300046511 Bacteria 5598
1063 Ga0495608_0015411 3300046511 Bacteria 5301
1064 Ga0495608_0037626 3300046511 Bacteria 3253
1065 Ga0495608_0038866 3300046511 Bacteria 3193
1066 Ga0495608_0051321 3300046511 Bacteria 2733
1067 Ga0495608_0054003 3300046511 Bacteria 2656
1068 Ga0495608_0132775 3300046511 Bacteria 1592
1069 Ga0495608_0285431 3300046511 Bacteria 1024
1070 Ga0495608_0849973 3300046511 Unclassified 536
1071 Ga0495618_0003806 3300046514 Bacteria 9335
1072 Ga0495618_0008293 3300046514 Bacteria 6292
1073 Ga0495618_0011730 3300046514 Bacteria 5319
1074 Ga0495618_0021086 3300046514 Bacteria 4016
1075 Ga0495618_0039492 3300046514 Bacteria 2967
1076 Ga0495618_0086836 3300046514 Bacteria 2000
1077 Ga0495628_0003764 3300046516 Bacteria 13502
1078 Ga0495628_0013037 3300046516 Bacteria 7002
1079 Ga0495628_0021978 3300046516 Bacteria 5242
1080 Ga0495628_0055250 3300046516 Bacteria 3128
1081 Ga0495628_0123378 3300046516 Bacteria 1985
1082 Ga0495628_0151725 3300046516 Bacteria 1764
1083 Ga0495628_0238910 3300046516 Bacteria 1359
1084 Ga0495628_0631134 3300046516 Bacteria 762
1085 Ga0495630_0003016 3300046517 Bacteria 11675
1086 Ga0495630_0004973 3300046517 Bacteria 9349
1087 Ga0495630_0011591 3300046517 Bacteria 6386
1088 Ga0495630_0046931 3300046517 Bacteria 3229
1089 Ga0495630_0140899 3300046517 Bacteria 1833
1090 Ga0495630_0211786 3300046517 Bacteria 1479
1091 Ga0495630_0226255 3300046517 Bacteria 1428
1092 Ga0495630_0763886 3300046517 Bacteria 738
1093 Ga0495648_0021050 3300046524 Bacteria 4528
1094 Ga0495663_0025407 3300046525 Bacteria 1727
1095 Ga0495666_0003315 3300046526 Bacteria 8134
1096 Ga0495666_0122066 3300046526 Bacteria 1220
1097 Ga0495666_0362833 3300046526 Bacteria 652
1098 Ga0495652_0003138 3300046529 Bacteria 16506
1099 Ga0495652_0004652 3300046529 Bacteria 13086
1100 Ga0495652_0017741 3300046529 Bacteria 6352
1101 Ga0495652_0039172 3300046529 Bacteria 4099
1102 Ga0495652_0070916 3300046529 Bacteria 2910
1103 Ga0495652_0092455 3300046529 Bacteria 2471
1104 Ga0495652_0139327 3300046529 Bacteria 1909
1105 Ga0495652_0145617 3300046529 Bacteria 1857
1106 Ga0495652_0276328 3300046529 Bacteria 1232
1107 Ga0495665_0000852 3300046531 Bacteria 15974
1108 Ga0495665_0020020 3300046531 Bacteria 3597
1109 Ga0495665_0023068 3300046531 Bacteria 3342
1110 Ga0495665_0029037 3300046531 Bacteria 2964
1111 Ga0495665_0099980 3300046531 Bacteria 1522
1112 Ga0495640_0000992 3300046533 Bacteria 21969
1113 Ga0495640_0023597 3300046533 Bacteria 4478
1114 Ga0495640_0026763 3300046533 Bacteria 4163
1115 Ga0495640_0034290 3300046533 Bacteria 3600
1116 Ga0495640_0094023 3300046533 Bacteria 1975
1117 Ga0495640_0116348 3300046533 Bacteria 1741
1118 Ga0495640_0273941 3300046533 Bacteria 1052
1119 Ga0495586_0034025 3300046535 Bacteria 2736
1120 Ga0495586_0114977 3300046535 Bacteria 1500
1121 Ga0495586_0685291 3300046535 Bacteria 592
1122 Ga0495587_0000348 3300046536 Bacteria 32978
1123 Ga0495587_0003250 3300046536 Bacteria 10859
1124 Ga0495587_0006890 3300046536 Bacteria 7389
1125 Ga0495587_0010228 3300046536 Bacteria 5980
1126 Ga0495587_0046591 3300046536 Bacteria 2573
1127 Ga0495587_0047295 3300046536 Bacteria 2551
1128 Ga0495587_0055754 3300046536 Bacteria 2327
1129 Ga0495587_0096864 3300046536 Bacteria 1701
1130 Ga0495587_0268098 3300046536 Bacteria 958
1131 Ga0495609_0458658 3300046538 Bacteria 506
1132 Ga0495645_0004292 3300046543 Bacteria 9738
1133 Ga0495645_0006831 3300046543 Bacteria 7929
1134 Ga0495645_0016495 3300046543 Bacteria 5275
1135 Ga0495645_0028737 3300046543 Bacteria 4041
1136 Ga0495645_0042680 3300046543 Bacteria 3307
1137 Ga0495645_0070256 3300046543 Bacteria 2527
1138 Ga0495645_0079380 3300046543 Bacteria 2357
1139 Ga0495645_0080814 3300046543 Bacteria 2333
1140 Ga0495645_0094953 3300046543 Bacteria 2126
1141 Ga0495645_0120593 3300046543 Bacteria 1846
1142 Ga0495645_0318675 3300046543 Bacteria 1010
1143 Ga0495667_0000353 3300046559 Bacteria 29147
1144 Ga0495667_0001265 3300046559 Bacteria 16568
1145 Ga0495667_0008594 3300046559 Bacteria 6932
1146 Ga0495667_0013460 3300046559 Bacteria 5538
1147 Ga0495667_0017945 3300046559 Bacteria 4779
1148 Ga0495667_0021774 3300046559 Bacteria 4324
1149 Ga0495667_0033601 3300046559 Bacteria 3432
1150 Ga0495667_0034736 3300046559 Bacteria 3370
1151 Ga0495667_0273906 3300046559 Unclassified 1072
1152 Ga0495667_0471113 3300046559 Bacteria 788
1153 Ga0495667_0543689 3300046559 Bacteria 726
1154 Ga0495656_0248378 3300046615 Bacteria 898
1155 Ga0495656_0592167 3300046615 Bacteria 593
1156 Ga0495668_0061673 3300046616 Bacteria 2068
1157 Ga0495668_0664543 3300046616 Bacteria 576
1158 Ga0495634_0001947 3300046642 Bacteria 17638
1159 Ga0495634_0008618 3300046642 Bacteria 7569
1160 Ga0495634_0111299 3300046642 Bacteria 1760
1161 Ga0495634_0130784 3300046642 Bacteria 1600
1162 Ga0495634_0236717 3300046642 Bacteria 1121
1163 Ga0495634_0323748 3300046642 Bacteria 928
1164 Ga0495634_0514517 3300046642 Bacteria 701
1165 Ga0495635_0006559 3300046663 Bacteria 8120
1166 Ga0495635_0009824 3300046663 Bacteria 6690
1167 Ga0495635_0029723 3300046663 Bacteria 3800
1168 Ga0495635_0030189 3300046663 Bacteria 3766
1169 Ga0495635_0034921 3300046663 Bacteria 3487
1170 Ga0495635_0037022 3300046663 Bacteria 3378
1171 Ga0495635_0075458 3300046663 Bacteria 2309
1172 Ga0495635_0359309 3300046663 Bacteria 971
1173 Ga0495635_0544619 3300046663 Bacteria 761
1174 Ga0495659_0270438 3300046664 Bacteria 712
1175 Ga0495661_0294118 3300046665 Bacteria 815
1176 Ga0495588_0044788 3300046674 Bacteria 2267
1177 Ga0495588_0138864 3300046674 Bacteria 1283
1178 Ga0495657_0002166 3300046675 Bacteria 16662
1179 Ga0495657_0002176 3300046675 Bacteria 16618
1180 Ga0495657_0012650 3300046675 Bacteria 6260
1181 Ga0495657_0023699 3300046675 Bacteria 4383
1182 Ga0495657_0024050 3300046675 Bacteria 4343
1183 Ga0495657_0074522 3300046675 Bacteria 2208
1184 Ga0495657_0085202 3300046675 Bacteria 2037
1185 Ga0495657_0117501 3300046675 Bacteria 1678
1186 Ga0495657_0219379 3300046675 Bacteria 1153
1187 Ga0495657_0513308 3300046675 Bacteria 698
1188 Ga0495657_0643083 3300046675 Bacteria 612
1189 Ga0495657_0759569 3300046675 Bacteria 555
1190 Ga0495599_0000267 3300046678 Bacteria 32878
1191 Ga0495599_0000894 3300046678 Bacteria 16666
1192 Ga0495599_0001817 3300046678 Bacteria 12379
1193 Ga0495599_0006456 3300046678 Bacteria 7074
1194 Ga0495599_0010888 3300046678 Bacteria 5575
1195 Ga0495599_0014766 3300046678 Bacteria 4835
1196 Ga0495599_0018140 3300046678 Bacteria 4382
1197 Ga0495599_0079146 3300046678 Bacteria 2052
1198 Ga0495599_0128017 3300046678 Bacteria 1577
1199 Ga0495599_0199913 3300046678 Bacteria 1228
1200 Ga0495599_0754412 3300046678 Bacteria 558
1201 Ga0495623_0001940 3300046679 Bacteria 13892
1202 Ga0495623_0007666 3300046679 Bacteria 7016
1203 Ga0495623_0044190 3300046679 Unclassified 2832
1204 Ga0495623_0066047 3300046679 Bacteria 2261
1205 Ga0495646_0008644 3300046680 Bacteria 6470
1206 Ga0495646_0010256 3300046680 Bacteria 5959
1207 Ga0495646_0013681 3300046680 Bacteria 5157
1208 Ga0495646_0025322 3300046680 Bacteria 3732
1209 Ga0495646_0042643 3300046680 Bacteria 2783
1210 Ga0495646_0213075 3300046680 Bacteria 1047
1211 Ga0495646_0256060 3300046680 Bacteria 936
1212 Ga0495646_0263139 3300046680 Bacteria 921
1213 Ga0495646_0514998 3300046680 Bacteria 613
1214 Ga0495647_0007560 3300046681 Bacteria 3646
1215 Ga0495647_0359022 3300046681 Bacteria 664
1216 Ga0495658_0005104 3300046683 Bacteria 6451
1217 Ga0495658_0064971 3300046683 Bacteria 2104
1218 Ga0495658_0270344 3300046683 Bacteria 1071
1219 Ga0495658_0854600 3300046683 Bacteria 582
1220 Ga0495613_0008946 3300046689 Bacteria 7433
