F494457

General Info

Members Datasets Scaffolds Average Seq Length
1508 400 3016 113

Family's Representative Sequence

Representative Sequence 3300050515|nmdc:mga0a205_406560_c1|nmdc:mga0a205_406560_c1_555_905
Length 109
Sequence MGTNWLSRELKRGSAELLILALIEQRARHGYEIAQGAIAFHTASLYPTLYRMEDKNLIDGRWVEKAGQRRRRYYRITATGRKALASQRSLWEGFFAALNRVARVKGAET

Samples

Sample ID Description Type Environment
1 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
7 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
20 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
21 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
22 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
23 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
24 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
25 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
26 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
27 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
28 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
29 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
30 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
31 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
32 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
33 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
34 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
35 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
36 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
37 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
38 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
39 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
40 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
41 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
42 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
43 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
44 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
45 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
46 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
47 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
48 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
49 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
50 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
51 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
52 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
53 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
54 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
55 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
56 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
57 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
58 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
59 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
60 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
61 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
62 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
63 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
64 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
65 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
66 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
67 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
68 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
69 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
70 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
71 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
72 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
73 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
74 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
75 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
76 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
77 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
78 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
79 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
80 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
81 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
82 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
83 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
84 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
85 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
86 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
87 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
88 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
89 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
90 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
91 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
92 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
93 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
94 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
95 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
96 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
97 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
98 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
99 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
100 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
101 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
102 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
103 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
104 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
105 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
106 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
107 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
108 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
109 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
110 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
111 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
112 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
113 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
114 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
115 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
116 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
117 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
118 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
119 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
120 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
121 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
122 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
123 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
124 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
125 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
126 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
127 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
128 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
129 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
130 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
131 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
132 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
133 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
134 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
135 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
136 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
137 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
138 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
139 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
140 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
141 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
142 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
143 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
144 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
145 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
210 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
211 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
215 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
216 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
217 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
218 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
219 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
220 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
221 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
222 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
223 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
224 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
225 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
226 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
227 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
228 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
229 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
230 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
231 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
232 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
233 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
234 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
235 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
236 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
237 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
238 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
239 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
240 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
241 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
242 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
243 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
244 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
245 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
246 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
247 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
248 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
249 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
250 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
251 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
252 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
253 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
254 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
255 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
256 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
257 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
258 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
259 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
260 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
261 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
262 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
263 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
264 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
265 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
266 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
267 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
268 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
269 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
270 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
271 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
272 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
273 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
274 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
275 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
276 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
277 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
278 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
279 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
280 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
281 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
282 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
283 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
284 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
285 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
286 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
287 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
288 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
289 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
290 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
291 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
292 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
293 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
294 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
295 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
296 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
297 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
298 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
299 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
300 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
301 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
302 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
303 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
304 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
305 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
306 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
307 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
308 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
309 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
310 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
311 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
312 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
313 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
314 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
315 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
316 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
317 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
318 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
319 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
320 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
321 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
322 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
323 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
324 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
325 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
326 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
327 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
328 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
329 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
330 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
331 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
332 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
333 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
334 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
335 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
336 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
337 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
338 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
339 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
340 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
341 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
342 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
343 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
344 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
345 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
346 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
347 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
348 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
349 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
350 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
351 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
352 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
353 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
354 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
355 3300049685 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control Metagenome Rhizosphere
356 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
357 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
358 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
359 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
360 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
361 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
