F494600
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1531 | 407 | 3062 | 122 |
Family's Representative Sequence
| Representative Sequence | 3300017792|Ga0163161_10155684|Ga0163161_101556841 |
| Length | 128 |
| Sequence | MWHCFEREHHQNRKALQTSRWEAVMSKAVISLTTGLEDAEKVTVAFLVAVGAAEQGRPTLMFLTKEAVRLATQGIQRFATAGGTYLVCPICFTAKHLAERTLVENASLGGTVPMWQWIGDDPATTFSY |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 2 | 3300000549 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled | Metagenome | Rhizosphere |
| 3 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 4 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 5 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 6 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 7 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 11 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 13 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 15 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 17 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 45 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 51 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 53 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 54 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 56 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 62 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 64 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 65 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 66 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 68 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 69 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 70 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 71 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 72 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 73 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 74 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 75 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 76 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 77 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 78 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 79 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 81 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 82 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 83 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 84 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 85 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 86 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 87 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 89 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 90 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 91 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 92 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 93 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 94 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 95 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 96 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 98 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 99 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 114 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300012477 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.3.yng.040610 | Metagenome | Rhizosphere |
| 117 | 3300012481 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.1.yng.040610 | Metagenome | Rhizosphere |
| 118 | 3300012505 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 | Metagenome | Rhizosphere |
| 119 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 131 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 135 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 136 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 137 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 138 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 139 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 140 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 205 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 209 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 210 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 211 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 212 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 213 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 214 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 215 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 216 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 217 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 218 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 219 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 220 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 221 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 222 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 223 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 224 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 225 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 226 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 227 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 228 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 229 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 230 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 231 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 232 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 233 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 234 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 235 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 236 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 237 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 238 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 239 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 240 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 241 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 242 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 243 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 244 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 245 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 246 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 247 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 248 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 249 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 250 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 251 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 252 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 253 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 254 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 255 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 256 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 257 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 258 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 259 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 260 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 261 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 262 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 263 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 264 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 265 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 266 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 267 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 268 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 269 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 270 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 271 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 272 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 273 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 274 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 275 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 276 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 277 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 278 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 279 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 280 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 345 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 346 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 347 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 348 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 349 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 350 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 351 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 352 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 353 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 354 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 355 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 356 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 357 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 358 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 359 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 360 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 361 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 362 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 363 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 364 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 365 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 366 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 367 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 368 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 369 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 370 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 371 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 372 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 373 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 374 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 375 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 376 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 377 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 378 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 379 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 380 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 381 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 382 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 383 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 384 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 385 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 386 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 387 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 388 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 389 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 390 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 391 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 392 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 393 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 394 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 395 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 396 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 397 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 398 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 399 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 404 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 405 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 406 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 407 | 2855386786 | Nocardioides ferulae EGI 63112 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.09 |
| Metatranscriptomes | 0.85 |
| Isolates | 0.07 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.44 |
| Nodule | 0 |
| Rhizoplane | 8.3 |
| Rhizosphere | 88.57 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.57 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0163161_10155684 | 3300017792 | Bacteria | 1740 |
| 2 | LJQas_1011961 | 3300000549 | Bacteria | 1029 |
| 3 | LJQas_1023097 | 3300000549 | Bacteria | 723 |
| 4 | JGI24735J21928_10251130 | 3300002067 | Bacteria | 516 |
| 5 | JGI24738J21930_10064619 | 3300002075 | Bacteria | 753 |
| 6 | Ga0058863_10612682 | 3300004799 | Bacteria | 766 |
| 7 | Ga0058860_11186195 | 3300004801 | Bacteria | 680 |
| 8 | Ga0070658_10023397 | 3300005327 | Bacteria | 4960 |
| 9 | Ga0070658_10037521 | 3300005327 | Bacteria | 3907 |
| 10 | Ga0070658_10121585 | 3300005327 | Bacteria | 2169 |
| 11 | Ga0070658_10528685 | 3300005327 | Bacteria | 1020 |
| 12 | Ga0070676_10060352 | 3300005328 | Bacteria | 2252 |
| 13 | Ga0070676_10593529 | 3300005328 | Bacteria | 798 |
| 14 | Ga0070683_100001699 | 3300005329 | Bacteria | 17118 |
| 15 | Ga0070683_100047697 | 3300005329 | Bacteria | 3958 |
| 16 | Ga0070683_100427781 | 3300005329 | Bacteria | 1263 |
| 17 | Ga0070683_101338792 | 3300005329 | Unclassified | 688 |
| 18 | Ga0070690_100027487 | 3300005330 | Bacteria | 3517 |
| 19 | Ga0070670_100023461 | 3300005331 | Bacteria | 5311 |
| 20 | Ga0070670_101876058 | 3300005331 | Bacteria | 552 |
| 21 | Ga0068869_100392894 | 3300005334 | Bacteria | 1139 |
| 22 | Ga0068869_100510938 | 3300005334 | Bacteria | 1004 |
| 23 | Ga0068869_100695163 | 3300005334 | Bacteria | 867 |
| 24 | Ga0070666_10021818 | 3300005335 | Bacteria | 4151 |
| 25 | Ga0070666_10825669 | 3300005335 | Unclassified | 683 |
| 26 | Ga0070666_11096202 | 3300005335 | Bacteria | 592 |
| 27 | Ga0070680_100014339 | 3300005336 | Bacteria | 6190 |
| 28 | Ga0070680_100076787 | 3300005336 | Bacteria | 2750 |
| 29 | Ga0070680_100991985 | 3300005336 | Unclassified | 725 |
| 30 | Ga0070682_100026024 | 3300005337 | Bacteria | 3497 |
| 31 | Ga0070682_100206474 | 3300005337 | Bacteria | 1389 |
| 32 | Ga0070682_100700046 | 3300005337 | Unclassified | 812 |
| 33 | Ga0070682_101213558 | 3300005337 | Bacteria | 637 |
| 34 | Ga0068868_100029180 | 3300005338 | Bacteria | 4224 |
| 35 | Ga0068868_100057865 | 3300005338 | Bacteria | 3063 |
| 36 | Ga0068868_100065392 | 3300005338 | Bacteria | 2889 |
| 37 | Ga0068868_100123876 | 3300005338 | Bacteria | 2110 |
| 38 | Ga0068868_100389601 | 3300005338 | Bacteria | 1200 |
| 39 | Ga0070660_100068951 | 3300005339 | Bacteria | 2757 |
| 40 | Ga0070660_100204138 | 3300005339 | Bacteria | 1604 |
| 41 | Ga0070689_100063700 | 3300005340 | Bacteria | 2869 |
| 42 | Ga0070689_102096378 | 3300005340 | Bacteria | 518 |
| 43 | Ga0070691_10040534 | 3300005341 | Bacteria | 2201 |
| 44 | Ga0070691_10080353 | 3300005341 | Bacteria | 1595 |
| 45 | Ga0070691_10083867 | 3300005341 | Bacteria | 1564 |
| 46 | Ga0070691_10299174 | 3300005341 | Bacteria | 878 |
| 47 | Ga0070687_100034994 | 3300005343 | Bacteria | 2490 |
| 48 | Ga0070687_100422943 | 3300005343 | Bacteria | 879 |
| 49 | Ga0070687_101391130 | 3300005343 | Unclassified | 524 |
| 50 | Ga0070661_100025495 | 3300005344 | Bacteria | 4250 |
| 51 | Ga0070661_100219953 | 3300005344 | Bacteria | 1456 |
| 52 | Ga0070661_101159897 | 3300005344 | Bacteria | 645 |
| 53 | Ga0070692_10010845 | 3300005345 | Bacteria | 4166 |
| 54 | Ga0070692_10024048 | 3300005345 | Bacteria | 2990 |
| 55 | Ga0070692_10546143 | 3300005345 | Bacteria | 758 |
| 56 | Ga0070668_100072162 | 3300005347 | Bacteria | 2690 |
| 57 | Ga0070668_100161098 | 3300005347 | Bacteria | 1821 |
| 58 | Ga0070668_100248225 | 3300005347 | Bacteria | 1476 |
| 59 | Ga0070669_101949841 | 3300005353 | Bacteria | 513 |
| 60 | Ga0070675_100055064 | 3300005354 | Bacteria | 3273 |
| 61 | Ga0070675_101746010 | 3300005354 | Bacteria | 574 |
| 62 | Ga0070671_100014133 | 3300005355 | Bacteria | 6446 |
| 63 | Ga0070671_100025639 | 3300005355 | Bacteria | 4839 |
| 64 | Ga0070671_100132376 | 3300005355 | Unclassified | 2101 |
| 65 | Ga0070671_101052211 | 3300005355 | Unclassified | 714 |
| 66 | Ga0070674_100548365 | 3300005356 | Bacteria | 970 |
| 67 | Ga0070673_100688571 | 3300005364 | Bacteria | 938 |
| 68 | Ga0070673_100945666 | 3300005364 | Bacteria | 800 |
| 69 | Ga0070673_101474045 | 3300005364 | Bacteria | 641 |
| 70 | Ga0070659_100044719 | 3300005366 | Bacteria | 3468 |
| 71 | Ga0070659_100373154 | 3300005366 | Bacteria | 1200 |
| 72 | Ga0070659_100377429 | 3300005366 | Bacteria | 1194 |
| 73 | Ga0070667_100009304 | 3300005367 | Bacteria | 8144 |
| 74 | Ga0070667_100130116 | 3300005367 | Bacteria | 2196 |
| 75 | Ga0070667_100387130 | 3300005367 | Bacteria | 1271 |
| 76 | Ga0070667_101232172 | 3300005367 | Unclassified | 700 |
| 77 | Ga0070667_101485304 | 3300005367 | Unclassified | 636 |
| 78 | Ga0070667_101749621 | 3300005367 | Bacteria | 585 |
| 79 | Ga0070703_10010592 | 3300005406 | Bacteria | 2600 |
| 80 | Ga0070709_10006365 | 3300005434 | Bacteria | 6430 |
| 81 | Ga0070709_10082800 | 3300005434 | Bacteria | 2097 |
| 82 | Ga0070709_10160532 | 3300005434 | Bacteria | 1562 |
| 83 | Ga0070709_10558753 | 3300005434 | Bacteria | 876 |
| 84 | Ga0070709_10710757 | 3300005434 | Bacteria | 782 |
| 85 | Ga0070714_100014992 | 3300005435 | Bacteria | 6230 |
| 86 | Ga0070714_100018039 | 3300005435 | Bacteria | 5725 |
| 87 | Ga0070714_100021082 | 3300005435 | Bacteria | 5328 |
| 88 | Ga0070714_100104434 | 3300005435 | Bacteria | 2500 |
| 89 | Ga0070714_100155256 | 3300005435 | Bacteria | 2065 |
| 90 | Ga0070714_100169380 | 3300005435 | Bacteria | 1981 |
| 91 | Ga0070714_101035457 | 3300005435 | Bacteria | 799 |
| 92 | Ga0070714_101097391 | 3300005435 | Bacteria | 775 |
| 93 | Ga0070714_101195841 | 3300005435 | Bacteria | 741 |
| 94 | Ga0070714_101239510 | 3300005435 | Bacteria | 728 |
| 95 | Ga0070714_101382371 | 3300005435 | Unclassified | 687 |
| 96 | Ga0070714_101399915 | 3300005435 | Unclassified | 683 |
| 97 | Ga0070714_102373108 | 3300005435 | Bacteria | 515 |
| 98 | Ga0070713_100021596 | 3300005436 | Bacteria | 4955 |
| 99 | Ga0070713_100053924 | 3300005436 | Bacteria | 3333 |
| 100 | Ga0070713_100147268 | 3300005436 | Bacteria | 2091 |
| 101 | Ga0070713_100164782 | 3300005436 | Bacteria | 1981 |
| 102 | Ga0070713_100233325 | 3300005436 | Bacteria | 1673 |
| 103 | Ga0070713_100355728 | 3300005436 | Bacteria | 1359 |
| 104 | Ga0070713_100385556 | 3300005436 | Bacteria | 1306 |
| 105 | Ga0070713_101050503 | 3300005436 | Unclassified | 786 |
| 106 | Ga0070713_101100519 | 3300005436 | Bacteria | 768 |
| 107 | Ga0070713_101345798 | 3300005436 | Bacteria | 692 |
| 108 | Ga0070713_101550399 | 3300005436 | Bacteria | 643 |
| 109 | Ga0070713_102130804 | 3300005436 | Bacteria | 543 |
| 110 | Ga0070710_10013207 | 3300005437 | Bacteria | 4128 |
| 111 | Ga0070710_10034114 | 3300005437 | Bacteria | 2767 |
| 112 | Ga0070710_10043312 | 3300005437 | Bacteria | 2492 |
| 113 | Ga0070710_10047882 | 3300005437 | Bacteria | 2386 |
| 114 | Ga0070710_10783120 | 3300005437 | Bacteria | 680 |
| 115 | Ga0070710_11437229 | 3300005437 | Bacteria | 516 |
| 116 | Ga0070701_10143340 | 3300005438 | Bacteria | 1369 |
| 117 | Ga0070711_100003686 | 3300005439 | Bacteria | 8968 |
| 118 | Ga0070711_100020537 | 3300005439 | Bacteria | 4258 |
| 119 | Ga0070711_100099044 | 3300005439 | Bacteria | 2117 |
| 120 | Ga0070711_100704354 | 3300005439 | Bacteria | 850 |
| 121 | Ga0070711_100949517 | 3300005439 | Bacteria | 736 |
| 122 | Ga0070711_100971678 | 3300005439 | Bacteria | 728 |
| 123 | Ga0070705_100229804 | 3300005440 | Bacteria | 1290 |
| 124 | Ga0070700_100158026 | 3300005441 | Bacteria | 1557 |
| 125 | Ga0070700_102022028 | 3300005441 | Bacteria | 500 |
| 126 | Ga0070708_100029283 | 3300005445 | Bacteria | 4747 |
| 127 | Ga0070708_100151681 | 3300005445 | Bacteria | 2155 |
| 128 | Ga0070708_100458527 | 3300005445 | Bacteria | 1202 |