1221 Ga0495613_0012223 3300046689 Bacteria 6380
1222 Ga0495613_0222909 3300046689 Bacteria 1323
1223 Ga0495613_0697975 3300046689 Bacteria 668
1224 Ga0495613_0853831 3300046689 Bacteria 591
1225 Ga0495624_0003764 3300046690 Bacteria 11208
1226 Ga0495624_0018876 3300046690 Bacteria 4608
1227 Ga0495624_0046945 3300046690 Bacteria 2745
1228 Ga0495624_0051058 3300046690 Bacteria 2618
1229 Ga0495624_0141997 3300046690 Bacteria 1471
1230 Ga0495624_0142746 3300046690 Bacteria 1466
1231 Ga0495624_0366358 3300046690 Bacteria 866
1232 Ga0495624_0773303 3300046690 Bacteria 568
1233 Ga0495670_0491385 3300046691 Bacteria 666
1234 Ga0495649_0386539 3300046694 Bacteria 704
1235 Ga0495600_0001242 3300046809 Bacteria 14012
1236 Ga0495600_0001286 3300046809 Bacteria 13875
1237 Ga0495600_0003324 3300046809 Bacteria 9444
1238 Ga0495600_0003483 3300046809 Bacteria 9252
1239 Ga0495600_0030510 3300046809 Bacteria 3492
1240 Ga0495600_0062392 3300046809 Bacteria 2435
1241 Ga0495600_0079066 3300046809 Bacteria 2147
1242 Ga0495600_0586391 3300046809 Bacteria 678
1243 Ga0495581_0001028 3300047315 Bacteria 15089
1244 Ga0495581_0008227 3300047315 Bacteria 6045
1245 Ga0495581_0049465 3300047315 Bacteria 2427
1246 Ga0495581_0238187 3300047315 Bacteria 1064
1247 Ga0495581_0296385 3300047315 Bacteria 945
1248 Ga0495581_0618467 3300047315 Bacteria 627
1249 Ga0495604_0000550 3300047317 Bacteria 32980
1250 Ga0495604_0004599 3300047317 Bacteria 10932
1251 Ga0495604_0006607 3300047317 Bacteria 9191
1252 Ga0495604_0012698 3300047317 Bacteria 6702
1253 Ga0495604_0029989 3300047317 Bacteria 4324
1254 Ga0495604_0045966 3300047317 Bacteria 3405
1255 Ga0495604_0163644 3300047317 Bacteria 1570
1256 Ga0495604_0548945 3300047317 Bacteria 745
1257 Ga0495636_0084328 3300047318 Bacteria 1372
1258 Ga0495674_0000590 3300047319 Bacteria 33960
1259 Ga0495674_0005002 3300047319 Bacteria 12750
1260 Ga0495674_0006374 3300047319 Bacteria 11312
1261 Ga0495674_0006392 3300047319 Bacteria 11295
1262 Ga0495674_0007829 3300047319 Bacteria 10202
1263 Ga0495674_0010942 3300047319 Bacteria 8571
1264 Ga0495674_0024200 3300047319 Bacteria 5584
1265 Ga0495674_0033926 3300047319 Bacteria 4618
1266 Ga0495674_0199721 3300047319 Bacteria 1659
1267 Ga0495672_0012718 3300047320 Bacteria 5851
1268 Ga0495672_0198051 3300047320 Bacteria 1006
1269 Ga0495676_0000954 3300047321 Bacteria 24253
1270 Ga0495676_0128560 3300047321 Bacteria 1832
1271 Ga0495676_0138887 3300047321 Bacteria 1743
1272 Ga0495676_0646499 3300047321 Bacteria 686
1273 Ga0495680_0000904 3300047322 Bacteria 32976
1274 Ga0495680_0004224 3300047322 Bacteria 13787
1275 Ga0495680_0005938 3300047322 Bacteria 11414
1276 Ga0495680_0011425 3300047322 Bacteria 7860
1277 Ga0495680_0026146 3300047322 Bacteria 4817
1278 Ga0495680_0028636 3300047322 Bacteria 4566
1279 Ga0495680_0030765 3300047322 Bacteria 4377
1280 Ga0495680_0039607 3300047322 Bacteria 3757
1281 Ga0495680_0486645 3300047322 Bacteria 839
1282 Ga0495675_0003298 3300047444 Bacteria 9705
1283 Ga0495675_0024148 3300047444 Bacteria 3875
1284 Ga0495675_0025904 3300047444 Bacteria 3737
1285 Ga0495675_0097522 3300047444 Bacteria 1842
1286 Ga0495675_0154449 3300047444 Bacteria 1416
1287 Ga0495675_0314679 3300047444 Bacteria 927
1288 Ga0495675_0720556 3300047444 Bacteria 557
1289 Ga0495677_0295495 3300047445 Bacteria 637
1290 Ga0495673_0011306 3300047469 Bacteria 4812
1291 Ga0495684_0003309 3300047471 Bacteria 12655
1292 Ga0495684_0005014 3300047471 Bacteria 10329
1293 Ga0495684_0005115 3300047471 Bacteria 10230
1294 Ga0495684_0010003 3300047471 Bacteria 7332
1295 Ga0495684_0018088 3300047471 Bacteria 5431
1296 Ga0495684_0058010 3300047471 Bacteria 2949
1297 Ga0495684_0062861 3300047471 Bacteria 2823
1298 Ga0495684_0487047 3300047471 Bacteria 850
1299 Ga0495684_0589865 3300047471 Bacteria 751
1300 Ga0495684_0646589 3300047471 Bacteria 708
1301 Ga0495593_0001796 3300047673 Bacteria 12731
1302 Ga0495593_0005834 3300047673 Bacteria 7260
1303 Ga0495593_0025918 3300047673 Bacteria 3244
1304 Ga0495593_0052138 3300047673 Bacteria 2163
1305 Ga0495593_0115266 3300047673 Bacteria 1370
1306 Ga0495593_0173969 3300047673 Bacteria 1085
1307 Ga0495593_0350587 3300047673 Bacteria 738
1308 Ga0495593_0640296 3300047673 Unclassified 534
1309 Ga0495602_0000631 3300048088 Bacteria 32978
1310 Ga0495602_0011014 3300048088 Bacteria 9365
1311 Ga0495602_0028399 3300048088 Bacteria 5353
1312 Ga0495602_0029254 3300048088 Bacteria 5251
1313 Ga0495602_0031883 3300048088 Bacteria 4973
1314 Ga0495602_0099556 3300048088 Bacteria 2389
1315 Ga0495602_0100285 3300048088 Bacteria 2378
1316 Ga0495602_0102694 3300048088 Bacteria 2342
1317 Ga0495614_0008860 3300048089 Bacteria 4465
1318 Ga0495614_0124294 3300048089 Bacteria 1139
1319 Ga0495614_0411875 3300048089 Bacteria 636
1320 Ga0496100_0096290 3300048903 Bacteria 2030
1321 Ga0496100_0141566 3300048903 Unclassified 1705
1322 Ga0496100_0202315 3300048903 Bacteria 1448
1323 Ga0496100_0222530 3300048903 Bacteria 1386
1324 Ga0496100_0262835 3300048903 Bacteria 1280
1325 Ga0496100_0413435 3300048903 Unclassified 1029
1326 Ga0496100_1254091 3300048903 Bacteria 585
1327 Ga0496101_0045495 3300048904 Bacteria 3144
1328 Ga0496101_0049889 3300048904 Bacteria 3011
1329 Ga0496101_0620998 3300048904 Bacteria 854
1330 Ga0496101_0856598 3300048904 Bacteria 716
1331 Ga0496101_1312592 3300048904 Bacteria 566
1332 Ga0496101_1572744 3300048904 Bacteria 511
1333 Ga0496102_0000080 3300048905 Bacteria 140541
1334 Ga0496102_0067624 3300048905 Bacteria 3277
1335 Ga0496102_0171188 3300048905 Bacteria 2044
1336 Ga0496102_0609187 3300048905 Bacteria 1015
1337 Ga0496102_0847969 3300048905 Bacteria 836
1338 Ga0496103_0000118 3300048906 Bacteria 86519
1339 Ga0496103_0018985 3300048906 Bacteria 4127
1340 Ga0496103_0087157 3300048906 Bacteria 1968
1341 Ga0496104_0013883 3300048907 Bacteria 7266
1342 Ga0496104_0032231 3300048907 Bacteria 4876
1343 Ga0496104_0087034 3300048907 Bacteria 2983
1344 Ga0496104_0111366 3300048907 Bacteria 2624
1345 Ga0496104_0112715 3300048907 Bacteria 2608
1346 Ga0496104_0276032 3300048907 Bacteria 1594
1347 Ga0496104_0420557 3300048907 Bacteria 1248
1348 Ga0496105_0005906 3300048908 Bacteria 9336
1349 Ga0496105_0006129 3300048908 Bacteria 9208
1350 Ga0496105_0036164 3300048908 Bacteria 4067
1351 Ga0496105_0045749 3300048908 Bacteria 3611
1352 Ga0496105_0058446 3300048908 Bacteria 3183
1353 Ga0496105_0242632 3300048908 Bacteria 1462
1354 Ga0496105_0251894 3300048908 Bacteria 1430
1355 Ga0496105_0391730 3300048908 Bacteria 1104
1356 Ga0496105_0402689 3300048908 Bacteria 1086
1357 Ga0496105_0559348 3300048908 Bacteria 892
1358 Ga0496105_1361106 3300048908 Bacteria 516
1359 Ga0496106_0002362 3300048909 Bacteria 14048
1360 Ga0496106_0014659 3300048909 Bacteria 5793
1361 Ga0496106_0093873 3300048909 Bacteria 2319
1362 Ga0496106_0192401 3300048909 Unclassified 1622
1363 Ga0496107_0020401 3300048910 Bacteria 4680
1364 Ga0496107_0109891 3300048910 Bacteria 2025
1365 Ga0496107_0352800 3300048910 Bacteria 1095
1366 Ga0496107_0391691 3300048910 Bacteria 1033
1367 Ga0496107_0500081 3300048910 Unclassified 902
1368 Ga0496108_0006269 3300048911 Bacteria 9637
1369 Ga0496108_0008118 3300048911 Bacteria 8513
1370 Ga0496108_0042290 3300048911 Bacteria 3803
1371 Ga0496108_0053659 3300048911 Bacteria 3381
1372 Ga0496108_0075171 3300048911 Bacteria 2854
1373 Ga0496108_0107438 3300048911 Bacteria 2383
1374 Ga0496108_0276256 3300048911 Bacteria 1463
1375 Ga0496108_0402570 3300048911 Bacteria 1195
1376 Ga0496108_0508385 3300048911 Bacteria 1052
1377 Ga0496108_0679481 3300048911 Bacteria 894
1378 Ga0496108_0828574 3300048911 Bacteria 797