362 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
363 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
364 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
365 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
366 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
367 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
368 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
369 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
370 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
371 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
372 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
373 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
374 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
375 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
376 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
377 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
378 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
379 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
380 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
381 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
382 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
383 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
384 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
385 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
386 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
387 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
388 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
389 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
390 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
391 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
392 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
393 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
394 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
395 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
396 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
397 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
398 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
399 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
400 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.87
Metatranscriptomes 0.13
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.05
Nodule 0
Rhizoplane 3.78
Rhizosphere 92.64
Stem 0
Stem Tuber 0
Unclassified 30.9

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga0a205_406560_c1 3300050515 Unclassified 1225
2 SwRhRL2b_contig_2243275 2162886007 Bacteria 1083
3 MRS1b_contig_3024102 2162886011 Bacteria 859
4 MBSR1b_contig_1652279 2162886012 Bacteria 1387
5 rootL2_10213578 3300003322 Bacteria 2223
6 rootL2_10313642 3300003322 Unclassified 1363
7 Ga0058861_10004023 3300004800 Bacteria 734
8 Ga0065704_10008609 3300005289 Bacteria 2066
9 Ga0065712_10000722 3300005290 Bacteria 11453
10 Ga0065712_10068112 3300005290 Bacteria 14573
11 Ga0065712_10080038 3300005290 Unclassified 3152
12 Ga0065712_10343860 3300005290 Unclassified 794
13 Ga0065715_10000665 3300005293 Bacteria 9117
14 Ga0065715_10090667 3300005293 Bacteria 6647
15 Ga0065715_10101699 3300005293 Bacteria 3179
16 Ga0065715_10181187 3300005293 Unclassified 1475
17 Ga0065715_10647439 3300005293 Bacteria 680
18 Ga0065715_10684669 3300005293 Unclassified 649
19 Ga0065707_10006461 3300005295 Bacteria 3173
20 Ga0065707_10097909 3300005295 Bacteria 3130
21 Ga0065707_10137150 3300005295 Bacteria 1824
22 Ga0065707_11030966 3300005295 Unclassified 530
23 Ga0070658_11727496 3300005327 Unclassified 542
24 Ga0070683_100043182 3300005329 Bacteria 4155
25 Ga0070683_100308188 3300005329 Bacteria 1506
26 Ga0070683_100409135 3300005329 Unclassified 1294
27 Ga0070690_100011979 3300005330 Bacteria 5088
28 Ga0070690_100047029 3300005330 Bacteria 2744
29 Ga0070690_100366826 3300005330 Bacteria 1049
30 Ga0070690_100430052 3300005330 Bacteria 975
31 Ga0070670_100001580 3300005331 Bacteria 18356
32 Ga0070670_100006915 3300005331 Bacteria 9617
33 Ga0070670_100019505 3300005331 Bacteria 5820
34 Ga0070670_100213363 3300005331 Bacteria 1679
35 Ga0070670_100278998 3300005331 Unclassified 1459
36 Ga0070670_100296107 3300005331 Unclassified 1415
37 Ga0070670_101038293 3300005331 Unclassified 746
38 Ga0070670_101493535 3300005331 Unclassified 620
39 Ga0070677_10357022 3300005333 Bacteria 759
40 Ga0068869_100022035 3300005334 Bacteria 4386
41 Ga0068869_100024074 3300005334 Unclassified 4215
42 Ga0068869_100040793 3300005334 Bacteria 3321
43 Ga0068869_100141175 3300005334 Bacteria 1860
44 Ga0068869_100154531 3300005334 Bacteria 1782
45 Ga0068869_100158076 3300005334 Bacteria 1763
46 Ga0068869_100444424 3300005334 Bacteria 1074
47 Ga0068869_100913324 3300005334 Unclassified 760
48 Ga0068869_101270990 3300005334 Unclassified 649
49 Ga0070666_10010768 3300005335 Bacteria 5723
50 Ga0070666_10185609 3300005335 Unclassified 1460
51 Ga0070666_10369917 3300005335 Unclassified 1028
52 Ga0070666_10700327 3300005335 Bacteria 743
53 Ga0070680_100148889 3300005336 Unclassified 1965
54 Ga0070680_100292914 3300005336 Unclassified 1380
55 Ga0070680_100302928 3300005336 Bacteria 1355
56 Ga0070680_101212020 3300005336 Bacteria 653
57 Ga0070682_100304757 3300005337 Unclassified 1170
58 Ga0070682_100473855 3300005337 Bacteria 964
59 Ga0070682_101127229 3300005337 Unclassified 658
60 Ga0070682_101415185 3300005337 Unclassified 595
61 Ga0068868_100023708 3300005338 Bacteria 4647
62 Ga0068868_100261634 3300005338 Bacteria 1459
63 Ga0068868_100414869 3300005338 Bacteria 1164
64 Ga0068868_100646317 3300005338 Bacteria 941
65 Ga0068868_101053747 3300005338 Unclassified 746
66 Ga0070660_100154209 3300005339 Bacteria 1848
67 Ga0070660_100278949 3300005339 Bacteria 1367
68 Ga0070689_100112375 3300005340 Bacteria 2168
69 Ga0070689_100120178 3300005340 Bacteria 2098
70 Ga0070689_100120412 3300005340 Bacteria 2096
71 Ga0070689_100239704 3300005340 Bacteria 1493
72 Ga0070689_100324970 3300005340 Bacteria 1285
73 Ga0070689_100413148 3300005340 Unclassified 1142
74 Ga0070689_100479593 3300005340 Unclassified 1062
75 Ga0070689_100917406 3300005340 Unclassified 776
76 Ga0070689_101376294 3300005340 Unclassified 637
77 Ga0070689_101848171 3300005340 Unclassified 551
78 Ga0070691_10186201 3300005341 Viruses 1083
79 Ga0070687_100002252 3300005343 Bacteria 7158
80 Ga0070687_100015678 3300005343 Bacteria 3433
81 Ga0070687_100274327 3300005343 Bacteria 1058
82 Ga0070687_100575883 3300005343 Bacteria 770
83 Ga0070661_100005111 3300005344 Bacteria 9046
84 Ga0070661_100848863 3300005344 Bacteria 751
85 Ga0070661_101519243 3300005344 Bacteria 565
86 Ga0070692_10106050 3300005345 Unclassified 1548
87 Ga0070692_10224706 3300005345 Bacteria 1111
88 Ga0070692_10598785 3300005345 Viruses 729
89 Ga0070692_10659100 3300005345 Bacteria 700
90 Ga0070692_11320079 3300005345 Unclassified 518
91 Ga0070668_100001555 3300005347 Bacteria 16564
92 Ga0070669_100003234 3300005353 Bacteria 11700
93 Ga0070669_100005529 3300005353 Bacteria 9122
94 Ga0070669_100010304 3300005353 Bacteria 6638
95 Ga0070669_100034970 3300005353 Bacteria 3639
96 Ga0070669_100049616 3300005353 Bacteria 3064
97 Ga0070669_100082770 3300005353 Bacteria 2393
98 Ga0070669_100261635 3300005353 Unclassified 1381
99 Ga0070669_100873864 3300005353 Bacteria 767
100 Ga0070669_101025873 3300005353 Unclassified 708
101 Ga0070669_101324868 3300005353 Unclassified 624
102 Ga0070675_100014022 3300005354 Bacteria 6311
103 Ga0070675_100026732 3300005354 Bacteria 4631
104 Ga0070675_100094438 3300005354 Unclassified 2509
105 Ga0070675_100291076 3300005354 Unclassified 1437
106 Ga0070675_100374782 3300005354 Unclassified 1266
107 Ga0070675_100376660 3300005354 Unclassified 1263
108 Ga0070675_100582762 3300005354 Bacteria 1014
109 Ga0070675_101189632 3300005354 Unclassified 702
110 Ga0070671_100051555 3300005355 Bacteria 3422
111 Ga0070671_100077766 3300005355 Bacteria 2773
112 Ga0070671_100205128 3300005355 Bacteria 1672
113 Ga0070674_100077603 3300005356 Unclassified 2365
114 Ga0070674_100114405 3300005356 Bacteria 1987
115 Ga0070673_100005167 3300005364 Bacteria 8332
116 Ga0070673_100049753 3300005364 Bacteria 3273
117 Ga0070673_100557000 3300005364 Unclassified 1042
118 Ga0070673_100602329 3300005364 Bacteria 1002
119 Ga0070673_101306452 3300005364 Bacteria 681
120 Ga0070688_100079423 3300005365 Bacteria 2119
121 Ga0070688_100145682 3300005365 Bacteria 1613
122 Ga0070688_100305076 3300005365 Bacteria 1152
123 Ga0070688_101063724 3300005365 Unclassified 645
124 Ga0070688_101153253 3300005365 Unclassified 621
125 Ga0070659_100176543 3300005366 Bacteria 1751
126 Ga0070659_100181975 3300005366 Bacteria 1725
127 Ga0070659_100407964 3300005366 Unclassified 1148
128 Ga0070659_101241324 3300005366 Viruses 660
129 Ga0070667_100024133 3300005367 Bacteria 5050
130 Ga0070667_100046729 3300005367 Bacteria 3642
131 Ga0070667_100273089 3300005367 Unclassified 1516
132 Ga0070667_101692008 3300005367 Unclassified 595
133 Ga0070667_102290534 3300005367 Bacteria 509
134 Ga0070703_10000864 3300005406 Bacteria 9777
135 Ga0070703_10002711 3300005406 Bacteria 5084
136 Ga0070703_10427295 3300005406 Bacteria 582
137 Ga0070709_10000012 3300005434 Bacteria 163026
138 Ga0070709_10074400 3300005434 Bacteria 2201
139 Ga0070709_10169840 3300005434 Unclassified 1523
140 Ga0070709_11458956 3300005434 Bacteria 555
141 Ga0070714_100056885 3300005435 Bacteria 3346
142 Ga0070714_101416524 3300005435 Bacteria 679
143 Ga0070713_100000943 3300005436 Bacteria 18588
144 Ga0070713_100040232 3300005436 Bacteria 3799
145 Ga0070713_100143785 3300005436 Bacteria 2115
146 Ga0070713_100785609 3300005436 Unclassified 912
147 Ga0070713_101870664 3300005436 Unclassified 582
148 Ga0070710_10382513 3300005437 Unclassified 939
149 Ga0070710_10479339 3300005437 Unclassified 848
150 Ga0070701_10000511 3300005438 Bacteria 13345
151 Ga0070701_10029826 3300005438 Bacteria 2694
152 Ga0070701_10150675 3300005438 Bacteria 1339
153 Ga0070701_10267227 3300005438 Bacteria 1039
154 Ga0070701_10331854 3300005438 Unclassified 944
155 Ga0070701_10623422 3300005438 Unclassified 717
156 Ga0070711_100184002 3300005439 Unclassified 1601
157 Ga0070711_100393843 3300005439 Bacteria 1123
158 Ga0070711_101698375 3300005439 Unclassified 553
159 Ga0070705_100000836 3300005440 Bacteria 17321
160 Ga0070705_100020093 3300005440 Bacteria 3528
161 Ga0070705_100263852 3300005440 Bacteria 1216
162 Ga0070705_100276519 3300005440 Bacteria 1192
163 Ga0070705_100717785 3300005440 Unclassified 787
164 Ga0070705_100738293 3300005440 Bacteria 777
165 Ga0070705_100954065 3300005440 Unclassified 693
166 Ga0070705_101217760 3300005440 Unclassified 621
167 Ga0070700_100010770 3300005441 Bacteria 5053
168 Ga0070700_100040611 3300005441 Bacteria 2849
169 Ga0070700_100074214 3300005441 Unclassified 2179
170 Ga0070700_100115958 3300005441 Bacteria 1788
171 Ga0070700_100159229 3300005441 Bacteria 1552
172 Ga0070700_100187992 3300005441 Bacteria 1442
173 Ga0070700_100321604 3300005441 Bacteria 1137
174 Ga0070700_100343971 3300005441 Unclassified 1103
175 Ga0070700_100890228 3300005441 Bacteria 724
176 Ga0070700_101539397 3300005441 Unclassified 566
177 Ga0070700_101971044 3300005441 Unclassified 506
178 Ga0070694_100008232 3300005444 Bacteria 6377
179 Ga0070694_100028243 3300005444 Bacteria 3649
180 Ga0070694_100033218 3300005444 Bacteria 3393
181 Ga0070694_100087134 3300005444 Bacteria 2183
182 Ga0070694_100143857 3300005444 Bacteria 1735
183 Ga0070694_100196928 3300005444 Unclassified 1500
184 Ga0070694_100221089 3300005444 Bacteria 1420
185 Ga0070694_100371641 3300005444 Bacteria 1113
186 Ga0070694_100496417 3300005444 Unclassified 971
187 Ga0070694_100676188 3300005444 Unclassified 838
188 Ga0070694_100694321 3300005444 Bacteria 827
189 Ga0070694_101132159 3300005444 Unclassified 654
190 Ga0070694_101160040 3300005444 Bacteria 646
191 Ga0070694_101171546 3300005444 Bacteria 643
192 Ga0070694_101247963 3300005444 Unclassified 624
193 Ga0070694_101349637 3300005444 Unclassified 601
194 Ga0070694_101509863 3300005444 Unclassified 569
195 Ga0070694_101606839 3300005444 Unclassified 552
196 Ga0070694_101685892 3300005444 Unclassified 539
197 Ga0070708_100000281 3300005445 Bacteria 38291
198 Ga0070708_100000312 3300005445 Bacteria 36574
199 Ga0070708_100174167 3300005445 Bacteria 2010
200 Ga0070708_101022903 3300005445 Bacteria 774
201 Ga0070708_101169918 3300005445 Unclassified 720
202 Ga0070708_101471163 3300005445 Bacteria 635
203 Ga0070708_102037969 3300005445 Unclassified 531
204 Ga0070663_100240802 3300005455 Unclassified 1428
205 Ga0070678_100075806 3300005456 Bacteria 2532
206 Ga0070678_101527063 3300005456 Unclassified 626
207 Ga0070662_100077521 3300005457 Bacteria 2466
208 Ga0070662_100805050 3300005457 Bacteria 799
209 Ga0070681_10001264 3300005458 Bacteria 22044
210 Ga0070681_10002886 3300005458 Bacteria 15883
211 Ga0070681_10014005 3300005458 Bacteria 7982
212 Ga0070681_10023405 3300005458 Bacteria 6211
213 Ga0070681_10053544 3300005458 Bacteria 4022
214 Ga0070681_10930240 3300005458 Viruses 788
215 Ga0068867_100367422 3300005459 Unclassified 1205
216 Ga0068867_100370121 3300005459 Bacteria 1201
217 Ga0068867_100469573 3300005459 Bacteria 1076
218 Ga0068867_101181630 3300005459 Unclassified 702
219 Ga0068867_101439899 3300005459 Bacteria 640
220 Ga0070685_10004702 3300005466 Bacteria 6907
221 Ga0070685_10139212 3300005466 Bacteria 1526
222 Ga0070685_10702421 3300005466 Unclassified 737
223 Ga0070706_100000162 3300005467 Bacteria 84837
224 Ga0070706_100001797 3300005467 Bacteria 22208
225 Ga0070706_100045601 3300005467 Bacteria 4049
226 Ga0070706_100175123 3300005467 Bacteria 2003
227 Ga0070706_100516605 3300005467 Bacteria 1111
228 Ga0070706_100950808 3300005467 Unclassified 793
229 Ga0070706_101135246 3300005467 Bacteria 719
230 Ga0070707_100021062 3300005468 Bacteria 6157
231 Ga0070707_100055784 3300005468 Unclassified 3788
232 Ga0070707_100120246 3300005468 Bacteria 2550
233 Ga0070707_100133093 3300005468 Bacteria 2418
234 Ga0070707_100498303 3300005468 Bacteria 1180
235 Ga0070707_100617636 3300005468 Bacteria 1046
236 Ga0070707_100643396 3300005468 Unclassified 1023
237 Ga0070707_101056142 3300005468 Bacteria 778
238 Ga0070707_101805997 3300005468 Unclassified 579
239 Ga0070698_100004480 3300005471 Bacteria 15354
240 Ga0070698_100076474 3300005471 Bacteria 3349
241 Ga0070698_100262445 3300005471 Bacteria 1659
242 Ga0070698_100324729 3300005471 Bacteria 1470
243 Ga0070698_100387753 3300005471 Bacteria 1330
244 Ga0070698_100402180 3300005471 Bacteria 1303
245 Ga0070698_100741931 3300005471 Bacteria 925
246 Ga0070698_100751895 3300005471 Bacteria 918
247 Ga0070699_100000015 3300005518 Bacteria 211169
248 Ga0070699_100000668 3300005518 Bacteria 32047
249 Ga0070699_100002373 3300005518 Bacteria 16893
250 Ga0070699_100071070 3300005518 Unclassified 3026
251 Ga0070699_100142560 3300005518 Bacteria 2117
252 Ga0070699_100172294 3300005518 Bacteria 1918
253 Ga0070699_100290842 3300005518 Bacteria 1465
254 Ga0070699_100410253 3300005518 Unclassified 1225
255 Ga0070699_100751414 3300005518 Unclassified 892
256 Ga0070699_101324121 3300005518 Bacteria 661
257 Ga0070699_101401299 3300005518 Unclassified 641
258 Ga0070679_100000108 3300005530 Bacteria 65441
259 Ga0070679_100016828 3300005530 Bacteria 7067
260 Ga0070679_100315754 3300005530 Bacteria 1512
261 Ga0070679_100401906 3300005530 Bacteria 1316
262 Ga0070679_100726336 3300005530 Unclassified 936
263 Ga0070679_100926532 3300005530 Viruses 815
264 Ga0070679_101180457 3300005530 Unclassified 710
265 Ga0070684_100008799 3300005535 Bacteria 7915
266 Ga0070684_100841199 3300005535 Bacteria 859
267 Ga0070684_100871404 3300005535 Bacteria 843
268 Ga0070684_101110091 3300005535 Bacteria 743
269 Ga0070684_101191198 3300005535 Unclassified 716
270 Ga0070684_101323869 3300005535 Bacteria 678
271 Ga0070697_100000157 3300005536 Bacteria 55346
272 Ga0070697_100014795 3300005536 Bacteria 6124
273 Ga0070697_100063927 3300005536 Bacteria 3005
274 Ga0070697_100238723 3300005536 Bacteria 1551
275 Ga0070697_100245227 3300005536 Unclassified 1531
276 Ga0070697_100407735 3300005536 Bacteria 1180
277 Ga0070697_100513063 3300005536 Unclassified 1049
278 Ga0070697_100588821 3300005536 Bacteria 977
279 Ga0070697_100781040 3300005536 Bacteria 845
280 Ga0070697_100953764 3300005536 Bacteria 762
281 Ga0070697_101212738 3300005536 Unclassified 672
282 Ga0068853_100042117 3300005539 Bacteria 3903