| 129 | Ga0070708_100473609 | 3300005445 | Bacteria | 1181 |
| 130 | Ga0070708_100582522 | 3300005445 | Bacteria | 1055 |
| 131 | Ga0070708_100863972 | 3300005445 | Bacteria | 850 |
| 132 | Ga0070708_100877258 | 3300005445 | Unclassified | 843 |
| 133 | Ga0070663_100016089 | 3300005455 | Bacteria | 4845 |
| 134 | Ga0070663_101278054 | 3300005455 | Bacteria | 647 |
| 135 | Ga0070663_101722833 | 3300005455 | Bacteria | 561 |
| 136 | Ga0070678_100003251 | 3300005456 | Bacteria | 9027 |
| 137 | Ga0070678_100029449 | 3300005456 | Bacteria | 3759 |
| 138 | Ga0070678_100058715 | 3300005456 | Bacteria | 2825 |
| 139 | Ga0070678_100120237 | 3300005456 | Bacteria | 2070 |
| 140 | Ga0070678_101278727 | 3300005456 | Bacteria | 682 |
| 141 | Ga0070662_100453507 | 3300005457 | Bacteria | 1065 |
| 142 | Ga0070662_100581614 | 3300005457 | Bacteria | 941 |
| 143 | Ga0070662_101435214 | 3300005457 | Bacteria | 595 |
| 144 | Ga0070681_10051750 | 3300005458 | Bacteria | 4096 |
| 145 | Ga0070681_10051977 | 3300005458 | Bacteria | 4086 |
| 146 | Ga0070681_10068358 | 3300005458 | Bacteria | 3519 |
| 147 | Ga0070681_10239215 | 3300005458 | Bacteria | 1729 |
| 148 | Ga0070685_10103221 | 3300005466 | Bacteria | 1744 |
| 149 | Ga0070685_10171648 | 3300005466 | Bacteria | 1390 |
| 150 | Ga0070685_10386349 | 3300005466 | Bacteria | 966 |
| 151 | Ga0070706_100009432 | 3300005467 | Bacteria | 9083 |
| 152 | Ga0070706_100035692 | 3300005467 | Bacteria | 4590 |
| 153 | Ga0070706_100041553 | 3300005467 | Bacteria | 4244 |
| 154 | Ga0070706_100050552 | 3300005467 | Unclassified | 3835 |
| 155 | Ga0070706_100141316 | 3300005467 | Bacteria | 2247 |
| 156 | Ga0070706_101258310 | 3300005467 | Bacteria | 679 |
| 157 | Ga0070707_100003621 | 3300005468 | Bacteria | 14571 |
| 158 | Ga0070707_100007443 | 3300005468 | Bacteria | 10169 |
| 159 | Ga0070707_100015400 | 3300005468 | Bacteria | 7175 |
| 160 | Ga0070707_100018081 | 3300005468 | Bacteria | 6631 |
| 161 | Ga0070707_100025227 | 3300005468 | Bacteria | 5638 |
| 162 | Ga0070707_100032684 | 3300005468 | Bacteria | 4957 |
| 163 | Ga0070707_100375396 | 3300005468 | Bacteria | 1381 |
| 164 | Ga0070707_100408752 | 3300005468 | Bacteria | 1318 |
| 165 | Ga0070707_100954413 | 3300005468 | Bacteria | 822 |
| 166 | Ga0070698_100000262 | 3300005471 | Bacteria | 53087 |
| 167 | Ga0070698_100024451 | 3300005471 | Bacteria | 6303 |
| 168 | Ga0070698_100053117 | 3300005471 | Unclassified | 4118 |
| 169 | Ga0070698_100189414 | 3300005471 | Bacteria | 1995 |
| 170 | Ga0070698_100508614 | 3300005471 | Bacteria | 1143 |
| 171 | Ga0070698_100819929 | 3300005471 | Bacteria | 875 |
| 172 | Ga0070699_100006212 | 3300005518 | Bacteria | 10428 |
| 173 | Ga0070699_100325971 | 3300005518 | Bacteria | 1381 |
| 174 | Ga0070699_100399782 | 3300005518 | Bacteria | 1242 |
| 175 | Ga0070699_101110480 | 3300005518 | Bacteria | 725 |
| 176 | Ga0070679_100029664 | 3300005530 | Bacteria | 5396 |
| 177 | Ga0070679_100126085 | 3300005530 | Bacteria | 2542 |
| 178 | Ga0070679_100162246 | 3300005530 | Bacteria | 2209 |
| 179 | Ga0070679_100474944 | 3300005530 | Bacteria | 1195 |
| 180 | Ga0070679_100553417 | 3300005530 | Bacteria | 1094 |
| 181 | Ga0070684_100010847 | 3300005535 | Bacteria | 7239 |
| 182 | Ga0070684_100067546 | 3300005535 | Bacteria | 3141 |
| 183 | Ga0070684_100089352 | 3300005535 | Bacteria | 2738 |
| 184 | Ga0070684_100161050 | 3300005535 | Bacteria | 2036 |
| 185 | Ga0070684_100275777 | 3300005535 | Bacteria | 1540 |
| 186 | Ga0070684_100286539 | 3300005535 | Bacteria | 1510 |
| 187 | Ga0070684_100341981 | 3300005535 | Bacteria | 1375 |
| 188 | Ga0070684_100633115 | 3300005535 | Bacteria | 995 |
| 189 | Ga0070697_100048257 | 3300005536 | Bacteria | 3452 |
| 190 | Ga0070697_100081954 | 3300005536 | Bacteria | 2659 |
| 191 | Ga0070697_100088613 | 3300005536 | Bacteria | 2556 |
| 192 | Ga0068853_100052879 | 3300005539 | Bacteria | 3497 |
| 193 | Ga0068853_100096222 | 3300005539 | Bacteria | 2612 |
| 194 | Ga0068853_100250633 | 3300005539 | Bacteria | 1624 |
| 195 | Ga0068853_100598158 | 3300005539 | Bacteria | 1047 |
| 196 | Ga0070672_100100915 | 3300005543 | Bacteria | 2341 |
| 197 | Ga0070672_100127991 | 3300005543 | Bacteria | 2085 |
| 198 | Ga0070686_100030199 | 3300005544 | Bacteria | 3304 |
| 199 | Ga0070686_100225219 | 3300005544 | Bacteria | 1357 |
| 200 | Ga0070686_101883889 | 3300005544 | Bacteria | 510 |
| 201 | Ga0070695_100039229 | 3300005545 | Bacteria | 2992 |
| 202 | Ga0070695_100769828 | 3300005545 | Bacteria | 769 |
| 203 | Ga0070696_100008840 | 3300005546 | Bacteria | 6736 |
| 204 | Ga0070696_100086709 | 3300005546 | Bacteria | 2223 |
| 205 | Ga0070696_100232544 | 3300005546 | Bacteria | 1387 |
| 206 | Ga0070693_100016669 | 3300005547 | Bacteria | 3806 |
| 207 | Ga0070693_100085929 | 3300005547 | Bacteria | 1886 |
| 208 | Ga0070693_100105242 | 3300005547 | Bacteria | 1726 |
| 209 | Ga0070693_100415535 | 3300005547 | Bacteria | 936 |
| 210 | Ga0070665_100233385 | 3300005548 | Bacteria | 1840 |
| 211 | Ga0070665_100411187 | 3300005548 | Bacteria | 1361 |
| 212 | Ga0070665_100535380 | 3300005548 | Bacteria | 1183 |
| 213 | Ga0070665_101057528 | 3300005548 | Bacteria | 823 |
| 214 | Ga0070704_100102286 | 3300005549 | Bacteria | 2162 |
| 215 | Ga0070704_102157184 | 3300005549 | Bacteria | 518 |
| 216 | Ga0068855_100172514 | 3300005563 | Bacteria | 2449 |
| 217 | Ga0068855_100205543 | 3300005563 | Bacteria | 2215 |
| 218 | Ga0068855_100477447 | 3300005563 | Bacteria | 1357 |
| 219 | Ga0070664_100110586 | 3300005564 | Bacteria | 2398 |
| 220 | Ga0070664_100471042 | 3300005564 | Bacteria | 1155 |
| 221 | Ga0070664_101455283 | 3300005564 | Bacteria | 648 |
| 222 | Ga0068857_100019129 | 3300005577 | Bacteria | 6011 |
| 223 | Ga0068857_100022281 | 3300005577 | Bacteria | 5572 |
| 224 | Ga0068857_100194944 | 3300005577 | Bacteria | 1846 |
| 225 | Ga0068857_100230967 | 3300005577 | Bacteria | 1692 |
| 226 | Ga0068857_100584706 | 3300005577 | Bacteria | 1054 |
| 227 | Ga0068857_100687925 | 3300005577 | Bacteria | 971 |
| 228 | Ga0068857_100871910 | 3300005577 | Unclassified | 862 |
| 229 | Ga0068857_101792343 | 3300005577 | Bacteria | 601 |
| 230 | Ga0068857_102029479 | 3300005577 | Bacteria | 564 |
| 231 | Ga0068854_100033477 | 3300005578 | Bacteria | 3583 |
| 232 | Ga0068854_100078421 | 3300005578 | Bacteria | 2433 |
| 233 | Ga0068854_101157063 | 3300005578 | Bacteria | 691 |
| 234 | Ga0068856_100067952 | 3300005614 | Bacteria | 3522 |
| 235 | Ga0068856_100111697 | 3300005614 | Bacteria | 2730 |
| 236 | Ga0068856_100148722 | 3300005614 | Bacteria | 2350 |
| 237 | Ga0068856_100154766 | 3300005614 | Bacteria | 2302 |
| 238 | Ga0068856_101586865 | 3300005614 | Unclassified | 668 |
| 239 | Ga0070702_100020073 | 3300005615 | Bacteria | 3495 |
| 240 | Ga0070702_100039107 | 3300005615 | Bacteria | 2645 |
| 241 | Ga0070702_100258063 | 3300005615 | Unclassified | 1185 |
| 242 | Ga0070702_101148672 | 3300005615 | Bacteria | 623 |
| 243 | Ga0068852_100081963 | 3300005616 | Bacteria | 2865 |
| 244 | Ga0068852_100082781 | 3300005616 | Bacteria | 2852 |
| 245 | Ga0068852_100264409 | 3300005616 | Bacteria | 1653 |
| 246 | Ga0068859_100089435 | 3300005617 | Bacteria | 3129 |
| 247 | Ga0068859_100126800 | 3300005617 | Bacteria | 2622 |
| 248 | Ga0068864_100025629 | 3300005618 | Bacteria | 4968 |
| 249 | Ga0068864_100092462 | 3300005618 | Bacteria | 2670 |
| 250 | Ga0068864_100204212 | 3300005618 | Bacteria | 1817 |
| 251 | Ga0068864_100267272 | 3300005618 | Bacteria | 1593 |
| 252 | Ga0068864_100342424 | 3300005618 | Bacteria | 1409 |
| 253 | Ga0068866_10206312 | 3300005718 | Unclassified | 1177 |
| 254 | Ga0068866_10932820 | 3300005718 | Unclassified | 613 |
| 255 | Ga0068861_100646322 | 3300005719 | Bacteria | 977 |
| 256 | Ga0068851_10562354 | 3300005834 | Bacteria | 690 |
| 257 | Ga0068851_10595832 | 3300005834 | Bacteria | 672 |
| 258 | Ga0068851_10644273 | 3300005834 | Bacteria | 648 |
| 259 | Ga0068851_10998933 | 3300005834 | Bacteria | 528 |
| 260 | Ga0068870_10003463 | 3300005840 | Bacteria | 6687 |
| 261 | Ga0068870_10005323 | 3300005840 | Bacteria | 5611 |
| 262 | Ga0068870_10720294 | 3300005840 | Bacteria | 690 |
| 263 | Ga0068863_100022113 | 3300005841 | Bacteria | 6071 |
| 264 | Ga0068863_100028645 | 3300005841 | Bacteria | 5317 |
| 265 | Ga0068863_100063677 | 3300005841 | Bacteria | 3488 |
| 266 | Ga0068863_100071316 | 3300005841 | Bacteria | 3286 |
| 267 | Ga0068863_100168023 | 3300005841 | Bacteria | 2104 |
| 268 | Ga0068863_100437274 | 3300005841 | Bacteria | 1283 |
| 269 | Ga0068863_100617686 | 3300005841 | Bacteria | 1074 |
| 270 | Ga0068863_102152782 | 3300005841 | Bacteria | 568 |
| 271 | Ga0068858_100107944 | 3300005842 | Bacteria | 2599 |
| 272 | Ga0068858_100300408 | 3300005842 | Bacteria | 1532 |
| 273 | Ga0068858_100562251 | 3300005842 | Bacteria | 1105 |
| 274 | Ga0068858_100577306 | 3300005842 | Bacteria | 1089 |
| 275 | Ga0068858_101399681 | 3300005842 | Bacteria | 689 |
| 276 | Ga0068860_100001468 | 3300005843 | Bacteria | 25481 |
| 277 | Ga0068860_100185759 | 3300005843 | Bacteria | 2010 |
| 278 | Ga0068860_101207576 | 3300005843 | Unclassified | 776 |
| 279 | Ga0068862_100971209 | 3300005844 | Bacteria | 839 |
| 280 | Ga0068862_101668719 | 3300005844 | Bacteria | 645 |
| 281 | Ga0081538_10130157 | 3300005981 | Bacteria | 1185 |
| 282 | Ga0070717_10016568 | 3300006028 | Bacteria | 5716 |
| 283 | Ga0070717_10025821 | 3300006028 | Bacteria | 4679 |
| 284 | Ga0070717_10038313 | 3300006028 | Bacteria | 3897 |
| 285 | Ga0070717_10061149 | 3300006028 | Bacteria | 3120 |
| 286 | Ga0070717_10098289 | 3300006028 | Bacteria | 2481 |
| 287 | Ga0070717_10128119 | 3300006028 | Bacteria | 2180 |
| 288 | Ga0070717_10158654 | 3300006028 | Bacteria | 1961 |
| 289 | Ga0070717_10166346 | 3300006028 | Bacteria | 1916 |
| 290 | Ga0070717_10184794 | 3300006028 | Bacteria | 1818 |
| 291 | Ga0070717_10293858 | 3300006028 | Bacteria | 1443 |
| 292 | Ga0070717_10311782 | 3300006028 | Bacteria | 1400 |
| 293 | Ga0070717_10451570 | 3300006028 | Bacteria | 1158 |
| 294 | Ga0070717_10556589 | 3300006028 | Bacteria | 1039 |
| 295 | Ga0070717_10557911 | 3300006028 | Bacteria | 1037 |
| 296 | Ga0070717_10567354 | 3300006028 | Bacteria | 1028 |
| 297 | Ga0070717_10581320 | 3300006028 | Bacteria | 1016 |
| 298 | Ga0070717_11817588 | 3300006028 | Bacteria | 551 |
| 299 | Ga0075363_100028144 | 3300006048 | Unclassified | 2888 |
| 300 | Ga0075363_100108468 | 3300006048 | Unclassified | 1541 |
| 301 | Ga0075363_100427993 | 3300006048 | Bacteria | 780 |
| 302 | Ga0075364_10029866 | 3300006051 | Bacteria | 3497 |
| 303 | Ga0075364_10455844 | 3300006051 | Bacteria | 874 |
| 304 | Ga0075364_11037452 | 3300006051 | Bacteria | 557 |
| 305 | Ga0075432_10047480 | 3300006058 | Bacteria | 1509 |
| 306 | Ga0070715_10033349 | 3300006163 | Bacteria | 2104 |
| 307 | Ga0070715_10041650 | 3300006163 | Bacteria | 1926 |
| 308 | Ga0070715_10398135 | 3300006163 | Bacteria | 765 |
| 309 | Ga0070716_100003620 | 3300006173 | Bacteria | 7302 |
| 310 | Ga0070716_100007387 | 3300006173 | Bacteria | 5406 |
| 311 | Ga0070716_100054172 | 3300006173 | Bacteria | 2290 |
| 312 | Ga0070716_100181400 | 3300006173 | Bacteria | 1382 |
| 313 | Ga0070716_100397085 | 3300006173 | Bacteria | 990 |
| 314 | Ga0070712_100009737 | 3300006175 | Bacteria | 6058 |
| 315 | Ga0070712_100200191 | 3300006175 | Bacteria | 1568 |
| 316 | Ga0070712_100266989 | 3300006175 | Bacteria | 1373 |
| 317 | Ga0070712_100350238 | 3300006175 | Bacteria | 1208 |
| 318 | Ga0070712_100365167 | 3300006175 | Bacteria | 1185 |
| 319 | Ga0070712_100459541 | 3300006175 | Bacteria | 1061 |
| 320 | Ga0070712_100690582 | 3300006175 | Bacteria | 869 |
| 321 | Ga0070712_101372186 | 3300006175 | Bacteria | 616 |
| 322 | Ga0075367_10048648 | 3300006178 | Bacteria | 2498 |
| 323 | Ga0075367_10082423 | 3300006178 | Bacteria | 1947 |
| 324 | Ga0075367_10292508 | 3300006178 | Bacteria | 1025 |
| 325 | Ga0097621_100240462 | 3300006237 | Bacteria | 1582 |
| 326 | Ga0097621_100603165 | 3300006237 | Bacteria | 1004 |
| 327 | Ga0097621_102164511 | 3300006237 | Bacteria | 532 |
| 328 | Ga0075370_10086526 | 3300006353 | Unclassified | 1805 |
| 329 | Ga0075370_10161801 | 3300006353 | Bacteria | 1314 |
| 330 | Ga0075370_10867557 | 3300006353 | Bacteria | 551 |
| 331 | Ga0068871_100053754 | 3300006358 | Bacteria | 3265 |
| 332 | Ga0068871_100113760 | 3300006358 | Bacteria | 2279 |
| 333 | Ga0068871_100575869 | 3300006358 | Bacteria | 1022 |
| 334 | Ga0068871_100947099 | 3300006358 | Bacteria | 800 |
| 335 | Ga0075428_100310957 | 3300006844 | Unclassified | 1694 |
| 336 | Ga0075428_100494663 | 3300006844 | Bacteria | 1308 |
| 337 | Ga0075428_100986690 | 3300006844 | Bacteria | 892 |
| 338 | Ga0075428_102178692 | 3300006844 | Bacteria | 572 |
| 339 | Ga0075431_100492855 | 3300006847 | Bacteria | 1217 |
| 340 | Ga0075431_101781862 | 3300006847 | Bacteria | 572 |
| 341 | Ga0075431_102166248 | 3300006847 | Bacteria | 510 |
| 342 | Ga0075434_100118657 | 3300006871 | Bacteria | 2659 |
| 343 | Ga0075434_100741802 | 3300006871 | Bacteria | 999 |
| 344 | Ga0075434_101115835 | 3300006871 | Bacteria | 802 |
| 345 | Ga0075429_100643607 | 3300006880 | Bacteria | 929 |
| 346 | Ga0075429_100938535 | 3300006880 | Bacteria | 757 |
| 347 | Ga0068865_100216770 | 3300006881 | Bacteria | 1494 |
| 348 | Ga0075436_100001878 | 3300006914 | Bacteria | 14437 |
| 349 | Ga0075436_100131148 | 3300006914 | Bacteria | 1758 |
| 350 | Ga0075436_100474941 | 3300006914 | Bacteria | 913 |
| 351 | Ga0075436_100688778 | 3300006914 | Bacteria | 757 |
| 352 | Ga0097620_100089437 | 3300006931 | Bacteria | 3129 |
| 353 | Ga0097620_100126798 | 3300006931 | Bacteria | 2622 |
| 354 | Ga0075435_100002133 | 3300007076 | Bacteria | 13029 |
| 355 | Ga0075435_101020311 | 3300007076 | Bacteria | 722 |
| 356 | Ga0075435_101625626 | 3300007076 | Bacteria | 567 |
| 357 | Ga0099795_10525849 | 3300007788 | Bacteria | 554 |
| 358 | Ga0105251_10022638 | 3300009011 | Bacteria | 3257 |
| 359 | Ga0105251_10110317 | 3300009011 | Bacteria | 1254 |
| 360 | Ga0105250_10055736 | 3300009092 | Bacteria | 1586 |
| 361 | Ga0105250_10217289 | 3300009092 | Bacteria | 810 |
| 362 | Ga0105240_10774981 | 3300009093 | Bacteria | 1041 |
| 363 | Ga0105240_11158502 | 3300009093 | Bacteria | 820 |
| 364 | Ga0111539_10409735 | 3300009094 | Bacteria | 1579 |
| 365 | Ga0111539_10420477 | 3300009094 | Bacteria | 1557 |
| 366 | Ga0111539_10541486 | 3300009094 | Bacteria | 1356 |
| 367 | Ga0111539_10606475 | 3300009094 | Bacteria | 1275 |
| 368 | Ga0111539_12315768 | 3300009094 | Bacteria | 623 |
| 369 | Ga0111539_12754439 | 3300009094 | Bacteria | 570 |
| 370 | Ga0111539_13150617 | 3300009094 | Bacteria | 532 |
| 371 | Ga0105245_10021795 | 3300009098 | Bacteria | 5623 |
| 372 | Ga0105245_10102903 | 3300009098 | Bacteria | 2645 |
| 373 | Ga0105245_10103666 | 3300009098 | Bacteria | 2636 |
| 374 | Ga0105245_10370565 | 3300009098 | Bacteria | 1424 |
| 375 | Ga0105245_10605173 | 3300009098 | Bacteria | 1123 |
| 376 | Ga0105245_10876152 | 3300009098 | Unclassified | 939 |
| 377 | Ga0105245_11093216 | 3300009098 | Bacteria | 843 |
| 378 | Ga0105245_11643832 | 3300009098 | Bacteria | 694 |
| 379 | Ga0105247_10041719 | 3300009101 | Bacteria | 2808 |
| 380 | Ga0105247_10197533 | 3300009101 | Bacteria | 1350 |
| 381 | Ga0105247_10210203 | 3300009101 | Bacteria | 1312 |
| 382 | Ga0105247_10236431 | 3300009101 | Unclassified | 1243 |
| 383 | Ga0105247_10355641 | 3300009101 | Bacteria | 1031 |
| 384 | Ga0105247_11250042 | 3300009101 | Bacteria | 594 |
| 385 | Ga0114129_11083433 | 3300009147 | Bacteria | 1004 |
| 386 | Ga0105243_10053779 | 3300009148 | Bacteria | 3195 |
| 387 | Ga0105243_10144776 | 3300009148 | Unclassified | 2032 |
| 388 | Ga0105241_10004425 | 3300009174 | Bacteria | 10390 |
| 389 | Ga0105241_11537861 | 3300009174 | Bacteria | 642 |
| 390 | Ga0105242_10055810 | 3300009176 | Bacteria | 3232 |
| 391 | Ga0105242_11050691 | 3300009176 | Unclassified | 825 |
| 392 | Ga0105248_10037443 | 3300009177 | Bacteria | 5427 |
| 393 | Ga0105248_10117068 | 3300009177 | Bacteria | 3005 |
| 394 | Ga0105248_10295438 | 3300009177 | Unclassified | 1824 |
| 395 | Ga0105248_10425492 | 3300009177 | Bacteria | 1495 |
| 396 | Ga0105248_10453208 | 3300009177 | Bacteria | 1445 |
| 397 | Ga0105248_10494595 | 3300009177 | Bacteria | 1379 |
| 398 | Ga0105237_10089102 | 3300009545 | Bacteria | 3075 |
| 399 | Ga0105237_10099944 | 3300009545 | Bacteria | 2892 |
| 400 | Ga0105237_10555669 | 3300009545 | Bacteria | 1154 |
| 401 | Ga0105237_10772052 | 3300009545 | Bacteria | 968 |
| 402 | Ga0105237_10999299 | 3300009545 | Bacteria | 843 |
| 403 | Ga0105238_10092785 | 3300009551 | Bacteria | 3007 |
| 404 | Ga0105238_10195691 | 3300009551 | Bacteria | 1997 |
| 405 | Ga0105238_10212597 | 3300009551 | Bacteria | 1910 |
| 406 | Ga0105238_11401670 | 3300009551 | Bacteria | 726 |
| 407 | Ga0105238_11754631 | 3300009551 | Bacteria | 652 |
| 408 | Ga0105249_10174447 | 3300009553 | Bacteria | 2087 |
| 409 | Ga0105249_10446733 | 3300009553 | Bacteria | 1331 |
| 410 | Ga0099796_10142736 | 3300010159 | Unclassified | 937 |
| 411 | Ga0099796_10436141 | 3300010159 | Bacteria | 580 |
| 412 | Ga0105239_10015531 | 3300010375 | Bacteria | 8433 |
| 413 | Ga0105239_10412884 | 3300010375 | Bacteria | 1529 |
| 414 | Ga0105239_10462196 | 3300010375 | Bacteria | 1440 |
| 415 | Ga0105239_10953153 | 3300010375 | Bacteria | 986 |
| 416 | Ga0105239_11135665 | 3300010375 | Bacteria | 900 |
| 417 | Ga0105246_10000911 | 3300011119 | Bacteria | 16930 |
| 418 | Ga0105246_10002762 | 3300011119 | Bacteria | 10621 |
| 419 | Ga0105246_10334884 | 3300011119 | Bacteria | 1235 |
| 420 | Ga0105246_10511030 | 3300011119 | Bacteria | 1022 |
| 421 | Ga0105246_11158464 | 3300011119 | Unclassified | 709 |
| 422 | Ga0157336_1035932 | 3300012477 | Unclassified | 515 |
| 423 | Ga0157320_1021744 | 3300012481 | Bacteria | 590 |
| 424 | Ga0157339_1032692 | 3300012505 | Bacteria | 617 |
| 425 | Ga0157373_10016278 | 3300013100 | Bacteria | 5426 |
| 426 | Ga0157371_10022649 | 3300013102 | Bacteria | 4597 |
| 427 | Ga0157371_10179736 | 3300013102 | Bacteria | 1513 |
| 428 | Ga0157371_10515940 | 3300013102 | Bacteria | 884 |
| 429 | Ga0157370_10030999 | 3300013104 | Bacteria | 5235 |
| 430 | Ga0157370_10116677 | 3300013104 | Bacteria | 2494 |
| 431 | Ga0157370_10869847 | 3300013104 | Bacteria | 819 |
| 432 | Ga0157370_11055178 | 3300013104 | Bacteria | 735 |
| 433 | Ga0157370_11858056 | 3300013104 | Bacteria | 540 |
| 434 | Ga0157369_10144321 | 3300013105 | Bacteria | 2517 |
| 435 | Ga0157369_10232574 | 3300013105 | Bacteria | 1927 |
| 436 | Ga0157369_11400628 | 3300013105 | Bacteria | 712 |
| 437 | Ga0157374_10114888 | 3300013296 | Bacteria | 2592 |
| 438 | Ga0157374_10330021 | 3300013296 | Bacteria | 1513 |
| 439 | Ga0157374_10353147 | 3300013296 | Bacteria | 1461 |
| 440 | Ga0157374_10666033 | 3300013296 | Unclassified | 1053 |
| 441 | Ga0157374_10786400 | 3300013296 | Bacteria | 967 |
| 442 | Ga0157374_11470969 | 3300013296 | Bacteria | 704 |
| 443 | Ga0157374_11806333 | 3300013296 | Bacteria | 637 |
| 444 | Ga0157378_10061143 | 3300013297 | Bacteria | 3360 |
| 445 | Ga0163162_10013188 | 3300013306 | Bacteria | 8071 |
| 446 | Ga0163162_10091111 | 3300013306 | Bacteria | 3131 |
| 447 | Ga0163162_10281421 | 3300013306 | Bacteria | 1795 |
| 448 | Ga0163162_10406105 | 3300013306 | Bacteria | 1495 |
| 449 | Ga0163162_12989434 | 3300013306 | Bacteria | 543 |
| 450 | Ga0157372_10015898 | 3300013307 | Bacteria | 8074 |
| 451 | Ga0157372_10378416 | 3300013307 | Bacteria | 1650 |
| 452 | Ga0157372_10509917 | 3300013307 | Bacteria | 1402 |
| 453 | Ga0157372_10575568 | 3300013307 | Bacteria | 1313 |
| 454 | Ga0157372_10966833 | 3300013307 | Bacteria | 987 |