1379 Ga0496109_0018225 3300048912 Bacteria 6165
1380 Ga0496109_0032488 3300048912 Bacteria 4692
1381 Ga0496109_0048849 3300048912 Bacteria 3850
1382 Ga0496109_0073072 3300048912 Bacteria 3151
1383 Ga0496109_0078626 3300048912 Bacteria 3037
1384 Ga0496109_0134444 3300048912 Bacteria 2310
1385 Ga0496109_0147756 3300048912 Bacteria 2199
1386 Ga0496109_0233899 3300048912 Bacteria 1729
1387 Ga0496109_0244941 3300048912 Unclassified 1688
1388 Ga0496109_0844428 3300048912 Bacteria 854
1389 Ga0496110_0008783 3300048913 Bacteria 8141
1390 Ga0496110_0011473 3300048913 Bacteria 7252
1391 Ga0496110_0023374 3300048913 Bacteria 5256
1392 Ga0496110_0026333 3300048913 Bacteria 4974
1393 Ga0496110_0045767 3300048913 Bacteria 3825
1394 Ga0496110_0048126 3300048913 Bacteria 3737
1395 Ga0496110_0084204 3300048913 Bacteria 2838
1396 Ga0496110_0134331 3300048913 Bacteria 2235
1397 Ga0496110_0195037 3300048913 Bacteria 1839
1398 Ga0496110_0212470 3300048913 Bacteria 1759
1399 Ga0496111_0001546 3300048914 Bacteria 13249
1400 Ga0496111_0001962 3300048914 Bacteria 12219
1401 Ga0496111_0038431 3300048914 Bacteria 3429
1402 Ga0496111_0063060 3300048914 Bacteria 2688
1403 Ga0496111_0082038 3300048914 Bacteria 2354
1404 Ga0496111_0247808 3300048914 Bacteria 1322
1405 Ga0496111_0251210 3300048914 Bacteria 1313
1406 Ga0496111_0548406 3300048914 Bacteria 849
1407 Ga0496111_0734068 3300048914 Bacteria 717
1408 Ga0496112_0048983 3300048915 Bacteria 4140
1409 Ga0496112_0095416 3300048915 Bacteria 2944
1410 Ga0496112_0185705 3300048915 Bacteria 2042
1411 Ga0496112_0227027 3300048915 Bacteria 1822
1412 Ga0496112_0387555 3300048915 Bacteria 1338
1413 Ga0496112_0610749 3300048915 Archaea 1022
1414 Ga0496112_0772629 3300048915 Bacteria 886
1415 Ga0496113_0021573 3300048916 Bacteria 4544
1416 Ga0496113_0031252 3300048916 Bacteria 3863
1417 Ga0496113_0061647 3300048916 Bacteria 2830
1418 Ga0496113_0084473 3300048916 Bacteria 2437
1419 Ga0496113_0095021 3300048916 Bacteria 2303
1420 Ga0496113_0145551 3300048916 Bacteria 1867
1421 Ga0496113_0237866 3300048916 Bacteria 1453
1422 Ga0496113_0554789 3300048916 Unclassified 921
1423 Ga0496113_1184216 3300048916 Bacteria 597
1424 Ga0496114_0001467 3300048917 Bacteria 17936
1425 Ga0496114_0043065 3300048917 Bacteria 3744
1426 Ga0496114_0046271 3300048917 Bacteria 3616
1427 Ga0496114_0065861 3300048917 Bacteria 3036
1428 Ga0496114_0137311 3300048917 Bacteria 2115
1429 Ga0496114_0529744 3300048917 Bacteria 1041
1430 Ga0496114_0823780 3300048917 Unclassified 807
1431 Ga0496114_1565768 3300048917 Bacteria 547
1432 Ga0496115_0078901 3300048918 Bacteria 2679
1433 Ga0496115_0129927 3300048918 Bacteria 2076
1434 Ga0496115_0174786 3300048918 Bacteria 1776
1435 Ga0496115_0175042 3300048918 Unclassified 1774
1436 Ga0496115_0522133 3300048918 Bacteria 952
1437 Ga0496115_0523540 3300048918 Bacteria 950
1438 Ga0496115_0524258 3300048918 Bacteria 950
1439 Ga0496116_0000493 3300048919 Bacteria 54285
1440 Ga0496117_0000287 3300048920 Bacteria 91621
1441 Ga0496118_0000266 3300048921 Bacteria 91632
1442 Ga0496119_0000558 3300048922 Bacteria 50488
1443 Ga0496119_0522511 3300048922 Bacteria 549
1444 Ga0496120_0032642 3300048923 Bacteria 3136
1445 Ga0496121_0034602 3300048924 Bacteria 4545
1446 Ga0496121_0625834 3300048924 Bacteria 660
1447 Ga0496124_0041754 3300048927 Bacteria 3955
1448 Ga0496125_0023352 3300048928 Bacteria 5710
1449 Ga0496126_0000383 3300048929 Bacteria 91602
1450 Ga0496126_0252559 3300048929 Bacteria 1469
1451 Ga0496126_0446431 3300048929 Bacteria 1042
1452 Ga0501032_0665548 3300049569 Bacteria 661
1453 Ga0501036_0220862 3300049572 Bacteria 1591
1454 Ga0501041_0234612 3300049577 Bacteria 1152
1455 Ga0501041_0656155 3300049577 Bacteria 671
1456 Ga0501042_0080546 3300049578 Bacteria 2333
1457 Ga0501046_0285155 3300049580 Bacteria 1209
1458 Ga0501047_0835889 3300049581 Bacteria 735
1459 Ga0501048_0146684 3300049582 Bacteria 1669
1460 Ga0501067_0032391 3300049583 Bacteria 2901
1461 Ga0501067_0421803 3300049583 Bacteria 744
1462 Ga0501068_0008894 3300049584 Bacteria 5603
1463 Ga0501068_0188942 3300049584 Bacteria 1304
1464 Ga0501069_0097667 3300049585 Bacteria 1665
1465 Ga0501069_0220456 3300049585 Bacteria 1102
1466 Ga0501069_0701459 3300049585 Bacteria 610
1467 Ga0501071_0061910 3300049587 Bacteria 2711
1468 Ga0501071_1240029 3300049587 Bacteria 576
1469 Ga0501072_0092972 3300049588 Bacteria 2396
1470 Ga0501075_0134936 3300049591 Bacteria 1880
1471 Ga0501076_0304532 3300049592 Bacteria 1307
1472 Ga0501079_0159797 3300049741 Bacteria 1757
1473 Ga0501080_0385241 3300049742 Bacteria 1263
1474 Ga0501035_1335924 3300049822 Bacteria 551
1475 nmdc:mga03n38_109246_c1 3300050490 Bacteria 1344
1476 nmdc:mga00v17_34430_c1 3300050491 Bacteria 3008
1477 nmdc:mga06z11_1002683_c1 3300050494 Bacteria 509
1478 nmdc:mga06z11_11055_c1 3300050494 Bacteria 3875
1479 nmdc:mga06z11_23889_c1 3300050494 Bacteria 2877
1480 nmdc:mga06z11_350278_c1 3300050494 Bacteria 884
1481 nmdc:mga07m45_286566_c1 3300050496 Bacteria 958
1482 nmdc:mga07m45_38864_c2 3300050496 Unclassified 1847
1483 nmdc:mga05p37_1044996_c1 3300050507 Bacteria 862
1484 nmdc:mga09592_524590_c1 3300050508 Bacteria 1018
1485 nmdc:mga06r32_1436416_c1 3300050510 Bacteria 631
1486 nmdc:mga06r32_1613458_c1 3300050510 Bacteria 587
1487 nmdc:mga08y16_12180_c1 3300050511 Bacteria 9039
1488 nmdc:mga08y16_906774_c1 3300050511 Bacteria 867
1489 nmdc:mga0n895_133729_c1 3300050512 Bacteria 2506
1490 nmdc:mga0n895_249911_c1 3300050512 Bacteria 1800
1491 nmdc:mga0rr50_1443566_c1 3300050513 Bacteria 582
1492 nmdc:mga0rr50_345835_c1 3300050513 Bacteria 1250
1493 nmdc:mga0rr50_49138_c1 3300050513 Bacteria 3122
1494 nmdc:mga0rr50_874535_c1 3300050513 Bacteria 766
1495 nmdc:mga0rr50_978519_c1 3300050513 Bacteria 721
1496 nmdc:mga08x19_119332_c1 3300050514 Bacteria 1766
1497 nmdc:mga08x19_35567_c1 3300050514 Bacteria 3152
1498 nmdc:mga08x19_362749_c1 3300050514 Bacteria 1013
1499 nmdc:mga08x19_843530_c1 3300050514 Bacteria 651
1500 nmdc:mga0a205_1415199_c1 3300050515 Bacteria 543
1501 nmdc:mga0sz30_275557_c1 3300050516 Bacteria 749
1502 Ga0495601_0061833 3300053077 Bacteria 2377
1503 Ga0495601_0089804 3300053077 Bacteria 1976
1504 Ga0495601_0103415 3300053077 Bacteria 1841
1505 Ga0495601_0124479 3300053077 Bacteria 1677
1506 Ga0495601_0199642 3300053077 Bacteria 1307
1507 Ga0495601_0230937 3300053077 Bacteria 1208
1508 Ga0495601_0250923 3300053077 Bacteria 1155
1509 Ga0495601_0259025 3300053077 Bacteria 1136
1510 Ga0495601_0321173 3300053077 Bacteria 1008
1511 Ga0495612_0067963 3300053078 Bacteria 1482
1512 Ga0495612_0141952 3300053078 Bacteria 1042
1513 Ga0495612_0437929 3300053078 Bacteria 596
1514 Ga0495595_0007895 3300053084 Bacteria 4356
1515 Ga0495595_0009676 3300053084 Bacteria 3992
1516 Ga0495595_0085688 3300053084 Bacteria 1506
1517 Ga0495595_0151182 3300053084 Bacteria 1142
1518 Ga0495595_0275970 3300053084 Bacteria 843
1519 Ga0495595_0486617 3300053084 Bacteria 628
1520 Ga0495595_0522864 3300053084 Bacteria 605
1521 Ga0495595_0711573 3300053084 Bacteria 515
1522 Ga0495619_0001335 3300053085 Bacteria 16151
1523 Ga0495619_0016774 3300053085 Bacteria 4637
1524 Ga0495619_0019874 3300053085 Bacteria 4275
1525 Ga0495619_0120564 3300053085 Bacteria 1798
1526 Ga0495619_0724416 3300053085 Bacteria 676
1527 Ga0500573_0073562 3300053140 Bacteria 1947
1528 Ga0501084_0119025 3300054114 Bacteria 2220
1529 Ga0590075_097874 3300059424 Bacteria 763
1530 Ga0466962_0367469 3300061719 Bacteria 718
1531 2855388217 2855386786 Bacteria 4752232
1532 Ga0163161_10155684
1533 LJQas_1011961
1534 LJQas_1023097
1535 JGI24735J21928_10251130
1536 JGI24738J21930_10064619