283 Ga0068853_100051524 3300005539 Bacteria 3543
284 Ga0068853_100281966 3300005539 Bacteria 1532
285 Ga0068853_100461978 3300005539 Bacteria 1195
286 Ga0068853_101602662 3300005539 Unclassified 631
287 Ga0070672_100021225 3300005543 Bacteria 4749
288 Ga0070672_100042591 3300005543 Bacteria 3496
289 Ga0070672_100056836 3300005543 Unclassified 3070
290 Ga0070672_100229608 3300005543 Unclassified 1559
291 Ga0070672_100229893 3300005543 Bacteria 1558
292 Ga0070672_100974402 3300005543 Bacteria 751
293 Ga0070672_101049155 3300005543 Bacteria 723
294 Ga0070686_100003534 3300005544 Bacteria 8573
295 Ga0070686_100056953 3300005544 Bacteria 2509
296 Ga0070686_100211250 3300005544 Bacteria 1397
297 Ga0070686_100804562 3300005544 Unclassified 758
298 Ga0070695_100014408 3300005545 Bacteria 4767
299 Ga0070695_100039434 3300005545 Unclassified 2986
300 Ga0070695_100096696 3300005545 Bacteria 1982
301 Ga0070695_100114118 3300005545 Bacteria 1838
302 Ga0070695_100275996 3300005545 Unclassified 1233
303 Ga0070695_100290531 3300005545 Bacteria 1205
304 Ga0070695_100418404 3300005545 Bacteria 1020
305 Ga0070695_100638863 3300005545 Unclassified 839
306 Ga0070696_100000100 3300005546 Bacteria 43586
307 Ga0070696_100002095 3300005546 Bacteria 13115
308 Ga0070696_100069401 3300005546 Bacteria 2476
309 Ga0070696_100690984 3300005546 Bacteria 831
310 Ga0070696_100894794 3300005546 Bacteria 736
311 Ga0070696_100988877 3300005546 Bacteria 702
312 Ga0070696_101037620 3300005546 Bacteria 686
313 Ga0070696_101438751 3300005546 Bacteria 589
314 Ga0070693_100001253 3300005547 Bacteria 11481
315 Ga0070693_100022347 3300005547 Unclassified 3362
316 Ga0070693_100035766 3300005547 Bacteria 2757
317 Ga0070693_100583621 3300005547 Unclassified 805
318 Ga0070693_100807272 3300005547 Unclassified 696
319 Ga0070693_101091646 3300005547 Unclassified 608
320 Ga0070693_101382642 3300005547 Bacteria 547
321 Ga0070665_100026599 3300005548 Bacteria 5825
322 Ga0070665_100125774 3300005548 Unclassified 2566
323 Ga0070665_100223173 3300005548 Bacteria 1885
324 Ga0070665_100260930 3300005548 Bacteria 1734
325 Ga0070704_100007922 3300005549 Bacteria 6342
326 Ga0070704_100021582 3300005549 Bacteria 4178
327 Ga0070704_100050456 3300005549 Bacteria 2925
328 Ga0070704_100244271 3300005549 Bacteria 1471
329 Ga0070704_100361634 3300005549 Bacteria 1228
330 Ga0070704_100372577 3300005549 Unclassified 1211
331 Ga0070704_100430612 3300005549 Bacteria 1132
332 Ga0070704_100864549 3300005549 Unclassified 811
333 Ga0068855_100072660 3300005563 Bacteria 3997
334 Ga0068855_100666456 3300005563 Bacteria 1116
335 Ga0068855_100732648 3300005563 Bacteria 1055
336 Ga0068855_101253612 3300005563 Unclassified 769
337 Ga0068855_101254650 3300005563 Bacteria 769
338 Ga0068855_102063788 3300005563 Unclassified 575
339 Ga0068855_102373300 3300005563 Unclassified 530
340 Ga0070664_100059730 3300005564 Bacteria 3245
341 Ga0070664_100136101 3300005564 Unclassified 2160
342 Ga0070664_100184064 3300005564 Bacteria 1858
343 Ga0070664_100202182 3300005564 Bacteria 1773
344 Ga0070664_100245025 3300005564 Bacteria 1610
345 Ga0070664_100325042 3300005564 Bacteria 1394
346 Ga0070664_100481815 3300005564 Bacteria 1142
347 Ga0070664_101179435 3300005564 Unclassified 722
348 Ga0070664_101899686 3300005564 Unclassified 565
349 Ga0068857_100049648 3300005577 Bacteria 3722
350 Ga0068857_100143677 3300005577 Unclassified 2158
351 Ga0068857_100364532 3300005577 Unclassified 1340
352 Ga0068857_100448824 3300005577 Bacteria 1205
353 Ga0068854_100002370 3300005578 Bacteria 11622
354 Ga0068854_100119644 3300005578 Unclassified 1997
355 Ga0068854_100161187 3300005578 Bacteria 1737
356 Ga0068854_100275900 3300005578 Bacteria 1352
357 Ga0068854_100295929 3300005578 Bacteria 1308
358 Ga0068854_100548200 3300005578 Bacteria 980
359 Ga0068856_100039066 3300005614 Bacteria 4660
360 Ga0068856_100268466 3300005614 Bacteria 1722
361 Ga0068856_100827489 3300005614 Bacteria 945
362 Ga0068856_100969082 3300005614 Bacteria 869
363 Ga0068856_101888837 3300005614 Unclassified 608
364 Ga0070702_100015286 3300005615 Bacteria 3916
365 Ga0070702_100266398 3300005615 Bacteria 1169
366 Ga0070702_100785191 3300005615 Unclassified 735
367 Ga0070702_101361195 3300005615 Unclassified 579
368 Ga0068852_100328979 3300005616 Bacteria 1486
369 Ga0068852_101024197 3300005616 Unclassified 845
370 Ga0068859_100049588 3300005617 Bacteria 4216
371 Ga0068859_100076373 3300005617 Bacteria 3390
372 Ga0068859_100099592 3300005617 Bacteria 2962
373 Ga0068859_100122844 3300005617 Bacteria 2663
374 Ga0068859_100191121 3300005617 Bacteria 2132
375 Ga0068859_100224674 3300005617 Bacteria 1966
376 Ga0068859_100225249 3300005617 Bacteria 1963
377 Ga0068859_100279853 3300005617 Bacteria 1761
378 Ga0068859_100336049 3300005617 Bacteria 1605
379 Ga0068859_100509408 3300005617 Unclassified 1299
380 Ga0068859_100952397 3300005617 Unclassified 942
381 Ga0068859_101138156 3300005617 Unclassified 859
382 Ga0068859_101912081 3300005617 Unclassified 655
383 Ga0068859_101995602 3300005617 Unclassified 641
384 Ga0068864_100000972 3300005618 Bacteria 24025
385 Ga0068864_100002361 3300005618 Bacteria 15612
386 Ga0068864_100011528 3300005618 Bacteria 7303
387 Ga0068864_100016902 3300005618 Bacteria 6080
388 Ga0068864_100035595 3300005618 Bacteria 4239
389 Ga0068864_100291069 3300005618 Unclassified 1527
390 Ga0068864_100465181 3300005618 Bacteria 1212
391 Ga0068864_100851999 3300005618 Unclassified 898
392 Ga0068864_101298721 3300005618 Unclassified 728
393 Ga0068866_10204673 3300005718 Bacteria 1181
394 Ga0068861_100009072 3300005719 Bacteria 6856
395 Ga0068861_100048952 3300005719 Bacteria 3198
396 Ga0068861_100085936 3300005719 Bacteria 2472
397 Ga0068861_100093878 3300005719 Bacteria 2373
398 Ga0068861_100180534 3300005719 Bacteria 1757
399 Ga0068861_100199378 3300005719 Bacteria 1679
400 Ga0068861_100616380 3300005719 Bacteria 998
401 Ga0068861_100617972 3300005719 Unclassified 997
402 Ga0068861_100964696 3300005719 Bacteria 812
403 Ga0068861_101175961 3300005719 Unclassified 740
404 Ga0068861_101258238 3300005719 Unclassified 718
405 Ga0068861_101492685 3300005719 Bacteria 663
406 Ga0068861_101652548 3300005719 Bacteria 632
407 Ga0068851_10001456 3300005834 Bacteria 10371
408 Ga0068851_10062433 3300005834 Bacteria 1912
409 Ga0068851_10382421 3300005834 Unclassified 825
410 Ga0068870_10344344 3300005840 Bacteria 954
411 Ga0068870_10548806 3300005840 Unclassified 778
412 Ga0068870_10624484 3300005840 Unclassified 735
413 Ga0068870_11317779 3300005840 Bacteria 527
414 Ga0068870_11422573 3300005840 Unclassified 509
415 Ga0068863_100004352 3300005841 Bacteria 13955
416 Ga0068863_100042962 3300005841 Bacteria 4293
417 Ga0068863_100043846 3300005841 Bacteria 4246
418 Ga0068863_100705301 3300005841 Unclassified 1003
419 Ga0068863_101013017 3300005841 Unclassified 833
420 Ga0068863_101275105 3300005841 Unclassified 741
421 Ga0068863_101451243 3300005841 Unclassified 694
422 Ga0068863_101485232 3300005841 Bacteria 686
423 Ga0068863_102576667 3300005841 Unclassified 518
424 Ga0068858_100007287 3300005842 Bacteria 10719
425 Ga0068858_100038388 3300005842 Bacteria 4441
426 Ga0068858_100201121 3300005842 Bacteria 1884
427 Ga0068858_100205876 3300005842 Unclassified 1861
428 Ga0068858_100311502 3300005842 Bacteria 1503
429 Ga0068858_100379446 3300005842 Unclassified 1356
430 Ga0068858_100632663 3300005842 Bacteria 1039
431 Ga0068858_101263259 3300005842 Unclassified 726
432 Ga0068860_100292781 3300005843 Bacteria 1593
433 Ga0068860_100374518 3300005843 Bacteria 1405
434 Ga0068860_100537839 3300005843 Bacteria 1169
435 Ga0068860_100768858 3300005843 Bacteria 976
436 Ga0068860_100954270 3300005843 Unclassified 875
437 Ga0068860_101495864 3300005843 Bacteria 697
438 Ga0068860_101881856 3300005843 Unclassified 620
439 Ga0068862_100022003 3300005844 Bacteria 5332
440 Ga0068862_100029198 3300005844 Bacteria 4646
441 Ga0068862_100031706 3300005844 Bacteria 4464
442 Ga0068862_100223542 3300005844 Bacteria 1705
443 Ga0068862_100324844 3300005844 Bacteria 1421
444 Ga0068862_100412434 3300005844 Bacteria 1266
445 Ga0068862_100645840 3300005844 Bacteria 1020
446 Ga0068862_101036859 3300005844 Bacteria 813
447 Ga0068862_102129104 3300005844 Bacteria 572
448 Ga0081455_10002273 3300005937 Bacteria 22915
449 Ga0081455_10009645 3300005937 Bacteria 9908
450 Ga0081455_10048972 3300005937 Unclassified 3646
451 Ga0081455_10122063 3300005937 Bacteria 2051
452 Ga0081455_10315448 3300005937 Bacteria 1116
453 Ga0081455_11002370 3300005937 Unclassified 517
454 Ga0081540_1103044 3300005983 Unclassified 1224
455 Ga0081540_1248725 3300005983 Bacteria 621
456 Ga0081539_10075890 3300005985 Bacteria 1783
457 Ga0081539_10092910 3300005985 Bacteria 1555
458 Ga0081539_10381415 3300005985 Bacteria 588
459 Ga0070717_10084349 3300006028 Bacteria 2672
460 Ga0070717_10094830 3300006028 Bacteria 2525
461 Ga0070717_10123183 3300006028 Bacteria 2223
462 Ga0075365_10210227 3300006038 Bacteria 1364
463 Ga0075368_10026567 3300006042 Unclassified 2227
464 Ga0075363_100007803 3300006048 Bacteria 4945
465 Ga0075363_100411820 3300006048 Bacteria 795
466 Ga0075364_10015046 3300006051 Bacteria 4790
467 Ga0075364_10224834 3300006051 Bacteria 1274
468 Ga0075364_10243940 3300006051 Bacteria 1220
469 Ga0075432_10245228 3300006058 Bacteria 725
470 Ga0070715_10162672 3300006163 Unclassified 1104
471 Ga0070716_100042757 3300006173 Unclassified 2531
472 Ga0070716_100492156 3300006173 Unclassified 903
473 Ga0070716_101275270 3300006173 Bacteria 593
474 Ga0070712_100072489 3300006175 Bacteria 2467
475 Ga0070712_100318062 3300006175 Bacteria 1265
476 Ga0070712_100494661 3300006175 Unclassified 1024
477 Ga0075367_10003333 3300006178 Bacteria 7629
478 Ga0075367_10019418 3300006178 Bacteria 3767
479 Ga0075367_10453085 3300006178 Bacteria 813
480 Ga0075369_10233764 3300006186 Unclassified 852
481 Ga0075366_10177411 3300006195 Unclassified 1293
482 Ga0075366_10329359 3300006195 Unclassified 936
483 Ga0097621_100004123 3300006237 Bacteria 10075
484 Ga0097621_102011203 3300006237 Unclassified 552
485 Ga0097621_102077654 3300006237 Unclassified 543
486 Ga0075370_10066331 3300006353 Bacteria 2059
487 Ga0075370_10067153 3300006353 Bacteria 2046
488 Ga0068871_100068482 3300006358 Bacteria 2914
489 Ga0068871_100394867 3300006358 Bacteria 1231
490 Ga0068871_100617585 3300006358 Bacteria 987
491 Ga0068871_100927017 3300006358 Unclassified 808
492 Ga0075428_100013681 3300006844 Bacteria 9033
493 Ga0075428_100053415 3300006844 Bacteria 4427
494 Ga0075428_100211742 3300006844 Unclassified 2094
495 Ga0075428_100259688 3300006844 Bacteria 1871
496 Ga0075428_100384232 3300006844 Bacteria 1505
497 Ga0075428_100496120 3300006844 Bacteria 1306
498 Ga0075428_100522993 3300006844 Bacteria 1269
499 Ga0075428_101071946 3300006844 Bacteria 852
500 Ga0075428_101621092 3300006844 Bacteria 676
501 Ga0075428_102604976 3300006844 Unclassified 517
502 Ga0075430_100191962 3300006846 Unclassified 1697
503 Ga0075430_100237311 3300006846 Bacteria 1511
504 Ga0075430_100273308 3300006846 Bacteria 1398
505 Ga0075430_100493766 3300006846 Unclassified 1010
506 Ga0075431_100042464 3300006847 Bacteria 4690
507 Ga0075431_100052990 3300006847 Bacteria 4183
508 Ga0075431_100056525 3300006847 Bacteria 4047
509 Ga0075431_100056998 3300006847 Unclassified 4029
510 Ga0075431_100075398 3300006847 Bacteria 3481
511 Ga0075431_100082032 3300006847 Bacteria 3329
512 Ga0075431_100092837 3300006847 Bacteria 3115
513 Ga0075431_101236031 3300006847 Bacteria 709
514 Ga0075431_101276624 3300006847 Bacteria 696
515 Ga0075433_10011826 3300006852 Bacteria 7030
516 Ga0075433_10035092 3300006852 Bacteria 4311
517 Ga0075433_10044905 3300006852 Bacteria 3840
518 Ga0075433_10048972 3300006852 Unclassified 3675
519 Ga0075433_10057957 3300006852 Bacteria 3387
520 Ga0075433_10271434 3300006852 Bacteria 1503
521 Ga0075433_10332158 3300006852 Bacteria 1344
522 Ga0075433_10361450 3300006852 Bacteria 1282
523 Ga0075433_10545336 3300006852 Bacteria 1020
524 Ga0075433_10591772 3300006852 Bacteria 974
525 Ga0075433_10766789 3300006852 Bacteria 843
526 Ga0075434_100013759 3300006871 Bacteria 7715
527 Ga0075434_100016132 3300006871 Bacteria 7177
528 Ga0075434_100031019 3300006871 Bacteria 5269
529 Ga0075434_100068189 3300006871 Bacteria 3543
530 Ga0075434_100101264 3300006871 Bacteria 2887
531 Ga0075434_100112774 3300006871 Bacteria 2730
532 Ga0075434_100121539 3300006871 Bacteria 2627
533 Ga0075434_100157401 3300006871 Unclassified 2291
534 Ga0075434_100246737 3300006871 Unclassified 1805
535 Ga0075434_100289610 3300006871 Unclassified 1657
536 Ga0075434_100378635 3300006871 Bacteria 1436
537 Ga0075434_100381869 3300006871 Bacteria 1429
538 Ga0075434_100586105 3300006871 Bacteria 1134
539 Ga0075434_101155971 3300006871 Bacteria 787
540 Ga0075429_100294443 3300006880 Bacteria 1421
541 Ga0075429_100364259 3300006880 Bacteria 1266
542 Ga0075429_100841736 3300006880 Archaea 803
543 Ga0075429_100876616 3300006880 Unclassified 786
544 Ga0075429_101312084 3300006880 Unclassified 631
545 Ga0075429_101975089 3300006880 Unclassified 505
546 Ga0068865_100009071 3300006881 Bacteria 6153
547 Ga0068865_100009725 3300006881 Bacteria 5966
548 Ga0068865_100491040 3300006881 Unclassified 1022
549 Ga0068865_100658241 3300006881 Bacteria 891
550 Ga0068865_100711318 3300006881 Unclassified 859
551 Ga0068865_101290936 3300006881 Bacteria 649
552 Ga0075436_100001685 3300006914 Bacteria 15101
553 Ga0075436_100050539 3300006914 Bacteria 2869
554 Ga0075436_100086262 3300006914 Bacteria 2180
555 Ga0075436_100484610 3300006914 Unclassified 903
556 Ga0097620_100049586 3300006931 Bacteria 4216
557 Ga0097620_100076373 3300006931 Bacteria 3390
558 Ga0097620_100099589 3300006931 Bacteria 2962
559 Ga0097620_100122835 3300006931 Bacteria 2663
560 Ga0097620_100191116 3300006931 Bacteria 2132
561 Ga0097620_100224658 3300006931 Bacteria 1966
562 Ga0097620_100225243 3300006931 Bacteria 1963
563 Ga0097620_100279852 3300006931 Bacteria 1761
564 Ga0097620_100336008 3300006931 Bacteria 1605
565 Ga0097620_100509387 3300006931 Unclassified 1299
566 Ga0097620_100952358 3300006931 Unclassified 942
567 Ga0097620_101137811 3300006931 Unclassified 859
568 Ga0097620_101911779 3300006931 Unclassified 655
569 Ga0097620_101995513 3300006931 Unclassified 641
570 Ga0075435_100001301 3300007076 Bacteria 16046
571 Ga0075435_100032624 3300007076 Unclassified 4114
572 Ga0075435_100042126 3300007076 Unclassified 3651
573 Ga0075435_100051314 3300007076 Unclassified 3323
574 Ga0075435_100060651 3300007076 Bacteria 3067
575 Ga0075435_100190239 3300007076 Bacteria 1737
576 Ga0075435_100190789 3300007076 Bacteria 1734
577 Ga0075435_100222999 3300007076 Bacteria 1601
578 Ga0075435_100932143 3300007076 Unclassified 758
579 Ga0099794_10612321 3300007265 Unclassified 577
580 Ga0105240_10017653 3300009093 Bacteria 9608
581 Ga0105240_10068345 3300009093 Bacteria 4400
582 Ga0105240_10086120 3300009093 Bacteria 3848
583 Ga0105240_10104152 3300009093 Unclassified 3446
584 Ga0105240_10148256 3300009093 Bacteria 2797
585 Ga0105240_10364634 3300009093 Bacteria 1635
586 Ga0105240_10805799 3300009093 Unclassified 1017
587 Ga0105240_11092522 3300009093 Bacteria 849
588 Ga0105240_11861517 3300009093 Bacteria 626
589 Ga0111539_10002572 3300009094 Bacteria 24018
590 Ga0111539_10005299 3300009094 Bacteria 16694
591 Ga0111539_10014503 3300009094 Bacteria 9840
592 Ga0111539_10048488 3300009094 Bacteria 5071
593 Ga0111539_10059685 3300009094 Bacteria 4522
594 Ga0111539_10083695 3300009094 Unclassified 3751
595 Ga0111539_10095836 3300009094 Bacteria 3485
596 Ga0111539_10103314 3300009094 Bacteria 3345
597 Ga0111539_10229348 3300009094 Bacteria 2162
598 Ga0111539_11202583 3300009094 Bacteria 880
599 Ga0105245_10199010 3300009098 Bacteria 1923
600 Ga0105245_10439492 3300009098 Bacteria 1311
601 Ga0105245_10439980 3300009098 Bacteria 1310
602 Ga0105245_10523354 3300009098 Bacteria 1205
603 Ga0105245_11638695 3300009098 Unclassified 695
604 Ga0105245_12327159 3300009098 Unclassified 589
605 Ga0105245_13281063 3300009098 Unclassified 501
606 Ga0105247_10017215 3300009101 Bacteria 4337
607 Ga0114129_10009070 3300009147 Bacteria 14178
608 Ga0114129_10028287 3300009147 Bacteria 7942
609 Ga0114129_10029552 3300009147 Bacteria 7762
610 Ga0114129_10047794 3300009147 Bacteria 6011
611 Ga0114129_10109761 3300009147 Bacteria 3808
612 Ga0114129_10116592 3300009147 Bacteria 3680
613 Ga0114129_10154124 3300009147 Bacteria 3143