| 455 | Ga0157372_11285556 | 3300013307 | Bacteria | 844 |
| 456 | Ga0157372_11975650 | 3300013307 | Bacteria | 670 |
| 457 | Ga0157375_10105486 | 3300013308 | Bacteria | 2908 |
| 458 | Ga0157375_10130023 | 3300013308 | Bacteria | 2636 |
| 459 | Ga0157375_10399179 | 3300013308 | Bacteria | 1542 |
| 460 | Ga0157375_10501827 | 3300013308 | Bacteria | 1377 |
| 461 | Ga0157375_12229913 | 3300013308 | Bacteria | 653 |
| 462 | Ga0157375_12945296 | 3300013308 | Bacteria | 569 |
| 463 | Ga0163163_10006286 | 3300014325 | Bacteria | 10370 |
| 464 | Ga0163163_10018303 | 3300014325 | Bacteria | 6553 |
| 465 | Ga0163163_10066480 | 3300014325 | Bacteria | 3580 |
| 466 | Ga0163163_10105620 | 3300014325 | Bacteria | 2842 |
| 467 | Ga0163163_10307075 | 3300014325 | Bacteria | 1639 |
| 468 | Ga0163163_10512402 | 3300014325 | Bacteria | 1262 |
| 469 | Ga0163163_10822136 | 3300014325 | Bacteria | 992 |
| 470 | Ga0163163_10838706 | 3300014325 | Bacteria | 983 |
| 471 | Ga0157380_10062530 | 3300014326 | Bacteria | 2982 |
| 472 | Ga0157380_12813348 | 3300014326 | Bacteria | 553 |
| 473 | Ga0182008_10404538 | 3300014497 | Bacteria | 734 |
| 474 | Ga0157377_10022293 | 3300014745 | Bacteria | 3341 |
| 475 | Ga0157377_10034766 | 3300014745 | Bacteria | 2759 |
| 476 | Ga0157377_10924745 | 3300014745 | Bacteria | 654 |
| 477 | Ga0157379_10029876 | 3300014968 | Bacteria | 4847 |
| 478 | Ga0157379_10045799 | 3300014968 | Bacteria | 3904 |
| 479 | Ga0157379_10906899 | 3300014968 | Bacteria | 836 |
| 480 | Ga0157379_12632932 | 3300014968 | Bacteria | 504 |
| 481 | Ga0157376_10195773 | 3300014969 | Bacteria | 1856 |
| 482 | Ga0157376_10298688 | 3300014969 | Bacteria | 1523 |
| 483 | Ga0157376_10953560 | 3300014969 | Bacteria | 878 |
| 484 | Ga0157376_11019454 | 3300014969 | Unclassified | 851 |
| 485 | Ga0157376_11293753 | 3300014969 | Bacteria | 759 |
| 486 | Ga0163161_10274120 | 3300017792 | Unclassified | 1321 |
| 487 | Ga0163161_10519693 | 3300017792 | Bacteria | 972 |
| 488 | Ga0163161_11860860 | 3300017792 | Bacteria | 536 |
| 489 | Ga0206356_10176058 | 3300020070 | Bacteria | 1972 |
| 490 | Ga0206356_10740431 | 3300020070 | Bacteria | 1192 |
| 491 | Ga0206350_10816149 | 3300020080 | Bacteria | 941 |
| 492 | Ga0206354_10405810 | 3300020081 | Bacteria | 2572 |
| 493 | Ga0206354_10777851 | 3300020081 | Bacteria | 3442 |
| 494 | Ga0206354_11274633 | 3300020081 | Bacteria | 1571 |
| 495 | Ga0206353_10425410 | 3300020082 | Bacteria | 4949 |
| 496 | Ga0206353_10452870 | 3300020082 | Bacteria | 2512 |
| 497 | Ga0206353_10710564 | 3300020082 | Bacteria | 1803 |
| 498 | Ga0206353_10787633 | 3300020082 | Bacteria | 528 |
| 499 | Ga0206353_11644540 | 3300020082 | Bacteria | 1132 |
| 500 | Ga0213875_10065940 | 3300021388 | Bacteria | 1692 |
| 501 | Ga0224572_1088459 | 3300024225 | Bacteria | 571 |
| 502 | Ga0207656_10272398 | 3300025321 | Bacteria | 833 |
| 503 | Ga0207656_10399755 | 3300025321 | Bacteria | 690 |
| 504 | Ga0207713_1122559 | 3300025735 | Bacteria | 870 |
| 505 | Ga0207653_10007655 | 3300025885 | Bacteria | 3369 |
| 506 | Ga0207682_10162617 | 3300025893 | Bacteria | 1012 |
| 507 | Ga0207692_10006312 | 3300025898 | Bacteria | 4803 |
| 508 | Ga0207692_10007738 | 3300025898 | Bacteria | 4415 |
| 509 | Ga0207692_10019386 | 3300025898 | Bacteria | 3073 |
| 510 | Ga0207692_10033931 | 3300025898 | Bacteria | 2467 |
| 511 | Ga0207692_10045357 | 3300025898 | Bacteria | 2198 |
| 512 | Ga0207692_11024196 | 3300025898 | Bacteria | 545 |
| 513 | Ga0207710_10051115 | 3300025900 | Bacteria | 1856 |
| 514 | Ga0207710_10088489 | 3300025900 | Bacteria | 1446 |
| 515 | Ga0207710_10161269 | 3300025900 | Bacteria | 1092 |
| 516 | Ga0207710_10355049 | 3300025900 | Unclassified | 747 |
| 517 | Ga0207688_10010832 | 3300025901 | Bacteria | 4960 |
| 518 | Ga0207688_10022892 | 3300025901 | Bacteria | 3420 |
| 519 | Ga0207680_10203512 | 3300025903 | Bacteria | 1350 |
| 520 | Ga0207647_10105804 | 3300025904 | Bacteria | 1666 |
| 521 | Ga0207647_10144274 | 3300025904 | Bacteria | 1394 |
| 522 | Ga0207647_10289066 | 3300025904 | Bacteria | 935 |
| 523 | Ga0207647_10409557 | 3300025904 | Bacteria | 763 |
| 524 | Ga0207685_10047409 | 3300025905 | Bacteria | 1640 |
| 525 | Ga0207685_10252940 | 3300025905 | Unclassified | 853 |
| 526 | Ga0207685_10780676 | 3300025905 | Bacteria | 525 |
| 527 | Ga0207685_10785239 | 3300025905 | Unclassified | 524 |
| 528 | Ga0207699_10002728 | 3300025906 | Bacteria | 8353 |
| 529 | Ga0207699_10003786 | 3300025906 | Bacteria | 7220 |
| 530 | Ga0207699_10013262 | 3300025906 | Bacteria | 4214 |
| 531 | Ga0207699_10048280 | 3300025906 | Bacteria | 2500 |
| 532 | Ga0207699_10048764 | 3300025906 | Bacteria | 2489 |
| 533 | Ga0207699_10050166 | 3300025906 | Bacteria | 2459 |
| 534 | Ga0207699_10069771 | 3300025906 | Bacteria | 2144 |
| 535 | Ga0207699_10275547 | 3300025906 | Bacteria | 1167 |
| 536 | Ga0207699_10850360 | 3300025906 | Bacteria | 672 |
| 537 | Ga0207645_10060893 | 3300025907 | Bacteria | 2411 |
| 538 | Ga0207643_10000496 | 3300025908 | Bacteria | 25178 |
| 539 | Ga0207643_10020391 | 3300025908 | Bacteria | 3638 |
| 540 | Ga0207705_10010928 | 3300025909 | Bacteria | 6591 |
| 541 | Ga0207705_10090058 | 3300025909 | Bacteria | 2245 |
| 542 | Ga0207705_11539525 | 3300025909 | Bacteria | 503 |
| 543 | Ga0207684_10001614 | 3300025910 | Bacteria | 23943 |
| 544 | Ga0207684_10035004 | 3300025910 | Bacteria | 4265 |
| 545 | Ga0207684_10125552 | 3300025910 | Bacteria | 2202 |
| 546 | Ga0207684_10363047 | 3300025910 | Unclassified | 1246 |
| 547 | Ga0207684_10523733 | 3300025910 | Bacteria | 1015 |
| 548 | Ga0207684_11067101 | 3300025910 | Unclassified | 673 |
| 549 | Ga0207654_10034578 | 3300025911 | Bacteria | 2809 |
| 550 | Ga0207707_10162644 | 3300025912 | Bacteria | 1951 |
| 551 | Ga0207707_10362759 | 3300025912 | Bacteria | 1247 |
| 552 | Ga0207707_10878196 | 3300025912 | Bacteria | 742 |
| 553 | Ga0207695_10193541 | 3300025913 | Bacteria | 1950 |
| 554 | Ga0207695_10568317 | 3300025913 | Bacteria | 1015 |
| 555 | Ga0207695_10901219 | 3300025913 | Bacteria | 764 |
| 556 | Ga0207671_10031423 | 3300025914 | Bacteria | 3957 |
| 557 | Ga0207671_10034855 | 3300025914 | Bacteria | 3739 |
| 558 | Ga0207671_10040115 | 3300025914 | Bacteria | 3466 |
| 559 | Ga0207671_11342194 | 3300025914 | Bacteria | 556 |
| 560 | Ga0207671_11491873 | 3300025914 | Unclassified | 522 |
| 561 | Ga0207693_10009761 | 3300025915 | Bacteria | 7815 |
| 562 | Ga0207693_10015285 | 3300025915 | Bacteria | 6160 |
| 563 | Ga0207693_10016363 | 3300025915 | Bacteria | 5928 |
| 564 | Ga0207693_10056142 | 3300025915 | Bacteria | 3088 |
| 565 | Ga0207693_10281884 | 3300025915 | Bacteria | 1302 |
| 566 | Ga0207693_10765227 | 3300025915 | Bacteria | 746 |
| 567 | Ga0207693_10943401 | 3300025915 | Bacteria | 661 |
| 568 | Ga0207663_10014592 | 3300025916 | Bacteria | 4307 |
| 569 | Ga0207663_10023610 | 3300025916 | Bacteria | 3531 |
| 570 | Ga0207663_10030578 | 3300025916 | Bacteria | 3177 |
| 571 | Ga0207663_10038132 | 3300025916 | Bacteria | 2902 |
| 572 | Ga0207663_10081774 | 3300025916 | Bacteria | 2117 |
| 573 | Ga0207663_10157445 | 3300025916 | Bacteria | 1599 |
| 574 | Ga0207663_10299864 | 3300025916 | Bacteria | 1200 |
| 575 | Ga0207663_10679136 | 3300025916 | Bacteria | 814 |
| 576 | Ga0207660_10057642 | 3300025917 | Bacteria | 2782 |
| 577 | Ga0207660_10750913 | 3300025917 | Bacteria | 796 |
| 578 | Ga0207662_10036568 | 3300025918 | Bacteria | 2870 |
| 579 | Ga0207662_10069250 | 3300025918 | Bacteria | 2132 |
| 580 | Ga0207657_10001570 | 3300025919 | Bacteria | 24516 |
| 581 | Ga0207657_10003201 | 3300025919 | Bacteria | 17523 |
| 582 | Ga0207649_10051809 | 3300025920 | Bacteria | 2543 |
| 583 | Ga0207649_10219069 | 3300025920 | Bacteria | 1354 |
| 584 | Ga0207652_10102775 | 3300025921 | Bacteria | 2526 |
| 585 | Ga0207652_10351536 | 3300025921 | Bacteria | 1330 |
| 586 | Ga0207652_10529532 | 3300025921 | Bacteria | 1060 |
| 587 | Ga0207652_10548320 | 3300025921 | Bacteria | 1039 |
| 588 | Ga0207652_11200975 | 3300025921 | Bacteria | 660 |
| 589 | Ga0207646_10000730 | 3300025922 | Bacteria | 42664 |
| 590 | Ga0207646_10004440 | 3300025922 | Bacteria | 15223 |
| 591 | Ga0207646_10025590 | 3300025922 | Bacteria | 5398 |
| 592 | Ga0207646_10030829 | 3300025922 | Bacteria | 4858 |
| 593 | Ga0207646_10034104 | 3300025922 | Bacteria | 4600 |
| 594 | Ga0207646_10536770 | 3300025922 | Bacteria | 1052 |
| 595 | Ga0207646_10891710 | 3300025922 | Bacteria | 789 |
| 596 | Ga0207646_10905292 | 3300025922 | Bacteria | 782 |
| 597 | Ga0207646_11323635 | 3300025922 | Bacteria | 628 |
| 598 | Ga0207681_10325822 | 3300025923 | Bacteria | 1223 |
| 599 | Ga0207694_10091265 | 3300025924 | Bacteria | 2404 |
| 600 | Ga0207694_10114650 | 3300025924 | Bacteria | 2146 |
| 601 | Ga0207650_10047958 | 3300025925 | Bacteria | 3149 |
| 602 | Ga0207650_11914005 | 3300025925 | Bacteria | 501 |
| 603 | Ga0207659_10042494 | 3300025926 | Bacteria | 3188 |
| 604 | Ga0207659_11026881 | 3300025926 | Bacteria | 709 |
| 605 | Ga0207687_10028626 | 3300025927 | Bacteria | 3743 |
| 606 | Ga0207687_10029737 | 3300025927 | Bacteria | 3677 |
| 607 | Ga0207687_10136910 | 3300025927 | Bacteria | 1853 |
| 608 | Ga0207687_10699495 | 3300025927 | Bacteria | 860 |
| 609 | Ga0207687_10740131 | 3300025927 | Bacteria | 836 |
| 610 | Ga0207687_10793132 | 3300025927 | Unclassified | 808 |
| 611 | Ga0207700_10005381 | 3300025928 | Bacteria | 7647 |
| 612 | Ga0207700_10015658 | 3300025928 | Bacteria | 5011 |
| 613 | Ga0207700_10019874 | 3300025928 | Bacteria | 4546 |
| 614 | Ga0207700_10049185 | 3300025928 | Bacteria | 3135 |
| 615 | Ga0207700_10085867 | 3300025928 | Bacteria | 2471 |
| 616 | Ga0207700_10104226 | 3300025928 | Bacteria | 2269 |
| 617 | Ga0207700_10169506 | 3300025928 | Bacteria | 1820 |
| 618 | Ga0207700_10250792 | 3300025928 | Bacteria | 1512 |
| 619 | Ga0207700_10392918 | 3300025928 | Bacteria | 1214 |
| 620 | Ga0207700_10393011 | 3300025928 | Bacteria | 1214 |
| 621 | Ga0207700_10393533 | 3300025928 | Bacteria | 1213 |
| 622 | Ga0207700_10397068 | 3300025928 | Bacteria | 1208 |
| 623 | Ga0207700_10853689 | 3300025928 | Bacteria | 815 |
| 624 | Ga0207700_10962249 | 3300025928 | Bacteria | 764 |
| 625 | Ga0207700_11052637 | 3300025928 | Bacteria | 728 |
| 626 | Ga0207700_11268885 | 3300025928 | Bacteria | 657 |
| 627 | Ga0207664_10003798 | 3300025929 | Bacteria | 10139 |
| 628 | Ga0207664_10006386 | 3300025929 | Bacteria | 8107 |
| 629 | Ga0207664_10019371 | 3300025929 | Bacteria | 5028 |
| 630 | Ga0207664_10020570 | 3300025929 | Bacteria | 4894 |
| 631 | Ga0207664_10026600 | 3300025929 | Bacteria | 4375 |
| 632 | Ga0207664_10028683 | 3300025929 | Bacteria | 4232 |
| 633 | Ga0207664_10036385 | 3300025929 | Bacteria | 3805 |
| 634 | Ga0207664_10038300 | 3300025929 | Bacteria | 3717 |
| 635 | Ga0207664_10049665 | 3300025929 | Bacteria | 3304 |
| 636 | Ga0207664_10122625 | 3300025929 | Bacteria | 2177 |
| 637 | Ga0207664_10143552 | 3300025929 | Bacteria | 2022 |
| 638 | Ga0207664_10204908 | 3300025929 | Bacteria | 1704 |
| 639 | Ga0207664_10436927 | 3300025929 | Bacteria | 1167 |
| 640 | Ga0207664_10448756 | 3300025929 | Bacteria | 1151 |
| 641 | Ga0207664_10453379 | 3300025929 | Bacteria | 1145 |
| 642 | Ga0207664_10503611 | 3300025929 | Bacteria | 1084 |
| 643 | Ga0207664_10592752 | 3300025929 | Bacteria | 995 |
| 644 | Ga0207664_11064488 | 3300025929 | Bacteria | 724 |
| 645 | Ga0207664_11284839 | 3300025929 | Unclassified | 651 |
| 646 | Ga0207664_11601984 | 3300025929 | Bacteria | 573 |
| 647 | Ga0207644_10006975 | 3300025931 | Bacteria | 7357 |
| 648 | Ga0207644_10146563 | 3300025931 | Unclassified | 1823 |
| 649 | Ga0207644_10163812 | 3300025931 | Bacteria | 1730 |
| 650 | Ga0207644_11387039 | 3300025931 | Bacteria | 590 |
| 651 | Ga0207690_10090943 | 3300025932 | Bacteria | 2156 |
| 652 | Ga0207706_10283643 | 3300025933 | Bacteria | 1444 |
| 653 | Ga0207686_10163599 | 3300025934 | Bacteria | 1562 |
| 654 | Ga0207686_10233310 | 3300025934 | Bacteria | 1335 |
| 655 | Ga0207686_10931356 | 3300025934 | Unclassified | 702 |
| 656 | Ga0207709_10027447 | 3300025935 | Bacteria | 3280 |
| 657 | Ga0207709_10071468 | 3300025935 | Bacteria | 2204 |
| 658 | Ga0207709_10162519 | 3300025935 | Unclassified | 1559 |
| 659 | Ga0207670_11241618 | 3300025936 | Unclassified | 631 |
| 660 | Ga0207704_10144598 | 3300025938 | Bacteria | 1668 |
| 661 | Ga0207704_11181954 | 3300025938 | Bacteria | 652 |
| 662 | Ga0207665_10025878 | 3300025939 | Bacteria | 3871 |
| 663 | Ga0207665_10041787 | 3300025939 | Bacteria | 3064 |
| 664 | Ga0207665_10042368 | 3300025939 | Bacteria | 3043 |
| 665 | Ga0207665_10062747 | 3300025939 | Bacteria | 2522 |
| 666 | Ga0207665_10109286 | 3300025939 | Bacteria | 1941 |
| 667 | Ga0207691_10023810 | 3300025940 | Bacteria | 5763 |
| 668 | Ga0207691_10090998 | 3300025940 | Bacteria | 2734 |
| 669 | Ga0207691_10597842 | 3300025940 | Bacteria | 934 |
| 670 | Ga0207711_10064839 | 3300025941 | Bacteria | 3156 |
| 671 | Ga0207711_10466795 | 3300025941 | Bacteria | 1175 |
| 672 | Ga0207711_10508054 | 3300025941 | Bacteria | 1123 |
| 673 | Ga0207711_10516961 | 3300025941 | Bacteria | 1113 |
| 674 | Ga0207711_11529205 | 3300025941 | Unclassified | 610 |
| 675 | Ga0207689_10003762 | 3300025942 | Bacteria | 13821 |
| 676 | Ga0207689_10011201 | 3300025942 | Bacteria | 7695 |
| 677 | Ga0207689_10403932 | 3300025942 | Bacteria | 1139 |
| 678 | Ga0207689_11257662 | 3300025942 | Bacteria | 622 |
| 679 | Ga0207661_10005461 | 3300025944 | Bacteria | 8963 |
| 680 | Ga0207661_10008656 | 3300025944 | Bacteria | 7272 |
| 681 | Ga0207661_10025595 | 3300025944 | Bacteria | 4488 |
| 682 | Ga0207661_10276564 | 3300025944 | Bacteria | 1500 |
| 683 | Ga0207661_10471709 | 3300025944 | Bacteria | 1145 |
| 684 | Ga0207661_11592882 | 3300025944 | Bacteria | 598 |
| 685 | Ga0207679_10051928 | 3300025945 | Bacteria | 3004 |
| 686 | Ga0207679_10324926 | 3300025945 | Bacteria | 1333 |
| 687 | Ga0207679_10693691 | 3300025945 | Bacteria | 923 |
| 688 | Ga0207667_10055804 | 3300025949 | Bacteria | 4151 |
| 689 | Ga0207667_10173637 | 3300025949 | Bacteria | 2215 |
| 690 | Ga0207667_10180185 | 3300025949 | Bacteria | 2170 |
| 691 | Ga0207667_10453567 | 3300025949 | Bacteria | 1303 |
| 692 | Ga0207712_11221743 | 3300025961 | Bacteria | 671 |
| 693 | Ga0207712_12015271 | 3300025961 | Bacteria | 517 |
| 694 | Ga0207668_10001182 | 3300025972 | Bacteria | 15503 |
| 695 | Ga0207668_10039018 | 3300025972 | Bacteria | 3193 |
| 696 | Ga0207668_10106177 | 3300025972 | Bacteria | 2097 |
| 697 | Ga0207640_10165330 | 3300025981 | Bacteria | 1642 |
| 698 | Ga0207658_10091618 | 3300025986 | Bacteria | 2359 |
| 699 | Ga0207658_10108260 | 3300025986 | Bacteria | 2192 |
| 700 | Ga0207658_10301720 | 3300025986 | Bacteria | 1380 |
| 701 | Ga0207677_10057222 | 3300026023 | Bacteria | 2676 |
| 702 | Ga0207677_10613299 | 3300026023 | Bacteria | 956 |
| 703 | Ga0207677_10622459 | 3300026023 | Bacteria | 949 |
| 704 | Ga0207677_11444875 | 3300026023 | Unclassified | 634 |
| 705 | Ga0207703_10050602 | 3300026035 | Bacteria | 3364 |
| 706 | Ga0207703_10514207 | 3300026035 | Bacteria | 1125 |
| 707 | Ga0207639_10089364 | 3300026041 | Bacteria | 2461 |
| 708 | Ga0207639_10161702 | 3300026041 | Bacteria | 1887 |
| 709 | Ga0207639_10248352 | 3300026041 | Bacteria | 1550 |
| 710 | Ga0207639_11054359 | 3300026041 | Bacteria | 762 |
| 711 | Ga0207678_10053854 | 3300026067 | Bacteria | 3466 |
| 712 | Ga0207678_10056882 | 3300026067 | Bacteria | 3366 |
| 713 | Ga0207678_10483575 | 3300026067 | Bacteria | 1078 |
| 714 | Ga0207708_10058212 | 3300026075 | Bacteria | 2949 |
| 715 | Ga0207702_10027472 | 3300026078 | Bacteria | 4725 |
| 716 | Ga0207702_10054053 | 3300026078 | Bacteria | 3402 |
| 717 | Ga0207702_10060477 | 3300026078 | Bacteria | 3230 |
| 718 | Ga0207702_10089831 | 3300026078 | Bacteria | 2687 |
| 719 | Ga0207702_10201222 | 3300026078 | Bacteria | 1846 |
| 720 | Ga0207702_10221259 | 3300026078 | Bacteria | 1764 |
| 721 | Ga0207641_10007880 | 3300026088 | Bacteria | 8834 |
| 722 | Ga0207641_10055263 | 3300026088 | Bacteria | 3371 |
| 723 | Ga0207641_10056959 | 3300026088 | Bacteria | 3323 |
| 724 | Ga0207641_10081297 | 3300026088 | Bacteria | 2813 |
| 725 | Ga0207641_10592076 | 3300026088 | Bacteria | 1085 |
| 726 | Ga0207641_11366517 | 3300026088 | Unclassified | 709 |
| 727 | Ga0207641_11441176 | 3300026088 | Bacteria | 690 |
| 728 | Ga0207641_12165341 | 3300026088 | Bacteria | 556 |
| 729 | Ga0207676_10003083 | 3300026095 | Bacteria | 11896 |
| 730 | Ga0207676_10014092 | 3300026095 | Bacteria | 5743 |
| 731 | Ga0207676_10118467 | 3300026095 | Bacteria | 2228 |
| 732 | Ga0207676_10319024 | 3300026095 | Bacteria | 1426 |
| 733 | Ga0207676_10619312 | 3300026095 | Bacteria | 1041 |
| 734 | Ga0207674_10022331 | 3300026116 | Bacteria | 6794 |
| 735 | Ga0207674_10022506 | 3300026116 | Bacteria | 6766 |
| 736 | Ga0207674_10066111 | 3300026116 | Bacteria | 3643 |
| 737 | Ga0207674_10432859 | 3300026116 | Bacteria | 1271 |
| 738 | Ga0207674_10594597 | 3300026116 | Bacteria | 1069 |
| 739 | Ga0207674_10611184 | 3300026116 | Bacteria | 1053 |
| 740 | Ga0207675_100001740 | 3300026118 | Bacteria | 21802 |
| 741 | Ga0207683_10004433 | 3300026121 | Bacteria | 12130 |
| 742 | Ga0207683_10011795 | 3300026121 | Bacteria | 7456 |
| 743 | Ga0207683_10165305 | 3300026121 | Bacteria | 2002 |
| 744 | Ga0207683_10270732 | 3300026121 | Bacteria | 1551 |
| 745 | Ga0207683_11098119 | 3300026121 | Unclassified | 738 |
| 746 | Ga0207698_10076121 | 3300026142 | Bacteria | 2685 |
| 747 | Ga0207698_10118353 | 3300026142 | Bacteria | 2237 |
| 748 | Ga0207698_10209342 | 3300026142 | Bacteria | 1753 |
| 749 | Ga0207698_10742368 | 3300026142 | Bacteria | 980 |
| 750 | Ga0207428_10052605 | 3300027907 | Bacteria | 3251 |
| 751 | Ga0268266_10106230 | 3300028379 | Bacteria | 2481 |
| 752 | Ga0268266_10120641 | 3300028379 | Bacteria | 2333 |
| 753 | Ga0268266_10457401 | 3300028379 | Bacteria | 1214 |
| 754 | Ga0268266_10711657 | 3300028379 | Unclassified | 968 |
| 755 | Ga0268265_10075896 | 3300028380 | Bacteria | 2635 |
| 756 | Ga0268265_10910648 | 3300028380 | Bacteria | 864 |
| 757 | Ga0268264_10000238 | 3300028381 | Bacteria | 105229 |
| 758 | Ga0268264_10134098 | 3300028381 | Bacteria | 2200 |
| 759 | Ga0268264_11166542 | 3300028381 | Bacteria | 779 |
| 760 | Ga0268264_11604674 | 3300028381 | Unclassified | 661 |
| 761 | Ga0265320_10525712 | 3300031240 | Unclassified | 523 |
| 762 | Ga0307509_10156849 | 3300031507 | Bacteria | 2180 |
| 763 | Ga0307405_11315969 | 3300031731 | Bacteria | 629 |
| 764 | Ga0307405_12151490 | 3300031731 | Bacteria | 501 |
| 765 | Ga0307410_10348187 | 3300031852 | Bacteria | 1183 |
| 766 | Ga0307410_11530923 | 3300031852 | Bacteria | 588 |
| 767 | Ga0307407_10357581 | 3300031903 | Bacteria | 1036 |
| 768 | Ga0307412_10219717 | 3300031911 | Bacteria | 1456 |
| 769 | Ga0307409_100116660 | 3300031995 | Bacteria | 2251 |
| 770 | Ga0307409_100921345 | 3300031995 | Bacteria | 888 |
| 771 | Ga0307409_101072303 | 3300031995 | Bacteria | 826 |
| 772 | Ga0307409_102546171 | 3300031995 | Bacteria | 540 |
| 773 | Ga0307416_100175445 | 3300032002 | Bacteria | 2001 |
| 774 | Ga0307416_100286658 | 3300032002 | Bacteria | 1627 |
| 775 | Ga0307416_100766228 | 3300032002 | Bacteria | 1059 |
| 776 | Ga0307411_10795039 | 3300032005 | Bacteria | 832 |
| 777 | Ga0307415_100217386 | 3300032126 | Bacteria | 1529 |
| 778 | Ga0307415_100239463 | 3300032126 | Bacteria | 1467 |
| 779 | Ga0307415_100530416 | 3300032126 | Bacteria | 1035 |
| 780 | Ga0307415_101729472 | 3300032126 | Bacteria | 604 |
| 781 | Ga0373930_0008208 | 3300034816 | Bacteria | 1823 |
| 782 | Ga0373948_0013610 | 3300034817 | Bacteria | 1471 |