1537 Ga0058863_10612682
1538 Ga0058860_11186195
1539 Ga0070658_10023397
1540 Ga0070658_10037521
1541 Ga0070658_10121585
1542 Ga0070658_10528685
1543 Ga0070676_10060352
1544 Ga0070676_10593529
1545 Ga0070683_100001699
1546 Ga0070683_100047697
1547 Ga0070683_100427781
1548 Ga0070683_101338792
1549 Ga0070690_100027487
1550 Ga0070670_100023461
1551 Ga0070670_101876058
1552 Ga0068869_100392894
1553 Ga0068869_100510938
1554 Ga0068869_100695163
1555 Ga0070666_10021818
1556 Ga0070666_10825669
1557 Ga0070666_11096202
1558 Ga0070680_100014339
1559 Ga0070680_100076787
1560 Ga0070680_100991985
1561 Ga0070682_100026024
1562 Ga0070682_100206474
1563 Ga0070682_100700046
1564 Ga0070682_101213558
1565 Ga0068868_100029180
1566 Ga0068868_100057865
1567 Ga0068868_100065392
1568 Ga0068868_100123876
1569 Ga0068868_100389601
1570 Ga0070660_100068951
1571 Ga0070660_100204138
1572 Ga0070689_100063700
1573 Ga0070689_102096378
1574 Ga0070691_10040534
1575 Ga0070691_10080353
1576 Ga0070691_10083867
1577 Ga0070691_10299174
1578 Ga0070687_100034994
1579 Ga0070687_100422943
1580 Ga0070687_101391130
1581 Ga0070661_100025495
1582 Ga0070661_100219953
1583 Ga0070661_101159897
1584 Ga0070692_10010845
1585 Ga0070692_10024048
1586 Ga0070692_10546143
1587 Ga0070668_100072162
1588 Ga0070668_100161098
1589 Ga0070668_100248225
1590 Ga0070669_101949841
1591 Ga0070675_100055064
1592 Ga0070675_101746010
1593 Ga0070671_100014133
1594 Ga0070671_100025639
1595 Ga0070671_100132376
1596 Ga0070671_101052211
1597 Ga0070674_100548365
1598 Ga0070673_100688571
1599 Ga0070673_100945666
1600 Ga0070673_101474045
1601 Ga0070659_100044719
1602 Ga0070659_100373154
1603 Ga0070659_100377429
1604 Ga0070667_100009304
1605 Ga0070667_100130116
1606 Ga0070667_100387130
1607 Ga0070667_101232172
1608 Ga0070667_101485304
1609 Ga0070667_101749621
1610 Ga0070703_10010592
1611 Ga0070709_10006365
1612 Ga0070709_10082800
1613 Ga0070709_10160532
1614 Ga0070709_10558753
1615 Ga0070709_10710757
1616 Ga0070714_100014992
1617 Ga0070714_100018039
1618 Ga0070714_100021082
1619 Ga0070714_100104434
1620 Ga0070714_100155256
1621 Ga0070714_100169380
1622 Ga0070714_101035457
1623 Ga0070714_101097391
1624 Ga0070714_101195841
1625 Ga0070714_101239510
1626 Ga0070714_101382371
1627 Ga0070714_101399915
1628 Ga0070714_102373108
1629 Ga0070713_100021596
1630 Ga0070713_100053924
1631 Ga0070713_100147268
1632 Ga0070713_100164782
1633 Ga0070713_100233325
1634 Ga0070713_100355728
1635 Ga0070713_100385556
1636 Ga0070713_101050503
1637 Ga0070713_101100519
1638 Ga0070713_101345798
1639 Ga0070713_101550399
1640 Ga0070713_102130804
1641 Ga0070710_10013207
1642 Ga0070710_10034114
1643 Ga0070710_10043312
1644 Ga0070710_10047882
1645 Ga0070710_10783120
1646 Ga0070710_11437229
1647 Ga0070701_10143340
1648 Ga0070711_100003686
1649 Ga0070711_100020537
1650 Ga0070711_100099044
1651 Ga0070711_100704354
1652 Ga0070711_100949517
1653 Ga0070711_100971678
1654 Ga0070705_100229804
1655 Ga0070700_100158026
1656 Ga0070700_102022028
1657 Ga0070708_100029283
1658 Ga0070708_100151681
1659 Ga0070708_100458527
1660 Ga0070708_100473609
1661 Ga0070708_100582522
1662 Ga0070708_100863972
1663 Ga0070708_100877258
1664 Ga0070663_100016089
1665 Ga0070663_101278054
1666 Ga0070663_101722833
1667 Ga0070678_100003251
1668 Ga0070678_100029449
1669 Ga0070678_100058715
1670 Ga0070678_100120237
1671 Ga0070678_101278727
1672 Ga0070662_100453507
1673 Ga0070662_100581614
1674 Ga0070662_101435214
1675 Ga0070681_10051750
1676 Ga0070681_10051977
1677 Ga0070681_10068358
1678 Ga0070681_10239215
1679 Ga0070685_10103221
1680 Ga0070685_10171648
1681 Ga0070685_10386349
1682 Ga0070706_100009432
1683 Ga0070706_100035692
1684 Ga0070706_100041553
1685 Ga0070706_100050552
1686 Ga0070706_100141316
1687 Ga0070706_101258310
1688 Ga0070707_100003621
1689 Ga0070707_100007443
1690 Ga0070707_100015400
1691 Ga0070707_100018081
1692 Ga0070707_100025227
1693 Ga0070707_100032684
1694 Ga0070707_100375396
1695 Ga0070707_100408752
1696 Ga0070707_100954413
1697 Ga0070698_100000262
1698 Ga0070698_100024451
1699 Ga0070698_100053117
1700 Ga0070698_100189414
1701 Ga0070698_100508614
1702 Ga0070698_100819929
1703 Ga0070699_100006212
1704 Ga0070699_100325971
1705 Ga0070699_100399782
1706 Ga0070699_101110480
1707 Ga0070679_100029664
1708 Ga0070679_100126085
1709 Ga0070679_100162246
1710 Ga0070679_100474944
1711 Ga0070679_100553417
1712 Ga0070684_100010847
1713 Ga0070684_100067546
1714 Ga0070684_100089352
1715 Ga0070684_100161050
1716 Ga0070684_100275777
1717 Ga0070684_100286539
1718 Ga0070684_100341981
1719 Ga0070684_100633115
1720 Ga0070697_100048257
1721 Ga0070697_100081954
1722 Ga0070697_100088613
1723 Ga0068853_100052879
1724 Ga0068853_100096222
1725 Ga0068853_100250633
1726 Ga0068853_100598158
1727 Ga0070672_100100915
1728 Ga0070672_100127991
1729 Ga0070686_100030199
1730 Ga0070686_100225219
1731 Ga0070686_101883889
1732 Ga0070695_100039229
1733 Ga0070695_100769828
1734 Ga0070696_100008840
1735 Ga0070696_100086709
1736 Ga0070696_100232544
1737 Ga0070693_100016669
1738 Ga0070693_100085929
1739 Ga0070693_100105242
1740 Ga0070693_100415535
1741 Ga0070665_100233385
1742 Ga0070665_100411187
1743 Ga0070665_100535380
1744 Ga0070665_101057528
1745 Ga0070704_100102286
1746 Ga0070704_102157184
1747 Ga0068855_100172514
1748 Ga0068855_100205543
1749 Ga0068855_100477447
1750 Ga0070664_100110586
1751 Ga0070664_100471042
1752 Ga0070664_101455283
1753 Ga0068857_100019129
1754 Ga0068857_100022281
1755 Ga0068857_100194944
1756 Ga0068857_100230967
1757 Ga0068857_100584706
1758 Ga0068857_100687925
1759 Ga0068857_100871910
1760 Ga0068857_101792343
1761 Ga0068857_102029479
1762 Ga0068854_100033477
1763 Ga0068854_100078421
1764 Ga0068854_101157063
1765 Ga0068856_100067952
1766 Ga0068856_100111697
1767 Ga0068856_100148722
1768 Ga0068856_100154766
1769 Ga0068856_101586865
1770 Ga0070702_100020073
1771 Ga0070702_100039107
1772 Ga0070702_100258063
1773 Ga0070702_101148672
1774 Ga0068852_100081963
1775 Ga0068852_100082781
1776 Ga0068852_100264409
1777 Ga0068859_100089435
1778 Ga0068859_100126800
1779 Ga0068864_100025629
1780 Ga0068864_100092462
1781 Ga0068864_100204212
1782 Ga0068864_100267272
1783 Ga0068864_100342424
1784 Ga0068866_10206312
1785 Ga0068866_10932820
1786 Ga0068861_100646322
1787 Ga0068851_10562354
1788 Ga0068851_10595832
1789 Ga0068851_10644273
1790 Ga0068851_10998933
1791 Ga0068870_10003463
1792 Ga0068870_10005323
1793 Ga0068870_10720294
1794 Ga0068863_100022113
1795 Ga0068863_100028645
1796 Ga0068863_100063677
1797 Ga0068863_100071316
1798 Ga0068863_100168023
1799 Ga0068863_100437274
1800 Ga0068863_100617686
1801 Ga0068863_102152782
1802 Ga0068858_100107944
1803 Ga0068858_100300408
1804 Ga0068858_100562251
1805 Ga0068858_100577306
1806 Ga0068858_101399681
1807 Ga0068860_100001468
1808 Ga0068860_100185759
1809 Ga0068860_101207576
1810 Ga0068862_100971209
1811 Ga0068862_101668719
1812 Ga0081538_10130157
1813 Ga0070717_10016568
1814 Ga0070717_10025821
1815 Ga0070717_10038313
1816 Ga0070717_10061149
1817 Ga0070717_10098289
1818 Ga0070717_10128119
1819 Ga0070717_10158654
1820 Ga0070717_10166346
1821 Ga0070717_10184794
1822 Ga0070717_10293858
1823 Ga0070717_10311782
1824 Ga0070717_10451570
1825 Ga0070717_10556589
1826 Ga0070717_10557911
1827 Ga0070717_10567354
1828 Ga0070717_10581320
1829 Ga0070717_11817588
1830 Ga0075363_100028144
1831 Ga0075363_100108468
1832 Ga0075363_100427993
1833 Ga0075364_10029866
1834 Ga0075364_10455844
1835 Ga0075364_11037452
1836 Ga0075432_10047480
1837 Ga0070715_10033349
1838 Ga0070715_10041650
1839 Ga0070715_10398135
1840 Ga0070716_100003620
1841 Ga0070716_100007387
1842 Ga0070716_100054172
1843 Ga0070716_100181400