614 Ga0114129_10325652 3300009147 Bacteria 2042
615 Ga0114129_10369079 3300009147 Bacteria 1897
616 Ga0114129_10610691 3300009147 Bacteria 1412
617 Ga0114129_10837098 3300009147 Unclassified 1171
618 Ga0105243_10055225 3300009148 Bacteria 3155
619 Ga0105243_10071306 3300009148 Bacteria 2809
620 Ga0105243_10160944 3300009148 Bacteria 1935
621 Ga0105243_10327568 3300009148 Bacteria 1398
622 Ga0105243_10807668 3300009148 Bacteria 925
623 Ga0105241_11155504 3300009174 Bacteria 731
624 Ga0105241_12128583 3300009174 Unclassified 555
625 Ga0105242_10224969 3300009176 Unclassified 1679
626 Ga0105242_10633373 3300009176 Bacteria 1038
627 Ga0105242_10793059 3300009176 Bacteria 937
628 Ga0105242_11179282 3300009176 Bacteria 784
629 Ga0105242_12190339 3300009176 Unclassified 598
630 Ga0105242_12413379 3300009176 Unclassified 573
631 Ga0105248_10004553 3300009177 Bacteria 15345
632 Ga0105248_10006130 3300009177 Bacteria 13194
633 Ga0105248_10007892 3300009177 Bacteria 11695
634 Ga0105248_10052803 3300009177 Bacteria 4561
635 Ga0105248_10080602 3300009177 Bacteria 3659
636 Ga0105248_10081317 3300009177 Bacteria 3641
637 Ga0105248_10090041 3300009177 Bacteria 3454
638 Ga0105248_10148696 3300009177 Bacteria 2643
639 Ga0105248_10160948 3300009177 Bacteria 2532
640 Ga0105248_10188524 3300009177 Bacteria 2323
641 Ga0105248_10265986 3300009177 Unclassified 1930
642 Ga0105248_10328857 3300009177 Bacteria 1721
643 Ga0105248_10612794 3300009177 Bacteria 1228
644 Ga0105248_11178071 3300009177 Unclassified 866
645 Ga0105248_13057288 3300009177 Unclassified 533
646 Ga0105237_10001278 3300009545 Bacteria 33584
647 Ga0105237_10100473 3300009545 Bacteria 2884
648 Ga0105237_12179793 3300009545 Unclassified 563
649 Ga0105238_10293590 3300009551 Bacteria 1608
650 Ga0105238_11910144 3300009551 Unclassified 627
651 Ga0105249_10014223 3300009553 Bacteria 7037
652 Ga0105249_10017230 3300009553 Bacteria 6411
653 Ga0105249_10019880 3300009553 Bacteria 5997
654 Ga0105249_10054585 3300009553 Unclassified 3654
655 Ga0105249_10111124 3300009553 Bacteria 2591
656 Ga0105249_10214913 3300009553 Bacteria 1889
657 Ga0105249_10288362 3300009553 Bacteria 1642
658 Ga0105249_10289495 3300009553 Bacteria 1639
659 Ga0105249_10763701 3300009553 Bacteria 1029
660 Ga0105249_10866455 3300009553 Bacteria 969
661 Ga0105249_11120230 3300009553 Unclassified 857
662 Ga0105249_11644118 3300009553 Bacteria 715
663 Ga0105249_11752056 3300009553 Unclassified 694
664 Ga0105249_12254864 3300009553 Unclassified 617
665 Ga0105249_12587689 3300009553 Unclassified 580
666 Ga0105239_10071710 3300010375 Bacteria 3806
667 Ga0105239_10082871 3300010375 Bacteria 3532
668 Ga0105239_10169212 3300010375 Bacteria 2443
669 Ga0105239_10350999 3300010375 Bacteria 1665
670 Ga0105239_10452006 3300010375 Bacteria 1458
671 Ga0105239_10635737 3300010375 Bacteria 1218
672 Ga0105246_10222528 3300011119 Unclassified 1480
673 Ga0105246_10384610 3300011119 Unclassified 1161
674 Ga0105246_10924992 3300011119 Unclassified 784
675 Ga0105246_11348636 3300011119 Unclassified 663
676 Ga0157314_1028801 3300012500 Bacteria 612
677 Ga0157373_10043275 3300013100 Bacteria 3217
678 Ga0157373_10164341 3300013100 Unclassified 1562
679 Ga0157373_10180072 3300013100 Bacteria 1488
680 Ga0157373_10871109 3300013100 Viruses 667
681 Ga0157371_10011944 3300013102 Bacteria 6660
682 Ga0157371_11577088 3300013102 Unclassified 513
683 Ga0157370_10963771 3300013104 Viruses 773
684 Ga0157369_10057370 3300013105 Bacteria 4201
685 Ga0157369_10068874 3300013105 Bacteria 3802
686 Ga0157369_10383556 3300013105 Viruses 1458
687 Ga0157369_11587871 3300013105 Bacteria 665
688 Ga0157374_10187792 3300013296 Bacteria 2021
689 Ga0157374_10617590 3300013296 Bacteria 1095
690 Ga0157374_10757646 3300013296 Unclassified 986
691 Ga0157374_12656422 3300013296 Unclassified 528
692 Ga0157378_10003443 3300013297 Bacteria 14035
693 Ga0157378_10187525 3300013297 Bacteria 1949
694 Ga0157378_10261128 3300013297 Bacteria 1662
695 Ga0157378_10631143 3300013297 Bacteria 1085
696 Ga0157378_10679105 3300013297 Bacteria 1048
697 Ga0157378_10856962 3300013297 Bacteria 937
698 Ga0157378_11391075 3300013297 Bacteria 744
699 Ga0157378_11397568 3300013297 Unclassified 743
700 Ga0157378_11421358 3300013297 Unclassified 737
701 Ga0157378_12624969 3300013297 Unclassified 556
702 Ga0163162_10012324 3300013306 Bacteria 8349
703 Ga0163162_10016878 3300013306 Bacteria 7137
704 Ga0163162_10020854 3300013306 Bacteria 6443
705 Ga0163162_10038119 3300013306 Bacteria 4797
706 Ga0163162_10093638 3300013306 Bacteria 3090
707 Ga0163162_11019097 3300013306 Unclassified 936
708 Ga0163162_11065812 3300013306 Bacteria 915
709 Ga0163162_11089666 3300013306 Bacteria 905
710 Ga0163162_13127424 3300013306 Bacteria 531
711 Ga0157372_10003493 3300013307 Bacteria 16945
712 Ga0157372_10031979 3300013307 Bacteria 5765
713 Ga0157372_10401406 3300013307 Bacteria 1597
714 Ga0157372_12018524 3300013307 Unclassified 663
715 Ga0157372_12501631 3300013307 Unclassified 593
716 Ga0157375_10007339 3300013308 Bacteria 9651
717 Ga0157375_10019518 3300013308 Bacteria 6168
718 Ga0157375_10142606 3300013308 Bacteria 2524
719 Ga0157375_10189760 3300013308 Unclassified 2209
720 Ga0157375_10208694 3300013308 Bacteria 2110
721 Ga0157375_10285934 3300013308 Unclassified 1812
722 Ga0157375_10871563 3300013308 Unclassified 1046
723 Ga0157375_11555120 3300013308 Unclassified 781
724 Ga0163163_10004088 3300014325 Bacteria 12445
725 Ga0163163_10057361 3300014325 Bacteria 3850
726 Ga0163163_10057551 3300014325 Bacteria 3844
727 Ga0163163_10252316 3300014325 Bacteria 1815
728 Ga0163163_10580399 3300014325 Unclassified 1184
729 Ga0163163_10585589 3300014325 Bacteria 1179
730 Ga0163163_11190756 3300014325 Unclassified 824
731 Ga0163163_11997790 3300014325 Bacteria 640
732 Ga0163163_12268108 3300014325 Bacteria 602
733 Ga0163163_12743378 3300014325 Unclassified 549
734 Ga0163163_12748141 3300014325 Unclassified 549
735 Ga0163163_13146099 3300014325 Unclassified 515
736 Ga0157380_10003931 3300014326 Bacteria 10255
737 Ga0157380_10013530 3300014326 Bacteria 5953
738 Ga0157380_10028285 3300014326 Unclassified 4272
739 Ga0157380_10106987 3300014326 Bacteria 2341
740 Ga0157380_10369555 3300014326 Bacteria 1349
741 Ga0157380_10528267 3300014326 Bacteria 1152
742 Ga0157380_10833754 3300014326 Unclassified 942
743 Ga0157380_11216817 3300014326 Bacteria 797
744 Ga0157380_11537457 3300014326 Unclassified 719
745 Ga0157380_12383631 3300014326 Bacteria 594
746 Ga0157377_10075696 3300014745 Bacteria 1955
747 Ga0157377_10536487 3300014745 Bacteria 824
748 Ga0157377_10789065 3300014745 Bacteria 699
749 Ga0157377_11043999 3300014745 Unclassified 622
750 Ga0157379_10072091 3300014968 Bacteria 3090
751 Ga0157379_10081890 3300014968 Unclassified 2891
752 Ga0157379_10103598 3300014968 Bacteria 2553
753 Ga0157379_10258980 3300014968 Bacteria 1580
754 Ga0157379_10366255 3300014968 Bacteria 1321
755 Ga0157379_11067649 3300014968 Bacteria 772
756 Ga0157376_10018262 3300014969 Bacteria 5372
757 Ga0157376_10289451 3300014969 Unclassified 1546
758 Ga0157376_10578424 3300014969 Bacteria 1115
759 Ga0157376_12938338 3300014969 Bacteria 516
760 Ga0182005_1225903 3300015265 Unclassified 571
761 Ga0163161_10033550 3300017792 Bacteria 3668
762 Ga0163161_10119365 3300017792 Unclassified 1980
763 Ga0163161_10147811 3300017792 Bacteria 1784
764 Ga0207697_10107670 3300025315 Bacteria 1192
765 Ga0207697_10187986 3300025315 Unclassified 906
766 Ga0207697_10246756 3300025315 Bacteria 789
767 Ga0207656_10041139 3300025321 Bacteria 1963
768 Ga0207656_10299496 3300025321 Unclassified 796
769 Ga0207653_10000263 3300025885 Bacteria 32142
770 Ga0207653_10000358 3300025885 Bacteria 22166
771 Ga0207653_10008632 3300025885 Bacteria 3176
772 Ga0207653_10104348 3300025885 Bacteria 1006
773 Ga0207653_10261728 3300025885 Bacteria 665
774 Ga0207692_10951333 3300025898 Unclassified 566
775 Ga0207642_10251586 3300025899 Bacteria 1003
776 Ga0207642_10261041 3300025899 Bacteria 988
777 Ga0207642_10489763 3300025899 Bacteria 751
778 Ga0207688_10212503 3300025901 Unclassified 1163
779 Ga0207688_10220963 3300025901 Bacteria 1141
780 Ga0207688_10344575 3300025901 Bacteria 917
781 Ga0207688_10440025 3300025901 Unclassified 812
782 Ga0207680_10013658 3300025903 Bacteria 4179
783 Ga0207680_10135370 3300025903 Bacteria 1628
784 Ga0207647_10064847 3300025904 Bacteria 2218
785 Ga0207647_10116528 3300025904 Bacteria 1577
786 Ga0207647_10125099 3300025904 Bacteria 1513
787 Ga0207699_10000006 3300025906 Bacteria 430147
788 Ga0207699_10000087 3300025906 Bacteria 69697
789 Ga0207699_10013362 3300025906 Bacteria 4200
790 Ga0207699_10044815 3300025906 Bacteria 2577
791 Ga0207699_10088841 3300025906 Bacteria 1935
792 Ga0207699_10184978 3300025906 Unclassified 1403
793 Ga0207645_10000288 3300025907 Bacteria 42109
794 Ga0207645_10182734 3300025907 Unclassified 1376
795 Ga0207645_10938427 3300025907 Unclassified 587
796 Ga0207643_10022517 3300025908 Unclassified 3469
797 Ga0207643_11038780 3300025908 Unclassified 529
798 Ga0207643_11148681 3300025908 Unclassified 500
799 Ga0207705_11082211 3300025909 Bacteria 618
800 Ga0207684_10001089 3300025910 Bacteria 30474
801 Ga0207684_10001832 3300025910 Bacteria 22186
802 Ga0207684_10030891 3300025910 Bacteria 4559
803 Ga0207684_10166738 3300025910 Bacteria 1898
804 Ga0207684_10688282 3300025910 Bacteria 869
805 Ga0207654_10076059 3300025911 Bacteria 2008
806 Ga0207654_10701797 3300025911 Unclassified 727
807 Ga0207654_11174500 3300025911 Bacteria 559
808 Ga0207707_10000053 3300025912 Bacteria 116823
809 Ga0207707_10005201 3300025912 Bacteria 11403
810 Ga0207707_10005983 3300025912 Bacteria 10646
811 Ga0207707_10359997 3300025912 Bacteria 1253
812 Ga0207707_10947066 3300025912 Unclassified 709
813 Ga0207695_10047812 3300025913 Bacteria 4523
814 Ga0207695_10353742 3300025913 Bacteria 1356
815 Ga0207671_10002090 3300025914 Bacteria 21855
816 Ga0207671_11114894 3300025914 Unclassified 619
817 Ga0207693_10000012 3300025915 Bacteria 154708
818 Ga0207693_10243234 3300025915 Bacteria 1412
819 Ga0207693_10280006 3300025915 Bacteria 1307
820 Ga0207663_10357372 3300025916 Unclassified 1107
821 Ga0207663_10750075 3300025916 Unclassified 775
822 Ga0207660_10008799 3300025917 Bacteria 6527
823 Ga0207660_10252585 3300025917 Unclassified 1392
824 Ga0207660_10589382 3300025917 Bacteria 905
825 Ga0207660_11365895 3300025917 Bacteria 574
826 Ga0207662_10004761 3300025918 Bacteria 7173
827 Ga0207662_10016657 3300025918 Bacteria 4150
828 Ga0207662_10068339 3300025918 Bacteria 2146
829 Ga0207657_10158044 3300025919 Bacteria 1842
830 Ga0207657_10238073 3300025919 Bacteria 1454
831 Ga0207657_10553752 3300025919 Bacteria 899
832 Ga0207649_10041481 3300025920 Bacteria 2801
833 Ga0207649_10092014 3300025920 Bacteria 1988
834 Ga0207649_10351331 3300025920 Unclassified 1091
835 Ga0207652_10000069 3300025921 Bacteria 109874
836 Ga0207652_10081157 3300025921 Bacteria 2836
837 Ga0207652_10269734 3300025921 Bacteria 1535
838 Ga0207652_10543817 3300025921 Bacteria 1044
839 Ga0207652_10738998 3300025921 Viruses 876
840 Ga0207652_10979401 3300025921 Unclassified 744
841 Ga0207652_11341812 3300025921 Bacteria 618
842 Ga0207646_10157507 3300025922 Unclassified 2049
843 Ga0207646_10169781 3300025922 Bacteria 1970
844 Ga0207646_10532254 3300025922 Bacteria 1057
845 Ga0207646_11503192 3300025922 Unclassified 583
846 Ga0207646_11669746 3300025922 Bacteria 548
847 Ga0207681_10004797 3300025923 Bacteria 8314
848 Ga0207681_10007887 3300025923 Bacteria 6510
849 Ga0207681_10049478 3300025923 Bacteria 2841
850 Ga0207681_10059163 3300025923 Bacteria 2626
851 Ga0207681_10064390 3300025923 Plasmid 2531
852 Ga0207681_10129111 3300025923 Bacteria 1866
853 Ga0207681_10242128 3300025923 Unclassified 1404
854 Ga0207681_10364511 3300025923 Bacteria 1160
855 Ga0207681_11368845 3300025923 Unclassified 594
856 Ga0207694_10225675 3300025924 Bacteria 1529
857 Ga0207694_11251763 3300025924 Unclassified 628
858 Ga0207650_10017898 3300025925 Bacteria 4965
859 Ga0207650_10044796 3300025925 Bacteria 3252
860 Ga0207650_10076831 3300025925 Unclassified 2523
861 Ga0207650_10105986 3300025925 Bacteria 2170
862 Ga0207650_10132772 3300025925 Bacteria 1950
863 Ga0207650_10160425 3300025925 Bacteria 1781
864 Ga0207650_11291334 3300025925 Unclassified 621
865 Ga0207659_10012156 3300025926 Bacteria 5462
866 Ga0207659_10268258 3300025926 Bacteria 1391
867 Ga0207659_11835766 3300025926 Unclassified 514
868 Ga0207687_10144702 3300025927 Unclassified 1807
869 Ga0207687_11122740 3300025927 Bacteria 675
870 Ga0207687_11299459 3300025927 Unclassified 625
871 Ga0207687_11410671 3300025927 Unclassified 598
872 Ga0207687_11503517 3300025927 Unclassified 578
873 Ga0207700_10107620 3300025928 Bacteria 2237
874 Ga0207700_10781397 3300025928 Unclassified 854
875 Ga0207700_11104144 3300025928 Unclassified 709
876 Ga0207664_10006013 3300025929 Bacteria 8308
877 Ga0207664_10045248 3300025929 Bacteria 3451
878 Ga0207664_10120991 3300025929 Bacteria 2190
879 Ga0207644_10032461 3300025931 Bacteria 3643
880 Ga0207644_10043302 3300025931 Bacteria 3194
881 Ga0207644_10689911 3300025931 Bacteria 851
882 Ga0207644_10938305 3300025931 Archaea 726
883 Ga0207690_10084174 3300025932 Bacteria 2229
884 Ga0207690_11011241 3300025932 Unclassified 692
885 Ga0207706_10011737 3300025933 Bacteria 7983
886 Ga0207706_10166834 3300025933 Bacteria 1935
887 Ga0207706_10354559 3300025933 Unclassified 1275
888 Ga0207706_10520291 3300025933 Unclassified 1026
889 Ga0207706_11189704 3300025933 Unclassified 634
890 Ga0207686_10216109 3300025934 Bacteria 1381
891 Ga0207686_10466645 3300025934 Bacteria 974
892 Ga0207686_10680090 3300025934 Unclassified 816
893 Ga0207686_10879073 3300025934 Bacteria 722
894 Ga0207709_10198788 3300025935 Bacteria 1430
895 Ga0207709_10532647 3300025935 Bacteria 921
896 Ga0207709_10550671 3300025935 Unclassified 907
897 Ga0207709_10624850 3300025935 Unclassified 855
898 Ga0207709_11279136 3300025935 Unclassified 606
899 Ga0207670_10087736 3300025936 Bacteria 2192
900 Ga0207670_10097855 3300025936 Bacteria 2090
901 Ga0207670_10125290 3300025936 Bacteria 1874
902 Ga0207670_10245152 3300025936 Unclassified 1382
903 Ga0207670_10355264 3300025936 Unclassified 1161
904 Ga0207670_11726646 3300025936 Unclassified 532
905 Ga0207670_11823884 3300025936 Unclassified 517
906 Ga0207704_10135868 3300025938 Bacteria 1711
907 Ga0207704_10239879 3300025938 Bacteria 1354
908 Ga0207704_10425624 3300025938 Bacteria 1054
909 Ga0207704_10810951 3300025938 Unclassified 782
910 Ga0207665_10022584 3300025939 Unclassified 4140
911 Ga0207665_10642997 3300025939 Bacteria 831
912 Ga0207691_10002394 3300025940 Bacteria 18343
913 Ga0207691_10006173 3300025940 Bacteria 11583
914 Ga0207691_10070040 3300025940 Bacteria 3167
915 Ga0207691_10256487 3300025940 Bacteria 1508
916 Ga0207691_10446014 3300025940 Bacteria 1101
917 Ga0207691_10834113 3300025940 Bacteria 774
918 Ga0207691_11464636 3300025940 Unclassified 559
919 Ga0207691_11498251 3300025940 Bacteria 551
920 Ga0207711_10028048 3300025941 Unclassified 4735
921 Ga0207711_10030911 3300025941 Bacteria 4517
922 Ga0207711_10033025 3300025941 Bacteria 4377
923 Ga0207711_10099216 3300025941 Bacteria 2574
924 Ga0207711_10134896 3300025941 Bacteria 2216
925 Ga0207711_10187537 3300025941 Unclassified 1883
926 Ga0207711_10238217 3300025941 Bacteria 1668
927 Ga0207711_10374686 3300025941 Bacteria 1320
928 Ga0207711_10433503 3300025941 Bacteria 1223
929 Ga0207711_11599579 3300025941 Unclassified 595
930 Ga0207689_10023776 3300025942 Bacteria 5140
931 Ga0207689_10035751 3300025942 Bacteria 4125
932 Ga0207689_10075895 3300025942 Bacteria 2763
933 Ga0207689_10096844 3300025942 Unclassified 2423
934 Ga0207689_10181709 3300025942 Bacteria 1734
935 Ga0207689_10200775 3300025942 Unclassified 1646
936 Ga0207689_10325595 3300025942 Bacteria 1276
937 Ga0207689_10760973 3300025942 Unclassified 817
938 Ga0207689_11334136 3300025942 Unclassified 602
939 Ga0207661_10019278 3300025944 Bacteria 5082
940 Ga0207661_11903681 3300025944 Unclassified 540
941 Ga0207679_10001346 3300025945 Bacteria 15500
942 Ga0207679_10137866 3300025945 Bacteria 1967
943 Ga0207679_10263336 3300025945 Unclassified 1471
944 Ga0207679_10360444 3300025945 Bacteria 1270
945 Ga0207679_10460423 3300025945 Bacteria 1129
946 Ga0207679_10752906 3300025945 Unclassified 886
947 Ga0207667_11132709 3300025949 Unclassified 764
948 Ga0207667_11444725 3300025949 Unclassified 660