| 783 | Ga0373948_0074181 | 3300034817 | Bacteria | 767 |
| 784 | Ga0373950_0021245 | 3300034818 | Bacteria | 1148 |
| 785 | Ga0373959_0104072 | 3300034820 | Bacteria | 678 |
| 786 | Ga0373938_0007289 | 3300034957 | Bacteria | 1942 |
| 787 | Ga0373926_0001366 | 3300035083 | Bacteria | 7388 |
| 788 | Ga0373926_0010578 | 3300035083 | Bacteria | 3094 |
| 789 | Ga0373926_0024539 | 3300035083 | Bacteria | 2100 |
| 790 | Ga0373926_0291350 | 3300035083 | Bacteria | 636 |
| 791 | Ga0373928_0061507 | 3300035084 | Bacteria | 909 |
| 792 | Ga0373934_0000680 | 3300035086 | Bacteria | 12062 |
| 793 | Ga0373934_0001711 | 3300035086 | Bacteria | 8060 |
| 794 | Ga0373934_0012797 | 3300035086 | Bacteria | 3169 |
| 795 | Ga0373934_0083000 | 3300035086 | Bacteria | 1288 |
| 796 | Ga0373940_0022878 | 3300035088 | Bacteria | 1609 |
| 797 | Ga0373944_0001086 | 3300035089 | Bacteria | 6746 |
| 798 | Ga0373944_0001504 | 3300035089 | Bacteria | 5896 |
| 799 | Ga0373944_0002339 | 3300035089 | Bacteria | 4823 |
| 800 | Ga0373944_0257508 | 3300035089 | Bacteria | 646 |
| 801 | Ga0373923_0000434 | 3300035111 | Bacteria | 9829 |
| 802 | Ga0373923_0002713 | 3300035111 | Bacteria | 5515 |
| 803 | Ga0373923_0026414 | 3300035111 | Bacteria | 2310 |
| 804 | Ga0373923_0090156 | 3300035111 | Bacteria | 1340 |
| 805 | Ga0373923_0118427 | 3300035111 | Bacteria | 1181 |
| 806 | Ga0373923_0201102 | 3300035111 | Bacteria | 921 |
| 807 | Ga0373923_0308029 | 3300035111 | Bacteria | 750 |
| 808 | Ga0373932_0023305 | 3300035112 | Bacteria | 1654 |
| 809 | Ga0373932_0024965 | 3300035112 | Bacteria | 1613 |
| 810 | Ga0373932_0351546 | 3300035112 | Bacteria | 561 |
| 811 | Ga0373936_0000112 | 3300035113 | Bacteria | 28228 |
| 812 | Ga0373936_0004092 | 3300035113 | Bacteria | 5491 |
| 813 | Ga0373936_0007615 | 3300035113 | Bacteria | 4069 |
| 814 | Ga0373936_0015947 | 3300035113 | Bacteria | 2883 |
| 815 | Ga0373936_0076603 | 3300035113 | Bacteria | 1386 |
| 816 | Ga0373936_0140831 | 3300035113 | Bacteria | 1041 |
| 817 | Ga0373936_0182791 | 3300035113 | Bacteria | 920 |
| 818 | Ga0373936_0633492 | 3300035113 | Bacteria | 503 |
| 819 | Ga0373939_0018781 | 3300035114 | Bacteria | 1857 |
| 820 | Ga0373941_0169116 | 3300035115 | Bacteria | 814 |
| 821 | Ga0373945_0000364 | 3300035116 | Bacteria | 12998 |
| 822 | Ga0373945_0006002 | 3300035116 | Bacteria | 3904 |
| 823 | Ga0373945_0006387 | 3300035116 | Bacteria | 3802 |
| 824 | Ga0373945_0294920 | 3300035116 | Bacteria | 693 |
| 825 | Ga0373953_0000043 | 3300035117 | Bacteria | 32688 |
| 826 | Ga0373953_0000407 | 3300035117 | Bacteria | 11668 |
| 827 | Ga0373953_0015371 | 3300035117 | Bacteria | 2772 |
| 828 | Ga0373953_0062791 | 3300035117 | Bacteria | 1521 |
| 829 | Ga0373953_0137938 | 3300035117 | Bacteria | 1042 |
| 830 | Ga0373953_0217399 | 3300035117 | Bacteria | 828 |
| 831 | Ga0373953_0296985 | 3300035117 | Bacteria | 705 |
| 832 | Ga0373954_0001380 | 3300035118 | Bacteria | 9814 |
| 833 | Ga0373954_0004326 | 3300035118 | Bacteria | 6105 |
| 834 | Ga0373954_0017809 | 3300035118 | Bacteria | 3193 |
| 835 | Ga0373954_0084765 | 3300035118 | Bacteria | 1517 |
| 836 | Ga0373954_0155871 | 3300035118 | Bacteria | 1117 |
| 837 | Ga0373954_0661706 | 3300035118 | Bacteria | 518 |
| 838 | Ga0373956_0000761 | 3300035119 | Bacteria | 13331 |
| 839 | Ga0373956_0002268 | 3300035119 | Bacteria | 7917 |
| 840 | Ga0373956_0035502 | 3300035119 | Bacteria | 2199 |
| 841 | Ga0373956_0187820 | 3300035119 | Bacteria | 978 |
| 842 | Ga0373957_0000905 | 3300035120 | Bacteria | 7740 |
| 843 | Ga0373957_0001292 | 3300035120 | Bacteria | 6715 |
| 844 | Ga0373957_0014284 | 3300035120 | Bacteria | 2711 |
| 845 | Ga0373957_0018571 | 3300035120 | Bacteria | 2438 |
| 846 | Ga0373957_0106341 | 3300035120 | Bacteria | 1127 |
| 847 | Ga0373957_0214874 | 3300035120 | Bacteria | 804 |
| 848 | Ga0373957_0272654 | 3300035120 | Bacteria | 714 |
| 849 | Ga0373957_0305855 | 3300035120 | Bacteria | 675 |
| 850 | Ga0373960_0002454 | 3300035121 | Bacteria | 4169 |
| 851 | Ga0373943_0000118 | 3300035170 | Bacteria | 29527 |
| 852 | Ga0373943_0003604 | 3300035170 | Bacteria | 7047 |
| 853 | Ga0373943_0016594 | 3300035170 | Bacteria | 3359 |
| 854 | Ga0373943_0024198 | 3300035170 | Bacteria | 2830 |
| 855 | Ga0373943_0146481 | 3300035170 | Bacteria | 1276 |
| 856 | Ga0373943_0261476 | 3300035170 | Bacteria | 974 |
| 857 | Ga0373943_0482366 | 3300035170 | Bacteria | 723 |
| 858 | Ga0373946_0000064 | 3300035171 | Bacteria | 28039 |
| 859 | Ga0373946_0005696 | 3300035171 | Bacteria | 4504 |
| 860 | Ga0373946_0016415 | 3300035171 | Bacteria | 2820 |
| 861 | Ga0373946_0068120 | 3300035171 | Bacteria | 1530 |
| 862 | Ga0373946_0150745 | 3300035171 | Bacteria | 1085 |
| 863 | Ga0373946_0307039 | 3300035171 | Bacteria | 786 |
| 864 | Ga0373946_0432100 | 3300035171 | Bacteria | 668 |
| 865 | Ga0373955_0000307 | 3300035172 | Bacteria | 20276 |
| 866 | Ga0373955_0001389 | 3300035172 | Bacteria | 10289 |
| 867 | Ga0373955_0010704 | 3300035172 | Bacteria | 4343 |
| 868 | Ga0373955_0061176 | 3300035172 | Bacteria | 2079 |
| 869 | Ga0373955_0070377 | 3300035172 | Bacteria | 1954 |
| 870 | Ga0373955_0101368 | 3300035172 | Bacteria | 1653 |
| 871 | Ga0373955_0109320 | 3300035172 | Bacteria | 1597 |
| 872 | Ga0373942_0005328 | 3300035207 | Bacteria | 2983 |
| 873 | Ga0373942_0058021 | 3300035207 | Bacteria | 1103 |
| 874 | Ga0373942_0114991 | 3300035207 | Bacteria | 835 |
| 875 | Ga0373961_0195971 | 3300035241 | Bacteria | 710 |
| 876 | Ga0373962_0011303 | 3300035242 | Bacteria | 2237 |
| 877 | Ga0373962_0190467 | 3300035242 | Bacteria | 690 |
| 878 | Ga0373924_0000805 | 3300035410 | Bacteria | 9792 |
| 879 | Ga0373924_0002180 | 3300035410 | Bacteria | 6559 |
| 880 | Ga0373924_0004825 | 3300035410 | Bacteria | 4740 |
| 881 | Ga0373924_0047025 | 3300035410 | Bacteria | 1779 |
| 882 | Ga0373924_0536455 | 3300035410 | Bacteria | 526 |
| 883 | Ga0373924_0552032 | 3300035410 | Bacteria | 519 |
| 884 | Ga0373931_0000023 | 3300035691 | Bacteria | 130307 |
| 885 | Ga0373931_0005176 | 3300035691 | Bacteria | 6013 |
| 886 | Ga0373931_0216668 | 3300035691 | Bacteria | 1151 |
| 887 | Ga0373935_0001398 | 3300035692 | Bacteria | 13351 |
| 888 | Ga0373935_0010150 | 3300035692 | Bacteria | 5640 |
| 889 | Ga0373935_0011246 | 3300035692 | Bacteria | 5374 |
| 890 | Ga0373935_0042060 | 3300035692 | Bacteria | 2872 |
| 891 | Ga0373935_0120688 | 3300035692 | Bacteria | 1751 |
| 892 | Ga0373935_0137292 | 3300035692 | Bacteria | 1648 |
| 893 | Ga0373935_0287869 | 3300035692 | Bacteria | 1158 |
| 894 | Ga0373935_0916350 | 3300035692 | Bacteria | 649 |
| 895 | Ga0373927_0003100 | 3300035695 | Bacteria | 12031 |
| 896 | Ga0373927_0015337 | 3300035695 | Bacteria | 5061 |
| 897 | Ga0373927_0017869 | 3300035695 | Bacteria | 4663 |
| 898 | Ga0373927_0090858 | 3300035695 | Bacteria | 1983 |
| 899 | Ga0373927_0218993 | 3300035695 | Bacteria | 1250 |
| 900 | Ga0373933_0000283 | 3300035724 | Bacteria | 32966 |
| 901 | Ga0373933_0003663 | 3300035724 | Bacteria | 8507 |
| 902 | Ga0373933_0014917 | 3300035724 | Bacteria | 4327 |
| 903 | Ga0373933_0017730 | 3300035724 | Bacteria | 3994 |
| 904 | Ga0373933_0019180 | 3300035724 | Bacteria | 3858 |
| 905 | Ga0373933_0230626 | 3300035724 | Bacteria | 1189 |
| 906 | Ga0373933_0304885 | 3300035724 | Unclassified | 1031 |
| 907 | Ga0373933_0630398 | 3300035724 | Bacteria | 704 |
| 908 | Ga0373947_0012001 | 3300035725 | Bacteria | 4961 |
| 909 | Ga0373947_0016714 | 3300035725 | Bacteria | 4215 |
| 910 | Ga0373947_0046936 | 3300035725 | Bacteria | 2587 |
| 911 | Ga0373947_0133035 | 3300035725 | Bacteria | 1589 |
| 912 | Ga0373947_0161788 | 3300035725 | Bacteria | 1448 |
| 913 | Ga0373947_0295495 | 3300035725 | Bacteria | 1079 |
| 914 | Ga0373947_0414923 | 3300035725 | Bacteria | 909 |
| 915 | Ga0373947_0625596 | 3300035725 | Bacteria | 734 |
| 916 | Ga0373937_0000560 | 3300036401 | Bacteria | 32978 |
| 917 | Ga0373937_0005931 | 3300036401 | Bacteria | 10515 |
| 918 | Ga0373937_0011035 | 3300036401 | Bacteria | 7921 |
| 919 | Ga0373937_0014488 | 3300036401 | Bacteria | 6963 |
| 920 | Ga0373937_0017147 | 3300036401 | Bacteria | 6444 |
| 921 | Ga0373937_0144616 | 3300036401 | Bacteria | 2225 |
| 922 | Ga0373937_0261363 | 3300036401 | Bacteria | 1632 |
| 923 | Ga0373937_0455953 | 3300036401 | Bacteria | 1214 |
| 924 | Ga0373937_0715116 | 3300036401 | Bacteria | 948 |
| 925 | Ga0373937_1285264 | 3300036401 | Bacteria | 680 |
| 926 | Ga0373937_1494159 | 3300036401 | Bacteria | 623 |
| 927 | Ga0373937_2123881 | 3300036401 | Bacteria | 508 |
| 928 | Ga0373925_0003688 | 3300037068 | Bacteria | 11769 |
| 929 | Ga0373925_0004201 | 3300037068 | Bacteria | 10930 |
| 930 | Ga0373925_0006891 | 3300037068 | Bacteria | 8318 |
| 931 | Ga0373925_0014026 | 3300037068 | Bacteria | 5800 |
| 932 | Ga0373925_0077222 | 3300037068 | Bacteria | 2527 |
| 933 | Ga0373925_0098261 | 3300037068 | Bacteria | 2246 |
| 934 | Ga0373925_0447777 | 3300037068 | Bacteria | 1057 |
| 935 | Ga0373925_0649229 | 3300037068 | Bacteria | 869 |
| 936 | Ga0373925_0754924 | 3300037068 | Bacteria | 802 |
| 937 | Ga0373925_0816855 | 3300037068 | Bacteria | 769 |
| 938 | Ga0373925_1229663 | 3300037068 | Bacteria | 615 |
| 939 | Ga0395899_0927176 | 3300037312 | Bacteria | 529 |
| 940 | Ga0395900_0463885 | 3300037418 | Bacteria | 1221 |
| 941 | Ga0395900_1012615 | 3300037418 | Bacteria | 750 |
| 942 | Ga0395898_0053505 | 3300037466 | Bacteria | 3943 |
| 943 | Ga0395898_0168316 | 3300037466 | Bacteria | 2095 |
| 944 | Ga0395898_1480528 | 3300037466 | Bacteria | 605 |
| 945 | Ga0395905_0061892 | 3300037471 | Bacteria | 3501 |
| 946 | Ga0395905_0095805 | 3300037471 | Bacteria | 2786 |
| 947 | Ga0395905_0202688 | 3300037471 | Bacteria | 1860 |
| 948 | Ga0436364_0626442 | 3300037853 | Bacteria | 1679 |
| 949 | Ga0395901_0003209 | 3300038443 | Bacteria | 16464 |
| 950 | Ga0395901_0010731 | 3300038443 | Bacteria | 9287 |
| 951 | Ga0395901_0022908 | 3300038443 | Bacteria | 6403 |
| 952 | Ga0395901_0033608 | 3300038443 | Bacteria | 5296 |
| 953 | Ga0395901_0349181 | 3300038443 | Bacteria | 1527 |
| 954 | Ga0395901_0892814 | 3300038443 | Bacteria | 871 |
| 955 | Ga0436365_0904426 | 3300039437 | Bacteria | 1042 |
| 956 | Ga0451787_591939 | 3300041441 | Bacteria | 542 |
| 957 | Ga0451789_0523819 | 3300041443 | Bacteria | 2348 |
| 958 | Ga0451791_0166158 | 3300041451 | Bacteria | 5040 |
| 959 | Ga0451791_0622792 | 3300041451 | Unclassified | 1699 |
| 960 | Ga0451793_0118808 | 3300041452 | Bacteria | 12202 |
| 961 | Ga0451793_1419480 | 3300041452 | Bacteria | 607 |
| 962 | Ga0451797_0328055 | 3300041453 | Bacteria | 1863 |
| 963 | Ga0451800_0789169 | 3300041459 | Bacteria | 2179 |
| 964 | Ga0451833_1106457 | 3300041491 | Bacteria | 1247 |
| 965 | Ga0451833_1447573 | 3300041491 | Bacteria | 1926 |
| 966 | Ga0451839_1460976 | 3300041496 | Bacteria | 2774 |
| 967 | Ga0451849_0857468 | 3300041505 | Bacteria | 2053 |
| 968 | Ga0451851_0216177 | 3300041507 | Bacteria | 998 |
| 969 | Ga0451843_0852902 | 3300041509 | Bacteria | 2169 |
| 970 | Ga0451853_3758868 | 3300041512 | Bacteria | 2443 |
| 971 | Ga0439448_0146704 | 3300042005 | Bacteria | 818 |
| 972 | Ga0466969_0586825 | 3300044656 | Bacteria | 511 |
| 973 | Ga0466966_0124347 | 3300044684 | Bacteria | 1583 |
| 974 | Ga0466963_0068227 | 3300044694 | Bacteria | 2388 |
| 975 | Ga0466963_0262770 | 3300044694 | Bacteria | 1212 |
| 976 | Ga0466963_0803224 | 3300044694 | Bacteria | 663 |
| 977 | Ga0466960_0797287 | 3300044901 | Bacteria | 572 |
| 978 | Ga0466959_0272089 | 3300045049 | Bacteria | 1164 |
| 979 | Ga0466958_0227802 | 3300045836 | Bacteria | 1190 |
| 980 | Ga0466958_0244552 | 3300045836 | Bacteria | 1147 |
| 981 | Ga0466958_0275866 | 3300045836 | Bacteria | 1077 |
| 982 | Ga0466958_0611728 | 3300045836 | Bacteria | 709 |
| 983 | Ga0466967_0002837 | 3300045976 | Bacteria | 10995 |
| 984 | Ga0466967_0034625 | 3300045976 | Bacteria | 4289 |
| 985 | Ga0466967_0036093 | 3300045976 | Bacteria | 4217 |
| 986 | Ga0466967_0616530 | 3300045976 | Bacteria | 1071 |
| 987 | Ga0466967_0815095 | 3300045976 | Bacteria | 927 |
| 988 | Ga0466967_1686854 | 3300045976 | Bacteria | 631 |
| 989 | Ga0495592_0000403 | 3300046454 | Bacteria | 32941 |
| 990 | Ga0495592_0004793 | 3300046454 | Bacteria | 9936 |
| 991 | Ga0495592_0007493 | 3300046454 | Bacteria | 8171 |
| 992 | Ga0495592_0011572 | 3300046454 | Bacteria | 6680 |
| 993 | Ga0495592_0032960 | 3300046454 | Bacteria | 3908 |
| 994 | Ga0495592_0140351 | 3300046454 | Bacteria | 1682 |
| 995 | Ga0495603_0344594 | 3300046455 | Bacteria | 855 |
| 996 | Ga0495603_0496127 | 3300046455 | Bacteria | 699 |
| 997 | Ga0495629_0006468 | 3300046459 | Bacteria | 8678 |
| 998 | Ga0495629_0006516 | 3300046459 | Bacteria | 8650 |
| 999 | Ga0495629_0021000 | 3300046459 | Bacteria | 4660 |
| 1000 | Ga0495629_0027475 | 3300046459 | Bacteria | 4040 |
| 1001 | Ga0495629_0177274 | 3300046459 | Bacteria | 1478 |
| 1002 | Ga0495629_0179305 | 3300046459 | Bacteria | 1468 |
| 1003 | Ga0495641_0001329 | 3300046461 | Bacteria | 21138 |
| 1004 | Ga0495641_0008248 | 3300046461 | Bacteria | 6377 |
| 1005 | Ga0495641_0037010 | 3300046461 | Bacteria | 2289 |
| 1006 | Ga0495641_0064419 | 3300046461 | Bacteria | 1651 |
| 1007 | Ga0495651_0000499 | 3300046462 | Bacteria | 30439 |
| 1008 | Ga0495651_0000629 | 3300046462 | Bacteria | 27312 |
| 1009 | Ga0495651_0008111 | 3300046462 | Bacteria | 8050 |
| 1010 | Ga0495651_0008484 | 3300046462 | Bacteria | 7874 |
| 1011 | Ga0495651_0031929 | 3300046462 | Bacteria | 4106 |
| 1012 | Ga0495651_0110928 | 3300046462 | Bacteria | 2028 |
| 1013 | Ga0495651_0345015 | 3300046462 | Bacteria | 985 |
| 1014 | Ga0495653_0000784 | 3300046463 | Bacteria | 24398 |
| 1015 | Ga0495653_0001785 | 3300046463 | Bacteria | 16960 |
| 1016 | Ga0495653_0006323 | 3300046463 | Bacteria | 9720 |
| 1017 | Ga0495653_0010486 | 3300046463 | Bacteria | 7582 |
| 1018 | Ga0495653_0017714 | 3300046463 | Bacteria | 5791 |
| 1019 | Ga0495653_0018669 | 3300046463 | Bacteria | 5630 |
| 1020 | Ga0495653_0023443 | 3300046463 | Bacteria | 4985 |
| 1021 | Ga0495653_0028193 | 3300046463 | Bacteria | 4491 |
| 1022 | Ga0495653_0176303 | 3300046463 | Bacteria | 1471 |
| 1023 | Ga0495653_0226269 | 3300046463 | Bacteria | 1254 |
| 1024 | Ga0495653_0379975 | 3300046463 | Bacteria | 902 |
| 1025 | Ga0495653_0485614 | 3300046463 | Bacteria | 772 |
| 1026 | Ga0495580_0010540 | 3300046472 | Bacteria | 7195 |
| 1027 | Ga0495580_0731998 | 3300046472 | Bacteria | 645 |
| 1028 | Ga0495582_0004671 | 3300046473 | Bacteria | 7703 |
| 1029 | Ga0495582_0026415 | 3300046473 | Bacteria | 3183 |
| 1030 | Ga0495582_0030798 | 3300046473 | Bacteria | 2947 |
| 1031 | Ga0495582_0040194 | 3300046473 | Bacteria | 2575 |
| 1032 | Ga0495582_0051612 | 3300046473 | Bacteria | 2267 |
| 1033 | Ga0495605_0400083 | 3300046474 | Bacteria | 571 |
| 1034 | Ga0495639_0113720 | 3300046475 | Bacteria | 1286 |
| 1035 | Ga0495639_0435760 | 3300046475 | Bacteria | 665 |
| 1036 | Ga0495639_0608007 | 3300046475 | Bacteria | 562 |
| 1037 | Ga0495639_0610811 | 3300046475 | Bacteria | 561 |
| 1038 | Ga0495662_0000450 | 3300046476 | Bacteria | 18519 |
| 1039 | Ga0495662_0011923 | 3300046476 | Bacteria | 4248 |
| 1040 | Ga0495662_0013265 | 3300046476 | Bacteria | 4011 |
| 1041 | Ga0495662_0013987 | 3300046476 | Bacteria | 3907 |
| 1042 | Ga0495662_0041720 | 3300046476 | Bacteria | 2215 |
| 1043 | Ga0495662_0080753 | 3300046476 | Bacteria | 1581 |
| 1044 | Ga0495664_0002021 | 3300046477 | Bacteria | 10830 |
| 1045 | Ga0495664_0012667 | 3300046477 | Bacteria | 4776 |
| 1046 | Ga0495664_0022552 | 3300046477 | Bacteria | 3650 |
| 1047 | Ga0495664_0035870 | 3300046477 | Bacteria | 2921 |
| 1048 | Ga0495664_0045276 | 3300046477 | Bacteria | 2609 |
| 1049 | Ga0495664_0056990 | 3300046477 | Bacteria | 2324 |
| 1050 | Ga0495664_0145399 | 3300046477 | Bacteria | 1437 |
| 1051 | Ga0495664_0145489 | 3300046477 | Bacteria | 1437 |
| 1052 | Ga0495664_0214734 | 3300046477 | Bacteria | 1165 |
| 1053 | Ga0495664_0873330 | 3300046477 | Bacteria | 527 |
| 1054 | Ga0495584_0363344 | 3300046491 | Bacteria | 735 |
| 1055 | Ga0495585_0304231 | 3300046492 | Bacteria | 783 |
| 1056 | Ga0495594_0003675 | 3300046499 | Bacteria | 7879 |
| 1057 | Ga0495594_0134358 | 3300046499 | Bacteria | 1402 |
| 1058 | Ga0495607_0469941 | 3300046501 | Bacteria | 562 |
| 1059 | Ga0495583_0157298 | 3300046506 | Bacteria | 939 |
| 1060 | Ga0495608_0000310 | 3300046511 | Bacteria | 34155 |
| 1061 | Ga0495608_0001991 | 3300046511 | Bacteria | 14646 |
| 1062 | Ga0495608_0013836 | 3300046511 | Bacteria | 5598 |
| 1063 | Ga0495608_0015411 | 3300046511 | Bacteria | 5301 |
| 1064 | Ga0495608_0037626 | 3300046511 | Bacteria | 3253 |
| 1065 | Ga0495608_0038866 | 3300046511 | Bacteria | 3193 |
| 1066 | Ga0495608_0051321 | 3300046511 | Bacteria | 2733 |
| 1067 | Ga0495608_0054003 | 3300046511 | Bacteria | 2656 |
| 1068 | Ga0495608_0132775 | 3300046511 | Bacteria | 1592 |
| 1069 | Ga0495608_0285431 | 3300046511 | Bacteria | 1024 |
| 1070 | Ga0495608_0849973 | 3300046511 | Unclassified | 536 |
| 1071 | Ga0495618_0003806 | 3300046514 | Bacteria | 9335 |
| 1072 | Ga0495618_0008293 | 3300046514 | Bacteria | 6292 |
| 1073 | Ga0495618_0011730 | 3300046514 | Bacteria | 5319 |
| 1074 | Ga0495618_0021086 | 3300046514 | Bacteria | 4016 |
| 1075 | Ga0495618_0039492 | 3300046514 | Bacteria | 2967 |
| 1076 | Ga0495618_0086836 | 3300046514 | Bacteria | 2000 |
| 1077 | Ga0495628_0003764 | 3300046516 | Bacteria | 13502 |
| 1078 | Ga0495628_0013037 | 3300046516 | Bacteria | 7002 |
| 1079 | Ga0495628_0021978 | 3300046516 | Bacteria | 5242 |
| 1080 | Ga0495628_0055250 | 3300046516 | Bacteria | 3128 |
| 1081 | Ga0495628_0123378 | 3300046516 | Bacteria | 1985 |
| 1082 | Ga0495628_0151725 | 3300046516 | Bacteria | 1764 |
| 1083 | Ga0495628_0238910 | 3300046516 | Bacteria | 1359 |
| 1084 | Ga0495628_0631134 | 3300046516 | Bacteria | 762 |
| 1085 | Ga0495630_0003016 | 3300046517 | Bacteria | 11675 |
| 1086 | Ga0495630_0004973 | 3300046517 | Bacteria | 9349 |
| 1087 | Ga0495630_0011591 | 3300046517 | Bacteria | 6386 |
| 1088 | Ga0495630_0046931 | 3300046517 | Bacteria | 3229 |
| 1089 | Ga0495630_0140899 | 3300046517 | Bacteria | 1833 |
| 1090 | Ga0495630_0211786 | 3300046517 | Bacteria | 1479 |
| 1091 | Ga0495630_0226255 | 3300046517 | Bacteria | 1428 |
| 1092 | Ga0495630_0763886 | 3300046517 | Bacteria | 738 |
| 1093 | Ga0495648_0021050 | 3300046524 | Bacteria | 4528 |
| 1094 | Ga0495663_0025407 | 3300046525 | Bacteria | 1727 |
| 1095 | Ga0495666_0003315 | 3300046526 | Bacteria | 8134 |
| 1096 | Ga0495666_0122066 | 3300046526 | Bacteria | 1220 |
| 1097 | Ga0495666_0362833 | 3300046526 | Bacteria | 652 |
| 1098 | Ga0495652_0003138 | 3300046529 | Bacteria | 16506 |
| 1099 | Ga0495652_0004652 | 3300046529 | Bacteria | 13086 |
| 1100 | Ga0495652_0017741 | 3300046529 | Bacteria | 6352 |
| 1101 | Ga0495652_0039172 | 3300046529 | Bacteria | 4099 |
| 1102 | Ga0495652_0070916 | 3300046529 | Bacteria | 2910 |
| 1103 | Ga0495652_0092455 | 3300046529 | Bacteria | 2471 |
| 1104 | Ga0495652_0139327 | 3300046529 | Bacteria | 1909 |
| 1105 | Ga0495652_0145617 | 3300046529 | Bacteria | 1857 |
| 1106 | Ga0495652_0276328 | 3300046529 | Bacteria | 1232 |
| 1107 | Ga0495665_0000852 | 3300046531 | Bacteria | 15974 |
| 1108 | Ga0495665_0020020 | 3300046531 | Bacteria | 3597 |
| 1109 | Ga0495665_0023068 | 3300046531 | Bacteria | 3342 |
| 1110 | Ga0495665_0029037 | 3300046531 | Bacteria | 2964 |
| 1111 | Ga0495665_0099980 | 3300046531 | Bacteria | 1522 |
| 1112 | Ga0495640_0000992 | 3300046533 | Bacteria | 21969 |
| 1113 | Ga0495640_0023597 | 3300046533 | Bacteria | 4478 |
| 1114 | Ga0495640_0026763 | 3300046533 | Bacteria | 4163 |