1844 Ga0070716_100397085
1845 Ga0070712_100009737
1846 Ga0070712_100200191
1847 Ga0070712_100266989
1848 Ga0070712_100350238
1849 Ga0070712_100365167
1850 Ga0070712_100459541
1851 Ga0070712_100690582
1852 Ga0070712_101372186
1853 Ga0075367_10048648
1854 Ga0075367_10082423
1855 Ga0075367_10292508
1856 Ga0097621_100240462
1857 Ga0097621_100603165
1858 Ga0097621_102164511
1859 Ga0075370_10086526
1860 Ga0075370_10161801
1861 Ga0075370_10867557
1862 Ga0068871_100053754
1863 Ga0068871_100113760
1864 Ga0068871_100575869
1865 Ga0068871_100947099
1866 Ga0075428_100310957
1867 Ga0075428_100494663
1868 Ga0075428_100986690
1869 Ga0075428_102178692
1870 Ga0075431_100492855
1871 Ga0075431_101781862
1872 Ga0075431_102166248
1873 Ga0075434_100118657
1874 Ga0075434_100741802
1875 Ga0075434_101115835
1876 Ga0075429_100643607
1877 Ga0075429_100938535
1878 Ga0068865_100216770
1879 Ga0075436_100001878
1880 Ga0075436_100131148
1881 Ga0075436_100474941
1882 Ga0075436_100688778
1883 Ga0097620_100089437
1884 Ga0097620_100126798
1885 Ga0075435_100002133
1886 Ga0075435_101020311
1887 Ga0075435_101625626
1888 Ga0099795_10525849
1889 Ga0105251_10022638
1890 Ga0105251_10110317
1891 Ga0105250_10055736
1892 Ga0105250_10217289
1893 Ga0105240_10774981
1894 Ga0105240_11158502
1895 Ga0111539_10409735
1896 Ga0111539_10420477
1897 Ga0111539_10541486
1898 Ga0111539_10606475
1899 Ga0111539_12315768
1900 Ga0111539_12754439
1901 Ga0111539_13150617
1902 Ga0105245_10021795
1903 Ga0105245_10102903
1904 Ga0105245_10103666
1905 Ga0105245_10370565
1906 Ga0105245_10605173
1907 Ga0105245_10876152
1908 Ga0105245_11093216
1909 Ga0105245_11643832
1910 Ga0105247_10041719
1911 Ga0105247_10197533
1912 Ga0105247_10210203
1913 Ga0105247_10236431
1914 Ga0105247_10355641
1915 Ga0105247_11250042
1916 Ga0114129_11083433
1917 Ga0105243_10053779
1918 Ga0105243_10144776
1919 Ga0105241_10004425
1920 Ga0105241_11537861
1921 Ga0105242_10055810
1922 Ga0105242_11050691
1923 Ga0105248_10037443
1924 Ga0105248_10117068
1925 Ga0105248_10295438
1926 Ga0105248_10425492
1927 Ga0105248_10453208
1928 Ga0105248_10494595
1929 Ga0105237_10089102
1930 Ga0105237_10099944
1931 Ga0105237_10555669
1932 Ga0105237_10772052
1933 Ga0105237_10999299
1934 Ga0105238_10092785
1935 Ga0105238_10195691
1936 Ga0105238_10212597
1937 Ga0105238_11401670
1938 Ga0105238_11754631
1939 Ga0105249_10174447
1940 Ga0105249_10446733
1941 Ga0099796_10142736
1942 Ga0099796_10436141
1943 Ga0105239_10015531
1944 Ga0105239_10412884
1945 Ga0105239_10462196
1946 Ga0105239_10953153
1947 Ga0105239_11135665
1948 Ga0105246_10000911
1949 Ga0105246_10002762
1950 Ga0105246_10334884
1951 Ga0105246_10511030
1952 Ga0105246_11158464
1953 Ga0157336_1035932
1954 Ga0157320_1021744
1955 Ga0157339_1032692
1956 Ga0157373_10016278
1957 Ga0157371_10022649
1958 Ga0157371_10179736
1959 Ga0157371_10515940
1960 Ga0157370_10030999
1961 Ga0157370_10116677
1962 Ga0157370_10869847
1963 Ga0157370_11055178
1964 Ga0157370_11858056
1965 Ga0157369_10144321
1966 Ga0157369_10232574
1967 Ga0157369_11400628
1968 Ga0157374_10114888
1969 Ga0157374_10330021
1970 Ga0157374_10353147
1971 Ga0157374_10666033
1972 Ga0157374_10786400
1973 Ga0157374_11470969
1974 Ga0157374_11806333
1975 Ga0157378_10061143
1976 Ga0163162_10013188
1977 Ga0163162_10091111
1978 Ga0163162_10281421
1979 Ga0163162_10406105
1980 Ga0163162_12989434
1981 Ga0157372_10015898
1982 Ga0157372_10378416
1983 Ga0157372_10509917
1984 Ga0157372_10575568
1985 Ga0157372_10966833
1986 Ga0157372_11285556
1987 Ga0157372_11975650
1988 Ga0157375_10105486
1989 Ga0157375_10130023
1990 Ga0157375_10399179
1991 Ga0157375_10501827
1992 Ga0157375_12229913
1993 Ga0157375_12945296
1994 Ga0163163_10006286
1995 Ga0163163_10018303
1996 Ga0163163_10066480
1997 Ga0163163_10105620
1998 Ga0163163_10307075
1999 Ga0163163_10512402
2000 Ga0163163_10822136
2001 Ga0163163_10838706
2002 Ga0157380_10062530
2003 Ga0157380_12813348
2004 Ga0182008_10404538
2005 Ga0157377_10022293
2006 Ga0157377_10034766
2007 Ga0157377_10924745
2008 Ga0157379_10029876
2009 Ga0157379_10045799
2010 Ga0157379_10906899
2011 Ga0157379_12632932
2012 Ga0157376_10195773
2013 Ga0157376_10298688
2014 Ga0157376_10953560
2015 Ga0157376_11019454
2016 Ga0157376_11293753
2017 Ga0163161_10274120
2018 Ga0163161_10519693
2019 Ga0163161_11860860
2020 Ga0206356_10176058
2021 Ga0206356_10740431
2022 Ga0206350_10816149
2023 Ga0206354_10405810
2024 Ga0206354_10777851
2025 Ga0206354_11274633
2026 Ga0206353_10425410
2027 Ga0206353_10452870
2028 Ga0206353_10710564
2029 Ga0206353_10787633
2030 Ga0206353_11644540
2031 Ga0213875_10065940
2032 Ga0224572_1088459
2033 Ga0207656_10272398
2034 Ga0207656_10399755
2035 Ga0207713_1122559
2036 Ga0207653_10007655
2037 Ga0207682_10162617
2038 Ga0207692_10006312
2039 Ga0207692_10007738
2040 Ga0207692_10019386
2041 Ga0207692_10033931
2042 Ga0207692_10045357
2043 Ga0207692_11024196
2044 Ga0207710_10051115
2045 Ga0207710_10088489
2046 Ga0207710_10161269
2047 Ga0207710_10355049
2048 Ga0207688_10010832
2049 Ga0207688_10022892
2050 Ga0207680_10203512
2051 Ga0207647_10105804
2052 Ga0207647_10144274
2053 Ga0207647_10289066
2054 Ga0207647_10409557
2055 Ga0207685_10047409
2056 Ga0207685_10252940
2057 Ga0207685_10780676
2058 Ga0207685_10785239
2059 Ga0207699_10002728
2060 Ga0207699_10003786
2061 Ga0207699_10013262
2062 Ga0207699_10048280
2063 Ga0207699_10048764
2064 Ga0207699_10050166
2065 Ga0207699_10069771
2066 Ga0207699_10275547
2067 Ga0207699_10850360
2068 Ga0207645_10060893
2069 Ga0207643_10000496
2070 Ga0207643_10020391
2071 Ga0207705_10010928
2072 Ga0207705_10090058
2073 Ga0207705_11539525
2074 Ga0207684_10001614
2075 Ga0207684_10035004
2076 Ga0207684_10125552
2077 Ga0207684_10363047
2078 Ga0207684_10523733
2079 Ga0207684_11067101
2080 Ga0207654_10034578
2081 Ga0207707_10162644
2082 Ga0207707_10362759
2083 Ga0207707_10878196
2084 Ga0207695_10193541
2085 Ga0207695_10568317
2086 Ga0207695_10901219
2087 Ga0207671_10031423
2088 Ga0207671_10034855
2089 Ga0207671_10040115
2090 Ga0207671_11342194
2091 Ga0207671_11491873
2092 Ga0207693_10009761
2093 Ga0207693_10015285
2094 Ga0207693_10016363
2095 Ga0207693_10056142
2096 Ga0207693_10281884
2097 Ga0207693_10765227
2098 Ga0207693_10943401
2099 Ga0207663_10014592
2100 Ga0207663_10023610
2101 Ga0207663_10030578
2102 Ga0207663_10038132
2103 Ga0207663_10081774
2104 Ga0207663_10157445
2105 Ga0207663_10299864
2106 Ga0207663_10679136
2107 Ga0207660_10057642
2108 Ga0207660_10750913
2109 Ga0207662_10036568
2110 Ga0207662_10069250
2111 Ga0207657_10001570
2112 Ga0207657_10003201
2113 Ga0207649_10051809
2114 Ga0207649_10219069
2115 Ga0207652_10102775
2116 Ga0207652_10351536
2117 Ga0207652_10529532
2118 Ga0207652_10548320
2119 Ga0207652_11200975
2120 Ga0207646_10000730
2121 Ga0207646_10004440
2122 Ga0207646_10025590
2123 Ga0207646_10030829
2124 Ga0207646_10034104
2125 Ga0207646_10536770
2126 Ga0207646_10891710
2127 Ga0207646_10905292
2128 Ga0207646_11323635
2129 Ga0207681_10325822
2130 Ga0207694_10091265
2131 Ga0207694_10114650
2132 Ga0207650_10047958
2133 Ga0207650_11914005
2134 Ga0207659_10042494
2135 Ga0207659_11026881
2136 Ga0207687_10028626
2137 Ga0207687_10029737
2138 Ga0207687_10136910
2139 Ga0207687_10699495
2140 Ga0207687_10740131
2141 Ga0207687_10793132
2142 Ga0207700_10005381
2143 Ga0207700_10015658
2144 Ga0207700_10019874
2145 Ga0207700_10049185
2146 Ga0207700_10085867
2147 Ga0207700_10104226
2148 Ga0207700_10169506
2149 Ga0207700_10250792
2150 Ga0207700_10392918
2151 Ga0207700_10393011
2152 Ga0207700_10393533
2153 Ga0207700_10397068
2154 Ga0207700_10853689
2155 Ga0207700_10962249
2156 Ga0207700_11052637
2157 Ga0207700_11268885
2158 Ga0207664_10003798