949 Ga0207667_11502050 3300025949 Bacteria 645
950 Ga0207667_11985569 3300025949 Unclassified 542
951 Ga0207651_10001373 3300025960 Bacteria 11014
952 Ga0207712_10003633 3300025961 Bacteria 9726
953 Ga0207712_10012473 3300025961 Bacteria 5430
954 Ga0207712_10028921 3300025961 Unclassified 3712
955 Ga0207712_10187443 3300025961 Bacteria 1630
956 Ga0207712_10220935 3300025961 Unclassified 1515
957 Ga0207712_10358303 3300025961 Bacteria 1215
958 Ga0207712_10635890 3300025961 Bacteria 926
959 Ga0207712_10857611 3300025961 Bacteria 801
960 Ga0207668_10109315 3300025972 Bacteria 2071
961 Ga0207668_10147613 3300025972 Unclassified 1816
962 Ga0207668_10629653 3300025972 Unclassified 937
963 Ga0207640_10019324 3300025981 Bacteria 4023
964 Ga0207640_10071609 3300025981 Bacteria 2335
965 Ga0207640_10103379 3300025981 Bacteria 2003
966 Ga0207640_10592295 3300025981 Bacteria 937
967 Ga0207658_10064239 3300025986 Bacteria 2753
968 Ga0207658_10224014 3300025986 Bacteria 1584
969 Ga0207658_10242627 3300025986 Bacteria 1527
970 Ga0207658_10318664 3300025986 Unclassified 1345
971 Ga0207658_10512428 3300025986 Bacteria 1070
972 Ga0207658_11157686 3300025986 Unclassified 707
973 Ga0207677_10067127 3300026023 Bacteria 2511
974 Ga0207677_10131953 3300026023 Bacteria 1898
975 Ga0207677_10420135 3300026023 Bacteria 1139
976 Ga0207677_11757611 3300026023 Unclassified 575
977 Ga0207703_10011290 3300026035 Bacteria 6946
978 Ga0207703_10061859 3300026035 Bacteria 3066
979 Ga0207703_10097141 3300026035 Bacteria 2489
980 Ga0207703_10101471 3300026035 Bacteria 2440
981 Ga0207703_10114121 3300026035 Bacteria 2310
982 Ga0207703_10291505 3300026035 Bacteria 1485
983 Ga0207703_10852019 3300026035 Unclassified 871
984 Ga0207703_10860608 3300026035 Unclassified 867
985 Ga0207703_11618216 3300026035 Unclassified 623
986 Ga0207639_10058177 3300026041 Bacteria 2972
987 Ga0207639_10270740 3300026041 Bacteria 1490
988 Ga0207639_10281920 3300026041 Bacteria 1462
989 Ga0207639_11758541 3300026041 Unclassified 580
990 Ga0207639_12291468 3300026041 Bacteria 501
991 Ga0207678_10069668 3300026067 Bacteria 3016
992 Ga0207678_11877872 3300026067 Unclassified 523
993 Ga0207708_10007122 3300026075 Bacteria 8264
994 Ga0207708_10022485 3300026075 Bacteria 4761
995 Ga0207708_10025866 3300026075 Bacteria 4441
996 Ga0207708_10047154 3300026075 Bacteria 3281
997 Ga0207708_10096996 3300026075 Bacteria 2278
998 Ga0207708_10169758 3300026075 Bacteria 1727
999 Ga0207708_10337914 3300026075 Bacteria 1233
1000 Ga0207708_10410215 3300026075 Bacteria 1122
1001 Ga0207708_10423428 3300026075 Unclassified 1104
1002 Ga0207708_11066611 3300026075 Bacteria 704
1003 Ga0207708_11108152 3300026075 Bacteria 690
1004 Ga0207708_11834446 3300026075 Unclassified 532
1005 Ga0207702_10019389 3300026078 Bacteria 5628
1006 Ga0207702_10401202 3300026078 Bacteria 1322
1007 Ga0207702_11197377 3300026078 Unclassified 754
1008 Ga0207702_11610959 3300026078 Bacteria 642
1009 Ga0207702_12200501 3300026078 Unclassified 540
1010 Ga0207641_10001307 3300026088 Bacteria 24663
1011 Ga0207641_10279049 3300026088 Bacteria 1571
1012 Ga0207641_10319770 3300026088 Bacteria 1471
1013 Ga0207641_10483275 3300026088 Bacteria 1201
1014 Ga0207641_10509754 3300026088 Bacteria 1169
1015 Ga0207641_10797482 3300026088 Unclassified 934
1016 Ga0207641_11435484 3300026088 Unclassified 691
1017 Ga0207641_11698357 3300026088 Bacteria 633
1018 Ga0207648_10107139 3300026089 Bacteria 2453
1019 Ga0207648_10144120 3300026089 Unclassified 2101
1020 Ga0207648_10402323 3300026089 Bacteria 1241
1021 Ga0207648_10483032 3300026089 Bacteria 1132
1022 Ga0207648_10566551 3300026089 Unclassified 1045
1023 Ga0207648_10578032 3300026089 Bacteria 1034
1024 Ga0207648_10595494 3300026089 Bacteria 1019
1025 Ga0207648_11771121 3300026089 Bacteria 579
1026 Ga0207676_10010941 3300026095 Bacteria 6476
1027 Ga0207676_10049142 3300026095 Unclassified 3279
1028 Ga0207676_10062706 3300026095 Bacteria 2949
1029 Ga0207676_10075685 3300026095 Bacteria 2717
1030 Ga0207676_10104052 3300026095 Bacteria 2360
1031 Ga0207676_10354101 3300026095 Bacteria 1359
1032 Ga0207676_10375759 3300026095 Bacteria 1321
1033 Ga0207676_10464974 3300026095 Bacteria 1195
1034 Ga0207676_10599632 3300026095 Bacteria 1058
1035 Ga0207676_11434095 3300026095 Bacteria 687
1036 Ga0207676_11478786 3300026095 Unclassified 676
1037 Ga0207674_10000485 3300026116 Bacteria 52515
1038 Ga0207674_10007921 3300026116 Bacteria 12337
1039 Ga0207674_10232569 3300026116 Unclassified 1791
1040 Ga0207674_10424604 3300026116 Bacteria 1284
1041 Ga0207674_10540199 3300026116 Bacteria 1126
1042 Ga0207674_10657572 3300026116 Unclassified 1012
1043 Ga0207675_100014875 3300026118 Bacteria 7262
1044 Ga0207675_100030178 3300026118 Bacteria 5050
1045 Ga0207675_100071466 3300026118 Bacteria 3245
1046 Ga0207675_100072880 3300026118 Bacteria 3212
1047 Ga0207675_100103712 3300026118 Unclassified 2680
1048 Ga0207675_100216509 3300026118 Unclassified 1844
1049 Ga0207675_100254380 3300026118 Bacteria 1701
1050 Ga0207675_100333913 3300026118 Bacteria 1482
1051 Ga0207675_100391063 3300026118 Bacteria 1369
1052 Ga0207675_100664470 3300026118 Bacteria 1049
1053 Ga0207675_101712971 3300026118 Unclassified 648
1054 Ga0207675_102071085 3300026118 Unclassified 586
1055 Ga0207675_102367051 3300026118 Unclassified 544
1056 Ga0207683_10074891 3300026121 Unclassified 2995
1057 Ga0207683_10344218 3300026121 Bacteria 1368
1058 Ga0207698_10030526 3300026142 Bacteria 3877
1059 Ga0207698_10358630 3300026142 Bacteria 1380
1060 Ga0207698_10595008 3300026142 Unclassified 1090
1061 Ga0209813_10025266 3300027866 Unclassified 1706
1062 Ga0209813_10235390 3300027866 Bacteria 691
1063 Ga0207428_10017341 3300027907 Bacteria 6181
1064 Ga0207428_10022688 3300027907 Bacteria 5293
1065 Ga0207428_10149919 3300027907 Bacteria 1775
1066 Ga0207428_10161189 3300027907 Bacteria 1703
1067 Ga0207428_10417486 3300027907 Bacteria 981
1068 Ga0207428_11227672 3300027907 Bacteria 521
1069 Ga0268266_10069072 3300028379 Unclassified 3061
1070 Ga0268266_10266946 3300028379 Bacteria 1588
1071 Ga0268266_10335616 3300028379 Bacteria 1418
1072 Ga0268265_10082198 3300028380 Bacteria 2546
1073 Ga0268265_10191326 3300028380 Unclassified 1767
1074 Ga0268265_10642983 3300028380 Bacteria 1019
1075 Ga0268265_10702710 3300028380 Bacteria 977
1076 Ga0268265_10856052 3300028380 Bacteria 890
1077 Ga0268265_11470388 3300028380 Bacteria 684
1078 Ga0268265_12399805 3300028380 Bacteria 534
1079 Ga0268265_12555683 3300028380 Unclassified 516
1080 Ga0268264_10348906 3300028381 Bacteria 1408
1081 Ga0268264_10913516 3300028381 Unclassified 882
1082 Ga0268264_11190806 3300028381 Bacteria 771
1083 Ga0268264_11394362 3300028381 Bacteria 711
1084 Ga0268264_11792936 3300028381 Unclassified 624
1085 Ga0268264_12108741 3300028381 Bacteria 572
1086 Ga0268264_12477274 3300028381 Unclassified 524
1087 Ga0307511_10363384 3300030521 Bacteria 615
1088 Ga0265762_1114685 3300030760 Unclassified 610
1089 Ga0265316_10058535 3300031344 Bacteria 3000
1090 Ga0307408_100017526 3300031548 Bacteria 4793
1091 Ga0307408_101661822 3300031548 Bacteria 608
1092 Ga0307408_102368298 3300031548 Bacteria 515
1093 Ga0307508_10428199 3300031616 Archaea 915
1094 Ga0265342_10149181 3300031712 Bacteria 1299
1095 Ga0307413_10581276 3300031824 Bacteria 914
1096 Ga0307413_11471179 3300031824 Unclassified 601
1097 Ga0307410_10198389 3300031852 Bacteria 1531
1098 Ga0307406_10005829 3300031901 Bacteria 6753
1099 Ga0307406_10101043 3300031901 Bacteria 1964
1100 Ga0307406_10152446 3300031901 Bacteria 1651
1101 Ga0307406_10351769 3300031901 Unclassified 1152
1102 Ga0307406_10439371 3300031901 Bacteria 1044
1103 Ga0307406_10710145 3300031901 Unclassified 840
1104 Ga0307407_10070224 3300031903 Bacteria 2081
1105 Ga0307407_10236346 3300031903 Bacteria 1244
1106 Ga0307412_10606774 3300031911 Bacteria 928
1107 Ga0307412_10868290 3300031911 Bacteria 788
1108 Ga0307409_100318827 3300031995 Bacteria 1454
1109 Ga0307409_100449447 3300031995 Bacteria 1243
1110 Ga0307416_100052588 3300032002 Bacteria 3262
1111 Ga0307416_100112403 3300032002 Bacteria 2404
1112 Ga0307416_100973525 3300032002 Bacteria 951
1113 Ga0307416_101206921 3300032002 Unclassified 862
1114 Ga0307416_102475935 3300032002 Bacteria 618
1115 Ga0307414_10043924 3300032004 Bacteria 3047
1116 Ga0307411_10024008 3300032005 Bacteria 3626
1117 Ga0307411_10065454 3300032005 Unclassified 2438
1118 Ga0307411_10162706 3300032005 Bacteria 1674
1119 Ga0307415_100471918 3300032126 Bacteria 1090
1120 Ga0373930_0072149 3300034816 Bacteria 786
1121 Ga0373948_0005196 3300034817 Bacteria 2097
1122 Ga0373950_0012513 3300034818 Bacteria 1402
1123 Ga0373938_0034197 3300034957 Unclassified 1103
1124 Ga0373926_0102420 3300035083 Unclassified 1071
1125 Ga0373928_0000435 3300035084 Bacteria 8318
1126 Ga0373929_0005480 3300035085 Bacteria 2284
1127 Ga0373929_0157122 3300035085 Bacteria 614
1128 Ga0373940_0003028 3300035088 Bacteria 3368
1129 Ga0373940_0154234 3300035088 Unclassified 734
1130 Ga0373949_0301666 3300035090 Unclassified 508
1131 Ga0373951_0009379 3300035091 Unclassified 2204
1132 Ga0373952_0017809 3300035092 Bacteria 1462
1133 Ga0373939_0303984 3300035114 Bacteria 637
1134 Ga0373941_0092624 3300035115 Bacteria 1039
1135 Ga0373941_0479814 3300035115 Unclassified 526
1136 Ga0373945_0280258 3300035116 Unclassified 710
1137 Ga0373956_0577711 3300035119 Bacteria 536
1138 Ga0373960_0009529 3300035121 Bacteria 2354
1139 Ga0373943_0116556 3300035170 Bacteria 1415
1140 Ga0373943_0573983 3300035170 Unclassified 663
1141 Ga0373943_0582614 3300035170 Bacteria 658
1142 Ga0373946_0026249 3300035171 Bacteria 2296
1143 Ga0373946_0538544 3300035171 Bacteria 601
1144 Ga0373955_0223968 3300035172 Unclassified 1124
1145 Ga0373942_0006172 3300035207 Bacteria 2766
1146 Ga0373942_0159383 3300035207 Bacteria 729
1147 Ga0373961_0001990 3300035241 Bacteria 5493
1148 Ga0373962_0059238 3300035242 Bacteria 1121
1149 Ga0373924_0157017 3300035410 Unclassified 997
1150 Ga0373931_0272291 3300035691 Bacteria 1037
1151 Ga0373931_0316027 3300035691 Bacteria 969
1152 Ga0373931_0717079 3300035691 Bacteria 661
1153 Ga0373935_0116630 3300035692 Bacteria 1779
1154 Ga0373947_0044683 3300035725 Bacteria 2649
1155 Ga0373947_0506094 3300035725 Unclassified 821
1156 Ga0373947_0749226 3300035725 Bacteria 666
1157 Ga0373937_0002184 3300036401 Bacteria 16375
1158 Ga0373937_0057935 3300036401 Unclassified 3559
1159 Ga0373937_0392281 3300036401 Bacteria 1317
1160 Ga0373925_0016796 3300037068 Bacteria 5299
1161 Ga0395900_0436933 3300037418 Unclassified 1267
1162 Ga0395905_0168778 3300037471 Bacteria 2056
1163 Ga0436364_0149045 3300037853 Bacteria 2642
1164 Ga0395901_1839902 3300038443 Unclassified 554
1165 Ga0436365_0489401 3300039437 Bacteria 1741
1166 Ga0436360_0372542 3300039438 Unclassified 845
1167 Ga0439439_0041670 3300041406 Bacteria 1192
1168 Ga0439453_0001879 3300041408 Bacteria 2798
1169 Ga0451845_0570708 3300041501 Unclassified 555
1170 Ga0451853_3373232 3300041512 Unclassified 1008
1171 Ga0439449_0356370 3300042007 Unclassified 554
1172 Ga0439455_0056949 3300042012 Bacteria 1030
1173 Ga0439455_0141397 3300042012 Bacteria 682
1174 Ga0439462_0200795 3300042015 Bacteria 568
1175 Ga0450888_018349 3300042126 Unclassified 875
1176 Ga0439446_0317979 3300042156 Unclassified 549
1177 Ga0439458_0001390 3300042157 Bacteria 6114
1178 Ga0439435_0020395 3300042436 Bacteria 1709
1179 Ga0439444_0047542 3300042437 Bacteria 862
1180 Ga0439444_0159683 3300042437 Bacteria 549
1181 Ga0439459_0060020 3300042438 Bacteria 857
1182 Ga0439459_0162467 3300042438 Unclassified 590
1183 Ga0439460_0100088 3300042461 Bacteria 930
1184 Ga0451577_1269728 3300042876 Unclassified 656
1185 Ga0466965_0255582 3300044683 Unclassified 941
1186 Ga0466966_0133531 3300044684 Bacteria 1519
1187 Ga0453684_0518070 3300044712 Bacteria 1318
1188 Ga0466960_0156075 3300044901 Bacteria 1222
1189 Ga0451576_0010483 3300045051 Bacteria 10625
1190 Ga0451576_0204978 3300045051 Bacteria 2059
1191 Ga0451576_0234484 3300045051 Bacteria 1916
1192 Ga0451576_0309812 3300045051 Bacteria 1652
1193 Ga0451576_0558457 3300045051 Bacteria 1203
1194 Ga0451576_1358143 3300045051 Bacteria 740
1195 Ga0451576_1703988 3300045051 Unclassified 653
1196 Ga0451576_1809414 3300045051 Unclassified 631
1197 Ga0451576_1864252 3300045051 Unclassified 621
1198 Ga0466967_1583006 3300045976 Bacteria 653
1199 Ga0495592_0173057 3300046454 Unclassified 1477
1200 Ga0495629_0713679 3300046459 Bacteria 665
1201 Ga0495580_0072052 3300046472 Bacteria 2413
1202 Ga0495580_0582615 3300046472 Bacteria 741
1203 Ga0495582_0001631 3300046473 Bacteria 12635
1204 Ga0495582_0181878 3300046473 Bacteria 1198
1205 Ga0495639_0509079 3300046475 Unclassified 615
1206 Ga0495594_0639076 3300046499 Unclassified 603
1207 Ga0495608_0047724 3300046511 Bacteria 2846
1208 Ga0495652_0837227 3300046529 Unclassified 610
1209 Ga0495598_0117627 3300046537 Unclassified 898
1210 Ga0495598_0428120 3300046537 Bacteria 521
1211 Ga0495633_0082097 3300046558 Bacteria 1500
1212 Ga0495656_0482348 3300046615 Unclassified 656
1213 Ga0495625_0184995 3300046660 Unclassified 1383
1214 Ga0495659_0108058 3300046664 Bacteria 1084
1215 Ga0495658_0118835 3300046683 Bacteria 1597
1216 Ga0495658_0133820 3300046683 Unclassified 1511
1217 Ga0495670_0011966 3300046691 Bacteria 4270
1218 Ga0495581_0268780 3300047315 Unclassified 997
1219 Ga0495676_0865875 3300047321 Bacteria 580
1220 Ga0495677_0085132 3300047445 Bacteria 1188
1221 Ga0495615_0044131 3300048090 Unclassified 1125
1222 Ga0496100_0323342 3300048903 Unclassified 1159
1223 Ga0496100_0499804 3300048903 Bacteria 937
1224 Ga0496100_0770481 3300048903 Unclassified 753
1225 Ga0496101_0474712 3300048904 Unclassified 987
1226 Ga0496101_0539347 3300048904 Bacteria 922
1227 Ga0496101_0606198 3300048904 Bacteria 866
1228 Ga0496102_0297098 3300048905 Bacteria 1522
1229 Ga0496102_0429273 3300048905 Bacteria 1241
1230 Ga0496102_0719851 3300048905 Bacteria 921
1231 Ga0496102_0880618 3300048905 Bacteria 817
1232 Ga0496103_0086176 3300048906 Bacteria 1980
1233 Ga0496103_0650143 3300048906 Bacteria 670
1234 Ga0496104_0006915 3300048907 Bacteria 10005
1235 Ga0496104_0039399 3300048907 Bacteria 4425
1236 Ga0496104_0041168 3300048907 Unclassified 4331
1237 Ga0496104_0058881 3300048907 Bacteria 3637
1238 Ga0496104_0379772 3300048907 Unclassified 1325
1239 Ga0496104_1547926 3300048907 Unclassified 566
1240 Ga0496105_0135362 3300048908 Bacteria 2030
1241 Ga0496105_0205935 3300048908 Unclassified 1604
1242 Ga0496105_0290454 3300048908 Bacteria 1316
1243 Ga0496105_0519100 3300048908 Bacteria 933
1244 Ga0496106_0052588 3300048909 Bacteria 3074
1245 Ga0496106_0192643 3300048909 Bacteria 1621
1246 Ga0496106_0262121 3300048909 Unclassified 1383
1247 Ga0496106_0368426 3300048909 Bacteria 1154
1248 Ga0496106_0751501 3300048909 Unclassified 775
1249 Ga0496107_0119878 3300048910 Bacteria 1938
1250 Ga0496108_0007316 3300048911 Bacteria 8949
1251 Ga0496108_0068095 3300048911 Unclassified 3003
1252 Ga0496108_0455161 3300048911 Bacteria 1118
1253 Ga0496109_0001812 3300048912 Bacteria 17780
1254 Ga0496109_0029579 3300048912 Bacteria 4907
1255 Ga0496109_0145177 3300048912 Bacteria 2220
1256 Ga0496109_0171215 3300048912 Bacteria 2037
1257 Ga0496109_0790757 3300048912 Bacteria 887
1258 Ga0496109_0924683 3300048912 Unclassified 810
1259 Ga0496109_0961825 3300048912 Unclassified 792
1260 Ga0496110_0036526 3300048913 Bacteria 4266
1261 Ga0496110_0208149 3300048913 Bacteria 1778
1262 Ga0496110_1166671 3300048913 Unclassified 679
1263 Ga0496110_1250673 3300048913 Bacteria 651
1264 Ga0496111_0735077 3300048914 Bacteria 716
1265 Ga0496112_0003609 3300048915 Bacteria 12880
1266 Ga0496112_0004837 3300048915 Bacteria 11498
1267 Ga0496112_0033934 3300048915 Bacteria 4964
1268 Ga0496112_0093463 3300048915 Unclassified 2978
1269 Ga0496112_0108283 3300048915 Unclassified 2749
1270 Ga0496112_0352989 3300048915 Unclassified 1413
1271 Ga0496112_0406282 3300048915 Unclassified 1301
1272 Ga0496113_0067329 3300048916 Bacteria 2715
1273 Ga0496113_0253135 3300048916 Bacteria 1406
1274 Ga0496113_1229853 3300048916 Unclassified 584
1275 Ga0496114_0001659 3300048917 Bacteria 16880
1276 Ga0496114_0242591 3300048917 Bacteria 1585
1277 Ga0496115_0191772 3300048918 Bacteria 1688
1278 Ga0496115_0899693 3300048918 Unclassified 682
1279 Ga0501291_051415 3300049514 Bacteria 751
1280 Ga0501296_053909 3300049519 Bacteria 595
1281 Ga0501031_0055975 3300049568 Bacteria 2570
1282 Ga0501032_0747423 3300049569 Unclassified 619