| 1115 | Ga0495640_0034290 | 3300046533 | Bacteria | 3600 |
| 1116 | Ga0495640_0094023 | 3300046533 | Bacteria | 1975 |
| 1117 | Ga0495640_0116348 | 3300046533 | Bacteria | 1741 |
| 1118 | Ga0495640_0273941 | 3300046533 | Bacteria | 1052 |
| 1119 | Ga0495586_0034025 | 3300046535 | Bacteria | 2736 |
| 1120 | Ga0495586_0114977 | 3300046535 | Bacteria | 1500 |
| 1121 | Ga0495586_0685291 | 3300046535 | Bacteria | 592 |
| 1122 | Ga0495587_0000348 | 3300046536 | Bacteria | 32978 |
| 1123 | Ga0495587_0003250 | 3300046536 | Bacteria | 10859 |
| 1124 | Ga0495587_0006890 | 3300046536 | Bacteria | 7389 |
| 1125 | Ga0495587_0010228 | 3300046536 | Bacteria | 5980 |
| 1126 | Ga0495587_0046591 | 3300046536 | Bacteria | 2573 |
| 1127 | Ga0495587_0047295 | 3300046536 | Bacteria | 2551 |
| 1128 | Ga0495587_0055754 | 3300046536 | Bacteria | 2327 |
| 1129 | Ga0495587_0096864 | 3300046536 | Bacteria | 1701 |
| 1130 | Ga0495587_0268098 | 3300046536 | Bacteria | 958 |
| 1131 | Ga0495609_0458658 | 3300046538 | Bacteria | 506 |
| 1132 | Ga0495645_0004292 | 3300046543 | Bacteria | 9738 |
| 1133 | Ga0495645_0006831 | 3300046543 | Bacteria | 7929 |
| 1134 | Ga0495645_0016495 | 3300046543 | Bacteria | 5275 |
| 1135 | Ga0495645_0028737 | 3300046543 | Bacteria | 4041 |
| 1136 | Ga0495645_0042680 | 3300046543 | Bacteria | 3307 |
| 1137 | Ga0495645_0070256 | 3300046543 | Bacteria | 2527 |
| 1138 | Ga0495645_0079380 | 3300046543 | Bacteria | 2357 |
| 1139 | Ga0495645_0080814 | 3300046543 | Bacteria | 2333 |
| 1140 | Ga0495645_0094953 | 3300046543 | Bacteria | 2126 |
| 1141 | Ga0495645_0120593 | 3300046543 | Bacteria | 1846 |
| 1142 | Ga0495645_0318675 | 3300046543 | Bacteria | 1010 |
| 1143 | Ga0495667_0000353 | 3300046559 | Bacteria | 29147 |
| 1144 | Ga0495667_0001265 | 3300046559 | Bacteria | 16568 |
| 1145 | Ga0495667_0008594 | 3300046559 | Bacteria | 6932 |
| 1146 | Ga0495667_0013460 | 3300046559 | Bacteria | 5538 |
| 1147 | Ga0495667_0017945 | 3300046559 | Bacteria | 4779 |
| 1148 | Ga0495667_0021774 | 3300046559 | Bacteria | 4324 |
| 1149 | Ga0495667_0033601 | 3300046559 | Bacteria | 3432 |
| 1150 | Ga0495667_0034736 | 3300046559 | Bacteria | 3370 |
| 1151 | Ga0495667_0273906 | 3300046559 | Unclassified | 1072 |
| 1152 | Ga0495667_0471113 | 3300046559 | Bacteria | 788 |
| 1153 | Ga0495667_0543689 | 3300046559 | Bacteria | 726 |
| 1154 | Ga0495656_0248378 | 3300046615 | Bacteria | 898 |
| 1155 | Ga0495656_0592167 | 3300046615 | Bacteria | 593 |
| 1156 | Ga0495668_0061673 | 3300046616 | Bacteria | 2068 |
| 1157 | Ga0495668_0664543 | 3300046616 | Bacteria | 576 |
| 1158 | Ga0495634_0001947 | 3300046642 | Bacteria | 17638 |
| 1159 | Ga0495634_0008618 | 3300046642 | Bacteria | 7569 |
| 1160 | Ga0495634_0111299 | 3300046642 | Bacteria | 1760 |
| 1161 | Ga0495634_0130784 | 3300046642 | Bacteria | 1600 |
| 1162 | Ga0495634_0236717 | 3300046642 | Bacteria | 1121 |
| 1163 | Ga0495634_0323748 | 3300046642 | Bacteria | 928 |
| 1164 | Ga0495634_0514517 | 3300046642 | Bacteria | 701 |
| 1165 | Ga0495635_0006559 | 3300046663 | Bacteria | 8120 |
| 1166 | Ga0495635_0009824 | 3300046663 | Bacteria | 6690 |
| 1167 | Ga0495635_0029723 | 3300046663 | Bacteria | 3800 |
| 1168 | Ga0495635_0030189 | 3300046663 | Bacteria | 3766 |
| 1169 | Ga0495635_0034921 | 3300046663 | Bacteria | 3487 |
| 1170 | Ga0495635_0037022 | 3300046663 | Bacteria | 3378 |
| 1171 | Ga0495635_0075458 | 3300046663 | Bacteria | 2309 |
| 1172 | Ga0495635_0359309 | 3300046663 | Bacteria | 971 |
| 1173 | Ga0495635_0544619 | 3300046663 | Bacteria | 761 |
| 1174 | Ga0495659_0270438 | 3300046664 | Bacteria | 712 |
| 1175 | Ga0495661_0294118 | 3300046665 | Bacteria | 815 |
| 1176 | Ga0495588_0044788 | 3300046674 | Bacteria | 2267 |
| 1177 | Ga0495588_0138864 | 3300046674 | Bacteria | 1283 |
| 1178 | Ga0495657_0002166 | 3300046675 | Bacteria | 16662 |
| 1179 | Ga0495657_0002176 | 3300046675 | Bacteria | 16618 |
| 1180 | Ga0495657_0012650 | 3300046675 | Bacteria | 6260 |
| 1181 | Ga0495657_0023699 | 3300046675 | Bacteria | 4383 |
| 1182 | Ga0495657_0024050 | 3300046675 | Bacteria | 4343 |
| 1183 | Ga0495657_0074522 | 3300046675 | Bacteria | 2208 |
| 1184 | Ga0495657_0085202 | 3300046675 | Bacteria | 2037 |
| 1185 | Ga0495657_0117501 | 3300046675 | Bacteria | 1678 |
| 1186 | Ga0495657_0219379 | 3300046675 | Bacteria | 1153 |
| 1187 | Ga0495657_0513308 | 3300046675 | Bacteria | 698 |
| 1188 | Ga0495657_0643083 | 3300046675 | Bacteria | 612 |
| 1189 | Ga0495657_0759569 | 3300046675 | Bacteria | 555 |
| 1190 | Ga0495599_0000267 | 3300046678 | Bacteria | 32878 |
| 1191 | Ga0495599_0000894 | 3300046678 | Bacteria | 16666 |
| 1192 | Ga0495599_0001817 | 3300046678 | Bacteria | 12379 |
| 1193 | Ga0495599_0006456 | 3300046678 | Bacteria | 7074 |
| 1194 | Ga0495599_0010888 | 3300046678 | Bacteria | 5575 |
| 1195 | Ga0495599_0014766 | 3300046678 | Bacteria | 4835 |
| 1196 | Ga0495599_0018140 | 3300046678 | Bacteria | 4382 |
| 1197 | Ga0495599_0079146 | 3300046678 | Bacteria | 2052 |
| 1198 | Ga0495599_0128017 | 3300046678 | Bacteria | 1577 |
| 1199 | Ga0495599_0199913 | 3300046678 | Bacteria | 1228 |
| 1200 | Ga0495599_0754412 | 3300046678 | Bacteria | 558 |
| 1201 | Ga0495623_0001940 | 3300046679 | Bacteria | 13892 |
| 1202 | Ga0495623_0007666 | 3300046679 | Bacteria | 7016 |
| 1203 | Ga0495623_0044190 | 3300046679 | Unclassified | 2832 |
| 1204 | Ga0495623_0066047 | 3300046679 | Bacteria | 2261 |
| 1205 | Ga0495646_0008644 | 3300046680 | Bacteria | 6470 |
| 1206 | Ga0495646_0010256 | 3300046680 | Bacteria | 5959 |
| 1207 | Ga0495646_0013681 | 3300046680 | Bacteria | 5157 |
| 1208 | Ga0495646_0025322 | 3300046680 | Bacteria | 3732 |
| 1209 | Ga0495646_0042643 | 3300046680 | Bacteria | 2783 |
| 1210 | Ga0495646_0213075 | 3300046680 | Bacteria | 1047 |
| 1211 | Ga0495646_0256060 | 3300046680 | Bacteria | 936 |
| 1212 | Ga0495646_0263139 | 3300046680 | Bacteria | 921 |
| 1213 | Ga0495646_0514998 | 3300046680 | Bacteria | 613 |
| 1214 | Ga0495647_0007560 | 3300046681 | Bacteria | 3646 |
| 1215 | Ga0495647_0359022 | 3300046681 | Bacteria | 664 |
| 1216 | Ga0495658_0005104 | 3300046683 | Bacteria | 6451 |
| 1217 | Ga0495658_0064971 | 3300046683 | Bacteria | 2104 |
| 1218 | Ga0495658_0270344 | 3300046683 | Bacteria | 1071 |
| 1219 | Ga0495658_0854600 | 3300046683 | Bacteria | 582 |
| 1220 | Ga0495613_0008946 | 3300046689 | Bacteria | 7433 |
| 1221 | Ga0495613_0012223 | 3300046689 | Bacteria | 6380 |
| 1222 | Ga0495613_0222909 | 3300046689 | Bacteria | 1323 |
| 1223 | Ga0495613_0697975 | 3300046689 | Bacteria | 668 |
| 1224 | Ga0495613_0853831 | 3300046689 | Bacteria | 591 |
| 1225 | Ga0495624_0003764 | 3300046690 | Bacteria | 11208 |
| 1226 | Ga0495624_0018876 | 3300046690 | Bacteria | 4608 |
| 1227 | Ga0495624_0046945 | 3300046690 | Bacteria | 2745 |
| 1228 | Ga0495624_0051058 | 3300046690 | Bacteria | 2618 |
| 1229 | Ga0495624_0141997 | 3300046690 | Bacteria | 1471 |
| 1230 | Ga0495624_0142746 | 3300046690 | Bacteria | 1466 |
| 1231 | Ga0495624_0366358 | 3300046690 | Bacteria | 866 |
| 1232 | Ga0495624_0773303 | 3300046690 | Bacteria | 568 |
| 1233 | Ga0495670_0491385 | 3300046691 | Bacteria | 666 |
| 1234 | Ga0495649_0386539 | 3300046694 | Bacteria | 704 |
| 1235 | Ga0495600_0001242 | 3300046809 | Bacteria | 14012 |
| 1236 | Ga0495600_0001286 | 3300046809 | Bacteria | 13875 |
| 1237 | Ga0495600_0003324 | 3300046809 | Bacteria | 9444 |
| 1238 | Ga0495600_0003483 | 3300046809 | Bacteria | 9252 |
| 1239 | Ga0495600_0030510 | 3300046809 | Bacteria | 3492 |
| 1240 | Ga0495600_0062392 | 3300046809 | Bacteria | 2435 |
| 1241 | Ga0495600_0079066 | 3300046809 | Bacteria | 2147 |
| 1242 | Ga0495600_0586391 | 3300046809 | Bacteria | 678 |
| 1243 | Ga0495581_0001028 | 3300047315 | Bacteria | 15089 |
| 1244 | Ga0495581_0008227 | 3300047315 | Bacteria | 6045 |
| 1245 | Ga0495581_0049465 | 3300047315 | Bacteria | 2427 |
| 1246 | Ga0495581_0238187 | 3300047315 | Bacteria | 1064 |
| 1247 | Ga0495581_0296385 | 3300047315 | Bacteria | 945 |
| 1248 | Ga0495581_0618467 | 3300047315 | Bacteria | 627 |
| 1249 | Ga0495604_0000550 | 3300047317 | Bacteria | 32980 |
| 1250 | Ga0495604_0004599 | 3300047317 | Bacteria | 10932 |
| 1251 | Ga0495604_0006607 | 3300047317 | Bacteria | 9191 |
| 1252 | Ga0495604_0012698 | 3300047317 | Bacteria | 6702 |
| 1253 | Ga0495604_0029989 | 3300047317 | Bacteria | 4324 |
| 1254 | Ga0495604_0045966 | 3300047317 | Bacteria | 3405 |
| 1255 | Ga0495604_0163644 | 3300047317 | Bacteria | 1570 |
| 1256 | Ga0495604_0548945 | 3300047317 | Bacteria | 745 |
| 1257 | Ga0495636_0084328 | 3300047318 | Bacteria | 1372 |
| 1258 | Ga0495674_0000590 | 3300047319 | Bacteria | 33960 |
| 1259 | Ga0495674_0005002 | 3300047319 | Bacteria | 12750 |
| 1260 | Ga0495674_0006374 | 3300047319 | Bacteria | 11312 |
| 1261 | Ga0495674_0006392 | 3300047319 | Bacteria | 11295 |
| 1262 | Ga0495674_0007829 | 3300047319 | Bacteria | 10202 |
| 1263 | Ga0495674_0010942 | 3300047319 | Bacteria | 8571 |
| 1264 | Ga0495674_0024200 | 3300047319 | Bacteria | 5584 |
| 1265 | Ga0495674_0033926 | 3300047319 | Bacteria | 4618 |
| 1266 | Ga0495674_0199721 | 3300047319 | Bacteria | 1659 |
| 1267 | Ga0495672_0012718 | 3300047320 | Bacteria | 5851 |
| 1268 | Ga0495672_0198051 | 3300047320 | Bacteria | 1006 |
| 1269 | Ga0495676_0000954 | 3300047321 | Bacteria | 24253 |
| 1270 | Ga0495676_0128560 | 3300047321 | Bacteria | 1832 |
| 1271 | Ga0495676_0138887 | 3300047321 | Bacteria | 1743 |
| 1272 | Ga0495676_0646499 | 3300047321 | Bacteria | 686 |
| 1273 | Ga0495680_0000904 | 3300047322 | Bacteria | 32976 |
| 1274 | Ga0495680_0004224 | 3300047322 | Bacteria | 13787 |
| 1275 | Ga0495680_0005938 | 3300047322 | Bacteria | 11414 |
| 1276 | Ga0495680_0011425 | 3300047322 | Bacteria | 7860 |
| 1277 | Ga0495680_0026146 | 3300047322 | Bacteria | 4817 |
| 1278 | Ga0495680_0028636 | 3300047322 | Bacteria | 4566 |
| 1279 | Ga0495680_0030765 | 3300047322 | Bacteria | 4377 |
| 1280 | Ga0495680_0039607 | 3300047322 | Bacteria | 3757 |
| 1281 | Ga0495680_0486645 | 3300047322 | Bacteria | 839 |
| 1282 | Ga0495675_0003298 | 3300047444 | Bacteria | 9705 |
| 1283 | Ga0495675_0024148 | 3300047444 | Bacteria | 3875 |
| 1284 | Ga0495675_0025904 | 3300047444 | Bacteria | 3737 |
| 1285 | Ga0495675_0097522 | 3300047444 | Bacteria | 1842 |
| 1286 | Ga0495675_0154449 | 3300047444 | Bacteria | 1416 |
| 1287 | Ga0495675_0314679 | 3300047444 | Bacteria | 927 |
| 1288 | Ga0495675_0720556 | 3300047444 | Bacteria | 557 |
| 1289 | Ga0495677_0295495 | 3300047445 | Bacteria | 637 |
| 1290 | Ga0495673_0011306 | 3300047469 | Bacteria | 4812 |
| 1291 | Ga0495684_0003309 | 3300047471 | Bacteria | 12655 |
| 1292 | Ga0495684_0005014 | 3300047471 | Bacteria | 10329 |
| 1293 | Ga0495684_0005115 | 3300047471 | Bacteria | 10230 |
| 1294 | Ga0495684_0010003 | 3300047471 | Bacteria | 7332 |
| 1295 | Ga0495684_0018088 | 3300047471 | Bacteria | 5431 |
| 1296 | Ga0495684_0058010 | 3300047471 | Bacteria | 2949 |
| 1297 | Ga0495684_0062861 | 3300047471 | Bacteria | 2823 |
| 1298 | Ga0495684_0487047 | 3300047471 | Bacteria | 850 |
| 1299 | Ga0495684_0589865 | 3300047471 | Bacteria | 751 |
| 1300 | Ga0495684_0646589 | 3300047471 | Bacteria | 708 |
| 1301 | Ga0495593_0001796 | 3300047673 | Bacteria | 12731 |
| 1302 | Ga0495593_0005834 | 3300047673 | Bacteria | 7260 |
| 1303 | Ga0495593_0025918 | 3300047673 | Bacteria | 3244 |
| 1304 | Ga0495593_0052138 | 3300047673 | Bacteria | 2163 |
| 1305 | Ga0495593_0115266 | 3300047673 | Bacteria | 1370 |
| 1306 | Ga0495593_0173969 | 3300047673 | Bacteria | 1085 |
| 1307 | Ga0495593_0350587 | 3300047673 | Bacteria | 738 |
| 1308 | Ga0495593_0640296 | 3300047673 | Unclassified | 534 |
| 1309 | Ga0495602_0000631 | 3300048088 | Bacteria | 32978 |
| 1310 | Ga0495602_0011014 | 3300048088 | Bacteria | 9365 |
| 1311 | Ga0495602_0028399 | 3300048088 | Bacteria | 5353 |
| 1312 | Ga0495602_0029254 | 3300048088 | Bacteria | 5251 |
| 1313 | Ga0495602_0031883 | 3300048088 | Bacteria | 4973 |
| 1314 | Ga0495602_0099556 | 3300048088 | Bacteria | 2389 |
| 1315 | Ga0495602_0100285 | 3300048088 | Bacteria | 2378 |
| 1316 | Ga0495602_0102694 | 3300048088 | Bacteria | 2342 |
| 1317 | Ga0495614_0008860 | 3300048089 | Bacteria | 4465 |
| 1318 | Ga0495614_0124294 | 3300048089 | Bacteria | 1139 |
| 1319 | Ga0495614_0411875 | 3300048089 | Bacteria | 636 |
| 1320 | Ga0496100_0096290 | 3300048903 | Bacteria | 2030 |
| 1321 | Ga0496100_0141566 | 3300048903 | Unclassified | 1705 |
| 1322 | Ga0496100_0202315 | 3300048903 | Bacteria | 1448 |
| 1323 | Ga0496100_0222530 | 3300048903 | Bacteria | 1386 |
| 1324 | Ga0496100_0262835 | 3300048903 | Bacteria | 1280 |
| 1325 | Ga0496100_0413435 | 3300048903 | Unclassified | 1029 |
| 1326 | Ga0496100_1254091 | 3300048903 | Bacteria | 585 |
| 1327 | Ga0496101_0045495 | 3300048904 | Bacteria | 3144 |
| 1328 | Ga0496101_0049889 | 3300048904 | Bacteria | 3011 |
| 1329 | Ga0496101_0620998 | 3300048904 | Bacteria | 854 |
| 1330 | Ga0496101_0856598 | 3300048904 | Bacteria | 716 |
| 1331 | Ga0496101_1312592 | 3300048904 | Bacteria | 566 |
| 1332 | Ga0496101_1572744 | 3300048904 | Bacteria | 511 |
| 1333 | Ga0496102_0000080 | 3300048905 | Bacteria | 140541 |
| 1334 | Ga0496102_0067624 | 3300048905 | Bacteria | 3277 |
| 1335 | Ga0496102_0171188 | 3300048905 | Bacteria | 2044 |
| 1336 | Ga0496102_0609187 | 3300048905 | Bacteria | 1015 |
| 1337 | Ga0496102_0847969 | 3300048905 | Bacteria | 836 |
| 1338 | Ga0496103_0000118 | 3300048906 | Bacteria | 86519 |
| 1339 | Ga0496103_0018985 | 3300048906 | Bacteria | 4127 |
| 1340 | Ga0496103_0087157 | 3300048906 | Bacteria | 1968 |
| 1341 | Ga0496104_0013883 | 3300048907 | Bacteria | 7266 |
| 1342 | Ga0496104_0032231 | 3300048907 | Bacteria | 4876 |
| 1343 | Ga0496104_0087034 | 3300048907 | Bacteria | 2983 |
| 1344 | Ga0496104_0111366 | 3300048907 | Bacteria | 2624 |
| 1345 | Ga0496104_0112715 | 3300048907 | Bacteria | 2608 |
| 1346 | Ga0496104_0276032 | 3300048907 | Bacteria | 1594 |
| 1347 | Ga0496104_0420557 | 3300048907 | Bacteria | 1248 |
| 1348 | Ga0496105_0005906 | 3300048908 | Bacteria | 9336 |
| 1349 | Ga0496105_0006129 | 3300048908 | Bacteria | 9208 |
| 1350 | Ga0496105_0036164 | 3300048908 | Bacteria | 4067 |
| 1351 | Ga0496105_0045749 | 3300048908 | Bacteria | 3611 |
| 1352 | Ga0496105_0058446 | 3300048908 | Bacteria | 3183 |
| 1353 | Ga0496105_0242632 | 3300048908 | Bacteria | 1462 |
| 1354 | Ga0496105_0251894 | 3300048908 | Bacteria | 1430 |
| 1355 | Ga0496105_0391730 | 3300048908 | Bacteria | 1104 |
| 1356 | Ga0496105_0402689 | 3300048908 | Bacteria | 1086 |
| 1357 | Ga0496105_0559348 | 3300048908 | Bacteria | 892 |
| 1358 | Ga0496105_1361106 | 3300048908 | Bacteria | 516 |
| 1359 | Ga0496106_0002362 | 3300048909 | Bacteria | 14048 |
| 1360 | Ga0496106_0014659 | 3300048909 | Bacteria | 5793 |
| 1361 | Ga0496106_0093873 | 3300048909 | Bacteria | 2319 |
| 1362 | Ga0496106_0192401 | 3300048909 | Unclassified | 1622 |
| 1363 | Ga0496107_0020401 | 3300048910 | Bacteria | 4680 |
| 1364 | Ga0496107_0109891 | 3300048910 | Bacteria | 2025 |
| 1365 | Ga0496107_0352800 | 3300048910 | Bacteria | 1095 |
| 1366 | Ga0496107_0391691 | 3300048910 | Bacteria | 1033 |
| 1367 | Ga0496107_0500081 | 3300048910 | Unclassified | 902 |
| 1368 | Ga0496108_0006269 | 3300048911 | Bacteria | 9637 |
| 1369 | Ga0496108_0008118 | 3300048911 | Bacteria | 8513 |
| 1370 | Ga0496108_0042290 | 3300048911 | Bacteria | 3803 |
| 1371 | Ga0496108_0053659 | 3300048911 | Bacteria | 3381 |
| 1372 | Ga0496108_0075171 | 3300048911 | Bacteria | 2854 |
| 1373 | Ga0496108_0107438 | 3300048911 | Bacteria | 2383 |
| 1374 | Ga0496108_0276256 | 3300048911 | Bacteria | 1463 |
| 1375 | Ga0496108_0402570 | 3300048911 | Bacteria | 1195 |
| 1376 | Ga0496108_0508385 | 3300048911 | Bacteria | 1052 |
| 1377 | Ga0496108_0679481 | 3300048911 | Bacteria | 894 |
| 1378 | Ga0496108_0828574 | 3300048911 | Bacteria | 797 |
| 1379 | Ga0496109_0018225 | 3300048912 | Bacteria | 6165 |
| 1380 | Ga0496109_0032488 | 3300048912 | Bacteria | 4692 |
| 1381 | Ga0496109_0048849 | 3300048912 | Bacteria | 3850 |
| 1382 | Ga0496109_0073072 | 3300048912 | Bacteria | 3151 |
| 1383 | Ga0496109_0078626 | 3300048912 | Bacteria | 3037 |
| 1384 | Ga0496109_0134444 | 3300048912 | Bacteria | 2310 |
| 1385 | Ga0496109_0147756 | 3300048912 | Bacteria | 2199 |
| 1386 | Ga0496109_0233899 | 3300048912 | Bacteria | 1729 |
| 1387 | Ga0496109_0244941 | 3300048912 | Unclassified | 1688 |
| 1388 | Ga0496109_0844428 | 3300048912 | Bacteria | 854 |
| 1389 | Ga0496110_0008783 | 3300048913 | Bacteria | 8141 |
| 1390 | Ga0496110_0011473 | 3300048913 | Bacteria | 7252 |
| 1391 | Ga0496110_0023374 | 3300048913 | Bacteria | 5256 |
| 1392 | Ga0496110_0026333 | 3300048913 | Bacteria | 4974 |
| 1393 | Ga0496110_0045767 | 3300048913 | Bacteria | 3825 |
| 1394 | Ga0496110_0048126 | 3300048913 | Bacteria | 3737 |
| 1395 | Ga0496110_0084204 | 3300048913 | Bacteria | 2838 |
| 1396 | Ga0496110_0134331 | 3300048913 | Bacteria | 2235 |
| 1397 | Ga0496110_0195037 | 3300048913 | Bacteria | 1839 |
| 1398 | Ga0496110_0212470 | 3300048913 | Bacteria | 1759 |
| 1399 | Ga0496111_0001546 | 3300048914 | Bacteria | 13249 |
| 1400 | Ga0496111_0001962 | 3300048914 | Bacteria | 12219 |
| 1401 | Ga0496111_0038431 | 3300048914 | Bacteria | 3429 |
| 1402 | Ga0496111_0063060 | 3300048914 | Bacteria | 2688 |
| 1403 | Ga0496111_0082038 | 3300048914 | Bacteria | 2354 |
| 1404 | Ga0496111_0247808 | 3300048914 | Bacteria | 1322 |
| 1405 | Ga0496111_0251210 | 3300048914 | Bacteria | 1313 |
| 1406 | Ga0496111_0548406 | 3300048914 | Bacteria | 849 |
| 1407 | Ga0496111_0734068 | 3300048914 | Bacteria | 717 |
| 1408 | Ga0496112_0048983 | 3300048915 | Bacteria | 4140 |
| 1409 | Ga0496112_0095416 | 3300048915 | Bacteria | 2944 |
| 1410 | Ga0496112_0185705 | 3300048915 | Bacteria | 2042 |
| 1411 | Ga0496112_0227027 | 3300048915 | Bacteria | 1822 |
| 1412 | Ga0496112_0387555 | 3300048915 | Bacteria | 1338 |
| 1413 | Ga0496112_0610749 | 3300048915 | Archaea | 1022 |
| 1414 | Ga0496112_0772629 | 3300048915 | Bacteria | 886 |
| 1415 | Ga0496113_0021573 | 3300048916 | Bacteria | 4544 |
| 1416 | Ga0496113_0031252 | 3300048916 | Bacteria | 3863 |
| 1417 | Ga0496113_0061647 | 3300048916 | Bacteria | 2830 |
| 1418 | Ga0496113_0084473 | 3300048916 | Bacteria | 2437 |
| 1419 | Ga0496113_0095021 | 3300048916 | Bacteria | 2303 |
| 1420 | Ga0496113_0145551 | 3300048916 | Bacteria | 1867 |
| 1421 | Ga0496113_0237866 | 3300048916 | Bacteria | 1453 |
| 1422 | Ga0496113_0554789 | 3300048916 | Unclassified | 921 |
| 1423 | Ga0496113_1184216 | 3300048916 | Bacteria | 597 |
| 1424 | Ga0496114_0001467 | 3300048917 | Bacteria | 17936 |
| 1425 | Ga0496114_0043065 | 3300048917 | Bacteria | 3744 |
| 1426 | Ga0496114_0046271 | 3300048917 | Bacteria | 3616 |
| 1427 | Ga0496114_0065861 | 3300048917 | Bacteria | 3036 |
| 1428 | Ga0496114_0137311 | 3300048917 | Bacteria | 2115 |
| 1429 | Ga0496114_0529744 | 3300048917 | Bacteria | 1041 |
| 1430 | Ga0496114_0823780 | 3300048917 | Unclassified | 807 |
| 1431 | Ga0496114_1565768 | 3300048917 | Bacteria | 547 |
| 1432 | Ga0496115_0078901 | 3300048918 | Bacteria | 2679 |
| 1433 | Ga0496115_0129927 | 3300048918 | Bacteria | 2076 |
| 1434 | Ga0496115_0174786 | 3300048918 | Bacteria | 1776 |
| 1435 | Ga0496115_0175042 | 3300048918 | Unclassified | 1774 |
| 1436 | Ga0496115_0522133 | 3300048918 | Bacteria | 952 |
| 1437 | Ga0496115_0523540 | 3300048918 | Bacteria | 950 |
| 1438 | Ga0496115_0524258 | 3300048918 | Bacteria | 950 |
| 1439 | Ga0496116_0000493 | 3300048919 | Bacteria | 54285 |
| 1440 | Ga0496117_0000287 | 3300048920 | Bacteria | 91621 |
| 1441 | Ga0496118_0000266 | 3300048921 | Bacteria | 91632 |
| 1442 | Ga0496119_0000558 | 3300048922 | Bacteria | 50488 |