2159 Ga0207664_10006386
2160 Ga0207664_10019371
2161 Ga0207664_10020570
2162 Ga0207664_10026600
2163 Ga0207664_10028683
2164 Ga0207664_10036385
2165 Ga0207664_10038300
2166 Ga0207664_10049665
2167 Ga0207664_10122625
2168 Ga0207664_10143552
2169 Ga0207664_10204908
2170 Ga0207664_10436927
2171 Ga0207664_10448756
2172 Ga0207664_10453379
2173 Ga0207664_10503611
2174 Ga0207664_10592752
2175 Ga0207664_11064488
2176 Ga0207664_11284839
2177 Ga0207664_11601984
2178 Ga0207644_10006975
2179 Ga0207644_10146563
2180 Ga0207644_10163812
2181 Ga0207644_11387039
2182 Ga0207690_10090943
2183 Ga0207706_10283643
2184 Ga0207686_10163599
2185 Ga0207686_10233310
2186 Ga0207686_10931356
2187 Ga0207709_10027447
2188 Ga0207709_10071468
2189 Ga0207709_10162519
2190 Ga0207670_11241618
2191 Ga0207704_10144598
2192 Ga0207704_11181954
2193 Ga0207665_10025878
2194 Ga0207665_10041787
2195 Ga0207665_10042368
2196 Ga0207665_10062747
2197 Ga0207665_10109286
2198 Ga0207691_10023810
2199 Ga0207691_10090998
2200 Ga0207691_10597842
2201 Ga0207711_10064839
2202 Ga0207711_10466795
2203 Ga0207711_10508054
2204 Ga0207711_10516961
2205 Ga0207711_11529205
2206 Ga0207689_10003762
2207 Ga0207689_10011201
2208 Ga0207689_10403932
2209 Ga0207689_11257662
2210 Ga0207661_10005461
2211 Ga0207661_10008656
2212 Ga0207661_10025595
2213 Ga0207661_10276564
2214 Ga0207661_10471709
2215 Ga0207661_11592882
2216 Ga0207679_10051928
2217 Ga0207679_10324926
2218 Ga0207679_10693691
2219 Ga0207667_10055804
2220 Ga0207667_10173637
2221 Ga0207667_10180185
2222 Ga0207667_10453567
2223 Ga0207712_11221743
2224 Ga0207712_12015271
2225 Ga0207668_10001182
2226 Ga0207668_10039018
2227 Ga0207668_10106177
2228 Ga0207640_10165330
2229 Ga0207658_10091618
2230 Ga0207658_10108260
2231 Ga0207658_10301720
2232 Ga0207677_10057222
2233 Ga0207677_10613299
2234 Ga0207677_10622459
2235 Ga0207677_11444875
2236 Ga0207703_10050602
2237 Ga0207703_10514207
2238 Ga0207639_10089364
2239 Ga0207639_10161702
2240 Ga0207639_10248352
2241 Ga0207639_11054359
2242 Ga0207678_10053854
2243 Ga0207678_10056882
2244 Ga0207678_10483575
2245 Ga0207708_10058212
2246 Ga0207702_10027472
2247 Ga0207702_10054053
2248 Ga0207702_10060477
2249 Ga0207702_10089831
2250 Ga0207702_10201222
2251 Ga0207702_10221259
2252 Ga0207641_10007880
2253 Ga0207641_10055263
2254 Ga0207641_10056959
2255 Ga0207641_10081297
2256 Ga0207641_10592076
2257 Ga0207641_11366517
2258 Ga0207641_11441176
2259 Ga0207641_12165341
2260 Ga0207676_10003083
2261 Ga0207676_10014092
2262 Ga0207676_10118467
2263 Ga0207676_10319024
2264 Ga0207676_10619312
2265 Ga0207674_10022331
2266 Ga0207674_10022506
2267 Ga0207674_10066111
2268 Ga0207674_10432859
2269 Ga0207674_10594597
2270 Ga0207674_10611184
2271 Ga0207675_100001740
2272 Ga0207683_10004433
2273 Ga0207683_10011795
2274 Ga0207683_10165305
2275 Ga0207683_10270732
2276 Ga0207683_11098119
2277 Ga0207698_10076121
2278 Ga0207698_10118353
2279 Ga0207698_10209342
2280 Ga0207698_10742368
2281 Ga0207428_10052605
2282 Ga0268266_10106230
2283 Ga0268266_10120641
2284 Ga0268266_10457401
2285 Ga0268266_10711657
2286 Ga0268265_10075896
2287 Ga0268265_10910648
2288 Ga0268264_10000238
2289 Ga0268264_10134098
2290 Ga0268264_11166542
2291 Ga0268264_11604674
2292 Ga0265320_10525712
2293 Ga0307509_10156849
2294 Ga0307405_11315969
2295 Ga0307405_12151490
2296 Ga0307410_10348187
2297 Ga0307410_11530923
2298 Ga0307407_10357581
2299 Ga0307412_10219717
2300 Ga0307409_100116660
2301 Ga0307409_100921345
2302 Ga0307409_101072303
2303 Ga0307409_102546171
2304 Ga0307416_100175445
2305 Ga0307416_100286658
2306 Ga0307416_100766228
2307 Ga0307411_10795039
2308 Ga0307415_100217386
2309 Ga0307415_100239463
2310 Ga0307415_100530416
2311 Ga0307415_101729472
2312 Ga0373930_0008208
2313 Ga0373948_0013610
2314 Ga0373948_0074181
2315 Ga0373950_0021245
2316 Ga0373959_0104072
2317 Ga0373938_0007289
2318 Ga0373926_0001366
2319 Ga0373926_0010578
2320 Ga0373926_0024539
2321 Ga0373926_0291350
2322 Ga0373928_0061507
2323 Ga0373934_0000680
2324 Ga0373934_0001711
2325 Ga0373934_0012797
2326 Ga0373934_0083000
2327 Ga0373940_0022878
2328 Ga0373944_0001086
2329 Ga0373944_0001504
2330 Ga0373944_0002339
2331 Ga0373944_0257508
2332 Ga0373923_0000434
2333 Ga0373923_0002713
2334 Ga0373923_0026414
2335 Ga0373923_0090156
2336 Ga0373923_0118427
2337 Ga0373923_0201102
2338 Ga0373923_0308029
2339 Ga0373932_0023305
2340 Ga0373932_0024965
2341 Ga0373932_0351546
2342 Ga0373936_0000112
2343 Ga0373936_0004092
2344 Ga0373936_0007615
2345 Ga0373936_0015947
2346 Ga0373936_0076603
2347 Ga0373936_0140831
2348 Ga0373936_0182791
2349 Ga0373936_0633492
2350 Ga0373939_0018781
2351 Ga0373941_0169116
2352 Ga0373945_0000364
2353 Ga0373945_0006002
2354 Ga0373945_0006387
2355 Ga0373945_0294920
2356 Ga0373953_0000043
2357 Ga0373953_0000407
2358 Ga0373953_0015371
2359 Ga0373953_0062791
2360 Ga0373953_0137938
2361 Ga0373953_0217399
2362 Ga0373953_0296985
2363 Ga0373954_0001380
2364 Ga0373954_0004326
2365 Ga0373954_0017809
2366 Ga0373954_0084765
2367 Ga0373954_0155871
2368 Ga0373954_0661706
2369 Ga0373956_0000761
2370 Ga0373956_0002268
2371 Ga0373956_0035502
2372 Ga0373956_0187820
2373 Ga0373957_0000905
2374 Ga0373957_0001292
2375 Ga0373957_0014284
2376 Ga0373957_0018571
2377 Ga0373957_0106341
2378 Ga0373957_0214874
2379 Ga0373957_0272654
2380 Ga0373957_0305855
2381 Ga0373960_0002454
2382 Ga0373943_0000118
2383 Ga0373943_0003604
2384 Ga0373943_0016594
2385 Ga0373943_0024198
2386 Ga0373943_0146481
2387 Ga0373943_0261476
2388 Ga0373943_0482366
2389 Ga0373946_0000064
2390 Ga0373946_0005696
2391 Ga0373946_0016415
2392 Ga0373946_0068120
2393 Ga0373946_0150745
2394 Ga0373946_0307039
2395 Ga0373946_0432100
2396 Ga0373955_0000307
2397 Ga0373955_0001389
2398 Ga0373955_0010704
2399 Ga0373955_0061176
2400 Ga0373955_0070377
2401 Ga0373955_0101368
2402 Ga0373955_0109320
2403 Ga0373942_0005328
2404 Ga0373942_0058021
2405 Ga0373942_0114991
2406 Ga0373961_0195971
2407 Ga0373962_0011303
2408 Ga0373962_0190467
2409 Ga0373924_0000805
2410 Ga0373924_0002180
2411 Ga0373924_0004825
2412 Ga0373924_0047025
2413 Ga0373924_0536455
2414 Ga0373924_0552032
2415 Ga0373931_0000023
2416 Ga0373931_0005176
2417 Ga0373931_0216668
2418 Ga0373935_0001398
2419 Ga0373935_0010150
2420 Ga0373935_0011246
2421 Ga0373935_0042060
2422 Ga0373935_0120688
2423 Ga0373935_0137292
2424 Ga0373935_0287869
2425 Ga0373935_0916350
2426 Ga0373927_0003100
2427 Ga0373927_0015337
2428 Ga0373927_0017869
2429 Ga0373927_0090858
2430 Ga0373927_0218993
2431 Ga0373933_0000283
2432 Ga0373933_0003663
2433 Ga0373933_0014917
2434 Ga0373933_0017730
2435 Ga0373933_0019180
2436 Ga0373933_0230626
2437 Ga0373933_0304885
2438 Ga0373933_0630398
2439 Ga0373947_0012001
2440 Ga0373947_0016714
2441 Ga0373947_0046936
2442 Ga0373947_0133035
2443 Ga0373947_0161788
2444 Ga0373947_0295495
2445 Ga0373947_0414923
2446 Ga0373947_0625596
2447 Ga0373937_0000560
2448 Ga0373937_0005931
2449 Ga0373937_0011035
2450 Ga0373937_0014488
2451 Ga0373937_0017147
2452 Ga0373937_0144616
2453 Ga0373937_0261363
2454 Ga0373937_0455953
2455 Ga0373937_0715116
2456 Ga0373937_1285264
2457 Ga0373937_1494159
2458 Ga0373937_2123881
2459 Ga0373925_0003688
2460 Ga0373925_0004201
2461 Ga0373925_0006891
2462 Ga0373925_0014026
2463 Ga0373925_0077222
2464 Ga0373925_0098261
2465 Ga0373925_0447777
2466 Ga0373925_0649229
2467 Ga0373925_0754924
2468 Ga0373925_0816855
2469 Ga0373925_1229663
2470 Ga0395899_0927176
2471 Ga0395900_0463885
2472 Ga0395900_1012615
2473 Ga0395898_0053505
2474 Ga0395898_0168316
2475 Ga0395898_1480528
2476 Ga0395905_0061892
2477 Ga0395905_0095805
2478 Ga0395905_0202688
2479 Ga0436364_0626442
2480 Ga0395901_0003209
2481 Ga0395901_0010731