1283 Ga0501033_0580994 3300049570 Bacteria 770
1284 Ga0501036_0031431 3300049572 Bacteria 4487
1285 Ga0501036_0050508 3300049572 Bacteria 3521
1286 Ga0501036_0109949 3300049572 Bacteria 2329
1287 Ga0501036_0205168 3300049572 Bacteria 1657
1288 Ga0501036_1093281 3300049572 Unclassified 651
1289 Ga0501037_0449480 3300049573 Unclassified 879
1290 Ga0501037_0753795 3300049573 Unclassified 645
1291 Ga0501038_1105767 3300049574 Unclassified 578
1292 Ga0501038_1240539 3300049574 Unclassified 540
1293 Ga0501039_0386563 3300049575 Unclassified 1099
1294 Ga0501039_0441749 3300049575 Bacteria 1022
1295 Ga0501040_0027884 3300049576 Bacteria 3804
1296 Ga0501040_0033682 3300049576 Bacteria 3472
1297 Ga0501040_0152234 3300049576 Bacteria 1632
1298 Ga0501041_0022062 3300049577 Bacteria 3812
1299 Ga0501041_0035275 3300049577 Unclassified 3031
1300 Ga0501041_0042450 3300049577 Bacteria 2764
1301 Ga0501042_0322650 3300049578 Unclassified 1116
1302 Ga0501042_0643541 3300049578 Bacteria 771
1303 Ga0501042_0700349 3300049578 Bacteria 736
1304 Ga0501046_0089967 3300049580 Bacteria 2362
1305 Ga0501046_0122480 3300049580 Bacteria 1978
1306 Ga0501046_0500920 3300049580 Unclassified 870
1307 Ga0501046_0552169 3300049580 Unclassified 821
1308 Ga0501048_0120772 3300049582 Unclassified 1852
1309 Ga0501048_0308492 3300049582 Bacteria 1126
1310 Ga0501067_0072758 3300049583 Bacteria 1904
1311 Ga0501068_1158294 3300049584 Bacteria 512
1312 Ga0501071_0262673 3300049587 Bacteria 1304
1313 Ga0501072_0084970 3300049588 Bacteria 2510
1314 Ga0501072_0103597 3300049588 Unclassified 2262
1315 Ga0501072_0140517 3300049588 Bacteria 1925
1316 Ga0501074_0320542 3300049590 Bacteria 1101
1317 Ga0501075_0029143 3300049591 Unclassified 4081
1318 Ga0501075_0078130 3300049591 Bacteria 2505
1319 Ga0501075_0357095 3300049591 Bacteria 1114
1320 Ga0501076_0020495 3300049592 Bacteria 5062
1321 Ga0501076_0074481 3300049592 Bacteria 2720
1322 Ga0501076_1701490 3300049592 Bacteria 517
1323 Ga0501077_0035306 3300049593 Bacteria 3183
1324 Ga0501077_0233475 3300049593 Bacteria 1169
1325 Ga0501198_074425 3300049649 Unclassified 647
1326 Ga0501199_021873 3300049650 Unclassified 747
1327 Ga0501202_000579 3300049652 Bacteria 5333
1328 Ga0501207_011698 3300049654 Unclassified 1310
1329 Ga0501217_000455 3300049661 Bacteria 6670
1330 Ga0501223_010821 3300049663 Bacteria 1832
1331 Ga0501227_000056 3300049665 Bacteria 17112
1332 Ga0501233_007086 3300049668 Bacteria 2127
1333 Ga0501233_024721 3300049668 Bacteria 1315
1334 Ga0501235_007731 3300049669 Bacteria 2343
1335 Ga0501239_071809 3300049672 Unclassified 540
1336 Ga0501240_000606 3300049673 Bacteria 3038
1337 Ga0501247_030694 3300049677 Bacteria 733
1338 Ga0501250_020350 3300049680 Bacteria 855
1339 Ga0501250_038260 3300049680 Bacteria 694
1340 Ga0501256_003453 3300049685 Unclassified 1314
1341 Ga0501257_012819 3300049686 Unclassified 1920
1342 Ga0501258_008666 3300049687 Unclassified 1050
1343 Ga0501261_063788 3300049690 Unclassified 632
1344 Ga0501221_002052 3300049704 Bacteria 3355
1345 Ga0501221_092611 3300049704 Unclassified 741
1346 Ga0501225_0004267 3300049705 Bacteria 4272
1347 Ga0501225_0167538 3300049705 Bacteria 679
1348 Ga0501225_0336322 3300049705 Unclassified 519
1349 Ga0501229_021405 3300049706 Unclassified 858
1350 Ga0501234_010861 3300049707 Bacteria 1420
1351 Ga0501079_0081372 3300049741 Bacteria 2504
1352 Ga0501079_0138698 3300049741 Bacteria 1894
1353 Ga0501079_0585421 3300049741 Bacteria 878
1354 Ga0501080_0439376 3300049742 Bacteria 1171
1355 Ga0501080_0865565 3300049742 Bacteria 789
1356 Ga0501081_0070213 3300049743 Unclassified 2441
1357 Ga0501081_0637216 3300049743 Unclassified 799
1358 Ga0501081_0652442 3300049743 Unclassified 789
1359 Ga0501083_0245840 3300049744 Bacteria 1165
1360 Ga0501083_0420432 3300049744 Bacteria 870
1361 Ga0501083_0446213 3300049744 Bacteria 842
1362 Ga0501265_076855 3300049762 Bacteria 574
1363 Ga0501266_045664 3300049763 Bacteria 664
1364 Ga0501273_094204 3300049770 Bacteria 512
1365 Ga0501283_033394 3300049779 Unclassified 871
1366 Ga0501283_047875 3300049779 Unclassified 752
1367 Ga0501035_0833513 3300049822 Bacteria 735
1368 Ga0501044_0043865 3300049823 Bacteria 4644
1369 Ga0501045_0018823 3300049824 Bacteria 4915
1370 Ga0501045_0138184 3300049824 Bacteria 1812
1371 Ga0501045_0220211 3300049824 Unclassified 1413
1372 Ga0501212_004226 3300049851 Unclassified 1843
1373 Ga0501226_000814 3300049853 Bacteria 4184
1374 Ga0501226_015239 3300049853 Unclassified 848
1375 nmdc:mga03683_472301_c1 3300050489 Unclassified 605
1376 nmdc:mga00v17_137195_c1 3300050491 Bacteria 1567
1377 nmdc:mga00v17_18754_c1 3300050491 Bacteria 3936
1378 nmdc:mga00v17_27688_c1 3300050491 Bacteria 3312
1379 nmdc:mga00v17_325512_c1 3300050491 Unclassified 999
1380 nmdc:mga00v17_351617_c1 3300050491 Bacteria 958
1381 nmdc:mga00v17_530726_c1 3300050491 Bacteria 762
1382 nmdc:mga00v17_85191_c1 3300050491 Bacteria 1979
1383 nmdc:mga0yw44_332057_c1 3300050492 Bacteria 1022
1384 nmdc:mga0yw44_997462_c1 3300050492 Bacteria 567
1385 nmdc:mga0k408_18283_c1 3300050493 Bacteria 3911
1386 nmdc:mga0k408_2060_c1 3300050493 Bacteria 10750
1387 nmdc:mga0k408_223958_c1 3300050493 Bacteria 1123
1388 nmdc:mga0k408_307410_c1 3300050493 Unclassified 946
1389 nmdc:mga0k408_929848_c1 3300050493 Unclassified 504
1390 nmdc:mga06z11_108774_c1 3300050494 Unclassified 1532
1391 nmdc:mga06z11_21419_c1 3300050494 Bacteria 3004
1392 nmdc:mga06z11_223910_c1 3300050494 Bacteria 1100
1393 nmdc:mga06z11_275524_c1 3300050494 Bacteria 996
1394 nmdc:mga06z11_961_c1 3300050494 Bacteria 10490
1395 nmdc:mga04h51_203475_c1 3300050495 Unclassified 779
1396 nmdc:mga04h51_24557_c1 3300050495 Bacteria 1847
1397 nmdc:mga04h51_66461_c1 3300050495 Bacteria 1249
1398 nmdc:mga07m45_198134_c1 3300050496 Bacteria 1168
1399 nmdc:mga07m45_66082_c1 3300050496 Bacteria 2054
1400 nmdc:mga05p37_10168_c1 3300050507 Bacteria 11168
1401 nmdc:mga05p37_117571_c1 3300050507 Bacteria 3267
1402 nmdc:mga05p37_1245173_c1 3300050507 Unclassified 764
1403 nmdc:mga05p37_15197_c1 3300050507 Bacteria 9244
1404 nmdc:mga05p37_163433_c1 3300050507 Bacteria 2718
1405 nmdc:mga05p37_169563_c1 3300050507 Bacteria 2663
1406 nmdc:mga05p37_173398_c1 3300050507 Unclassified 2629
1407 nmdc:mga05p37_19640_c1 3300050507 Bacteria 8173
1408 nmdc:mga05p37_397361_c1 3300050507 Bacteria 1610
1409 nmdc:mga05p37_452360_c1 3300050507 Bacteria 1486
1410 nmdc:mga05p37_463078_c1 3300050507 Bacteria 1464
1411 nmdc:mga05p37_69322_c1 3300050507 Bacteria 4337
1412 nmdc:mga05p37_730413_c1 3300050507 Bacteria 1095
1413 nmdc:mga05p37_850_c1 3300050507 Bacteria 34355
1414 nmdc:mga05p37_889615_c1 3300050507 Bacteria 962
1415 nmdc:mga05p37_923166_c1 3300050507 Bacteria 938
1416 nmdc:mga09592_1095670_c1 3300050508 Bacteria 662
1417 nmdc:mga09592_1120364_c1 3300050508 Unclassified 653
1418 nmdc:mga09592_1654047_c1 3300050508 Unclassified 517
1419 nmdc:mga09592_17478_c1 3300050508 Bacteria 5875
1420 nmdc:mga09592_263096_c1 3300050508 Bacteria 1496
1421 nmdc:mga09592_411656_c1 3300050508 Bacteria 1168
1422 nmdc:mga09592_475982_c2 3300050508 Unclassified 539
1423 nmdc:mga0qj67_1071280_c1 3300050509 Unclassified 630
1424 nmdc:mga0qj67_195446_c1 3300050509 Bacteria 1644
1425 nmdc:mga0qj67_22746_c1 3300050509 Unclassified 4816
1426 nmdc:mga0qj67_860356_c1 3300050509 Unclassified 716
1427 nmdc:mga0qj67_998899_c1 3300050509 Bacteria 657
1428 nmdc:mga06r32_1414214_c1 3300050510 Bacteria 637
1429 nmdc:mga06r32_1464391_c1 3300050510 Bacteria 624
1430 nmdc:mga06r32_1472609_c1 3300050510 Unclassified 621
1431 nmdc:mga06r32_178404_c1 3300050510 Bacteria 2109
1432 nmdc:mga06r32_22977_c1 3300050510 Bacteria 5768
1433 nmdc:mga06r32_393194_c1 3300050510 Unclassified 1369
1434 nmdc:mga06r32_593971_c1 3300050510 Bacteria 1078
1435 nmdc:mga06r32_60494_c1 3300050510 Bacteria 3645
1436 nmdc:mga06r32_609290_c1 3300050510 Bacteria 1062
1437 nmdc:mga06r32_79234_c1 3300050510 Bacteria 3195
1438 nmdc:mga06r32_896035_c1 3300050510 Unclassified 844
1439 nmdc:mga08y16_1042084_c1 3300050511 Bacteria 796
1440 nmdc:mga08y16_1089500_c1 3300050511 Unclassified 774
1441 nmdc:mga08y16_1371756_c1 3300050511 Unclassified 671
1442 nmdc:mga08y16_149931_c1 3300050511 Unclassified 2424
1443 nmdc:mga08y16_212465_c1 3300050511 Unclassified 2004
1444 nmdc:mga08y16_48577_c1 3300050511 Bacteria 4441
1445 nmdc:mga08y16_55284_c1 3300050511 Bacteria 4148
1446 nmdc:mga08y16_582316_c1 3300050511 Bacteria 1130
1447 nmdc:mga08y16_76213_c1 3300050511 Bacteria 3496
1448 nmdc:mga08y16_7824_c1 3300050511 Bacteria 11194
1449 nmdc:mga08y16_8556_c1 3300050511 Bacteria 10721
1450 nmdc:mga0n895_117770_c1 3300050512 Bacteria 2676
1451 nmdc:mga0n895_1953618_c1 3300050512 Bacteria 545
1452 nmdc:mga0n895_2086_c1 3300050512 Bacteria 15401
1453 nmdc:mga0n895_223048_c1 3300050512 Bacteria 1913
1454 nmdc:mga0n895_279650_c1 3300050512 Bacteria 1692
1455 nmdc:mga0n895_377714_c1 3300050512 Bacteria 1434
1456 nmdc:mga0n895_385739_c1 3300050512 Unclassified 1417
1457 nmdc:mga0n895_434264_c1 3300050512 Unclassified 1327
1458 nmdc:mga0n895_488361_c1 3300050512 Bacteria 1241
1459 nmdc:mga0n895_533911_c1 3300050512 Bacteria 1180
1460 nmdc:mga0n895_598303_c1 3300050512 Bacteria 1105
1461 nmdc:mga0n895_614_c1 3300050512 Bacteria 24742
1462 nmdc:mga0n895_6722_c1 3300050512 Bacteria 9803
1463 nmdc:mga0n895_68468_c1 3300050512 Unclassified 3516
1464 nmdc:mga0n895_97117_c1 3300050512 Bacteria 2952
1465 nmdc:mga0rr50_112277_c1 3300050513 Unclassified 2158
1466 nmdc:mga0rr50_12252_c1 3300050513 Bacteria 5531
1467 nmdc:mga0rr50_1248130_c1 3300050513 Unclassified 631
1468 nmdc:mga0rr50_1276208_c1 3300050513 Unclassified 623
1469 nmdc:mga0rr50_183789_c1 3300050513 Bacteria 1710
1470 nmdc:mga0rr50_20140_c1 3300050513 Unclassified 4520
1471 nmdc:mga0rr50_285396_c1 3300050513 Bacteria 1378
1472 nmdc:mga0rr50_34139_c1 3300050513 Unclassified 3641
1473 nmdc:mga0rr50_3718_c1 3300050513 Bacteria 8839
1474 nmdc:mga08x19_27626_c1 3300050514 Bacteria 3550
1475 nmdc:mga08x19_422633_c1 3300050514 Unclassified 936
1476 nmdc:mga08x19_544298_c1 3300050514 Archaea 821
1477 nmdc:mga08x19_625299_c1 3300050514 Unclassified 763
1478 nmdc:mga08x19_75110_c1 3300050514 Bacteria 2209
1479 nmdc:mga08x19_86074_c1 3300050514 Bacteria 2069
1480 nmdc:mga0a205_138943_c1 3300050515 Bacteria 2330
1481 nmdc:mga0a205_280518_c1 3300050515 Bacteria 1541
1482 nmdc:mga0a205_285389_c1 3300050515 Bacteria 1526
1483 nmdc:mga0a205_330535_c1 3300050515 Bacteria 1394
1484 nmdc:mga0a205_45214_c1 3300050515 Bacteria 4245
1485 nmdc:mga0a205_45839_c1 3300050515 Bacteria 4216
1486 nmdc:mga0a205_46984_c1 3300050515 Unclassified 4164
1487 nmdc:mga0a205_62761_c1 3300050515 Bacteria 3590
1488 nmdc:mga0a205_634646_c1 3300050515 Bacteria 920
1489 nmdc:mga0a205_746990_c1 3300050515 Unclassified 827
1490 nmdc:mga0a205_930407_c1 3300050515 Bacteria 716
1491 nmdc:mga0sz30_309442_c1 3300050516 Unclassified 705
1492 Ga0500646_0093184 3300053090 Bacteria 935
1493 Ga0500642_0110266 3300053130 Unclassified 1285
1494 Ga0500652_307375 3300053131 Bacteria 611
1495 Ga0501084_0022820 3300054114 Bacteria 5222
1496 Ga0501084_0025929 3300054114 Bacteria 4888
1497 Ga0501084_0055908 3300054114 Bacteria 3302
1498 Ga0501084_0565743 3300054114 Unclassified 960
1499 Ga0590071_000136 3300059421 Bacteria 20680
1500 Ga0590071_012090 3300059421 Bacteria 2023
1501 Ga0590075_001107 3300059424 Bacteria 6915
1502 Ga0590077_000296 3300059426 Bacteria 14081
1503 Ga0501082_0190763 3300060353 Bacteria 1783
1504 Ga0501082_0921000 3300060353 Bacteria 764
1505 Ga0501082_1553737 3300060353 Bacteria 578
1506 Ga0530510_0075636 3300061734 Unclassified 2446
1507 Ga0530510_0631028 3300061734 Bacteria 815
1508 Ga0530510_1011795 3300061734 Unclassified 636
1509 nmdc:mga0a205_406560_c1
1510 SwRhRL2b_contig_2243275
1511 MRS1b_contig_3024102
1512 MBSR1b_contig_1652279
1513 rootL2_10213578
1514 rootL2_10313642
1515 Ga0058861_10004023
1516 Ga0065704_10008609
1517 Ga0065712_10000722
1518 Ga0065712_10068112
1519 Ga0065712_10080038
1520 Ga0065712_10343860
1521 Ga0065715_10000665
1522 Ga0065715_10090667
1523 Ga0065715_10101699
1524 Ga0065715_10181187
1525 Ga0065715_10647439
1526 Ga0065715_10684669
1527 Ga0065707_10006461
1528 Ga0065707_10097909
1529 Ga0065707_10137150
1530 Ga0065707_11030966
1531 Ga0070658_11727496
1532 Ga0070683_100043182
1533 Ga0070683_100308188
1534 Ga0070683_100409135
1535 Ga0070690_100011979
1536 Ga0070690_100047029
1537 Ga0070690_100366826
1538 Ga0070690_100430052
1539 Ga0070670_100001580
1540 Ga0070670_100006915
1541 Ga0070670_100019505
1542 Ga0070670_100213363
1543 Ga0070670_100278998
1544 Ga0070670_100296107
1545 Ga0070670_101038293
1546 Ga0070670_101493535
1547 Ga0070677_10357022
1548 Ga0068869_100022035
1549 Ga0068869_100024074
1550 Ga0068869_100040793
1551 Ga0068869_100141175
1552 Ga0068869_100154531
1553 Ga0068869_100158076
1554 Ga0068869_100444424
1555 Ga0068869_100913324
1556 Ga0068869_101270990
1557 Ga0070666_10010768
1558 Ga0070666_10185609
1559 Ga0070666_10369917
1560 Ga0070666_10700327
1561 Ga0070680_100148889
1562 Ga0070680_100292914
1563 Ga0070680_100302928
1564 Ga0070680_101212020
1565 Ga0070682_100304757
1566 Ga0070682_100473855
1567 Ga0070682_101127229
1568 Ga0070682_101415185
1569 Ga0068868_100023708
1570 Ga0068868_100261634
1571 Ga0068868_100414869
1572 Ga0068868_100646317
1573 Ga0068868_101053747
1574 Ga0070660_100154209
1575 Ga0070660_100278949
1576 Ga0070689_100112375
1577 Ga0070689_100120178
1578 Ga0070689_100120412
1579 Ga0070689_100239704
1580 Ga0070689_100324970
1581 Ga0070689_100413148
1582 Ga0070689_100479593
1583 Ga0070689_100917406
1584 Ga0070689_101376294
1585 Ga0070689_101848171
1586 Ga0070691_10186201
1587 Ga0070687_100002252
1588 Ga0070687_100015678
1589 Ga0070687_100274327
1590 Ga0070687_100575883
1591 Ga0070661_100005111
1592 Ga0070661_100848863
1593 Ga0070661_101519243
1594 Ga0070692_10106050
1595 Ga0070692_10224706
1596 Ga0070692_10598785
1597 Ga0070692_10659100
1598 Ga0070692_11320079
1599 Ga0070668_100001555
1600 Ga0070669_100003234
1601 Ga0070669_100005529
1602 Ga0070669_100010304
1603 Ga0070669_100034970
1604 Ga0070669_100049616
1605 Ga0070669_100082770
1606 Ga0070669_100261635
1607 Ga0070669_100873864
1608 Ga0070669_101025873
1609 Ga0070669_101324868
1610 Ga0070675_100014022
1611 Ga0070675_100026732
1612 Ga0070675_100094438
1613 Ga0070675_100291076
1614 Ga0070675_100374782
1615 Ga0070675_100376660
1616 Ga0070675_100582762
1617 Ga0070675_101189632
1618 Ga0070671_100051555
1619 Ga0070671_100077766
1620 Ga0070671_100205128
1621 Ga0070674_100077603
1622 Ga0070674_100114405
1623 Ga0070673_100005167
1624 Ga0070673_100049753
1625 Ga0070673_100557000
1626 Ga0070673_100602329
1627 Ga0070673_101306452
1628 Ga0070688_100079423
1629 Ga0070688_100145682
1630 Ga0070688_100305076
1631 Ga0070688_101063724
1632 Ga0070688_101153253
1633 Ga0070659_100176543
1634 Ga0070659_100181975
1635 Ga0070659_100407964
1636 Ga0070659_101241324
1637 Ga0070667_100024133
1638 Ga0070667_100046729
1639 Ga0070667_100273089
1640 Ga0070667_101692008
1641 Ga0070667_102290534
1642 Ga0070703_10000864
1643 Ga0070703_10002711
1644 Ga0070703_10427295
1645 Ga0070709_10000012
1646 Ga0070709_10074400
1647 Ga0070709_10169840
1648 Ga0070709_11458956
1649 Ga0070714_100056885
1650 Ga0070714_101416524
1651 Ga0070713_100000943
1652 Ga0070713_100040232
1653 Ga0070713_100143785
1654 Ga0070713_100785609
1655 Ga0070713_101870664
1656 Ga0070710_10382513
1657 Ga0070710_10479339
1658 Ga0070701_10000511
1659 Ga0070701_10029826
1660 Ga0070701_10150675
1661 Ga0070701_10267227
1662 Ga0070701_10331854
1663 Ga0070701_10623422
1664 Ga0070711_100184002
1665 Ga0070711_100393843
1666 Ga0070711_101698375
1667 Ga0070705_100000836
1668 Ga0070705_100020093
1669 Ga0070705_100263852
1670 Ga0070705_100276519
1671 Ga0070705_100717785
1672 Ga0070705_100738293
1673 Ga0070705_100954065
1674 Ga0070705_101217760
1675 Ga0070700_100010770
1676 Ga0070700_100040611
1677 Ga0070700_100074214
1678 Ga0070700_100115958
1679 Ga0070700_100159229
1680 Ga0070700_100187992
1681 Ga0070700_100321604
1682 Ga0070700_100343971
1683 Ga0070700_100890228
1684 Ga0070700_101539397
1685 Ga0070700_101971044
1686 Ga0070694_100008232
1687 Ga0070694_100028243
1688 Ga0070694_100033218
1689 Ga0070694_100087134
1690 Ga0070694_100143857
1691 Ga0070694_100196928
1692 Ga0070694_100221089
1693 Ga0070694_100371641
1694 Ga0070694_100496417
1695 Ga0070694_100676188
1696 Ga0070694_100694321
1697 Ga0070694_101132159
1698 Ga0070694_101160040