| 1443 | Ga0496119_0522511 | 3300048922 | Bacteria | 549 |
| 1444 | Ga0496120_0032642 | 3300048923 | Bacteria | 3136 |
| 1445 | Ga0496121_0034602 | 3300048924 | Bacteria | 4545 |
| 1446 | Ga0496121_0625834 | 3300048924 | Bacteria | 660 |
| 1447 | Ga0496124_0041754 | 3300048927 | Bacteria | 3955 |
| 1448 | Ga0496125_0023352 | 3300048928 | Bacteria | 5710 |
| 1449 | Ga0496126_0000383 | 3300048929 | Bacteria | 91602 |
| 1450 | Ga0496126_0252559 | 3300048929 | Bacteria | 1469 |
| 1451 | Ga0496126_0446431 | 3300048929 | Bacteria | 1042 |
| 1452 | Ga0501032_0665548 | 3300049569 | Bacteria | 661 |
| 1453 | Ga0501036_0220862 | 3300049572 | Bacteria | 1591 |
| 1454 | Ga0501041_0234612 | 3300049577 | Bacteria | 1152 |
| 1455 | Ga0501041_0656155 | 3300049577 | Bacteria | 671 |
| 1456 | Ga0501042_0080546 | 3300049578 | Bacteria | 2333 |
| 1457 | Ga0501046_0285155 | 3300049580 | Bacteria | 1209 |
| 1458 | Ga0501047_0835889 | 3300049581 | Bacteria | 735 |
| 1459 | Ga0501048_0146684 | 3300049582 | Bacteria | 1669 |
| 1460 | Ga0501067_0032391 | 3300049583 | Bacteria | 2901 |
| 1461 | Ga0501067_0421803 | 3300049583 | Bacteria | 744 |
| 1462 | Ga0501068_0008894 | 3300049584 | Bacteria | 5603 |
| 1463 | Ga0501068_0188942 | 3300049584 | Bacteria | 1304 |
| 1464 | Ga0501069_0097667 | 3300049585 | Bacteria | 1665 |
| 1465 | Ga0501069_0220456 | 3300049585 | Bacteria | 1102 |
| 1466 | Ga0501069_0701459 | 3300049585 | Bacteria | 610 |
| 1467 | Ga0501071_0061910 | 3300049587 | Bacteria | 2711 |
| 1468 | Ga0501071_1240029 | 3300049587 | Bacteria | 576 |
| 1469 | Ga0501072_0092972 | 3300049588 | Bacteria | 2396 |
| 1470 | Ga0501075_0134936 | 3300049591 | Bacteria | 1880 |
| 1471 | Ga0501076_0304532 | 3300049592 | Bacteria | 1307 |
| 1472 | Ga0501079_0159797 | 3300049741 | Bacteria | 1757 |
| 1473 | Ga0501080_0385241 | 3300049742 | Bacteria | 1263 |
| 1474 | Ga0501035_1335924 | 3300049822 | Bacteria | 551 |
| 1475 | nmdc:mga03n38_109246_c1 | 3300050490 | Bacteria | 1344 |
| 1476 | nmdc:mga00v17_34430_c1 | 3300050491 | Bacteria | 3008 |
| 1477 | nmdc:mga06z11_1002683_c1 | 3300050494 | Bacteria | 509 |
| 1478 | nmdc:mga06z11_11055_c1 | 3300050494 | Bacteria | 3875 |
| 1479 | nmdc:mga06z11_23889_c1 | 3300050494 | Bacteria | 2877 |
| 1480 | nmdc:mga06z11_350278_c1 | 3300050494 | Bacteria | 884 |
| 1481 | nmdc:mga07m45_286566_c1 | 3300050496 | Bacteria | 958 |
| 1482 | nmdc:mga07m45_38864_c2 | 3300050496 | Unclassified | 1847 |
| 1483 | nmdc:mga05p37_1044996_c1 | 3300050507 | Bacteria | 862 |
| 1484 | nmdc:mga09592_524590_c1 | 3300050508 | Bacteria | 1018 |
| 1485 | nmdc:mga06r32_1436416_c1 | 3300050510 | Bacteria | 631 |
| 1486 | nmdc:mga06r32_1613458_c1 | 3300050510 | Bacteria | 587 |
| 1487 | nmdc:mga08y16_12180_c1 | 3300050511 | Bacteria | 9039 |
| 1488 | nmdc:mga08y16_906774_c1 | 3300050511 | Bacteria | 867 |
| 1489 | nmdc:mga0n895_133729_c1 | 3300050512 | Bacteria | 2506 |
| 1490 | nmdc:mga0n895_249911_c1 | 3300050512 | Bacteria | 1800 |
| 1491 | nmdc:mga0rr50_1443566_c1 | 3300050513 | Bacteria | 582 |
| 1492 | nmdc:mga0rr50_345835_c1 | 3300050513 | Bacteria | 1250 |
| 1493 | nmdc:mga0rr50_49138_c1 | 3300050513 | Bacteria | 3122 |
| 1494 | nmdc:mga0rr50_874535_c1 | 3300050513 | Bacteria | 766 |
| 1495 | nmdc:mga0rr50_978519_c1 | 3300050513 | Bacteria | 721 |
| 1496 | nmdc:mga08x19_119332_c1 | 3300050514 | Bacteria | 1766 |
| 1497 | nmdc:mga08x19_35567_c1 | 3300050514 | Bacteria | 3152 |
| 1498 | nmdc:mga08x19_362749_c1 | 3300050514 | Bacteria | 1013 |
| 1499 | nmdc:mga08x19_843530_c1 | 3300050514 | Bacteria | 651 |
| 1500 | nmdc:mga0a205_1415199_c1 | 3300050515 | Bacteria | 543 |
| 1501 | nmdc:mga0sz30_275557_c1 | 3300050516 | Bacteria | 749 |
| 1502 | Ga0495601_0061833 | 3300053077 | Bacteria | 2377 |
| 1503 | Ga0495601_0089804 | 3300053077 | Bacteria | 1976 |
| 1504 | Ga0495601_0103415 | 3300053077 | Bacteria | 1841 |
| 1505 | Ga0495601_0124479 | 3300053077 | Bacteria | 1677 |
| 1506 | Ga0495601_0199642 | 3300053077 | Bacteria | 1307 |
| 1507 | Ga0495601_0230937 | 3300053077 | Bacteria | 1208 |
| 1508 | Ga0495601_0250923 | 3300053077 | Bacteria | 1155 |
| 1509 | Ga0495601_0259025 | 3300053077 | Bacteria | 1136 |
| 1510 | Ga0495601_0321173 | 3300053077 | Bacteria | 1008 |
| 1511 | Ga0495612_0067963 | 3300053078 | Bacteria | 1482 |
| 1512 | Ga0495612_0141952 | 3300053078 | Bacteria | 1042 |
| 1513 | Ga0495612_0437929 | 3300053078 | Bacteria | 596 |
| 1514 | Ga0495595_0007895 | 3300053084 | Bacteria | 4356 |
| 1515 | Ga0495595_0009676 | 3300053084 | Bacteria | 3992 |
| 1516 | Ga0495595_0085688 | 3300053084 | Bacteria | 1506 |
| 1517 | Ga0495595_0151182 | 3300053084 | Bacteria | 1142 |
| 1518 | Ga0495595_0275970 | 3300053084 | Bacteria | 843 |
| 1519 | Ga0495595_0486617 | 3300053084 | Bacteria | 628 |
| 1520 | Ga0495595_0522864 | 3300053084 | Bacteria | 605 |
| 1521 | Ga0495595_0711573 | 3300053084 | Bacteria | 515 |
| 1522 | Ga0495619_0001335 | 3300053085 | Bacteria | 16151 |
| 1523 | Ga0495619_0016774 | 3300053085 | Bacteria | 4637 |
| 1524 | Ga0495619_0019874 | 3300053085 | Bacteria | 4275 |
| 1525 | Ga0495619_0120564 | 3300053085 | Bacteria | 1798 |
| 1526 | Ga0495619_0724416 | 3300053085 | Bacteria | 676 |
| 1527 | Ga0500573_0073562 | 3300053140 | Bacteria | 1947 |
| 1528 | Ga0501084_0119025 | 3300054114 | Bacteria | 2220 |
| 1529 | Ga0590075_097874 | 3300059424 | Bacteria | 763 |
| 1530 | Ga0466962_0367469 | 3300061719 | Bacteria | 718 |
| 1531 | 2855388217 | 2855386786 | Bacteria | 4752232 |
| 1532 | Ga0163161_10155684 | |||
| 1533 | LJQas_1011961 | |||
| 1534 | LJQas_1023097 | |||
| 1535 | JGI24735J21928_10251130 | |||
| 1536 | JGI24738J21930_10064619 | |||
| 1537 | Ga0058863_10612682 | |||
| 1538 | Ga0058860_11186195 | |||
| 1539 | Ga0070658_10023397 | |||
| 1540 | Ga0070658_10037521 | |||
| 1541 | Ga0070658_10121585 | |||
| 1542 | Ga0070658_10528685 | |||
| 1543 | Ga0070676_10060352 | |||
| 1544 | Ga0070676_10593529 | |||
| 1545 | Ga0070683_100001699 | |||
| 1546 | Ga0070683_100047697 | |||
| 1547 | Ga0070683_100427781 | |||
| 1548 | Ga0070683_101338792 | |||
| 1549 | Ga0070690_100027487 | |||
| 1550 | Ga0070670_100023461 | |||
| 1551 | Ga0070670_101876058 | |||
| 1552 | Ga0068869_100392894 | |||
| 1553 | Ga0068869_100510938 | |||
| 1554 | Ga0068869_100695163 | |||
| 1555 | Ga0070666_10021818 | |||
| 1556 | Ga0070666_10825669 | |||
| 1557 | Ga0070666_11096202 | |||
| 1558 | Ga0070680_100014339 | |||
| 1559 | Ga0070680_100076787 | |||
| 1560 | Ga0070680_100991985 | |||
| 1561 | Ga0070682_100026024 | |||
| 1562 | Ga0070682_100206474 | |||
| 1563 | Ga0070682_100700046 | |||
| 1564 | Ga0070682_101213558 | |||
| 1565 | Ga0068868_100029180 | |||
| 1566 | Ga0068868_100057865 | |||
| 1567 | Ga0068868_100065392 | |||
| 1568 | Ga0068868_100123876 | |||
| 1569 | Ga0068868_100389601 | |||
| 1570 | Ga0070660_100068951 | |||
| 1571 | Ga0070660_100204138 | |||
| 1572 | Ga0070689_100063700 | |||
| 1573 | Ga0070689_102096378 | |||
| 1574 | Ga0070691_10040534 | |||
| 1575 | Ga0070691_10080353 | |||
| 1576 | Ga0070691_10083867 | |||
| 1577 | Ga0070691_10299174 | |||
| 1578 | Ga0070687_100034994 | |||
| 1579 | Ga0070687_100422943 | |||
| 1580 | Ga0070687_101391130 | |||
| 1581 | Ga0070661_100025495 | |||
| 1582 | Ga0070661_100219953 | |||
| 1583 | Ga0070661_101159897 | |||
| 1584 | Ga0070692_10010845 | |||
| 1585 | Ga0070692_10024048 | |||
| 1586 | Ga0070692_10546143 | |||
| 1587 | Ga0070668_100072162 | |||
| 1588 | Ga0070668_100161098 | |||
| 1589 | Ga0070668_100248225 | |||
| 1590 | Ga0070669_101949841 | |||
| 1591 | Ga0070675_100055064 | |||
| 1592 | Ga0070675_101746010 | |||
| 1593 | Ga0070671_100014133 | |||
| 1594 | Ga0070671_100025639 | |||
| 1595 | Ga0070671_100132376 | |||
| 1596 | Ga0070671_101052211 | |||
| 1597 | Ga0070674_100548365 | |||
| 1598 | Ga0070673_100688571 | |||
| 1599 | Ga0070673_100945666 | |||
| 1600 | Ga0070673_101474045 | |||
| 1601 | Ga0070659_100044719 | |||
| 1602 | Ga0070659_100373154 | |||
| 1603 | Ga0070659_100377429 | |||
| 1604 | Ga0070667_100009304 | |||
| 1605 | Ga0070667_100130116 | |||
| 1606 | Ga0070667_100387130 | |||
| 1607 | Ga0070667_101232172 | |||
| 1608 | Ga0070667_101485304 | |||
| 1609 | Ga0070667_101749621 | |||
| 1610 | Ga0070703_10010592 | |||
| 1611 | Ga0070709_10006365 | |||
| 1612 | Ga0070709_10082800 | |||
| 1613 | Ga0070709_10160532 | |||
| 1614 | Ga0070709_10558753 | |||
| 1615 | Ga0070709_10710757 | |||
| 1616 | Ga0070714_100014992 | |||
| 1617 | Ga0070714_100018039 | |||
| 1618 | Ga0070714_100021082 | |||
| 1619 | Ga0070714_100104434 | |||
| 1620 | Ga0070714_100155256 | |||
| 1621 | Ga0070714_100169380 | |||
| 1622 | Ga0070714_101035457 | |||
| 1623 | Ga0070714_101097391 | |||
| 1624 | Ga0070714_101195841 | |||
| 1625 | Ga0070714_101239510 | |||
| 1626 | Ga0070714_101382371 | |||
| 1627 | Ga0070714_101399915 | |||
| 1628 | Ga0070714_102373108 | |||
| 1629 | Ga0070713_100021596 | |||
| 1630 | Ga0070713_100053924 | |||
| 1631 | Ga0070713_100147268 | |||
| 1632 | Ga0070713_100164782 | |||
| 1633 | Ga0070713_100233325 | |||
| 1634 | Ga0070713_100355728 | |||
| 1635 | Ga0070713_100385556 | |||
| 1636 | Ga0070713_101050503 | |||
| 1637 | Ga0070713_101100519 | |||
| 1638 | Ga0070713_101345798 | |||
| 1639 | Ga0070713_101550399 | |||
| 1640 | Ga0070713_102130804 | |||
| 1641 | Ga0070710_10013207 | |||
| 1642 | Ga0070710_10034114 | |||
| 1643 | Ga0070710_10043312 | |||
| 1644 | Ga0070710_10047882 | |||
| 1645 | Ga0070710_10783120 | |||
| 1646 | Ga0070710_11437229 | |||
| 1647 | Ga0070701_10143340 | |||
| 1648 | Ga0070711_100003686 | |||
| 1649 | Ga0070711_100020537 | |||
| 1650 | Ga0070711_100099044 | |||
| 1651 | Ga0070711_100704354 | |||
| 1652 | Ga0070711_100949517 | |||
| 1653 | Ga0070711_100971678 | |||
| 1654 | Ga0070705_100229804 | |||
| 1655 | Ga0070700_100158026 | |||
| 1656 | Ga0070700_102022028 | |||
| 1657 | Ga0070708_100029283 | |||
| 1658 | Ga0070708_100151681 | |||
| 1659 | Ga0070708_100458527 | |||
| 1660 | Ga0070708_100473609 | |||
| 1661 | Ga0070708_100582522 | |||
| 1662 | Ga0070708_100863972 | |||
| 1663 | Ga0070708_100877258 | |||
| 1664 | Ga0070663_100016089 | |||
| 1665 | Ga0070663_101278054 | |||
| 1666 | Ga0070663_101722833 | |||
| 1667 | Ga0070678_100003251 | |||
| 1668 | Ga0070678_100029449 | |||
| 1669 | Ga0070678_100058715 | |||
| 1670 | Ga0070678_100120237 | |||
| 1671 | Ga0070678_101278727 | |||
| 1672 | Ga0070662_100453507 | |||
| 1673 | Ga0070662_100581614 | |||
| 1674 | Ga0070662_101435214 | |||
| 1675 | Ga0070681_10051750 | |||
| 1676 | Ga0070681_10051977 | |||
| 1677 | Ga0070681_10068358 | |||
| 1678 | Ga0070681_10239215 | |||
| 1679 | Ga0070685_10103221 | |||
| 1680 | Ga0070685_10171648 | |||
| 1681 | Ga0070685_10386349 | |||
| 1682 | Ga0070706_100009432 | |||
| 1683 | Ga0070706_100035692 | |||
| 1684 | Ga0070706_100041553 | |||
| 1685 | Ga0070706_100050552 | |||
| 1686 | Ga0070706_100141316 | |||
| 1687 | Ga0070706_101258310 | |||
| 1688 | Ga0070707_100003621 | |||
| 1689 | Ga0070707_100007443 | |||
| 1690 | Ga0070707_100015400 | |||
| 1691 | Ga0070707_100018081 | |||
| 1692 | Ga0070707_100025227 | |||
| 1693 | Ga0070707_100032684 | |||
| 1694 | Ga0070707_100375396 | |||
| 1695 | Ga0070707_100408752 | |||
| 1696 | Ga0070707_100954413 | |||
| 1697 | Ga0070698_100000262 | |||
| 1698 | Ga0070698_100024451 | |||
| 1699 | Ga0070698_100053117 | |||
| 1700 | Ga0070698_100189414 | |||
| 1701 | Ga0070698_100508614 | |||
| 1702 | Ga0070698_100819929 | |||
| 1703 | Ga0070699_100006212 | |||
| 1704 | Ga0070699_100325971 | |||
| 1705 | Ga0070699_100399782 | |||
| 1706 | Ga0070699_101110480 | |||
| 1707 | Ga0070679_100029664 | |||
| 1708 | Ga0070679_100126085 | |||
| 1709 | Ga0070679_100162246 | |||
| 1710 | Ga0070679_100474944 | |||
| 1711 | Ga0070679_100553417 | |||
| 1712 | Ga0070684_100010847 | |||
| 1713 | Ga0070684_100067546 | |||
| 1714 | Ga0070684_100089352 | |||
| 1715 | Ga0070684_100161050 | |||
| 1716 | Ga0070684_100275777 | |||
| 1717 | Ga0070684_100286539 | |||
| 1718 | Ga0070684_100341981 | |||
| 1719 | Ga0070684_100633115 | |||
| 1720 | Ga0070697_100048257 | |||
| 1721 | Ga0070697_100081954 | |||
| 1722 | Ga0070697_100088613 | |||
| 1723 | Ga0068853_100052879 | |||
| 1724 | Ga0068853_100096222 | |||
| 1725 | Ga0068853_100250633 | |||
| 1726 | Ga0068853_100598158 | |||
| 1727 | Ga0070672_100100915 | |||
| 1728 | Ga0070672_100127991 | |||
| 1729 | Ga0070686_100030199 | |||
| 1730 | Ga0070686_100225219 | |||
| 1731 | Ga0070686_101883889 | |||
| 1732 | Ga0070695_100039229 | |||
| 1733 | Ga0070695_100769828 | |||
| 1734 | Ga0070696_100008840 | |||
| 1735 | Ga0070696_100086709 | |||
| 1736 | Ga0070696_100232544 | |||
| 1737 | Ga0070693_100016669 | |||
| 1738 | Ga0070693_100085929 | |||
| 1739 | Ga0070693_100105242 | |||
| 1740 | Ga0070693_100415535 | |||
| 1741 | Ga0070665_100233385 | |||
| 1742 | Ga0070665_100411187 | |||
| 1743 | Ga0070665_100535380 | |||
| 1744 | Ga0070665_101057528 | |||
| 1745 | Ga0070704_100102286 | |||
| 1746 | Ga0070704_102157184 | |||
| 1747 | Ga0068855_100172514 | |||
| 1748 | Ga0068855_100205543 | |||
| 1749 | Ga0068855_100477447 | |||
| 1750 | Ga0070664_100110586 | |||
| 1751 | Ga0070664_100471042 | |||
| 1752 | Ga0070664_101455283 | |||
| 1753 | Ga0068857_100019129 | |||
| 1754 | Ga0068857_100022281 | |||
| 1755 | Ga0068857_100194944 | |||
| 1756 | Ga0068857_100230967 | |||
| 1757 | Ga0068857_100584706 | |||
| 1758 | Ga0068857_100687925 | |||
| 1759 | Ga0068857_100871910 | |||
| 1760 | Ga0068857_101792343 | |||
| 1761 | Ga0068857_102029479 | |||
| 1762 | Ga0068854_100033477 | |||
| 1763 | Ga0068854_100078421 | |||
| 1764 | Ga0068854_101157063 | |||
| 1765 | Ga0068856_100067952 | |||
| 1766 | Ga0068856_100111697 | |||
| 1767 | Ga0068856_100148722 | |||
| 1768 | Ga0068856_100154766 | |||
| 1769 | Ga0068856_101586865 | |||
| 1770 | Ga0070702_100020073 | |||
| 1771 | Ga0070702_100039107 | |||
| 1772 | Ga0070702_100258063 | |||
| 1773 | Ga0070702_101148672 | |||
| 1774 | Ga0068852_100081963 | |||
| 1775 | Ga0068852_100082781 | |||
| 1776 | Ga0068852_100264409 | |||
| 1777 | Ga0068859_100089435 | |||
| 1778 | Ga0068859_100126800 | |||
| 1779 | Ga0068864_100025629 | |||
| 1780 | Ga0068864_100092462 | |||
| 1781 | Ga0068864_100204212 | |||
| 1782 | Ga0068864_100267272 | |||
| 1783 | Ga0068864_100342424 | |||
| 1784 | Ga0068866_10206312 | |||
| 1785 | Ga0068866_10932820 | |||
| 1786 | Ga0068861_100646322 | |||
| 1787 | Ga0068851_10562354 | |||
| 1788 | Ga0068851_10595832 | |||
| 1789 | Ga0068851_10644273 | |||
| 1790 | Ga0068851_10998933 | |||
| 1791 | Ga0068870_10003463 | |||
| 1792 | Ga0068870_10005323 | |||
| 1793 | Ga0068870_10720294 | |||
| 1794 | Ga0068863_100022113 | |||
| 1795 | Ga0068863_100028645 | |||
| 1796 | Ga0068863_100063677 | |||
| 1797 | Ga0068863_100071316 | |||
| 1798 | Ga0068863_100168023 | |||
| 1799 | Ga0068863_100437274 | |||
| 1800 | Ga0068863_100617686 | |||
| 1801 | Ga0068863_102152782 | |||
| 1802 | Ga0068858_100107944 | |||
| 1803 | Ga0068858_100300408 | |||
| 1804 | Ga0068858_100562251 | |||
| 1805 | Ga0068858_100577306 | |||
| 1806 | Ga0068858_101399681 | |||
| 1807 | Ga0068860_100001468 | |||
| 1808 | Ga0068860_100185759 | |||
| 1809 | Ga0068860_101207576 | |||
| 1810 | Ga0068862_100971209 | |||
| 1811 | Ga0068862_101668719 | |||
| 1812 | Ga0081538_10130157 | |||
| 1813 | Ga0070717_10016568 | |||
| 1814 | Ga0070717_10025821 | |||
| 1815 | Ga0070717_10038313 | |||
| 1816 | Ga0070717_10061149 | |||
| 1817 | Ga0070717_10098289 | |||
| 1818 | Ga0070717_10128119 | |||
| 1819 | Ga0070717_10158654 | |||
| 1820 | Ga0070717_10166346 | |||
| 1821 | Ga0070717_10184794 | |||
| 1822 | Ga0070717_10293858 | |||
| 1823 | Ga0070717_10311782 | |||
| 1824 | Ga0070717_10451570 | |||
| 1825 | Ga0070717_10556589 | |||
| 1826 | Ga0070717_10557911 | |||
| 1827 | Ga0070717_10567354 | |||
| 1828 | Ga0070717_10581320 | |||
| 1829 | Ga0070717_11817588 | |||
| 1830 | Ga0075363_100028144 | |||
| 1831 | Ga0075363_100108468 | |||
| 1832 | Ga0075363_100427993 | |||
| 1833 | Ga0075364_10029866 | |||
| 1834 | Ga0075364_10455844 | |||
| 1835 | Ga0075364_11037452 | |||
| 1836 | Ga0075432_10047480 | |||
| 1837 | Ga0070715_10033349 | |||
| 1838 | Ga0070715_10041650 | |||
| 1839 | Ga0070715_10398135 | |||
| 1840 | Ga0070716_100003620 | |||
| 1841 | Ga0070716_100007387 | |||
| 1842 | Ga0070716_100054172 | |||
| 1843 | Ga0070716_100181400 | |||
| 1844 | Ga0070716_100397085 | |||
| 1845 | Ga0070712_100009737 | |||
| 1846 | Ga0070712_100200191 | |||
| 1847 | Ga0070712_100266989 | |||
| 1848 | Ga0070712_100350238 | |||
| 1849 | Ga0070712_100365167 | |||
| 1850 | Ga0070712_100459541 | |||
| 1851 | Ga0070712_100690582 | |||
| 1852 | Ga0070712_101372186 | |||
| 1853 | Ga0075367_10048648 | |||
| 1854 | Ga0075367_10082423 | |||
| 1855 | Ga0075367_10292508 | |||
| 1856 | Ga0097621_100240462 | |||
| 1857 | Ga0097621_100603165 | |||
| 1858 | Ga0097621_102164511 | |||
| 1859 | Ga0075370_10086526 | |||
| 1860 | Ga0075370_10161801 | |||
| 1861 | Ga0075370_10867557 | |||
| 1862 | Ga0068871_100053754 | |||
| 1863 | Ga0068871_100113760 | |||
| 1864 | Ga0068871_100575869 | |||
| 1865 | Ga0068871_100947099 | |||
| 1866 | Ga0075428_100310957 | |||
| 1867 | Ga0075428_100494663 | |||
| 1868 | Ga0075428_100986690 | |||
| 1869 | Ga0075428_102178692 | |||
| 1870 | Ga0075431_100492855 | |||
| 1871 | Ga0075431_101781862 | |||
| 1872 | Ga0075431_102166248 | |||
| 1873 | Ga0075434_100118657 | |||
| 1874 | Ga0075434_100741802 | |||
| 1875 | Ga0075434_101115835 | |||
| 1876 | Ga0075429_100643607 | |||
| 1877 | Ga0075429_100938535 | |||
| 1878 | Ga0068865_100216770 | |||
| 1879 | Ga0075436_100001878 | |||
| 1880 | Ga0075436_100131148 | |||
| 1881 | Ga0075436_100474941 | |||
| 1882 | Ga0075436_100688778 | |||
| 1883 | Ga0097620_100089437 | |||
| 1884 | Ga0097620_100126798 | |||
| 1885 | Ga0075435_100002133 | |||
| 1886 | Ga0075435_101020311 | |||
| 1887 | Ga0075435_101625626 | |||
| 1888 | Ga0099795_10525849 | |||
| 1889 | Ga0105251_10022638 | |||
| 1890 | Ga0105251_10110317 | |||
| 1891 | Ga0105250_10055736 | |||
| 1892 | Ga0105250_10217289 | |||
| 1893 | Ga0105240_10774981 | |||
| 1894 | Ga0105240_11158502 | |||
| 1895 | Ga0111539_10409735 | |||
| 1896 | Ga0111539_10420477 | |||
| 1897 | Ga0111539_10541486 | |||
| 1898 | Ga0111539_10606475 | |||
| 1899 | Ga0111539_12315768 | |||
| 1900 | Ga0111539_12754439 | |||
| 1901 | Ga0111539_13150617 | |||
| 1902 | Ga0105245_10021795 | |||
| 1903 | Ga0105245_10102903 | |||
| 1904 | Ga0105245_10103666 | |||
| 1905 | Ga0105245_10370565 | |||
| 1906 | Ga0105245_10605173 | |||
| 1907 | Ga0105245_10876152 | |||
| 1908 | Ga0105245_11093216 | |||
| 1909 | Ga0105245_11643832 | |||
| 1910 | Ga0105247_10041719 | |||
| 1911 | Ga0105247_10197533 | |||
| 1912 | Ga0105247_10210203 | |||
| 1913 | Ga0105247_10236431 | |||
| 1914 | Ga0105247_10355641 | |||
| 1915 | Ga0105247_11250042 | |||
| 1916 | Ga0114129_11083433 | |||
| 1917 | Ga0105243_10053779 | |||
| 1918 | Ga0105243_10144776 | |||
| 1919 | Ga0105241_10004425 | |||
| 1920 | Ga0105241_11537861 | |||
| 1921 | Ga0105242_10055810 | |||
| 1922 | Ga0105242_11050691 | |||
| 1923 | Ga0105248_10037443 | |||
| 1924 | Ga0105248_10117068 | |||
| 1925 | Ga0105248_10295438 | |||
| 1926 | Ga0105248_10425492 | |||
| 1927 | Ga0105248_10453208 | |||
| 1928 | Ga0105248_10494595 | |||
| 1929 | Ga0105237_10089102 | |||
| 1930 | Ga0105237_10099944 | |||
| 1931 | Ga0105237_10555669 | |||
| 1932 | Ga0105237_10772052 | |||
| 1933 | Ga0105237_10999299 | |||
| 1934 | Ga0105238_10092785 | |||
| 1935 | Ga0105238_10195691 | |||
| 1936 | Ga0105238_10212597 | |||
| 1937 | Ga0105238_11401670 | |||
| 1938 | Ga0105238_11754631 | |||
| 1939 | Ga0105249_10174447 | |||
| 1940 | Ga0105249_10446733 | |||
| 1941 | Ga0099796_10142736 | |||
| 1942 | Ga0099796_10436141 | |||