2482 Ga0395901_0022908
2483 Ga0395901_0033608
2484 Ga0395901_0349181
2485 Ga0395901_0892814
2486 Ga0436365_0904426
2487 Ga0451787_591939
2488 Ga0451789_0523819
2489 Ga0451791_0166158
2490 Ga0451791_0622792
2491 Ga0451793_0118808
2492 Ga0451793_1419480
2493 Ga0451797_0328055
2494 Ga0451800_0789169
2495 Ga0451833_1106457
2496 Ga0451833_1447573
2497 Ga0451839_1460976
2498 Ga0451849_0857468
2499 Ga0451851_0216177
2500 Ga0451843_0852902
2501 Ga0451853_3758868
2502 Ga0439448_0146704
2503 Ga0466969_0586825
2504 Ga0466966_0124347
2505 Ga0466963_0068227
2506 Ga0466963_0262770
2507 Ga0466963_0803224
2508 Ga0466960_0797287
2509 Ga0466959_0272089
2510 Ga0466958_0227802
2511 Ga0466958_0244552
2512 Ga0466958_0275866
2513 Ga0466958_0611728
2514 Ga0466967_0002837
2515 Ga0466967_0034625
2516 Ga0466967_0036093
2517 Ga0466967_0616530
2518 Ga0466967_0815095
2519 Ga0466967_1686854
2520 Ga0495592_0000403
2521 Ga0495592_0004793
2522 Ga0495592_0007493
2523 Ga0495592_0011572
2524 Ga0495592_0032960
2525 Ga0495592_0140351
2526 Ga0495603_0344594
2527 Ga0495603_0496127
2528 Ga0495629_0006468
2529 Ga0495629_0006516
2530 Ga0495629_0021000
2531 Ga0495629_0027475
2532 Ga0495629_0177274
2533 Ga0495629_0179305
2534 Ga0495641_0001329
2535 Ga0495641_0008248
2536 Ga0495641_0037010
2537 Ga0495641_0064419
2538 Ga0495651_0000499
2539 Ga0495651_0000629
2540 Ga0495651_0008111
2541 Ga0495651_0008484
2542 Ga0495651_0031929
2543 Ga0495651_0110928
2544 Ga0495651_0345015
2545 Ga0495653_0000784
2546 Ga0495653_0001785
2547 Ga0495653_0006323
2548 Ga0495653_0010486
2549 Ga0495653_0017714
2550 Ga0495653_0018669
2551 Ga0495653_0023443
2552 Ga0495653_0028193
2553 Ga0495653_0176303
2554 Ga0495653_0226269
2555 Ga0495653_0379975
2556 Ga0495653_0485614
2557 Ga0495580_0010540
2558 Ga0495580_0731998
2559 Ga0495582_0004671
2560 Ga0495582_0026415
2561 Ga0495582_0030798
2562 Ga0495582_0040194
2563 Ga0495582_0051612
2564 Ga0495605_0400083
2565 Ga0495639_0113720
2566 Ga0495639_0435760
2567 Ga0495639_0608007
2568 Ga0495639_0610811
2569 Ga0495662_0000450
2570 Ga0495662_0011923
2571 Ga0495662_0013265
2572 Ga0495662_0013987
2573 Ga0495662_0041720
2574 Ga0495662_0080753
2575 Ga0495664_0002021
2576 Ga0495664_0012667
2577 Ga0495664_0022552
2578 Ga0495664_0035870
2579 Ga0495664_0045276
2580 Ga0495664_0056990
2581 Ga0495664_0145399
2582 Ga0495664_0145489
2583 Ga0495664_0214734
2584 Ga0495664_0873330
2585 Ga0495584_0363344
2586 Ga0495585_0304231
2587 Ga0495594_0003675
2588 Ga0495594_0134358
2589 Ga0495607_0469941
2590 Ga0495583_0157298
2591 Ga0495608_0000310
2592 Ga0495608_0001991
2593 Ga0495608_0013836
2594 Ga0495608_0015411
2595 Ga0495608_0037626
2596 Ga0495608_0038866
2597 Ga0495608_0051321
2598 Ga0495608_0054003
2599 Ga0495608_0132775
2600 Ga0495608_0285431
2601 Ga0495608_0849973
2602 Ga0495618_0003806
2603 Ga0495618_0008293
2604 Ga0495618_0011730
2605 Ga0495618_0021086
2606 Ga0495618_0039492
2607 Ga0495618_0086836
2608 Ga0495628_0003764
2609 Ga0495628_0013037
2610 Ga0495628_0021978
2611 Ga0495628_0055250
2612 Ga0495628_0123378
2613 Ga0495628_0151725
2614 Ga0495628_0238910
2615 Ga0495628_0631134
2616 Ga0495630_0003016
2617 Ga0495630_0004973
2618 Ga0495630_0011591
2619 Ga0495630_0046931
2620 Ga0495630_0140899
2621 Ga0495630_0211786
2622 Ga0495630_0226255
2623 Ga0495630_0763886
2624 Ga0495648_0021050
2625 Ga0495663_0025407
2626 Ga0495666_0003315
2627 Ga0495666_0122066
2628 Ga0495666_0362833
2629 Ga0495652_0003138
2630 Ga0495652_0004652
2631 Ga0495652_0017741
2632 Ga0495652_0039172
2633 Ga0495652_0070916
2634 Ga0495652_0092455
2635 Ga0495652_0139327
2636 Ga0495652_0145617
2637 Ga0495652_0276328
2638 Ga0495665_0000852
2639 Ga0495665_0020020
2640 Ga0495665_0023068
2641 Ga0495665_0029037
2642 Ga0495665_0099980
2643 Ga0495640_0000992
2644 Ga0495640_0023597
2645 Ga0495640_0026763
2646 Ga0495640_0034290
2647 Ga0495640_0094023
2648 Ga0495640_0116348
2649 Ga0495640_0273941
2650 Ga0495586_0034025
2651 Ga0495586_0114977
2652 Ga0495586_0685291
2653 Ga0495587_0000348
2654 Ga0495587_0003250
2655 Ga0495587_0006890
2656 Ga0495587_0010228
2657 Ga0495587_0046591
2658 Ga0495587_0047295
2659 Ga0495587_0055754
2660 Ga0495587_0096864
2661 Ga0495587_0268098
2662 Ga0495609_0458658
2663 Ga0495645_0004292
2664 Ga0495645_0006831
2665 Ga0495645_0016495
2666 Ga0495645_0028737
2667 Ga0495645_0042680
2668 Ga0495645_0070256
2669 Ga0495645_0079380
2670 Ga0495645_0080814
2671 Ga0495645_0094953
2672 Ga0495645_0120593
2673 Ga0495645_0318675
2674 Ga0495667_0000353
2675 Ga0495667_0001265
2676 Ga0495667_0008594
2677 Ga0495667_0013460
2678 Ga0495667_0017945
2679 Ga0495667_0021774
2680 Ga0495667_0033601
2681 Ga0495667_0034736
2682 Ga0495667_0273906
2683 Ga0495667_0471113
2684 Ga0495667_0543689
2685 Ga0495656_0248378
2686 Ga0495656_0592167
2687 Ga0495668_0061673
2688 Ga0495668_0664543
2689 Ga0495634_0001947
2690 Ga0495634_0008618
2691 Ga0495634_0111299
2692 Ga0495634_0130784
2693 Ga0495634_0236717
2694 Ga0495634_0323748
2695 Ga0495634_0514517
2696 Ga0495635_0006559
2697 Ga0495635_0009824
2698 Ga0495635_0029723
2699 Ga0495635_0030189
2700 Ga0495635_0034921
2701 Ga0495635_0037022
2702 Ga0495635_0075458
2703 Ga0495635_0359309
2704 Ga0495635_0544619
2705 Ga0495659_0270438
2706 Ga0495661_0294118
2707 Ga0495588_0044788
2708 Ga0495588_0138864
2709 Ga0495657_0002166
2710 Ga0495657_0002176
2711 Ga0495657_0012650
2712 Ga0495657_0023699
2713 Ga0495657_0024050
2714 Ga0495657_0074522
2715 Ga0495657_0085202
2716 Ga0495657_0117501
2717 Ga0495657_0219379
2718 Ga0495657_0513308
2719 Ga0495657_0643083
2720 Ga0495657_0759569
2721 Ga0495599_0000267
2722 Ga0495599_0000894
2723 Ga0495599_0001817
2724 Ga0495599_0006456
2725 Ga0495599_0010888
2726 Ga0495599_0014766
2727 Ga0495599_0018140
2728 Ga0495599_0079146
2729 Ga0495599_0128017
2730 Ga0495599_0199913
2731 Ga0495599_0754412
2732 Ga0495623_0001940
2733 Ga0495623_0007666
2734 Ga0495623_0044190
2735 Ga0495623_0066047
2736 Ga0495646_0008644
2737 Ga0495646_0010256
2738 Ga0495646_0013681
2739 Ga0495646_0025322
2740 Ga0495646_0042643
2741 Ga0495646_0213075
2742 Ga0495646_0256060
2743 Ga0495646_0263139
2744 Ga0495646_0514998
2745 Ga0495647_0007560
2746 Ga0495647_0359022
2747 Ga0495658_0005104
2748 Ga0495658_0064971
2749 Ga0495658_0270344
2750 Ga0495658_0854600
2751 Ga0495613_0008946
2752 Ga0495613_0012223
2753 Ga0495613_0222909
2754 Ga0495613_0697975
2755 Ga0495613_0853831
2756 Ga0495624_0003764
2757 Ga0495624_0018876
2758 Ga0495624_0046945
2759 Ga0495624_0051058
2760 Ga0495624_0141997
2761 Ga0495624_0142746
2762 Ga0495624_0366358
2763 Ga0495624_0773303
2764 Ga0495670_0491385
2765 Ga0495649_0386539
2766 Ga0495600_0001242
2767 Ga0495600_0001286
2768 Ga0495600_0003324
2769 Ga0495600_0003483
2770 Ga0495600_0030510
2771 Ga0495600_0062392
2772 Ga0495600_0079066
2773 Ga0495600_0586391
2774 Ga0495581_0001028
2775 Ga0495581_0008227
2776 Ga0495581_0049465
2777 Ga0495581_0238187
2778 Ga0495581_0296385
2779 Ga0495581_0618467
2780 Ga0495604_0000550
2781 Ga0495604_0004599
2782 Ga0495604_0006607
2783 Ga0495604_0012698
2784 Ga0495604_0029989
2785 Ga0495604_0045966
2786 Ga0495604_0163644
2787 Ga0495604_0548945
2788 Ga0495636_0084328
2789 Ga0495674_0000590
2790 Ga0495674_0005002
2791 Ga0495674_0006374
2792 Ga0495674_0006392
2793 Ga0495674_0007829
2794 Ga0495674_0010942
2795 Ga0495674_0024200
2796 Ga0495674_0033926
2797 Ga0495674_0199721
2798 Ga0495672_0012718
2799 Ga0495672_0198051
2800 Ga0495676_0000954
2801 Ga0495676_0128560
2802 Ga0495676_0138887
2803 Ga0495676_0646499
2804 Ga0495680_0000904
2805 Ga0495680_0004224
2806 Ga0495680_0005938
2807 Ga0495680_0011425
2808 Ga0495680_0026146
2809 Ga0495680_0028636
2810 Ga0495680_0030765
2811 Ga0495680_0039607
2812 Ga0495680_0486645