1699 Ga0070694_101171546
1700 Ga0070694_101247963
1701 Ga0070694_101349637
1702 Ga0070694_101509863
1703 Ga0070694_101606839
1704 Ga0070694_101685892
1705 Ga0070708_100000281
1706 Ga0070708_100000312
1707 Ga0070708_100174167
1708 Ga0070708_101022903
1709 Ga0070708_101169918
1710 Ga0070708_101471163
1711 Ga0070708_102037969
1712 Ga0070663_100240802
1713 Ga0070678_100075806
1714 Ga0070678_101527063
1715 Ga0070662_100077521
1716 Ga0070662_100805050
1717 Ga0070681_10001264
1718 Ga0070681_10002886
1719 Ga0070681_10014005
1720 Ga0070681_10023405
1721 Ga0070681_10053544
1722 Ga0070681_10930240
1723 Ga0068867_100367422
1724 Ga0068867_100370121
1725 Ga0068867_100469573
1726 Ga0068867_101181630
1727 Ga0068867_101439899
1728 Ga0070685_10004702
1729 Ga0070685_10139212
1730 Ga0070685_10702421
1731 Ga0070706_100000162
1732 Ga0070706_100001797
1733 Ga0070706_100045601
1734 Ga0070706_100175123
1735 Ga0070706_100516605
1736 Ga0070706_100950808
1737 Ga0070706_101135246
1738 Ga0070707_100021062
1739 Ga0070707_100055784
1740 Ga0070707_100120246
1741 Ga0070707_100133093
1742 Ga0070707_100498303
1743 Ga0070707_100617636
1744 Ga0070707_100643396
1745 Ga0070707_101056142
1746 Ga0070707_101805997
1747 Ga0070698_100004480
1748 Ga0070698_100076474
1749 Ga0070698_100262445
1750 Ga0070698_100324729
1751 Ga0070698_100387753
1752 Ga0070698_100402180
1753 Ga0070698_100741931
1754 Ga0070698_100751895
1755 Ga0070699_100000015
1756 Ga0070699_100000668
1757 Ga0070699_100002373
1758 Ga0070699_100071070
1759 Ga0070699_100142560
1760 Ga0070699_100172294
1761 Ga0070699_100290842
1762 Ga0070699_100410253
1763 Ga0070699_100751414
1764 Ga0070699_101324121
1765 Ga0070699_101401299
1766 Ga0070679_100000108
1767 Ga0070679_100016828
1768 Ga0070679_100315754
1769 Ga0070679_100401906
1770 Ga0070679_100726336
1771 Ga0070679_100926532
1772 Ga0070679_101180457
1773 Ga0070684_100008799
1774 Ga0070684_100841199
1775 Ga0070684_100871404
1776 Ga0070684_101110091
1777 Ga0070684_101191198
1778 Ga0070684_101323869
1779 Ga0070697_100000157
1780 Ga0070697_100014795
1781 Ga0070697_100063927
1782 Ga0070697_100238723
1783 Ga0070697_100245227
1784 Ga0070697_100407735
1785 Ga0070697_100513063
1786 Ga0070697_100588821
1787 Ga0070697_100781040
1788 Ga0070697_100953764
1789 Ga0070697_101212738
1790 Ga0068853_100042117
1791 Ga0068853_100051524
1792 Ga0068853_100281966
1793 Ga0068853_100461978
1794 Ga0068853_101602662
1795 Ga0070672_100021225
1796 Ga0070672_100042591
1797 Ga0070672_100056836
1798 Ga0070672_100229608
1799 Ga0070672_100229893
1800 Ga0070672_100974402
1801 Ga0070672_101049155
1802 Ga0070686_100003534
1803 Ga0070686_100056953
1804 Ga0070686_100211250
1805 Ga0070686_100804562
1806 Ga0070695_100014408
1807 Ga0070695_100039434
1808 Ga0070695_100096696
1809 Ga0070695_100114118
1810 Ga0070695_100275996
1811 Ga0070695_100290531
1812 Ga0070695_100418404
1813 Ga0070695_100638863
1814 Ga0070696_100000100
1815 Ga0070696_100002095
1816 Ga0070696_100069401
1817 Ga0070696_100690984
1818 Ga0070696_100894794
1819 Ga0070696_100988877
1820 Ga0070696_101037620
1821 Ga0070696_101438751
1822 Ga0070693_100001253
1823 Ga0070693_100022347
1824 Ga0070693_100035766
1825 Ga0070693_100583621
1826 Ga0070693_100807272
1827 Ga0070693_101091646
1828 Ga0070693_101382642
1829 Ga0070665_100026599
1830 Ga0070665_100125774
1831 Ga0070665_100223173
1832 Ga0070665_100260930
1833 Ga0070704_100007922
1834 Ga0070704_100021582
1835 Ga0070704_100050456
1836 Ga0070704_100244271
1837 Ga0070704_100361634
1838 Ga0070704_100372577
1839 Ga0070704_100430612
1840 Ga0070704_100864549
1841 Ga0068855_100072660
1842 Ga0068855_100666456
1843 Ga0068855_100732648
1844 Ga0068855_101253612
1845 Ga0068855_101254650
1846 Ga0068855_102063788
1847 Ga0068855_102373300
1848 Ga0070664_100059730
1849 Ga0070664_100136101
1850 Ga0070664_100184064
1851 Ga0070664_100202182
1852 Ga0070664_100245025
1853 Ga0070664_100325042
1854 Ga0070664_100481815
1855 Ga0070664_101179435
1856 Ga0070664_101899686
1857 Ga0068857_100049648
1858 Ga0068857_100143677
1859 Ga0068857_100364532
1860 Ga0068857_100448824
1861 Ga0068854_100002370
1862 Ga0068854_100119644
1863 Ga0068854_100161187
1864 Ga0068854_100275900
1865 Ga0068854_100295929
1866 Ga0068854_100548200
1867 Ga0068856_100039066
1868 Ga0068856_100268466
1869 Ga0068856_100827489
1870 Ga0068856_100969082
1871 Ga0068856_101888837
1872 Ga0070702_100015286
1873 Ga0070702_100266398
1874 Ga0070702_100785191
1875 Ga0070702_101361195
1876 Ga0068852_100328979
1877 Ga0068852_101024197
1878 Ga0068859_100049588
1879 Ga0068859_100076373
1880 Ga0068859_100099592
1881 Ga0068859_100122844
1882 Ga0068859_100191121
1883 Ga0068859_100224674
1884 Ga0068859_100225249
1885 Ga0068859_100279853
1886 Ga0068859_100336049
1887 Ga0068859_100509408
1888 Ga0068859_100952397
1889 Ga0068859_101138156
1890 Ga0068859_101912081
1891 Ga0068859_101995602
1892 Ga0068864_100000972
1893 Ga0068864_100002361
1894 Ga0068864_100011528
1895 Ga0068864_100016902
1896 Ga0068864_100035595
1897 Ga0068864_100291069
1898 Ga0068864_100465181
1899 Ga0068864_100851999
1900 Ga0068864_101298721
1901 Ga0068866_10204673
1902 Ga0068861_100009072
1903 Ga0068861_100048952
1904 Ga0068861_100085936
1905 Ga0068861_100093878
1906 Ga0068861_100180534
1907 Ga0068861_100199378
1908 Ga0068861_100616380
1909 Ga0068861_100617972
1910 Ga0068861_100964696
1911 Ga0068861_101175961
1912 Ga0068861_101258238
1913 Ga0068861_101492685
1914 Ga0068861_101652548
1915 Ga0068851_10001456
1916 Ga0068851_10062433
1917 Ga0068851_10382421
1918 Ga0068870_10344344
1919 Ga0068870_10548806
1920 Ga0068870_10624484
1921 Ga0068870_11317779
1922 Ga0068870_11422573
1923 Ga0068863_100004352
1924 Ga0068863_100042962
1925 Ga0068863_100043846
1926 Ga0068863_100705301
1927 Ga0068863_101013017
1928 Ga0068863_101275105
1929 Ga0068863_101451243
1930 Ga0068863_101485232
1931 Ga0068863_102576667
1932 Ga0068858_100007287
1933 Ga0068858_100038388
1934 Ga0068858_100201121
1935 Ga0068858_100205876
1936 Ga0068858_100311502
1937 Ga0068858_100379446
1938 Ga0068858_100632663
1939 Ga0068858_101263259
1940 Ga0068860_100292781
1941 Ga0068860_100374518
1942 Ga0068860_100537839
1943 Ga0068860_100768858
1944 Ga0068860_100954270
1945 Ga0068860_101495864
1946 Ga0068860_101881856
1947 Ga0068862_100022003
1948 Ga0068862_100029198
1949 Ga0068862_100031706
1950 Ga0068862_100223542
1951 Ga0068862_100324844
1952 Ga0068862_100412434
1953 Ga0068862_100645840
1954 Ga0068862_101036859
1955 Ga0068862_102129104
1956 Ga0081455_10002273
1957 Ga0081455_10009645
1958 Ga0081455_10048972
1959 Ga0081455_10122063
1960 Ga0081455_10315448
1961 Ga0081455_11002370
1962 Ga0081540_1103044
1963 Ga0081540_1248725
1964 Ga0081539_10075890
1965 Ga0081539_10092910
1966 Ga0081539_10381415
1967 Ga0070717_10084349
1968 Ga0070717_10094830
1969 Ga0070717_10123183
1970 Ga0075365_10210227
1971 Ga0075368_10026567
1972 Ga0075363_100007803
1973 Ga0075363_100411820
1974 Ga0075364_10015046
1975 Ga0075364_10224834
1976 Ga0075364_10243940
1977 Ga0075432_10245228
1978 Ga0070715_10162672
1979 Ga0070716_100042757
1980 Ga0070716_100492156
1981 Ga0070716_101275270
1982 Ga0070712_100072489
1983 Ga0070712_100318062
1984 Ga0070712_100494661
1985 Ga0075367_10003333
1986 Ga0075367_10019418
1987 Ga0075367_10453085
1988 Ga0075369_10233764
1989 Ga0075366_10177411
1990 Ga0075366_10329359
1991 Ga0097621_100004123
1992 Ga0097621_102011203
1993 Ga0097621_102077654
1994 Ga0075370_10066331
1995 Ga0075370_10067153
1996 Ga0068871_100068482
1997 Ga0068871_100394867
1998 Ga0068871_100617585
1999 Ga0068871_100927017
2000 Ga0075428_100013681
2001 Ga0075428_100053415
2002 Ga0075428_100211742
2003 Ga0075428_100259688
2004 Ga0075428_100384232
2005 Ga0075428_100496120
2006 Ga0075428_100522993
2007 Ga0075428_101071946
2008 Ga0075428_101621092
2009 Ga0075428_102604976
2010 Ga0075430_100191962
2011 Ga0075430_100237311
2012 Ga0075430_100273308
2013 Ga0075430_100493766
2014 Ga0075431_100042464
2015 Ga0075431_100052990
2016 Ga0075431_100056525
2017 Ga0075431_100056998
2018 Ga0075431_100075398
2019 Ga0075431_100082032
2020 Ga0075431_100092837
2021 Ga0075431_101236031
2022 Ga0075431_101276624
2023 Ga0075433_10011826
2024 Ga0075433_10035092
2025 Ga0075433_10044905
2026 Ga0075433_10048972
2027 Ga0075433_10057957
2028 Ga0075433_10271434
2029 Ga0075433_10332158
2030 Ga0075433_10361450
2031 Ga0075433_10545336
2032 Ga0075433_10591772
2033 Ga0075433_10766789
2034 Ga0075434_100013759
2035 Ga0075434_100016132
2036 Ga0075434_100031019
2037 Ga0075434_100068189
2038 Ga0075434_100101264
2039 Ga0075434_100112774
2040 Ga0075434_100121539
2041 Ga0075434_100157401
2042 Ga0075434_100246737
2043 Ga0075434_100289610
2044 Ga0075434_100378635
2045 Ga0075434_100381869
2046 Ga0075434_100586105
2047 Ga0075434_101155971
2048 Ga0075429_100294443
2049 Ga0075429_100364259
2050 Ga0075429_100841736
2051 Ga0075429_100876616
2052 Ga0075429_101312084
2053 Ga0075429_101975089
2054 Ga0068865_100009071
2055 Ga0068865_100009725
2056 Ga0068865_100491040
2057 Ga0068865_100658241
2058 Ga0068865_100711318
2059 Ga0068865_101290936
2060 Ga0075436_100001685
2061 Ga0075436_100050539
2062 Ga0075436_100086262
2063 Ga0075436_100484610
2064 Ga0097620_100049586
2065 Ga0097620_100076373
2066 Ga0097620_100099589
2067 Ga0097620_100122835
2068 Ga0097620_100191116
2069 Ga0097620_100224658
2070 Ga0097620_100225243
2071 Ga0097620_100279852
2072 Ga0097620_100336008
2073 Ga0097620_100509387
2074 Ga0097620_100952358
2075 Ga0097620_101137811
2076 Ga0097620_101911779
2077 Ga0097620_101995513
2078 Ga0075435_100001301
2079 Ga0075435_100032624
2080 Ga0075435_100042126
2081 Ga0075435_100051314
2082 Ga0075435_100060651
2083 Ga0075435_100190239
2084 Ga0075435_100190789
2085 Ga0075435_100222999
2086 Ga0075435_100932143
2087 Ga0099794_10612321
2088 Ga0105240_10017653
2089 Ga0105240_10068345
2090 Ga0105240_10086120
2091 Ga0105240_10104152
2092 Ga0105240_10148256
2093 Ga0105240_10364634
2094 Ga0105240_10805799
2095 Ga0105240_11092522
2096 Ga0105240_11861517
2097 Ga0111539_10002572
2098 Ga0111539_10005299
2099 Ga0111539_10014503
2100 Ga0111539_10048488
2101 Ga0111539_10059685
2102 Ga0111539_10083695
2103 Ga0111539_10095836
2104 Ga0111539_10103314
2105 Ga0111539_10229348
2106 Ga0111539_11202583
2107 Ga0105245_10199010
2108 Ga0105245_10439492
2109 Ga0105245_10439980
2110 Ga0105245_10523354
2111 Ga0105245_11638695
2112 Ga0105245_12327159
2113 Ga0105245_13281063
2114 Ga0105247_10017215
2115 Ga0114129_10009070
2116 Ga0114129_10028287
2117 Ga0114129_10029552
2118 Ga0114129_10047794
2119 Ga0114129_10109761
2120 Ga0114129_10116592
2121 Ga0114129_10154124
2122 Ga0114129_10325652
2123 Ga0114129_10369079
2124 Ga0114129_10610691
2125 Ga0114129_10837098
2126 Ga0105243_10055225
2127 Ga0105243_10071306
2128 Ga0105243_10160944
2129 Ga0105243_10327568
2130 Ga0105243_10807668
2131 Ga0105241_11155504
2132 Ga0105241_12128583
2133 Ga0105242_10224969
2134 Ga0105242_10633373
2135 Ga0105242_10793059
2136 Ga0105242_11179282
2137 Ga0105242_12190339
2138 Ga0105242_12413379
2139 Ga0105248_10004553
2140 Ga0105248_10006130
2141 Ga0105248_10007892
2142 Ga0105248_10052803
2143 Ga0105248_10080602
2144 Ga0105248_10081317
2145 Ga0105248_10090041
2146 Ga0105248_10148696
2147 Ga0105248_10160948
2148 Ga0105248_10188524
2149 Ga0105248_10265986
2150 Ga0105248_10328857
2151 Ga0105248_10612794
2152 Ga0105248_11178071
2153 Ga0105248_13057288
2154 Ga0105237_10001278
2155 Ga0105237_10100473
2156 Ga0105237_12179793
2157 Ga0105238_10293590
2158 Ga0105238_11910144
2159 Ga0105249_10014223
2160 Ga0105249_10017230
2161 Ga0105249_10019880
2162 Ga0105249_10054585
2163 Ga0105249_10111124
2164 Ga0105249_10214913
2165 Ga0105249_10288362
2166 Ga0105249_10289495
2167 Ga0105249_10763701
2168 Ga0105249_10866455
2169 Ga0105249_11120230
2170 Ga0105249_11644118
2171 Ga0105249_11752056
2172 Ga0105249_12254864
2173 Ga0105249_12587689
2174 Ga0105239_10071710
2175 Ga0105239_10082871
2176 Ga0105239_10169212
2177 Ga0105239_10350999
2178 Ga0105239_10452006
2179 Ga0105239_10635737
2180 Ga0105246_10222528
2181 Ga0105246_10384610
2182 Ga0105246_10924992
2183 Ga0105246_11348636
2184 Ga0157314_1028801
2185 Ga0157373_10043275
2186 Ga0157373_10164341
2187 Ga0157373_10180072
2188 Ga0157373_10871109
2189 Ga0157371_10011944
2190 Ga0157371_11577088
2191 Ga0157370_10963771
2192 Ga0157369_10057370
2193 Ga0157369_10068874
2194 Ga0157369_10383556
2195 Ga0157369_11587871
2196 Ga0157374_10187792
2197 Ga0157374_10617590
2198 Ga0157374_10757646
2199 Ga0157374_12656422
2200 Ga0157378_10003443
2201 Ga0157378_10187525
2202 Ga0157378_10261128
2203 Ga0157378_10631143
2204 Ga0157378_10679105
2205 Ga0157378_10856962
2206 Ga0157378_11391075
2207 Ga0157378_11397568
2208 Ga0157378_11421358
2209 Ga0157378_12624969
2210 Ga0163162_10012324
2211 Ga0163162_10016878
2212 Ga0163162_10020854
2213 Ga0163162_10038119
2214 Ga0163162_10093638
2215 Ga0163162_11019097
2216 Ga0163162_11065812
2217 Ga0163162_11089666
2218 Ga0163162_13127424
2219 Ga0157372_10003493
2220 Ga0157372_10031979
2221 Ga0157372_10401406
2222 Ga0157372_12018524
2223 Ga0157372_12501631
2224 Ga0157375_10007339
2225 Ga0157375_10019518
2226 Ga0157375_10142606
2227 Ga0157375_10189760
2228 Ga0157375_10208694
2229 Ga0157375_10285934
2230 Ga0157375_10871563
2231 Ga0157375_11555120
2232 Ga0163163_10004088
2233 Ga0163163_10057361
2234 Ga0163163_10057551
2235 Ga0163163_10252316
2236 Ga0163163_10580399
2237 Ga0163163_10585589
2238 Ga0163163_11190756
2239 Ga0163163_11997790
2240 Ga0163163_12268108
2241 Ga0163163_12743378
2242 Ga0163163_12748141
2243 Ga0163163_13146099
2244 Ga0157380_10003931
2245 Ga0157380_10013530
2246 Ga0157380_10028285
2247 Ga0157380_10106987
2248 Ga0157380_10369555
2249 Ga0157380_10528267
2250 Ga0157380_10833754
2251 Ga0157380_11216817
2252 Ga0157380_11537457
2253 Ga0157380_12383631
2254 Ga0157377_10075696
2255 Ga0157377_10536487
2256 Ga0157377_10789065
2257 Ga0157377_11043999
2258 Ga0157379_10072091
2259 Ga0157379_10081890
2260 Ga0157379_10103598
2261 Ga0157379_10258980
2262 Ga0157379_10366255
2263 Ga0157379_11067649
2264 Ga0157376_10018262
2265 Ga0157376_10289451
2266 Ga0157376_10578424
2267 Ga0157376_12938338
2268 Ga0182005_1225903
2269 Ga0163161_10033550
2270 Ga0163161_10119365
2271 Ga0163161_10147811
2272 Ga0207697_10107670
2273 Ga0207697_10187986
2274 Ga0207697_10246756
2275 Ga0207656_10041139
2276 Ga0207656_10299496
2277 Ga0207653_10000263
2278 Ga0207653_10000358
2279 Ga0207653_10008632
2280 Ga0207653_10104348
2281 Ga0207653_10261728
2282 Ga0207692_10951333
2283 Ga0207642_10251586
2284 Ga0207642_10261041
2285 Ga0207642_10489763
2286 Ga0207688_10212503
2287 Ga0207688_10220963
2288 Ga0207688_10344575
2289 Ga0207688_10440025
2290 Ga0207680_10013658
2291 Ga0207680_10135370
2292 Ga0207647_10064847
2293 Ga0207647_10116528
2294 Ga0207647_10125099
2295 Ga0207699_10000006
2296 Ga0207699_10000087
2297 Ga0207699_10013362
2298 Ga0207699_10044815
2299 Ga0207699_10088841
2300 Ga0207699_10184978
2301 Ga0207645_10000288
2302 Ga0207645_10182734
2303 Ga0207645_10938427
2304 Ga0207643_10022517
2305 Ga0207643_11038780
2306 Ga0207643_11148681
2307 Ga0207705_11082211
2308 Ga0207684_10001089
2309 Ga0207684_10001832
2310 Ga0207684_10030891
2311 Ga0207684_10166738
2312 Ga0207684_10688282
2313 Ga0207654_10076059
2314 Ga0207654_10701797
2315 Ga0207654_11174500
2316 Ga0207707_10000053
2317 Ga0207707_10005201
2318 Ga0207707_10005983
2319 Ga0207707_10359997
2320 Ga0207707_10947066
2321 Ga0207695_10047812
2322 Ga0207695_10353742
2323 Ga0207671_10002090
2324 Ga0207671_11114894
2325 Ga0207693_10000012
2326 Ga0207693_10243234
2327 Ga0207693_10280006
2328 Ga0207663_10357372
2329 Ga0207663_10750075
2330 Ga0207660_10008799
2331 Ga0207660_10252585
2332 Ga0207660_10589382
2333 Ga0207660_11365895
2334 Ga0207662_10004761
2335 Ga0207662_10016657
2336 Ga0207662_10068339
2337 Ga0207657_10158044
2338 Ga0207657_10238073
2339 Ga0207657_10553752
2340 Ga0207649_10041481
2341 Ga0207649_10092014
2342 Ga0207649_10351331
2343 Ga0207652_10000069
2344 Ga0207652_10081157
2345 Ga0207652_10269734
2346 Ga0207652_10543817
2347 Ga0207652_10738998
2348 Ga0207652_10979401
2349 Ga0207652_11341812
2350 Ga0207646_10157507
2351 Ga0207646_10169781
2352 Ga0207646_10532254
2353 Ga0207646_11503192
2354 Ga0207646_11669746
2355 Ga0207681_10004797
2356 Ga0207681_10007887
2357 Ga0207681_10049478
2358 Ga0207681_10059163
2359 Ga0207681_10064390
2360 Ga0207681_10129111
2361 Ga0207681_10242128
2362 Ga0207681_10364511
2363 Ga0207681_11368845
2364 Ga0207694_10225675
2365 Ga0207694_11251763
2366 Ga0207650_10017898
2367 Ga0207650_10044796
2368 Ga0207650_10076831
2369 Ga0207650_10105986