| 1943 | Ga0105239_10015531 | |||
| 1944 | Ga0105239_10412884 | |||
| 1945 | Ga0105239_10462196 | |||
| 1946 | Ga0105239_10953153 | |||
| 1947 | Ga0105239_11135665 | |||
| 1948 | Ga0105246_10000911 | |||
| 1949 | Ga0105246_10002762 | |||
| 1950 | Ga0105246_10334884 | |||
| 1951 | Ga0105246_10511030 | |||
| 1952 | Ga0105246_11158464 | |||
| 1953 | Ga0157336_1035932 | |||
| 1954 | Ga0157320_1021744 | |||
| 1955 | Ga0157339_1032692 | |||
| 1956 | Ga0157373_10016278 | |||
| 1957 | Ga0157371_10022649 | |||
| 1958 | Ga0157371_10179736 | |||
| 1959 | Ga0157371_10515940 | |||
| 1960 | Ga0157370_10030999 | |||
| 1961 | Ga0157370_10116677 | |||
| 1962 | Ga0157370_10869847 | |||
| 1963 | Ga0157370_11055178 | |||
| 1964 | Ga0157370_11858056 | |||
| 1965 | Ga0157369_10144321 | |||
| 1966 | Ga0157369_10232574 | |||
| 1967 | Ga0157369_11400628 | |||
| 1968 | Ga0157374_10114888 | |||
| 1969 | Ga0157374_10330021 | |||
| 1970 | Ga0157374_10353147 | |||
| 1971 | Ga0157374_10666033 | |||
| 1972 | Ga0157374_10786400 | |||
| 1973 | Ga0157374_11470969 | |||
| 1974 | Ga0157374_11806333 | |||
| 1975 | Ga0157378_10061143 | |||
| 1976 | Ga0163162_10013188 | |||
| 1977 | Ga0163162_10091111 | |||
| 1978 | Ga0163162_10281421 | |||
| 1979 | Ga0163162_10406105 | |||
| 1980 | Ga0163162_12989434 | |||
| 1981 | Ga0157372_10015898 | |||
| 1982 | Ga0157372_10378416 | |||
| 1983 | Ga0157372_10509917 | |||
| 1984 | Ga0157372_10575568 | |||
| 1985 | Ga0157372_10966833 | |||
| 1986 | Ga0157372_11285556 | |||
| 1987 | Ga0157372_11975650 | |||
| 1988 | Ga0157375_10105486 | |||
| 1989 | Ga0157375_10130023 | |||
| 1990 | Ga0157375_10399179 | |||
| 1991 | Ga0157375_10501827 | |||
| 1992 | Ga0157375_12229913 | |||
| 1993 | Ga0157375_12945296 | |||
| 1994 | Ga0163163_10006286 | |||
| 1995 | Ga0163163_10018303 | |||
| 1996 | Ga0163163_10066480 | |||
| 1997 | Ga0163163_10105620 | |||
| 1998 | Ga0163163_10307075 | |||
| 1999 | Ga0163163_10512402 | |||
| 2000 | Ga0163163_10822136 | |||
| 2001 | Ga0163163_10838706 | |||
| 2002 | Ga0157380_10062530 | |||
| 2003 | Ga0157380_12813348 | |||
| 2004 | Ga0182008_10404538 | |||
| 2005 | Ga0157377_10022293 | |||
| 2006 | Ga0157377_10034766 | |||
| 2007 | Ga0157377_10924745 | |||
| 2008 | Ga0157379_10029876 | |||
| 2009 | Ga0157379_10045799 | |||
| 2010 | Ga0157379_10906899 | |||
| 2011 | Ga0157379_12632932 | |||
| 2012 | Ga0157376_10195773 | |||
| 2013 | Ga0157376_10298688 | |||
| 2014 | Ga0157376_10953560 | |||
| 2015 | Ga0157376_11019454 | |||
| 2016 | Ga0157376_11293753 | |||
| 2017 | Ga0163161_10274120 | |||
| 2018 | Ga0163161_10519693 | |||
| 2019 | Ga0163161_11860860 | |||
| 2020 | Ga0206356_10176058 | |||
| 2021 | Ga0206356_10740431 | |||
| 2022 | Ga0206350_10816149 | |||
| 2023 | Ga0206354_10405810 | |||
| 2024 | Ga0206354_10777851 | |||
| 2025 | Ga0206354_11274633 | |||
| 2026 | Ga0206353_10425410 | |||
| 2027 | Ga0206353_10452870 | |||
| 2028 | Ga0206353_10710564 | |||
| 2029 | Ga0206353_10787633 | |||
| 2030 | Ga0206353_11644540 | |||
| 2031 | Ga0213875_10065940 | |||
| 2032 | Ga0224572_1088459 | |||
| 2033 | Ga0207656_10272398 | |||
| 2034 | Ga0207656_10399755 | |||
| 2035 | Ga0207713_1122559 | |||
| 2036 | Ga0207653_10007655 | |||
| 2037 | Ga0207682_10162617 | |||
| 2038 | Ga0207692_10006312 | |||
| 2039 | Ga0207692_10007738 | |||
| 2040 | Ga0207692_10019386 | |||
| 2041 | Ga0207692_10033931 | |||
| 2042 | Ga0207692_10045357 | |||
| 2043 | Ga0207692_11024196 | |||
| 2044 | Ga0207710_10051115 | |||
| 2045 | Ga0207710_10088489 | |||
| 2046 | Ga0207710_10161269 | |||
| 2047 | Ga0207710_10355049 | |||
| 2048 | Ga0207688_10010832 | |||
| 2049 | Ga0207688_10022892 | |||
| 2050 | Ga0207680_10203512 | |||
| 2051 | Ga0207647_10105804 | |||
| 2052 | Ga0207647_10144274 | |||
| 2053 | Ga0207647_10289066 | |||
| 2054 | Ga0207647_10409557 | |||
| 2055 | Ga0207685_10047409 | |||
| 2056 | Ga0207685_10252940 | |||
| 2057 | Ga0207685_10780676 | |||
| 2058 | Ga0207685_10785239 | |||
| 2059 | Ga0207699_10002728 | |||
| 2060 | Ga0207699_10003786 | |||
| 2061 | Ga0207699_10013262 | |||
| 2062 | Ga0207699_10048280 | |||
| 2063 | Ga0207699_10048764 | |||
| 2064 | Ga0207699_10050166 | |||
| 2065 | Ga0207699_10069771 | |||
| 2066 | Ga0207699_10275547 | |||
| 2067 | Ga0207699_10850360 | |||
| 2068 | Ga0207645_10060893 | |||
| 2069 | Ga0207643_10000496 | |||
| 2070 | Ga0207643_10020391 | |||
| 2071 | Ga0207705_10010928 | |||
| 2072 | Ga0207705_10090058 | |||
| 2073 | Ga0207705_11539525 | |||
| 2074 | Ga0207684_10001614 | |||
| 2075 | Ga0207684_10035004 | |||
| 2076 | Ga0207684_10125552 | |||
| 2077 | Ga0207684_10363047 | |||
| 2078 | Ga0207684_10523733 | |||
| 2079 | Ga0207684_11067101 | |||
| 2080 | Ga0207654_10034578 | |||
| 2081 | Ga0207707_10162644 | |||
| 2082 | Ga0207707_10362759 | |||
| 2083 | Ga0207707_10878196 | |||
| 2084 | Ga0207695_10193541 | |||
| 2085 | Ga0207695_10568317 | |||
| 2086 | Ga0207695_10901219 | |||
| 2087 | Ga0207671_10031423 | |||
| 2088 | Ga0207671_10034855 | |||
| 2089 | Ga0207671_10040115 | |||
| 2090 | Ga0207671_11342194 | |||
| 2091 | Ga0207671_11491873 | |||
| 2092 | Ga0207693_10009761 | |||
| 2093 | Ga0207693_10015285 | |||
| 2094 | Ga0207693_10016363 | |||
| 2095 | Ga0207693_10056142 | |||
| 2096 | Ga0207693_10281884 | |||
| 2097 | Ga0207693_10765227 | |||
| 2098 | Ga0207693_10943401 | |||
| 2099 | Ga0207663_10014592 | |||
| 2100 | Ga0207663_10023610 | |||
| 2101 | Ga0207663_10030578 | |||
| 2102 | Ga0207663_10038132 | |||
| 2103 | Ga0207663_10081774 | |||
| 2104 | Ga0207663_10157445 | |||
| 2105 | Ga0207663_10299864 | |||
| 2106 | Ga0207663_10679136 | |||
| 2107 | Ga0207660_10057642 | |||
| 2108 | Ga0207660_10750913 | |||
| 2109 | Ga0207662_10036568 | |||
| 2110 | Ga0207662_10069250 | |||
| 2111 | Ga0207657_10001570 | |||
| 2112 | Ga0207657_10003201 | |||
| 2113 | Ga0207649_10051809 | |||
| 2114 | Ga0207649_10219069 | |||
| 2115 | Ga0207652_10102775 | |||
| 2116 | Ga0207652_10351536 | |||
| 2117 | Ga0207652_10529532 | |||
| 2118 | Ga0207652_10548320 | |||
| 2119 | Ga0207652_11200975 | |||
| 2120 | Ga0207646_10000730 | |||
| 2121 | Ga0207646_10004440 | |||
| 2122 | Ga0207646_10025590 | |||
| 2123 | Ga0207646_10030829 | |||
| 2124 | Ga0207646_10034104 | |||
| 2125 | Ga0207646_10536770 | |||
| 2126 | Ga0207646_10891710 | |||
| 2127 | Ga0207646_10905292 | |||
| 2128 | Ga0207646_11323635 | |||
| 2129 | Ga0207681_10325822 | |||
| 2130 | Ga0207694_10091265 | |||
| 2131 | Ga0207694_10114650 | |||
| 2132 | Ga0207650_10047958 | |||
| 2133 | Ga0207650_11914005 | |||
| 2134 | Ga0207659_10042494 | |||
| 2135 | Ga0207659_11026881 | |||
| 2136 | Ga0207687_10028626 | |||
| 2137 | Ga0207687_10029737 | |||
| 2138 | Ga0207687_10136910 | |||
| 2139 | Ga0207687_10699495 | |||
| 2140 | Ga0207687_10740131 | |||
| 2141 | Ga0207687_10793132 | |||
| 2142 | Ga0207700_10005381 | |||
| 2143 | Ga0207700_10015658 | |||
| 2144 | Ga0207700_10019874 | |||
| 2145 | Ga0207700_10049185 | |||
| 2146 | Ga0207700_10085867 | |||
| 2147 | Ga0207700_10104226 | |||
| 2148 | Ga0207700_10169506 | |||
| 2149 | Ga0207700_10250792 | |||
| 2150 | Ga0207700_10392918 | |||
| 2151 | Ga0207700_10393011 | |||
| 2152 | Ga0207700_10393533 | |||
| 2153 | Ga0207700_10397068 | |||
| 2154 | Ga0207700_10853689 | |||
| 2155 | Ga0207700_10962249 | |||
| 2156 | Ga0207700_11052637 | |||
| 2157 | Ga0207700_11268885 | |||
| 2158 | Ga0207664_10003798 | |||
| 2159 | Ga0207664_10006386 | |||
| 2160 | Ga0207664_10019371 | |||
| 2161 | Ga0207664_10020570 | |||
| 2162 | Ga0207664_10026600 | |||
| 2163 | Ga0207664_10028683 | |||
| 2164 | Ga0207664_10036385 | |||
| 2165 | Ga0207664_10038300 | |||
| 2166 | Ga0207664_10049665 | |||
| 2167 | Ga0207664_10122625 | |||
| 2168 | Ga0207664_10143552 | |||
| 2169 | Ga0207664_10204908 | |||
| 2170 | Ga0207664_10436927 | |||
| 2171 | Ga0207664_10448756 | |||
| 2172 | Ga0207664_10453379 | |||
| 2173 | Ga0207664_10503611 | |||
| 2174 | Ga0207664_10592752 | |||
| 2175 | Ga0207664_11064488 | |||
| 2176 | Ga0207664_11284839 | |||
| 2177 | Ga0207664_11601984 | |||
| 2178 | Ga0207644_10006975 | |||
| 2179 | Ga0207644_10146563 | |||
| 2180 | Ga0207644_10163812 | |||
| 2181 | Ga0207644_11387039 | |||
| 2182 | Ga0207690_10090943 | |||
| 2183 | Ga0207706_10283643 | |||
| 2184 | Ga0207686_10163599 | |||
| 2185 | Ga0207686_10233310 | |||
| 2186 | Ga0207686_10931356 | |||
| 2187 | Ga0207709_10027447 | |||
| 2188 | Ga0207709_10071468 | |||
| 2189 | Ga0207709_10162519 | |||
| 2190 | Ga0207670_11241618 | |||
| 2191 | Ga0207704_10144598 | |||
| 2192 | Ga0207704_11181954 | |||
| 2193 | Ga0207665_10025878 | |||
| 2194 | Ga0207665_10041787 | |||
| 2195 | Ga0207665_10042368 | |||
| 2196 | Ga0207665_10062747 | |||
| 2197 | Ga0207665_10109286 | |||
| 2198 | Ga0207691_10023810 | |||
| 2199 | Ga0207691_10090998 | |||
| 2200 | Ga0207691_10597842 | |||
| 2201 | Ga0207711_10064839 | |||
| 2202 | Ga0207711_10466795 | |||
| 2203 | Ga0207711_10508054 | |||
| 2204 | Ga0207711_10516961 | |||
| 2205 | Ga0207711_11529205 | |||
| 2206 | Ga0207689_10003762 | |||
| 2207 | Ga0207689_10011201 | |||
| 2208 | Ga0207689_10403932 | |||
| 2209 | Ga0207689_11257662 | |||
| 2210 | Ga0207661_10005461 | |||
| 2211 | Ga0207661_10008656 | |||
| 2212 | Ga0207661_10025595 | |||
| 2213 | Ga0207661_10276564 | |||
| 2214 | Ga0207661_10471709 | |||
| 2215 | Ga0207661_11592882 | |||
| 2216 | Ga0207679_10051928 | |||
| 2217 | Ga0207679_10324926 | |||
| 2218 | Ga0207679_10693691 | |||
| 2219 | Ga0207667_10055804 | |||
| 2220 | Ga0207667_10173637 | |||
| 2221 | Ga0207667_10180185 | |||
| 2222 | Ga0207667_10453567 | |||
| 2223 | Ga0207712_11221743 | |||
| 2224 | Ga0207712_12015271 | |||
| 2225 | Ga0207668_10001182 | |||
| 2226 | Ga0207668_10039018 | |||
| 2227 | Ga0207668_10106177 | |||
| 2228 | Ga0207640_10165330 | |||
| 2229 | Ga0207658_10091618 | |||
| 2230 | Ga0207658_10108260 | |||
| 2231 | Ga0207658_10301720 | |||
| 2232 | Ga0207677_10057222 | |||
| 2233 | Ga0207677_10613299 | |||
| 2234 | Ga0207677_10622459 | |||
| 2235 | Ga0207677_11444875 | |||
| 2236 | Ga0207703_10050602 | |||
| 2237 | Ga0207703_10514207 | |||
| 2238 | Ga0207639_10089364 | |||
| 2239 | Ga0207639_10161702 | |||
| 2240 | Ga0207639_10248352 | |||
| 2241 | Ga0207639_11054359 | |||
| 2242 | Ga0207678_10053854 | |||
| 2243 | Ga0207678_10056882 | |||
| 2244 | Ga0207678_10483575 | |||
| 2245 | Ga0207708_10058212 | |||
| 2246 | Ga0207702_10027472 | |||
| 2247 | Ga0207702_10054053 | |||
| 2248 | Ga0207702_10060477 | |||
| 2249 | Ga0207702_10089831 | |||
| 2250 | Ga0207702_10201222 | |||
| 2251 | Ga0207702_10221259 | |||
| 2252 | Ga0207641_10007880 | |||
| 2253 | Ga0207641_10055263 | |||
| 2254 | Ga0207641_10056959 | |||
| 2255 | Ga0207641_10081297 | |||
| 2256 | Ga0207641_10592076 | |||
| 2257 | Ga0207641_11366517 | |||
| 2258 | Ga0207641_11441176 | |||
| 2259 | Ga0207641_12165341 | |||
| 2260 | Ga0207676_10003083 | |||
| 2261 | Ga0207676_10014092 | |||
| 2262 | Ga0207676_10118467 | |||
| 2263 | Ga0207676_10319024 | |||
| 2264 | Ga0207676_10619312 | |||
| 2265 | Ga0207674_10022331 | |||
| 2266 | Ga0207674_10022506 | |||
| 2267 | Ga0207674_10066111 | |||
| 2268 | Ga0207674_10432859 | |||
| 2269 | Ga0207674_10594597 | |||
| 2270 | Ga0207674_10611184 | |||
| 2271 | Ga0207675_100001740 | |||
| 2272 | Ga0207683_10004433 | |||
| 2273 | Ga0207683_10011795 | |||
| 2274 | Ga0207683_10165305 | |||
| 2275 | Ga0207683_10270732 | |||
| 2276 | Ga0207683_11098119 | |||
| 2277 | Ga0207698_10076121 | |||
| 2278 | Ga0207698_10118353 | |||
| 2279 | Ga0207698_10209342 | |||
| 2280 | Ga0207698_10742368 | |||
| 2281 | Ga0207428_10052605 | |||
| 2282 | Ga0268266_10106230 | |||
| 2283 | Ga0268266_10120641 | |||
| 2284 | Ga0268266_10457401 | |||
| 2285 | Ga0268266_10711657 | |||
| 2286 | Ga0268265_10075896 | |||
| 2287 | Ga0268265_10910648 | |||
| 2288 | Ga0268264_10000238 | |||
| 2289 | Ga0268264_10134098 | |||
| 2290 | Ga0268264_11166542 | |||
| 2291 | Ga0268264_11604674 | |||
| 2292 | Ga0265320_10525712 | |||
| 2293 | Ga0307509_10156849 | |||
| 2294 | Ga0307405_11315969 | |||
| 2295 | Ga0307405_12151490 | |||
| 2296 | Ga0307410_10348187 | |||
| 2297 | Ga0307410_11530923 | |||
| 2298 | Ga0307407_10357581 | |||
| 2299 | Ga0307412_10219717 | |||
| 2300 | Ga0307409_100116660 | |||
| 2301 | Ga0307409_100921345 | |||
| 2302 | Ga0307409_101072303 | |||
| 2303 | Ga0307409_102546171 | |||
| 2304 | Ga0307416_100175445 | |||
| 2305 | Ga0307416_100286658 | |||
| 2306 | Ga0307416_100766228 | |||
| 2307 | Ga0307411_10795039 | |||
| 2308 | Ga0307415_100217386 | |||
| 2309 | Ga0307415_100239463 | |||
| 2310 | Ga0307415_100530416 | |||
| 2311 | Ga0307415_101729472 | |||
| 2312 | Ga0373930_0008208 | |||
| 2313 | Ga0373948_0013610 | |||
| 2314 | Ga0373948_0074181 | |||
| 2315 | Ga0373950_0021245 | |||
| 2316 | Ga0373959_0104072 | |||
| 2317 | Ga0373938_0007289 | |||
| 2318 | Ga0373926_0001366 | |||
| 2319 | Ga0373926_0010578 | |||
| 2320 | Ga0373926_0024539 | |||
| 2321 | Ga0373926_0291350 | |||
| 2322 | Ga0373928_0061507 | |||
| 2323 | Ga0373934_0000680 | |||
| 2324 | Ga0373934_0001711 | |||
| 2325 | Ga0373934_0012797 | |||
| 2326 | Ga0373934_0083000 | |||
| 2327 | Ga0373940_0022878 | |||
| 2328 | Ga0373944_0001086 | |||
| 2329 | Ga0373944_0001504 | |||
| 2330 | Ga0373944_0002339 | |||
| 2331 | Ga0373944_0257508 | |||
| 2332 | Ga0373923_0000434 | |||
| 2333 | Ga0373923_0002713 | |||
| 2334 | Ga0373923_0026414 | |||
| 2335 | Ga0373923_0090156 | |||
| 2336 | Ga0373923_0118427 | |||
| 2337 | Ga0373923_0201102 | |||
| 2338 | Ga0373923_0308029 | |||
| 2339 | Ga0373932_0023305 | |||
| 2340 | Ga0373932_0024965 | |||
| 2341 | Ga0373932_0351546 | |||
| 2342 | Ga0373936_0000112 | |||
| 2343 | Ga0373936_0004092 | |||
| 2344 | Ga0373936_0007615 | |||
| 2345 | Ga0373936_0015947 | |||
| 2346 | Ga0373936_0076603 | |||
| 2347 | Ga0373936_0140831 | |||
| 2348 | Ga0373936_0182791 | |||
| 2349 | Ga0373936_0633492 | |||
| 2350 | Ga0373939_0018781 | |||
| 2351 | Ga0373941_0169116 | |||
| 2352 | Ga0373945_0000364 | |||
| 2353 | Ga0373945_0006002 | |||
| 2354 | Ga0373945_0006387 | |||
| 2355 | Ga0373945_0294920 | |||
| 2356 | Ga0373953_0000043 | |||
| 2357 | Ga0373953_0000407 | |||
| 2358 | Ga0373953_0015371 | |||
| 2359 | Ga0373953_0062791 | |||
| 2360 | Ga0373953_0137938 | |||
| 2361 | Ga0373953_0217399 | |||
| 2362 | Ga0373953_0296985 | |||
| 2363 | Ga0373954_0001380 | |||
| 2364 | Ga0373954_0004326 | |||
| 2365 | Ga0373954_0017809 | |||
| 2366 | Ga0373954_0084765 | |||
| 2367 | Ga0373954_0155871 | |||
| 2368 | Ga0373954_0661706 | |||
| 2369 | Ga0373956_0000761 | |||
| 2370 | Ga0373956_0002268 | |||
| 2371 | Ga0373956_0035502 | |||
| 2372 | Ga0373956_0187820 | |||
| 2373 | Ga0373957_0000905 | |||
| 2374 | Ga0373957_0001292 | |||
| 2375 | Ga0373957_0014284 | |||
| 2376 | Ga0373957_0018571 | |||
| 2377 | Ga0373957_0106341 | |||
| 2378 | Ga0373957_0214874 | |||
| 2379 | Ga0373957_0272654 | |||
| 2380 | Ga0373957_0305855 | |||
| 2381 | Ga0373960_0002454 | |||
| 2382 | Ga0373943_0000118 | |||
| 2383 | Ga0373943_0003604 | |||
| 2384 | Ga0373943_0016594 | |||
| 2385 | Ga0373943_0024198 | |||
| 2386 | Ga0373943_0146481 | |||
| 2387 | Ga0373943_0261476 | |||
| 2388 | Ga0373943_0482366 | |||
| 2389 | Ga0373946_0000064 | |||
| 2390 | Ga0373946_0005696 | |||
| 2391 | Ga0373946_0016415 | |||
| 2392 | Ga0373946_0068120 | |||
| 2393 | Ga0373946_0150745 | |||
| 2394 | Ga0373946_0307039 | |||
| 2395 | Ga0373946_0432100 | |||
| 2396 | Ga0373955_0000307 | |||
| 2397 | Ga0373955_0001389 | |||
| 2398 | Ga0373955_0010704 | |||
| 2399 | Ga0373955_0061176 | |||
| 2400 | Ga0373955_0070377 | |||
| 2401 | Ga0373955_0101368 | |||
| 2402 | Ga0373955_0109320 | |||
| 2403 | Ga0373942_0005328 | |||
| 2404 | Ga0373942_0058021 | |||
| 2405 | Ga0373942_0114991 | |||
| 2406 | Ga0373961_0195971 | |||
| 2407 | Ga0373962_0011303 | |||
| 2408 | Ga0373962_0190467 | |||
| 2409 | Ga0373924_0000805 | |||
| 2410 | Ga0373924_0002180 | |||
| 2411 | Ga0373924_0004825 | |||
| 2412 | Ga0373924_0047025 | |||
| 2413 | Ga0373924_0536455 | |||
| 2414 | Ga0373924_0552032 | |||
| 2415 | Ga0373931_0000023 | |||
| 2416 | Ga0373931_0005176 | |||
| 2417 | Ga0373931_0216668 | |||
| 2418 | Ga0373935_0001398 | |||
| 2419 | Ga0373935_0010150 | |||
| 2420 | Ga0373935_0011246 | |||
| 2421 | Ga0373935_0042060 | |||
| 2422 | Ga0373935_0120688 | |||
| 2423 | Ga0373935_0137292 | |||
| 2424 | Ga0373935_0287869 | |||
| 2425 | Ga0373935_0916350 | |||
| 2426 | Ga0373927_0003100 | |||
| 2427 | Ga0373927_0015337 | |||
| 2428 | Ga0373927_0017869 | |||
| 2429 | Ga0373927_0090858 | |||
| 2430 | Ga0373927_0218993 | |||
| 2431 | Ga0373933_0000283 | |||
| 2432 | Ga0373933_0003663 | |||
| 2433 | Ga0373933_0014917 | |||
| 2434 | Ga0373933_0017730 | |||
| 2435 | Ga0373933_0019180 | |||
| 2436 | Ga0373933_0230626 | |||
| 2437 | Ga0373933_0304885 | |||
| 2438 | Ga0373933_0630398 | |||
| 2439 | Ga0373947_0012001 | |||
| 2440 | Ga0373947_0016714 | |||
| 2441 | Ga0373947_0046936 | |||
| 2442 | Ga0373947_0133035 | |||
| 2443 | Ga0373947_0161788 | |||
| 2444 | Ga0373947_0295495 | |||
| 2445 | Ga0373947_0414923 | |||
| 2446 | Ga0373947_0625596 | |||
| 2447 | Ga0373937_0000560 | |||
| 2448 | Ga0373937_0005931 | |||
| 2449 | Ga0373937_0011035 | |||
| 2450 | Ga0373937_0014488 | |||
| 2451 | Ga0373937_0017147 | |||
| 2452 | Ga0373937_0144616 | |||
| 2453 | Ga0373937_0261363 | |||
| 2454 | Ga0373937_0455953 | |||
| 2455 | Ga0373937_0715116 | |||
| 2456 | Ga0373937_1285264 | |||
| 2457 | Ga0373937_1494159 | |||
| 2458 | Ga0373937_2123881 | |||
| 2459 | Ga0373925_0003688 | |||
| 2460 | Ga0373925_0004201 | |||
| 2461 | Ga0373925_0006891 | |||
| 2462 | Ga0373925_0014026 | |||
| 2463 | Ga0373925_0077222 | |||
| 2464 | Ga0373925_0098261 | |||
| 2465 | Ga0373925_0447777 | |||
| 2466 | Ga0373925_0649229 | |||
| 2467 | Ga0373925_0754924 | |||
| 2468 | Ga0373925_0816855 | |||
| 2469 | Ga0373925_1229663 | |||
| 2470 | Ga0395899_0927176 | |||
| 2471 | Ga0395900_0463885 | |||
| 2472 | Ga0395900_1012615 | |||
| 2473 | Ga0395898_0053505 | |||
| 2474 | Ga0395898_0168316 | |||
| 2475 | Ga0395898_1480528 | |||
| 2476 | Ga0395905_0061892 | |||
| 2477 | Ga0395905_0095805 | |||
| 2478 | Ga0395905_0202688 | |||
| 2479 | Ga0436364_0626442 | |||
| 2480 | Ga0395901_0003209 | |||
| 2481 | Ga0395901_0010731 | |||
| 2482 | Ga0395901_0022908 | |||
| 2483 | Ga0395901_0033608 | |||
| 2484 | Ga0395901_0349181 | |||
| 2485 | Ga0395901_0892814 | |||
| 2486 | Ga0436365_0904426 | |||
| 2487 | Ga0451787_591939 | |||
| 2488 | Ga0451789_0523819 | |||
| 2489 | Ga0451791_0166158 | |||
| 2490 | Ga0451791_0622792 | |||
| 2491 | Ga0451793_0118808 | |||
| 2492 | Ga0451793_1419480 | |||
| 2493 | Ga0451797_0328055 | |||
| 2494 | Ga0451800_0789169 | |||
| 2495 | Ga0451833_1106457 | |||
| 2496 | Ga0451833_1447573 | |||
| 2497 | Ga0451839_1460976 | |||
| 2498 | Ga0451849_0857468 | |||
| 2499 | Ga0451851_0216177 | |||
| 2500 | Ga0451843_0852902 | |||
| 2501 | Ga0451853_3758868 | |||
| 2502 | Ga0439448_0146704 | |||
| 2503 | Ga0466969_0586825 | |||
| 2504 | Ga0466966_0124347 | |||
| 2505 | Ga0466963_0068227 | |||
| 2506 | Ga0466963_0262770 | |||
| 2507 | Ga0466963_0803224 | |||
| 2508 | Ga0466960_0797287 | |||
| 2509 | Ga0466959_0272089 | |||
| 2510 | Ga0466958_0227802 | |||
| 2511 | Ga0466958_0244552 | |||
| 2512 | Ga0466958_0275866 | |||
| 2513 | Ga0466958_0611728 | |||
| 2514 | Ga0466967_0002837 | |||
| 2515 | Ga0466967_0034625 | |||
| 2516 | Ga0466967_0036093 | |||
| 2517 | Ga0466967_0616530 | |||
| 2518 | Ga0466967_0815095 | |||
| 2519 | Ga0466967_1686854 | |||
| 2520 | Ga0495592_0000403 | |||
| 2521 | Ga0495592_0004793 | |||
| 2522 | Ga0495592_0007493 | |||
| 2523 | Ga0495592_0011572 | |||
| 2524 | Ga0495592_0032960 | |||
| 2525 | Ga0495592_0140351 | |||
| 2526 | Ga0495603_0344594 | |||
| 2527 | Ga0495603_0496127 | |||
| 2528 | Ga0495629_0006468 | |||