2813 Ga0495675_0003298
2814 Ga0495675_0024148
2815 Ga0495675_0025904
2816 Ga0495675_0097522
2817 Ga0495675_0154449
2818 Ga0495675_0314679
2819 Ga0495675_0720556
2820 Ga0495677_0295495
2821 Ga0495673_0011306
2822 Ga0495684_0003309
2823 Ga0495684_0005014
2824 Ga0495684_0005115
2825 Ga0495684_0010003
2826 Ga0495684_0018088
2827 Ga0495684_0058010
2828 Ga0495684_0062861
2829 Ga0495684_0487047
2830 Ga0495684_0589865
2831 Ga0495684_0646589
2832 Ga0495593_0001796
2833 Ga0495593_0005834
2834 Ga0495593_0025918
2835 Ga0495593_0052138
2836 Ga0495593_0115266
2837 Ga0495593_0173969
2838 Ga0495593_0350587
2839 Ga0495593_0640296
2840 Ga0495602_0000631
2841 Ga0495602_0011014
2842 Ga0495602_0028399
2843 Ga0495602_0029254
2844 Ga0495602_0031883
2845 Ga0495602_0099556
2846 Ga0495602_0100285
2847 Ga0495602_0102694
2848 Ga0495614_0008860
2849 Ga0495614_0124294
2850 Ga0495614_0411875
2851 Ga0496100_0096290
2852 Ga0496100_0141566
2853 Ga0496100_0202315
2854 Ga0496100_0222530
2855 Ga0496100_0262835
2856 Ga0496100_0413435
2857 Ga0496100_1254091
2858 Ga0496101_0045495
2859 Ga0496101_0049889
2860 Ga0496101_0620998
2861 Ga0496101_0856598
2862 Ga0496101_1312592
2863 Ga0496101_1572744
2864 Ga0496102_0000080
2865 Ga0496102_0067624
2866 Ga0496102_0171188
2867 Ga0496102_0609187
2868 Ga0496102_0847969
2869 Ga0496103_0000118
2870 Ga0496103_0018985
2871 Ga0496103_0087157
2872 Ga0496104_0013883
2873 Ga0496104_0032231
2874 Ga0496104_0087034
2875 Ga0496104_0111366
2876 Ga0496104_0112715
2877 Ga0496104_0276032
2878 Ga0496104_0420557
2879 Ga0496105_0005906
2880 Ga0496105_0006129
2881 Ga0496105_0036164
2882 Ga0496105_0045749
2883 Ga0496105_0058446
2884 Ga0496105_0242632
2885 Ga0496105_0251894
2886 Ga0496105_0391730
2887 Ga0496105_0402689
2888 Ga0496105_0559348
2889 Ga0496105_1361106
2890 Ga0496106_0002362
2891 Ga0496106_0014659
2892 Ga0496106_0093873
2893 Ga0496106_0192401
2894 Ga0496107_0020401
2895 Ga0496107_0109891
2896 Ga0496107_0352800
2897 Ga0496107_0391691
2898 Ga0496107_0500081
2899 Ga0496108_0006269
2900 Ga0496108_0008118
2901 Ga0496108_0042290
2902 Ga0496108_0053659
2903 Ga0496108_0075171
2904 Ga0496108_0107438
2905 Ga0496108_0276256
2906 Ga0496108_0402570
2907 Ga0496108_0508385
2908 Ga0496108_0679481
2909 Ga0496108_0828574
2910 Ga0496109_0018225
2911 Ga0496109_0032488
2912 Ga0496109_0048849
2913 Ga0496109_0073072
2914 Ga0496109_0078626
2915 Ga0496109_0134444
2916 Ga0496109_0147756
2917 Ga0496109_0233899
2918 Ga0496109_0244941
2919 Ga0496109_0844428
2920 Ga0496110_0008783
2921 Ga0496110_0011473
2922 Ga0496110_0023374
2923 Ga0496110_0026333
2924 Ga0496110_0045767
2925 Ga0496110_0048126
2926 Ga0496110_0084204
2927 Ga0496110_0134331
2928 Ga0496110_0195037
2929 Ga0496110_0212470
2930 Ga0496111_0001546
2931 Ga0496111_0001962
2932 Ga0496111_0038431
2933 Ga0496111_0063060
2934 Ga0496111_0082038
2935 Ga0496111_0247808
2936 Ga0496111_0251210
2937 Ga0496111_0548406
2938 Ga0496111_0734068
2939 Ga0496112_0048983
2940 Ga0496112_0095416
2941 Ga0496112_0185705
2942 Ga0496112_0227027
2943 Ga0496112_0387555
2944 Ga0496112_0610749
2945 Ga0496112_0772629
2946 Ga0496113_0021573
2947 Ga0496113_0031252
2948 Ga0496113_0061647
2949 Ga0496113_0084473
2950 Ga0496113_0095021
2951 Ga0496113_0145551
2952 Ga0496113_0237866
2953 Ga0496113_0554789
2954 Ga0496113_1184216
2955 Ga0496114_0001467
2956 Ga0496114_0043065
2957 Ga0496114_0046271
2958 Ga0496114_0065861
2959 Ga0496114_0137311
2960 Ga0496114_0529744
2961 Ga0496114_0823780
2962 Ga0496114_1565768
2963 Ga0496115_0078901
2964 Ga0496115_0129927
2965 Ga0496115_0174786
2966 Ga0496115_0175042
2967 Ga0496115_0522133
2968 Ga0496115_0523540
2969 Ga0496115_0524258
2970 Ga0496116_0000493
2971 Ga0496117_0000287
2972 Ga0496118_0000266
2973 Ga0496119_0000558
2974 Ga0496119_0522511
2975 Ga0496120_0032642
2976 Ga0496121_0034602
2977 Ga0496121_0625834
2978 Ga0496124_0041754
2979 Ga0496125_0023352
2980 Ga0496126_0000383
2981 Ga0496126_0252559
2982 Ga0496126_0446431
2983 Ga0501032_0665548
2984 Ga0501036_0220862
2985 Ga0501041_0234612
2986 Ga0501041_0656155
2987 Ga0501042_0080546
2988 Ga0501046_0285155
2989 Ga0501047_0835889
2990 Ga0501048_0146684
2991 Ga0501067_0032391
2992 Ga0501067_0421803
2993 Ga0501068_0008894
2994 Ga0501068_0188942
2995 Ga0501069_0097667
2996 Ga0501069_0220456
2997 Ga0501069_0701459
2998 Ga0501071_0061910
2999 Ga0501071_1240029
3000 Ga0501072_0092972
3001 Ga0501075_0134936
3002 Ga0501076_0304532
3003 Ga0501079_0159797
3004 Ga0501080_0385241
3005 Ga0501035_1335924
3006 nmdc:mga03n38_109246_c1
3007 nmdc:mga00v17_34430_c1
3008 nmdc:mga06z11_1002683_c1
3009 nmdc:mga06z11_11055_c1
3010 nmdc:mga06z11_23889_c1
3011 nmdc:mga06z11_350278_c1
3012 nmdc:mga07m45_286566_c1
3013 nmdc:mga07m45_38864_c2
3014 nmdc:mga05p37_1044996_c1
3015 nmdc:mga09592_524590_c1
3016 nmdc:mga06r32_1436416_c1
3017 nmdc:mga06r32_1613458_c1
3018 nmdc:mga08y16_12180_c1
3019 nmdc:mga08y16_906774_c1
3020 nmdc:mga0n895_133729_c1
3021 nmdc:mga0n895_249911_c1
3022 nmdc:mga0rr50_1443566_c1
3023 nmdc:mga0rr50_345835_c1
3024 nmdc:mga0rr50_49138_c1
3025 nmdc:mga0rr50_874535_c1
3026 nmdc:mga0rr50_978519_c1
3027 nmdc:mga08x19_119332_c1
3028 nmdc:mga08x19_35567_c1
3029 nmdc:mga08x19_362749_c1
3030 nmdc:mga08x19_843530_c1
3031 nmdc:mga0a205_1415199_c1
3032 nmdc:mga0sz30_275557_c1
3033 Ga0495601_0061833
3034 Ga0495601_0089804
3035 Ga0495601_0103415
3036 Ga0495601_0124479
3037 Ga0495601_0199642
3038 Ga0495601_0230937
3039 Ga0495601_0250923
3040 Ga0495601_0259025
3041 Ga0495601_0321173
3042 Ga0495612_0067963
3043 Ga0495612_0141952
3044 Ga0495612_0437929
3045 Ga0495595_0007895
3046 Ga0495595_0009676
3047 Ga0495595_0085688
3048 Ga0495595_0151182
3049 Ga0495595_0275970
3050 Ga0495595_0486617
3051 Ga0495595_0522864
3052 Ga0495595_0711573
3053 Ga0495619_0001335
3054 Ga0495619_0016774
3055 Ga0495619_0019874
3056 Ga0495619_0120564
3057 Ga0495619_0724416
3058 Ga0500573_0073562
3059 Ga0501084_0119025
3060 Ga0590075_097874
3061 Ga0466962_0367469
3062 2855388217

MSA Aligner

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
1jx7-assembly1.cif.gz_E crystal structure of ychn protein from e.coli 0.815 2 121
1jx7-assembly1.cif.gz_E crystal structure of ychn protein from e.coli 0.8088 2 121
2qs7-assembly2.cif.gz_D crystal structure of a putative oxidoreductase of the dsre/dsrf-like family (sso1126) from sulfolobus solfataricus p2 at 2.09 a resolution 0.7963 2 121
3pnx-assembly2.cif.gz_E crystal structure of a putative sulfurtransferase dsre (swol_2425) from syntrophomonas wolfei str. goettingen at 1.92 a resolution 0.7942 2 121
3mc3-assembly1.cif.gz_A crystal structure of dsre/dsrf-like family protein (np_342589.1) from sulfolobus solfataricus at 1.49 a resolution 0.7892 2 121
ID Description Score Start End Superfamily
af_Q58170_143_270_3.40.1260.10 Alpha Beta;3-Layer(aba) Sandwich;Hypothetical Protein Ychn; Chain: A,;DsrEFH-like 0.8627 1 113 3.40.1260.10
af_Q58396_1_114_3.40.1260.10 Alpha Beta;3-Layer(aba) Sandwich;Hypothetical Protein Ychn; Chain: A,;DsrEFH-like 0.8399 4 121 3.40.1260.10
af_Q9TXZ5_1_281_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.8285 3 40 3.40.50.2000
af_Q58396_1_114_3.40.1260.10 Alpha Beta;3-Layer(aba) Sandwich;Hypothetical Protein Ychn; Chain: A,;DsrEFH-like 0.8266 4 121 3.40.1260.10
af_Q22180_1_276_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.8258 1 39 3.40.50.2000
ID Description Score Start End GO Terms
AF-A1SLX6-F1-model_v4 Peroxiredoxins-like protein 0.9982 3 121
AF-A0A5A7WDM2-F1-model_v4 Peroxiredoxin 0.9947 3 121
AF-A0A1I4ZLF0-F1-model_v4 Predicted peroxiredoxin 0.9928 2 121
AF-A0A850CJB2-F1-model_v4 Peroxiredoxin 0.9919 18 121
AF-A0A172ULQ7-F1-model_v4 Peroxiredoxin 0.9915 2 121

Map