| 2529 | Ga0495629_0006516 | |||
| 2530 | Ga0495629_0021000 | |||
| 2531 | Ga0495629_0027475 | |||
| 2532 | Ga0495629_0177274 | |||
| 2533 | Ga0495629_0179305 | |||
| 2534 | Ga0495641_0001329 | |||
| 2535 | Ga0495641_0008248 | |||
| 2536 | Ga0495641_0037010 | |||
| 2537 | Ga0495641_0064419 | |||
| 2538 | Ga0495651_0000499 | |||
| 2539 | Ga0495651_0000629 | |||
| 2540 | Ga0495651_0008111 | |||
| 2541 | Ga0495651_0008484 | |||
| 2542 | Ga0495651_0031929 | |||
| 2543 | Ga0495651_0110928 | |||
| 2544 | Ga0495651_0345015 | |||
| 2545 | Ga0495653_0000784 | |||
| 2546 | Ga0495653_0001785 | |||
| 2547 | Ga0495653_0006323 | |||
| 2548 | Ga0495653_0010486 | |||
| 2549 | Ga0495653_0017714 | |||
| 2550 | Ga0495653_0018669 | |||
| 2551 | Ga0495653_0023443 | |||
| 2552 | Ga0495653_0028193 | |||
| 2553 | Ga0495653_0176303 | |||
| 2554 | Ga0495653_0226269 | |||
| 2555 | Ga0495653_0379975 | |||
| 2556 | Ga0495653_0485614 | |||
| 2557 | Ga0495580_0010540 | |||
| 2558 | Ga0495580_0731998 | |||
| 2559 | Ga0495582_0004671 | |||
| 2560 | Ga0495582_0026415 | |||
| 2561 | Ga0495582_0030798 | |||
| 2562 | Ga0495582_0040194 | |||
| 2563 | Ga0495582_0051612 | |||
| 2564 | Ga0495605_0400083 | |||
| 2565 | Ga0495639_0113720 | |||
| 2566 | Ga0495639_0435760 | |||
| 2567 | Ga0495639_0608007 | |||
| 2568 | Ga0495639_0610811 | |||
| 2569 | Ga0495662_0000450 | |||
| 2570 | Ga0495662_0011923 | |||
| 2571 | Ga0495662_0013265 | |||
| 2572 | Ga0495662_0013987 | |||
| 2573 | Ga0495662_0041720 | |||
| 2574 | Ga0495662_0080753 | |||
| 2575 | Ga0495664_0002021 | |||
| 2576 | Ga0495664_0012667 | |||
| 2577 | Ga0495664_0022552 | |||
| 2578 | Ga0495664_0035870 | |||
| 2579 | Ga0495664_0045276 | |||
| 2580 | Ga0495664_0056990 | |||
| 2581 | Ga0495664_0145399 | |||
| 2582 | Ga0495664_0145489 | |||
| 2583 | Ga0495664_0214734 | |||
| 2584 | Ga0495664_0873330 | |||
| 2585 | Ga0495584_0363344 | |||
| 2586 | Ga0495585_0304231 | |||
| 2587 | Ga0495594_0003675 | |||
| 2588 | Ga0495594_0134358 | |||
| 2589 | Ga0495607_0469941 | |||
| 2590 | Ga0495583_0157298 | |||
| 2591 | Ga0495608_0000310 | |||
| 2592 | Ga0495608_0001991 | |||
| 2593 | Ga0495608_0013836 | |||
| 2594 | Ga0495608_0015411 | |||
| 2595 | Ga0495608_0037626 | |||
| 2596 | Ga0495608_0038866 | |||
| 2597 | Ga0495608_0051321 | |||
| 2598 | Ga0495608_0054003 | |||
| 2599 | Ga0495608_0132775 | |||
| 2600 | Ga0495608_0285431 | |||
| 2601 | Ga0495608_0849973 | |||
| 2602 | Ga0495618_0003806 | |||
| 2603 | Ga0495618_0008293 | |||
| 2604 | Ga0495618_0011730 | |||
| 2605 | Ga0495618_0021086 | |||
| 2606 | Ga0495618_0039492 | |||
| 2607 | Ga0495618_0086836 | |||
| 2608 | Ga0495628_0003764 | |||
| 2609 | Ga0495628_0013037 | |||
| 2610 | Ga0495628_0021978 | |||
| 2611 | Ga0495628_0055250 | |||
| 2612 | Ga0495628_0123378 | |||
| 2613 | Ga0495628_0151725 | |||
| 2614 | Ga0495628_0238910 | |||
| 2615 | Ga0495628_0631134 | |||
| 2616 | Ga0495630_0003016 | |||
| 2617 | Ga0495630_0004973 | |||
| 2618 | Ga0495630_0011591 | |||
| 2619 | Ga0495630_0046931 | |||
| 2620 | Ga0495630_0140899 | |||
| 2621 | Ga0495630_0211786 | |||
| 2622 | Ga0495630_0226255 | |||
| 2623 | Ga0495630_0763886 | |||
| 2624 | Ga0495648_0021050 | |||
| 2625 | Ga0495663_0025407 | |||
| 2626 | Ga0495666_0003315 | |||
| 2627 | Ga0495666_0122066 | |||
| 2628 | Ga0495666_0362833 | |||
| 2629 | Ga0495652_0003138 | |||
| 2630 | Ga0495652_0004652 | |||
| 2631 | Ga0495652_0017741 | |||
| 2632 | Ga0495652_0039172 | |||
| 2633 | Ga0495652_0070916 | |||
| 2634 | Ga0495652_0092455 | |||
| 2635 | Ga0495652_0139327 | |||
| 2636 | Ga0495652_0145617 | |||
| 2637 | Ga0495652_0276328 | |||
| 2638 | Ga0495665_0000852 | |||
| 2639 | Ga0495665_0020020 | |||
| 2640 | Ga0495665_0023068 | |||
| 2641 | Ga0495665_0029037 | |||
| 2642 | Ga0495665_0099980 | |||
| 2643 | Ga0495640_0000992 | |||
| 2644 | Ga0495640_0023597 | |||
| 2645 | Ga0495640_0026763 | |||
| 2646 | Ga0495640_0034290 | |||
| 2647 | Ga0495640_0094023 | |||
| 2648 | Ga0495640_0116348 | |||
| 2649 | Ga0495640_0273941 | |||
| 2650 | Ga0495586_0034025 | |||
| 2651 | Ga0495586_0114977 | |||
| 2652 | Ga0495586_0685291 | |||
| 2653 | Ga0495587_0000348 | |||
| 2654 | Ga0495587_0003250 | |||
| 2655 | Ga0495587_0006890 | |||
| 2656 | Ga0495587_0010228 | |||
| 2657 | Ga0495587_0046591 | |||
| 2658 | Ga0495587_0047295 | |||
| 2659 | Ga0495587_0055754 | |||
| 2660 | Ga0495587_0096864 | |||
| 2661 | Ga0495587_0268098 | |||
| 2662 | Ga0495609_0458658 | |||
| 2663 | Ga0495645_0004292 | |||
| 2664 | Ga0495645_0006831 | |||
| 2665 | Ga0495645_0016495 | |||
| 2666 | Ga0495645_0028737 | |||
| 2667 | Ga0495645_0042680 | |||
| 2668 | Ga0495645_0070256 | |||
| 2669 | Ga0495645_0079380 | |||
| 2670 | Ga0495645_0080814 | |||
| 2671 | Ga0495645_0094953 | |||
| 2672 | Ga0495645_0120593 | |||
| 2673 | Ga0495645_0318675 | |||
| 2674 | Ga0495667_0000353 | |||
| 2675 | Ga0495667_0001265 | |||
| 2676 | Ga0495667_0008594 | |||
| 2677 | Ga0495667_0013460 | |||
| 2678 | Ga0495667_0017945 | |||
| 2679 | Ga0495667_0021774 | |||
| 2680 | Ga0495667_0033601 | |||
| 2681 | Ga0495667_0034736 | |||
| 2682 | Ga0495667_0273906 | |||
| 2683 | Ga0495667_0471113 | |||
| 2684 | Ga0495667_0543689 | |||
| 2685 | Ga0495656_0248378 | |||
| 2686 | Ga0495656_0592167 | |||
| 2687 | Ga0495668_0061673 | |||
| 2688 | Ga0495668_0664543 | |||
| 2689 | Ga0495634_0001947 | |||
| 2690 | Ga0495634_0008618 | |||
| 2691 | Ga0495634_0111299 | |||
| 2692 | Ga0495634_0130784 | |||
| 2693 | Ga0495634_0236717 | |||
| 2694 | Ga0495634_0323748 | |||
| 2695 | Ga0495634_0514517 | |||
| 2696 | Ga0495635_0006559 | |||
| 2697 | Ga0495635_0009824 | |||
| 2698 | Ga0495635_0029723 | |||
| 2699 | Ga0495635_0030189 | |||
| 2700 | Ga0495635_0034921 | |||
| 2701 | Ga0495635_0037022 | |||
| 2702 | Ga0495635_0075458 | |||
| 2703 | Ga0495635_0359309 | |||
| 2704 | Ga0495635_0544619 | |||
| 2705 | Ga0495659_0270438 | |||
| 2706 | Ga0495661_0294118 | |||
| 2707 | Ga0495588_0044788 | |||
| 2708 | Ga0495588_0138864 | |||
| 2709 | Ga0495657_0002166 | |||
| 2710 | Ga0495657_0002176 | |||
| 2711 | Ga0495657_0012650 | |||
| 2712 | Ga0495657_0023699 | |||
| 2713 | Ga0495657_0024050 | |||
| 2714 | Ga0495657_0074522 | |||
| 2715 | Ga0495657_0085202 | |||
| 2716 | Ga0495657_0117501 | |||
| 2717 | Ga0495657_0219379 | |||
| 2718 | Ga0495657_0513308 | |||
| 2719 | Ga0495657_0643083 | |||
| 2720 | Ga0495657_0759569 | |||
| 2721 | Ga0495599_0000267 | |||
| 2722 | Ga0495599_0000894 | |||
| 2723 | Ga0495599_0001817 | |||
| 2724 | Ga0495599_0006456 | |||
| 2725 | Ga0495599_0010888 | |||
| 2726 | Ga0495599_0014766 | |||
| 2727 | Ga0495599_0018140 | |||
| 2728 | Ga0495599_0079146 | |||
| 2729 | Ga0495599_0128017 | |||
| 2730 | Ga0495599_0199913 | |||
| 2731 | Ga0495599_0754412 | |||
| 2732 | Ga0495623_0001940 | |||
| 2733 | Ga0495623_0007666 | |||
| 2734 | Ga0495623_0044190 | |||
| 2735 | Ga0495623_0066047 | |||
| 2736 | Ga0495646_0008644 | |||
| 2737 | Ga0495646_0010256 | |||
| 2738 | Ga0495646_0013681 | |||
| 2739 | Ga0495646_0025322 | |||
| 2740 | Ga0495646_0042643 | |||
| 2741 | Ga0495646_0213075 | |||
| 2742 | Ga0495646_0256060 | |||
| 2743 | Ga0495646_0263139 | |||
| 2744 | Ga0495646_0514998 | |||
| 2745 | Ga0495647_0007560 | |||
| 2746 | Ga0495647_0359022 | |||
| 2747 | Ga0495658_0005104 | |||
| 2748 | Ga0495658_0064971 | |||
| 2749 | Ga0495658_0270344 | |||
| 2750 | Ga0495658_0854600 | |||
| 2751 | Ga0495613_0008946 | |||
| 2752 | Ga0495613_0012223 | |||
| 2753 | Ga0495613_0222909 | |||
| 2754 | Ga0495613_0697975 | |||
| 2755 | Ga0495613_0853831 | |||
| 2756 | Ga0495624_0003764 | |||
| 2757 | Ga0495624_0018876 | |||
| 2758 | Ga0495624_0046945 | |||
| 2759 | Ga0495624_0051058 | |||
| 2760 | Ga0495624_0141997 | |||
| 2761 | Ga0495624_0142746 | |||
| 2762 | Ga0495624_0366358 | |||
| 2763 | Ga0495624_0773303 | |||
| 2764 | Ga0495670_0491385 | |||
| 2765 | Ga0495649_0386539 | |||
| 2766 | Ga0495600_0001242 | |||
| 2767 | Ga0495600_0001286 | |||
| 2768 | Ga0495600_0003324 | |||
| 2769 | Ga0495600_0003483 | |||
| 2770 | Ga0495600_0030510 | |||
| 2771 | Ga0495600_0062392 | |||
| 2772 | Ga0495600_0079066 | |||
| 2773 | Ga0495600_0586391 | |||
| 2774 | Ga0495581_0001028 | |||
| 2775 | Ga0495581_0008227 | |||
| 2776 | Ga0495581_0049465 | |||
| 2777 | Ga0495581_0238187 | |||
| 2778 | Ga0495581_0296385 | |||
| 2779 | Ga0495581_0618467 | |||
| 2780 | Ga0495604_0000550 | |||
| 2781 | Ga0495604_0004599 | |||
| 2782 | Ga0495604_0006607 | |||
| 2783 | Ga0495604_0012698 | |||
| 2784 | Ga0495604_0029989 | |||
| 2785 | Ga0495604_0045966 | |||
| 2786 | Ga0495604_0163644 | |||
| 2787 | Ga0495604_0548945 | |||
| 2788 | Ga0495636_0084328 | |||
| 2789 | Ga0495674_0000590 | |||
| 2790 | Ga0495674_0005002 | |||
| 2791 | Ga0495674_0006374 | |||
| 2792 | Ga0495674_0006392 | |||
| 2793 | Ga0495674_0007829 | |||
| 2794 | Ga0495674_0010942 | |||
| 2795 | Ga0495674_0024200 | |||
| 2796 | Ga0495674_0033926 | |||
| 2797 | Ga0495674_0199721 | |||
| 2798 | Ga0495672_0012718 | |||
| 2799 | Ga0495672_0198051 | |||
| 2800 | Ga0495676_0000954 | |||
| 2801 | Ga0495676_0128560 | |||
| 2802 | Ga0495676_0138887 | |||
| 2803 | Ga0495676_0646499 | |||
| 2804 | Ga0495680_0000904 | |||
| 2805 | Ga0495680_0004224 | |||
| 2806 | Ga0495680_0005938 | |||
| 2807 | Ga0495680_0011425 | |||
| 2808 | Ga0495680_0026146 | |||
| 2809 | Ga0495680_0028636 | |||
| 2810 | Ga0495680_0030765 | |||
| 2811 | Ga0495680_0039607 | |||
| 2812 | Ga0495680_0486645 | |||
| 2813 | Ga0495675_0003298 | |||
| 2814 | Ga0495675_0024148 | |||
| 2815 | Ga0495675_0025904 | |||
| 2816 | Ga0495675_0097522 | |||
| 2817 | Ga0495675_0154449 | |||
| 2818 | Ga0495675_0314679 | |||
| 2819 | Ga0495675_0720556 | |||
| 2820 | Ga0495677_0295495 | |||
| 2821 | Ga0495673_0011306 | |||
| 2822 | Ga0495684_0003309 | |||
| 2823 | Ga0495684_0005014 | |||
| 2824 | Ga0495684_0005115 | |||
| 2825 | Ga0495684_0010003 | |||
| 2826 | Ga0495684_0018088 | |||
| 2827 | Ga0495684_0058010 | |||
| 2828 | Ga0495684_0062861 | |||
| 2829 | Ga0495684_0487047 | |||
| 2830 | Ga0495684_0589865 | |||
| 2831 | Ga0495684_0646589 | |||
| 2832 | Ga0495593_0001796 | |||
| 2833 | Ga0495593_0005834 | |||
| 2834 | Ga0495593_0025918 | |||
| 2835 | Ga0495593_0052138 | |||
| 2836 | Ga0495593_0115266 | |||
| 2837 | Ga0495593_0173969 | |||
| 2838 | Ga0495593_0350587 | |||
| 2839 | Ga0495593_0640296 | |||
| 2840 | Ga0495602_0000631 | |||
| 2841 | Ga0495602_0011014 | |||
| 2842 | Ga0495602_0028399 | |||
| 2843 | Ga0495602_0029254 | |||
| 2844 | Ga0495602_0031883 | |||
| 2845 | Ga0495602_0099556 | |||
| 2846 | Ga0495602_0100285 | |||
| 2847 | Ga0495602_0102694 | |||
| 2848 | Ga0495614_0008860 | |||
| 2849 | Ga0495614_0124294 | |||
| 2850 | Ga0495614_0411875 | |||
| 2851 | Ga0496100_0096290 | |||
| 2852 | Ga0496100_0141566 | |||
| 2853 | Ga0496100_0202315 | |||
| 2854 | Ga0496100_0222530 | |||
| 2855 | Ga0496100_0262835 | |||
| 2856 | Ga0496100_0413435 | |||
| 2857 | Ga0496100_1254091 | |||
| 2858 | Ga0496101_0045495 | |||
| 2859 | Ga0496101_0049889 | |||
| 2860 | Ga0496101_0620998 | |||
| 2861 | Ga0496101_0856598 | |||
| 2862 | Ga0496101_1312592 | |||
| 2863 | Ga0496101_1572744 | |||
| 2864 | Ga0496102_0000080 | |||
| 2865 | Ga0496102_0067624 | |||
| 2866 | Ga0496102_0171188 | |||
| 2867 | Ga0496102_0609187 | |||
| 2868 | Ga0496102_0847969 | |||
| 2869 | Ga0496103_0000118 | |||
| 2870 | Ga0496103_0018985 | |||
| 2871 | Ga0496103_0087157 | |||
| 2872 | Ga0496104_0013883 | |||
| 2873 | Ga0496104_0032231 | |||
| 2874 | Ga0496104_0087034 | |||
| 2875 | Ga0496104_0111366 | |||
| 2876 | Ga0496104_0112715 | |||
| 2877 | Ga0496104_0276032 | |||
| 2878 | Ga0496104_0420557 | |||
| 2879 | Ga0496105_0005906 | |||
| 2880 | Ga0496105_0006129 | |||
| 2881 | Ga0496105_0036164 | |||
| 2882 | Ga0496105_0045749 | |||
| 2883 | Ga0496105_0058446 | |||
| 2884 | Ga0496105_0242632 | |||
| 2885 | Ga0496105_0251894 | |||
| 2886 | Ga0496105_0391730 | |||
| 2887 | Ga0496105_0402689 | |||
| 2888 | Ga0496105_0559348 | |||
| 2889 | Ga0496105_1361106 | |||
| 2890 | Ga0496106_0002362 | |||
| 2891 | Ga0496106_0014659 | |||
| 2892 | Ga0496106_0093873 | |||
| 2893 | Ga0496106_0192401 | |||
| 2894 | Ga0496107_0020401 | |||
| 2895 | Ga0496107_0109891 | |||
| 2896 | Ga0496107_0352800 | |||
| 2897 | Ga0496107_0391691 | |||
| 2898 | Ga0496107_0500081 | |||
| 2899 | Ga0496108_0006269 | |||
| 2900 | Ga0496108_0008118 | |||
| 2901 | Ga0496108_0042290 | |||
| 2902 | Ga0496108_0053659 | |||
| 2903 | Ga0496108_0075171 | |||
| 2904 | Ga0496108_0107438 | |||
| 2905 | Ga0496108_0276256 | |||
| 2906 | Ga0496108_0402570 | |||
| 2907 | Ga0496108_0508385 | |||
| 2908 | Ga0496108_0679481 | |||
| 2909 | Ga0496108_0828574 | |||
| 2910 | Ga0496109_0018225 | |||
| 2911 | Ga0496109_0032488 | |||
| 2912 | Ga0496109_0048849 | |||
| 2913 | Ga0496109_0073072 | |||
| 2914 | Ga0496109_0078626 | |||
| 2915 | Ga0496109_0134444 | |||
| 2916 | Ga0496109_0147756 | |||
| 2917 | Ga0496109_0233899 | |||
| 2918 | Ga0496109_0244941 | |||
| 2919 | Ga0496109_0844428 | |||
| 2920 | Ga0496110_0008783 | |||
| 2921 | Ga0496110_0011473 | |||
| 2922 | Ga0496110_0023374 | |||
| 2923 | Ga0496110_0026333 | |||
| 2924 | Ga0496110_0045767 | |||
| 2925 | Ga0496110_0048126 | |||
| 2926 | Ga0496110_0084204 | |||
| 2927 | Ga0496110_0134331 | |||
| 2928 | Ga0496110_0195037 | |||
| 2929 | Ga0496110_0212470 | |||
| 2930 | Ga0496111_0001546 | |||
| 2931 | Ga0496111_0001962 | |||
| 2932 | Ga0496111_0038431 | |||
| 2933 | Ga0496111_0063060 | |||
| 2934 | Ga0496111_0082038 | |||
| 2935 | Ga0496111_0247808 | |||
| 2936 | Ga0496111_0251210 | |||
| 2937 | Ga0496111_0548406 | |||
| 2938 | Ga0496111_0734068 | |||
| 2939 | Ga0496112_0048983 | |||
| 2940 | Ga0496112_0095416 | |||
| 2941 | Ga0496112_0185705 | |||
| 2942 | Ga0496112_0227027 | |||
| 2943 | Ga0496112_0387555 | |||
| 2944 | Ga0496112_0610749 | |||
| 2945 | Ga0496112_0772629 | |||
| 2946 | Ga0496113_0021573 | |||
| 2947 | Ga0496113_0031252 | |||
| 2948 | Ga0496113_0061647 | |||
| 2949 | Ga0496113_0084473 | |||
| 2950 | Ga0496113_0095021 | |||
| 2951 | Ga0496113_0145551 | |||
| 2952 | Ga0496113_0237866 | |||
| 2953 | Ga0496113_0554789 | |||
| 2954 | Ga0496113_1184216 | |||
| 2955 | Ga0496114_0001467 | |||
| 2956 | Ga0496114_0043065 | |||
| 2957 | Ga0496114_0046271 | |||
| 2958 | Ga0496114_0065861 | |||
| 2959 | Ga0496114_0137311 | |||
| 2960 | Ga0496114_0529744 | |||
| 2961 | Ga0496114_0823780 | |||
| 2962 | Ga0496114_1565768 | |||
| 2963 | Ga0496115_0078901 | |||
| 2964 | Ga0496115_0129927 | |||
| 2965 | Ga0496115_0174786 | |||
| 2966 | Ga0496115_0175042 | |||
| 2967 | Ga0496115_0522133 | |||
| 2968 | Ga0496115_0523540 | |||
| 2969 | Ga0496115_0524258 | |||
| 2970 | Ga0496116_0000493 | |||
| 2971 | Ga0496117_0000287 | |||
| 2972 | Ga0496118_0000266 | |||
| 2973 | Ga0496119_0000558 | |||
| 2974 | Ga0496119_0522511 | |||
| 2975 | Ga0496120_0032642 | |||
| 2976 | Ga0496121_0034602 | |||
| 2977 | Ga0496121_0625834 | |||
| 2978 | Ga0496124_0041754 | |||
| 2979 | Ga0496125_0023352 | |||
| 2980 | Ga0496126_0000383 | |||
| 2981 | Ga0496126_0252559 | |||
| 2982 | Ga0496126_0446431 | |||
| 2983 | Ga0501032_0665548 | |||
| 2984 | Ga0501036_0220862 | |||
| 2985 | Ga0501041_0234612 | |||
| 2986 | Ga0501041_0656155 | |||
| 2987 | Ga0501042_0080546 | |||
| 2988 | Ga0501046_0285155 | |||
| 2989 | Ga0501047_0835889 | |||
| 2990 | Ga0501048_0146684 | |||
| 2991 | Ga0501067_0032391 | |||
| 2992 | Ga0501067_0421803 | |||
| 2993 | Ga0501068_0008894 | |||
| 2994 | Ga0501068_0188942 | |||
| 2995 | Ga0501069_0097667 | |||
| 2996 | Ga0501069_0220456 | |||
| 2997 | Ga0501069_0701459 | |||
| 2998 | Ga0501071_0061910 | |||
| 2999 | Ga0501071_1240029 | |||
| 3000 | Ga0501072_0092972 | |||
| 3001 | Ga0501075_0134936 | |||
| 3002 | Ga0501076_0304532 | |||
| 3003 | Ga0501079_0159797 | |||
| 3004 | Ga0501080_0385241 | |||
| 3005 | Ga0501035_1335924 | |||
| 3006 | nmdc:mga03n38_109246_c1 | |||
| 3007 | nmdc:mga00v17_34430_c1 | |||
| 3008 | nmdc:mga06z11_1002683_c1 | |||
| 3009 | nmdc:mga06z11_11055_c1 | |||
| 3010 | nmdc:mga06z11_23889_c1 | |||
| 3011 | nmdc:mga06z11_350278_c1 | |||
| 3012 | nmdc:mga07m45_286566_c1 | |||
| 3013 | nmdc:mga07m45_38864_c2 | |||
| 3014 | nmdc:mga05p37_1044996_c1 | |||
| 3015 | nmdc:mga09592_524590_c1 | |||
| 3016 | nmdc:mga06r32_1436416_c1 | |||
| 3017 | nmdc:mga06r32_1613458_c1 | |||
| 3018 | nmdc:mga08y16_12180_c1 | |||
| 3019 | nmdc:mga08y16_906774_c1 | |||
| 3020 | nmdc:mga0n895_133729_c1 | |||
| 3021 | nmdc:mga0n895_249911_c1 | |||
| 3022 | nmdc:mga0rr50_1443566_c1 | |||
| 3023 | nmdc:mga0rr50_345835_c1 | |||
| 3024 | nmdc:mga0rr50_49138_c1 | |||
| 3025 | nmdc:mga0rr50_874535_c1 | |||
| 3026 | nmdc:mga0rr50_978519_c1 | |||
| 3027 | nmdc:mga08x19_119332_c1 | |||
| 3028 | nmdc:mga08x19_35567_c1 | |||
| 3029 | nmdc:mga08x19_362749_c1 | |||
| 3030 | nmdc:mga08x19_843530_c1 | |||
| 3031 | nmdc:mga0a205_1415199_c1 | |||
| 3032 | nmdc:mga0sz30_275557_c1 | |||
| 3033 | Ga0495601_0061833 | |||
| 3034 | Ga0495601_0089804 | |||
| 3035 | Ga0495601_0103415 | |||
| 3036 | Ga0495601_0124479 | |||
| 3037 | Ga0495601_0199642 | |||
| 3038 | Ga0495601_0230937 | |||
| 3039 | Ga0495601_0250923 | |||
| 3040 | Ga0495601_0259025 | |||
| 3041 | Ga0495601_0321173 | |||
| 3042 | Ga0495612_0067963 | |||
| 3043 | Ga0495612_0141952 | |||
| 3044 | Ga0495612_0437929 | |||
| 3045 | Ga0495595_0007895 | |||
| 3046 | Ga0495595_0009676 | |||
| 3047 | Ga0495595_0085688 | |||
| 3048 | Ga0495595_0151182 | |||
| 3049 | Ga0495595_0275970 | |||
| 3050 | Ga0495595_0486617 | |||
| 3051 | Ga0495595_0522864 | |||
| 3052 | Ga0495595_0711573 | |||
| 3053 | Ga0495619_0001335 | |||
| 3054 | Ga0495619_0016774 | |||
| 3055 | Ga0495619_0019874 | |||
| 3056 | Ga0495619_0120564 | |||
| 3057 | Ga0495619_0724416 | |||
| 3058 | Ga0500573_0073562 | |||
| 3059 | Ga0501084_0119025 | |||
| 3060 | Ga0590075_097874 | |||
| 3061 | Ga0466962_0367469 | |||
| 3062 | 2855388217 |
Family Sequences
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1jx7-assembly1.cif.gz_E | crystal structure of ychn protein from e.coli | 0.815 | 2 | 121 |
| 1jx7-assembly1.cif.gz_E | crystal structure of ychn protein from e.coli | 0.8088 | 2 | 121 |
| 2qs7-assembly2.cif.gz_D | crystal structure of a putative oxidoreductase of the dsre/dsrf-like family (sso1126) from sulfolobus solfataricus p2 at 2.09 a resolution | 0.7963 | 2 | 121 |
| 3pnx-assembly2.cif.gz_E | crystal structure of a putative sulfurtransferase dsre (swol_2425) from syntrophomonas wolfei str. goettingen at 1.92 a resolution | 0.7942 | 2 | 121 |
| 3mc3-assembly1.cif.gz_A | crystal structure of dsre/dsrf-like family protein (np_342589.1) from sulfolobus solfataricus at 1.49 a resolution | 0.7892 | 2 | 121 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q58170_143_270_3.40.1260.10 | Alpha Beta;3-Layer(aba) Sandwich;Hypothetical Protein Ychn; Chain: A,;DsrEFH-like | 0.8627 | 1 | 113 | 3.40.1260.10 |
| af_Q58396_1_114_3.40.1260.10 | Alpha Beta;3-Layer(aba) Sandwich;Hypothetical Protein Ychn; Chain: A,;DsrEFH-like | 0.8399 | 4 | 121 | 3.40.1260.10 |
| af_Q9TXZ5_1_281_3.40.50.2000 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; | 0.8285 | 3 | 40 | 3.40.50.2000 |
| af_Q58396_1_114_3.40.1260.10 | Alpha Beta;3-Layer(aba) Sandwich;Hypothetical Protein Ychn; Chain: A,;DsrEFH-like | 0.8266 | 4 | 121 | 3.40.1260.10 |
| af_Q22180_1_276_3.40.50.2000 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; | 0.8258 | 1 | 39 | 3.40.50.2000 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A1SLX6-F1-model_v4 | Peroxiredoxins-like protein | 0.9982 | 3 | 121 |
|
| AF-A0A5A7WDM2-F1-model_v4 | Peroxiredoxin | 0.9947 | 3 | 121 |
|
| AF-A0A1I4ZLF0-F1-model_v4 | Predicted peroxiredoxin | 0.9928 | 2 | 121 |
|
| AF-A0A850CJB2-F1-model_v4 | Peroxiredoxin | 0.9919 | 18 | 121 |
|
| AF-A0A172ULQ7-F1-model_v4 | Peroxiredoxin | 0.9915 | 2 | 121 |
|