2370 Ga0207650_10132772
2371 Ga0207650_10160425
2372 Ga0207650_11291334
2373 Ga0207659_10012156
2374 Ga0207659_10268258
2375 Ga0207659_11835766
2376 Ga0207687_10144702
2377 Ga0207687_11122740
2378 Ga0207687_11299459
2379 Ga0207687_11410671
2380 Ga0207687_11503517
2381 Ga0207700_10107620
2382 Ga0207700_10781397
2383 Ga0207700_11104144
2384 Ga0207664_10006013
2385 Ga0207664_10045248
2386 Ga0207664_10120991
2387 Ga0207644_10032461
2388 Ga0207644_10043302
2389 Ga0207644_10689911
2390 Ga0207644_10938305
2391 Ga0207690_10084174
2392 Ga0207690_11011241
2393 Ga0207706_10011737
2394 Ga0207706_10166834
2395 Ga0207706_10354559
2396 Ga0207706_10520291
2397 Ga0207706_11189704
2398 Ga0207686_10216109
2399 Ga0207686_10466645
2400 Ga0207686_10680090
2401 Ga0207686_10879073
2402 Ga0207709_10198788
2403 Ga0207709_10532647
2404 Ga0207709_10550671
2405 Ga0207709_10624850
2406 Ga0207709_11279136
2407 Ga0207670_10087736
2408 Ga0207670_10097855
2409 Ga0207670_10125290
2410 Ga0207670_10245152
2411 Ga0207670_10355264
2412 Ga0207670_11726646
2413 Ga0207670_11823884
2414 Ga0207704_10135868
2415 Ga0207704_10239879
2416 Ga0207704_10425624
2417 Ga0207704_10810951
2418 Ga0207665_10022584
2419 Ga0207665_10642997
2420 Ga0207691_10002394
2421 Ga0207691_10006173
2422 Ga0207691_10070040
2423 Ga0207691_10256487
2424 Ga0207691_10446014
2425 Ga0207691_10834113
2426 Ga0207691_11464636
2427 Ga0207691_11498251
2428 Ga0207711_10028048
2429 Ga0207711_10030911
2430 Ga0207711_10033025
2431 Ga0207711_10099216
2432 Ga0207711_10134896
2433 Ga0207711_10187537
2434 Ga0207711_10238217
2435 Ga0207711_10374686
2436 Ga0207711_10433503
2437 Ga0207711_11599579
2438 Ga0207689_10023776
2439 Ga0207689_10035751
2440 Ga0207689_10075895
2441 Ga0207689_10096844
2442 Ga0207689_10181709
2443 Ga0207689_10200775
2444 Ga0207689_10325595
2445 Ga0207689_10760973
2446 Ga0207689_11334136
2447 Ga0207661_10019278
2448 Ga0207661_11903681
2449 Ga0207679_10001346
2450 Ga0207679_10137866
2451 Ga0207679_10263336
2452 Ga0207679_10360444
2453 Ga0207679_10460423
2454 Ga0207679_10752906
2455 Ga0207667_11132709
2456 Ga0207667_11444725
2457 Ga0207667_11502050
2458 Ga0207667_11985569
2459 Ga0207651_10001373
2460 Ga0207712_10003633
2461 Ga0207712_10012473
2462 Ga0207712_10028921
2463 Ga0207712_10187443
2464 Ga0207712_10220935
2465 Ga0207712_10358303
2466 Ga0207712_10635890
2467 Ga0207712_10857611
2468 Ga0207668_10109315
2469 Ga0207668_10147613
2470 Ga0207668_10629653
2471 Ga0207640_10019324
2472 Ga0207640_10071609
2473 Ga0207640_10103379
2474 Ga0207640_10592295
2475 Ga0207658_10064239
2476 Ga0207658_10224014
2477 Ga0207658_10242627
2478 Ga0207658_10318664
2479 Ga0207658_10512428
2480 Ga0207658_11157686
2481 Ga0207677_10067127
2482 Ga0207677_10131953
2483 Ga0207677_10420135
2484 Ga0207677_11757611
2485 Ga0207703_10011290
2486 Ga0207703_10061859
2487 Ga0207703_10097141
2488 Ga0207703_10101471
2489 Ga0207703_10114121
2490 Ga0207703_10291505
2491 Ga0207703_10852019
2492 Ga0207703_10860608
2493 Ga0207703_11618216
2494 Ga0207639_10058177
2495 Ga0207639_10270740
2496 Ga0207639_10281920
2497 Ga0207639_11758541
2498 Ga0207639_12291468
2499 Ga0207678_10069668
2500 Ga0207678_11877872
2501 Ga0207708_10007122
2502 Ga0207708_10022485
2503 Ga0207708_10025866
2504 Ga0207708_10047154
2505 Ga0207708_10096996
2506 Ga0207708_10169758
2507 Ga0207708_10337914
2508 Ga0207708_10410215
2509 Ga0207708_10423428
2510 Ga0207708_11066611
2511 Ga0207708_11108152
2512 Ga0207708_11834446
2513 Ga0207702_10019389
2514 Ga0207702_10401202
2515 Ga0207702_11197377
2516 Ga0207702_11610959
2517 Ga0207702_12200501
2518 Ga0207641_10001307
2519 Ga0207641_10279049
2520 Ga0207641_10319770
2521 Ga0207641_10483275
2522 Ga0207641_10509754
2523 Ga0207641_10797482
2524 Ga0207641_11435484
2525 Ga0207641_11698357
2526 Ga0207648_10107139
2527 Ga0207648_10144120
2528 Ga0207648_10402323
2529 Ga0207648_10483032
2530 Ga0207648_10566551
2531 Ga0207648_10578032
2532 Ga0207648_10595494
2533 Ga0207648_11771121
2534 Ga0207676_10010941
2535 Ga0207676_10049142
2536 Ga0207676_10062706
2537 Ga0207676_10075685
2538 Ga0207676_10104052
2539 Ga0207676_10354101
2540 Ga0207676_10375759
2541 Ga0207676_10464974
2542 Ga0207676_10599632
2543 Ga0207676_11434095
2544 Ga0207676_11478786
2545 Ga0207674_10000485
2546 Ga0207674_10007921
2547 Ga0207674_10232569
2548 Ga0207674_10424604
2549 Ga0207674_10540199
2550 Ga0207674_10657572
2551 Ga0207675_100014875
2552 Ga0207675_100030178
2553 Ga0207675_100071466
2554 Ga0207675_100072880
2555 Ga0207675_100103712
2556 Ga0207675_100216509
2557 Ga0207675_100254380
2558 Ga0207675_100333913
2559 Ga0207675_100391063
2560 Ga0207675_100664470
2561 Ga0207675_101712971
2562 Ga0207675_102071085
2563 Ga0207675_102367051
2564 Ga0207683_10074891
2565 Ga0207683_10344218
2566 Ga0207698_10030526
2567 Ga0207698_10358630
2568 Ga0207698_10595008
2569 Ga0209813_10025266
2570 Ga0209813_10235390
2571 Ga0207428_10017341
2572 Ga0207428_10022688
2573 Ga0207428_10149919
2574 Ga0207428_10161189
2575 Ga0207428_10417486
2576 Ga0207428_11227672
2577 Ga0268266_10069072
2578 Ga0268266_10266946
2579 Ga0268266_10335616
2580 Ga0268265_10082198
2581 Ga0268265_10191326
2582 Ga0268265_10642983
2583 Ga0268265_10702710
2584 Ga0268265_10856052
2585 Ga0268265_11470388
2586 Ga0268265_12399805
2587 Ga0268265_12555683
2588 Ga0268264_10348906
2589 Ga0268264_10913516
2590 Ga0268264_11190806
2591 Ga0268264_11394362
2592 Ga0268264_11792936
2593 Ga0268264_12108741
2594 Ga0268264_12477274
2595 Ga0307511_10363384
2596 Ga0265762_1114685
2597 Ga0265316_10058535
2598 Ga0307408_100017526
2599 Ga0307408_101661822
2600 Ga0307408_102368298
2601 Ga0307508_10428199
2602 Ga0265342_10149181
2603 Ga0307413_10581276
2604 Ga0307413_11471179
2605 Ga0307410_10198389
2606 Ga0307406_10005829
2607 Ga0307406_10101043
2608 Ga0307406_10152446
2609 Ga0307406_10351769
2610 Ga0307406_10439371
2611 Ga0307406_10710145
2612 Ga0307407_10070224
2613 Ga0307407_10236346
2614 Ga0307412_10606774
2615 Ga0307412_10868290
2616 Ga0307409_100318827
2617 Ga0307409_100449447
2618 Ga0307416_100052588
2619 Ga0307416_100112403
2620 Ga0307416_100973525
2621 Ga0307416_101206921
2622 Ga0307416_102475935
2623 Ga0307414_10043924
2624 Ga0307411_10024008
2625 Ga0307411_10065454
2626 Ga0307411_10162706
2627 Ga0307415_100471918
2628 Ga0373930_0072149
2629 Ga0373948_0005196
2630 Ga0373950_0012513
2631 Ga0373938_0034197
2632 Ga0373926_0102420
2633 Ga0373928_0000435
2634 Ga0373929_0005480
2635 Ga0373929_0157122
2636 Ga0373940_0003028
2637 Ga0373940_0154234
2638 Ga0373949_0301666
2639 Ga0373951_0009379
2640 Ga0373952_0017809
2641 Ga0373939_0303984
2642 Ga0373941_0092624
2643 Ga0373941_0479814
2644 Ga0373945_0280258
2645 Ga0373956_0577711
2646 Ga0373960_0009529
2647 Ga0373943_0116556
2648 Ga0373943_0573983
2649 Ga0373943_0582614
2650 Ga0373946_0026249
2651 Ga0373946_0538544
2652 Ga0373955_0223968
2653 Ga0373942_0006172
2654 Ga0373942_0159383
2655 Ga0373961_0001990
2656 Ga0373962_0059238
2657 Ga0373924_0157017
2658 Ga0373931_0272291
2659 Ga0373931_0316027
2660 Ga0373931_0717079
2661 Ga0373935_0116630
2662 Ga0373947_0044683
2663 Ga0373947_0506094
2664 Ga0373947_0749226
2665 Ga0373937_0002184
2666 Ga0373937_0057935
2667 Ga0373937_0392281
2668 Ga0373925_0016796
2669 Ga0395900_0436933
2670 Ga0395905_0168778
2671 Ga0436364_0149045
2672 Ga0395901_1839902
2673 Ga0436365_0489401
2674 Ga0436360_0372542
2675 Ga0439439_0041670
2676 Ga0439453_0001879
2677 Ga0451845_0570708
2678 Ga0451853_3373232
2679 Ga0439449_0356370
2680 Ga0439455_0056949
2681 Ga0439455_0141397
2682 Ga0439462_0200795
2683 Ga0450888_018349
2684 Ga0439446_0317979
2685 Ga0439458_0001390
2686 Ga0439435_0020395
2687 Ga0439444_0047542
2688 Ga0439444_0159683
2689 Ga0439459_0060020
2690 Ga0439459_0162467
2691 Ga0439460_0100088
2692 Ga0451577_1269728
2693 Ga0466965_0255582
2694 Ga0466966_0133531
2695 Ga0453684_0518070
2696 Ga0466960_0156075
2697 Ga0451576_0010483
2698 Ga0451576_0204978
2699 Ga0451576_0234484
2700 Ga0451576_0309812
2701 Ga0451576_0558457
2702 Ga0451576_1358143
2703 Ga0451576_1703988
2704 Ga0451576_1809414
2705 Ga0451576_1864252
2706 Ga0466967_1583006
2707 Ga0495592_0173057
2708 Ga0495629_0713679
2709 Ga0495580_0072052
2710 Ga0495580_0582615
2711 Ga0495582_0001631
2712 Ga0495582_0181878
2713 Ga0495639_0509079
2714 Ga0495594_0639076
2715 Ga0495608_0047724
2716 Ga0495652_0837227
2717 Ga0495598_0117627
2718 Ga0495598_0428120
2719 Ga0495633_0082097
2720 Ga0495656_0482348
2721 Ga0495625_0184995
2722 Ga0495659_0108058
2723 Ga0495658_0118835
2724 Ga0495658_0133820
2725 Ga0495670_0011966
2726 Ga0495581_0268780
2727 Ga0495676_0865875
2728 Ga0495677_0085132
2729 Ga0495615_0044131
2730 Ga0496100_0323342
2731 Ga0496100_0499804
2732 Ga0496100_0770481
2733 Ga0496101_0474712
2734 Ga0496101_0539347
2735 Ga0496101_0606198
2736 Ga0496102_0297098
2737 Ga0496102_0429273
2738 Ga0496102_0719851
2739 Ga0496102_0880618
2740 Ga0496103_0086176
2741 Ga0496103_0650143
2742 Ga0496104_0006915
2743 Ga0496104_0039399
2744 Ga0496104_0041168
2745 Ga0496104_0058881
2746 Ga0496104_0379772
2747 Ga0496104_1547926
2748 Ga0496105_0135362
2749 Ga0496105_0205935
2750 Ga0496105_0290454
2751 Ga0496105_0519100
2752 Ga0496106_0052588
2753 Ga0496106_0192643
2754 Ga0496106_0262121
2755 Ga0496106_0368426
2756 Ga0496106_0751501
2757 Ga0496107_0119878
2758 Ga0496108_0007316
2759 Ga0496108_0068095
2760 Ga0496108_0455161
2761 Ga0496109_0001812
2762 Ga0496109_0029579
2763 Ga0496109_0145177
2764 Ga0496109_0171215
2765 Ga0496109_0790757
2766 Ga0496109_0924683
2767 Ga0496109_0961825
2768 Ga0496110_0036526
2769 Ga0496110_0208149
2770 Ga0496110_1166671
2771 Ga0496110_1250673
2772 Ga0496111_0735077
2773 Ga0496112_0003609
2774 Ga0496112_0004837
2775 Ga0496112_0033934
2776 Ga0496112_0093463
2777 Ga0496112_0108283
2778 Ga0496112_0352989
2779 Ga0496112_0406282
2780 Ga0496113_0067329
2781 Ga0496113_0253135
2782 Ga0496113_1229853
2783 Ga0496114_0001659
2784 Ga0496114_0242591
2785 Ga0496115_0191772
2786 Ga0496115_0899693
2787 Ga0501291_051415
2788 Ga0501296_053909
2789 Ga0501031_0055975
2790 Ga0501032_0747423
2791 Ga0501033_0580994
2792 Ga0501036_0031431
2793 Ga0501036_0050508
2794 Ga0501036_0109949
2795 Ga0501036_0205168
2796 Ga0501036_1093281
2797 Ga0501037_0449480
2798 Ga0501037_0753795
2799 Ga0501038_1105767
2800 Ga0501038_1240539
2801 Ga0501039_0386563
2802 Ga0501039_0441749
2803 Ga0501040_0027884
2804 Ga0501040_0033682
2805 Ga0501040_0152234
2806 Ga0501041_0022062
2807 Ga0501041_0035275
2808 Ga0501041_0042450
2809 Ga0501042_0322650
2810 Ga0501042_0643541
2811 Ga0501042_0700349
2812 Ga0501046_0089967
2813 Ga0501046_0122480
2814 Ga0501046_0500920
2815 Ga0501046_0552169
2816 Ga0501048_0120772
2817 Ga0501048_0308492
2818 Ga0501067_0072758
2819 Ga0501068_1158294
2820 Ga0501071_0262673
2821 Ga0501072_0084970
2822 Ga0501072_0103597
2823 Ga0501072_0140517
2824 Ga0501074_0320542
2825 Ga0501075_0029143
2826 Ga0501075_0078130
2827 Ga0501075_0357095
2828 Ga0501076_0020495
2829 Ga0501076_0074481
2830 Ga0501076_1701490
2831 Ga0501077_0035306
2832 Ga0501077_0233475
2833 Ga0501198_074425
2834 Ga0501199_021873
2835 Ga0501202_000579
2836 Ga0501207_011698
2837 Ga0501217_000455
2838 Ga0501223_010821
2839 Ga0501227_000056
2840 Ga0501233_007086
2841 Ga0501233_024721
2842 Ga0501235_007731
2843 Ga0501239_071809
2844 Ga0501240_000606
2845 Ga0501247_030694
2846 Ga0501250_020350
2847 Ga0501250_038260
2848 Ga0501256_003453
2849 Ga0501257_012819
2850 Ga0501258_008666
2851 Ga0501261_063788
2852 Ga0501221_002052
2853 Ga0501221_092611
2854 Ga0501225_0004267
2855 Ga0501225_0167538
2856 Ga0501225_0336322
2857 Ga0501229_021405
2858 Ga0501234_010861
2859 Ga0501079_0081372
2860 Ga0501079_0138698
2861 Ga0501079_0585421
2862 Ga0501080_0439376
2863 Ga0501080_0865565
2864 Ga0501081_0070213
2865 Ga0501081_0637216
2866 Ga0501081_0652442
2867 Ga0501083_0245840
2868 Ga0501083_0420432
2869 Ga0501083_0446213
2870 Ga0501265_076855
2871 Ga0501266_045664
2872 Ga0501273_094204
2873 Ga0501283_033394
2874 Ga0501283_047875
2875 Ga0501035_0833513
2876 Ga0501044_0043865
2877 Ga0501045_0018823
2878 Ga0501045_0138184
2879 Ga0501045_0220211
2880 Ga0501212_004226
2881 Ga0501226_000814
2882 Ga0501226_015239
2883 nmdc:mga03683_472301_c1
2884 nmdc:mga00v17_137195_c1
2885 nmdc:mga00v17_18754_c1
2886 nmdc:mga00v17_27688_c1
2887 nmdc:mga00v17_325512_c1
2888 nmdc:mga00v17_351617_c1
2889 nmdc:mga00v17_530726_c1
2890 nmdc:mga00v17_85191_c1
2891 nmdc:mga0yw44_332057_c1
2892 nmdc:mga0yw44_997462_c1
2893 nmdc:mga0k408_18283_c1
2894 nmdc:mga0k408_2060_c1
2895 nmdc:mga0k408_223958_c1
2896 nmdc:mga0k408_307410_c1
2897 nmdc:mga0k408_929848_c1
2898 nmdc:mga06z11_108774_c1
2899 nmdc:mga06z11_21419_c1
2900 nmdc:mga06z11_223910_c1
2901 nmdc:mga06z11_275524_c1
2902 nmdc:mga06z11_961_c1
2903 nmdc:mga04h51_203475_c1
2904 nmdc:mga04h51_24557_c1
2905 nmdc:mga04h51_66461_c1
2906 nmdc:mga07m45_198134_c1
2907 nmdc:mga07m45_66082_c1
2908 nmdc:mga05p37_10168_c1
2909 nmdc:mga05p37_117571_c1
2910 nmdc:mga05p37_1245173_c1
2911 nmdc:mga05p37_15197_c1
2912 nmdc:mga05p37_163433_c1
2913 nmdc:mga05p37_169563_c1
2914 nmdc:mga05p37_173398_c1
2915 nmdc:mga05p37_19640_c1
2916 nmdc:mga05p37_397361_c1
2917 nmdc:mga05p37_452360_c1
2918 nmdc:mga05p37_463078_c1
2919 nmdc:mga05p37_69322_c1
2920 nmdc:mga05p37_730413_c1
2921 nmdc:mga05p37_850_c1
2922 nmdc:mga05p37_889615_c1
2923 nmdc:mga05p37_923166_c1
2924 nmdc:mga09592_1095670_c1
2925 nmdc:mga09592_1120364_c1
2926 nmdc:mga09592_1654047_c1
2927 nmdc:mga09592_17478_c1
2928 nmdc:mga09592_263096_c1
2929 nmdc:mga09592_411656_c1
2930 nmdc:mga09592_475982_c2
2931 nmdc:mga0qj67_1071280_c1
2932 nmdc:mga0qj67_195446_c1
2933 nmdc:mga0qj67_22746_c1
2934 nmdc:mga0qj67_860356_c1
2935 nmdc:mga0qj67_998899_c1
2936 nmdc:mga06r32_1414214_c1
2937 nmdc:mga06r32_1464391_c1
2938 nmdc:mga06r32_1472609_c1
2939 nmdc:mga06r32_178404_c1
2940 nmdc:mga06r32_22977_c1
2941 nmdc:mga06r32_393194_c1
2942 nmdc:mga06r32_593971_c1
2943 nmdc:mga06r32_60494_c1
2944 nmdc:mga06r32_609290_c1
2945 nmdc:mga06r32_79234_c1
2946 nmdc:mga06r32_896035_c1
2947 nmdc:mga08y16_1042084_c1
2948 nmdc:mga08y16_1089500_c1
2949 nmdc:mga08y16_1371756_c1
2950 nmdc:mga08y16_149931_c1
2951 nmdc:mga08y16_212465_c1
2952 nmdc:mga08y16_48577_c1
2953 nmdc:mga08y16_55284_c1
2954 nmdc:mga08y16_582316_c1
2955 nmdc:mga08y16_76213_c1
2956 nmdc:mga08y16_7824_c1
2957 nmdc:mga08y16_8556_c1
2958 nmdc:mga0n895_117770_c1
2959 nmdc:mga0n895_1953618_c1
2960 nmdc:mga0n895_2086_c1
2961 nmdc:mga0n895_223048_c1
2962 nmdc:mga0n895_279650_c1
2963 nmdc:mga0n895_377714_c1
2964 nmdc:mga0n895_385739_c1
2965 nmdc:mga0n895_434264_c1
2966 nmdc:mga0n895_488361_c1
2967 nmdc:mga0n895_533911_c1
2968 nmdc:mga0n895_598303_c1
2969 nmdc:mga0n895_614_c1
2970 nmdc:mga0n895_6722_c1
2971 nmdc:mga0n895_68468_c1
2972 nmdc:mga0n895_97117_c1
2973 nmdc:mga0rr50_112277_c1
2974 nmdc:mga0rr50_12252_c1
2975 nmdc:mga0rr50_1248130_c1
2976 nmdc:mga0rr50_1276208_c1
2977 nmdc:mga0rr50_183789_c1
2978 nmdc:mga0rr50_20140_c1
2979 nmdc:mga0rr50_285396_c1
2980 nmdc:mga0rr50_34139_c1
2981 nmdc:mga0rr50_3718_c1
2982 nmdc:mga08x19_27626_c1
2983 nmdc:mga08x19_422633_c1
2984 nmdc:mga08x19_544298_c1
2985 nmdc:mga08x19_625299_c1
2986 nmdc:mga08x19_75110_c1
2987 nmdc:mga08x19_86074_c1
2988 nmdc:mga0a205_138943_c1
2989 nmdc:mga0a205_280518_c1
2990 nmdc:mga0a205_285389_c1
2991 nmdc:mga0a205_330535_c1
2992 nmdc:mga0a205_45214_c1
2993 nmdc:mga0a205_45839_c1
2994 nmdc:mga0a205_46984_c1
2995 nmdc:mga0a205_62761_c1
2996 nmdc:mga0a205_634646_c1
2997 nmdc:mga0a205_746990_c1
2998 nmdc:mga0a205_930407_c1
2999 nmdc:mga0sz30_309442_c1
3000 Ga0500646_0093184
3001 Ga0500642_0110266
3002 Ga0500652_307375
3003 Ga0501084_0022820
3004 Ga0501084_0025929
3005 Ga0501084_0055908
3006 Ga0501084_0565743
3007 Ga0590071_000136
3008 Ga0590071_012090
3009 Ga0590075_001107
3010 Ga0590077_000296
3011 Ga0501082_0190763
3012 Ga0501082_0921000
3013 Ga0501082_1553737
3014 Ga0530510_0075636
3015 Ga0530510_0631028
3016 Ga0530510_1011795

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03551

PadR

Transcriptional regulator PadR-like family

19

86

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
1xma-assembly1.cif.gz_B-2 structure of a transcriptional regulator from clostridium thermocellum cth-833 0.9325 12 109
3l7w-assembly1.cif.gz_A-2 the crystal structure of smu.1704 from streptococcus mutans ua159 0.9264 15 114
1xma-assembly1.cif.gz_A structure of a transcriptional regulator from clostridium thermocellum cth-833 0.9217 12 109
7wjp-assembly1.cif.gz_A-2 structure of padr-like protein from listeria monocytogenes 0.9206 13 112
3hhh-assembly1.cif.gz_B crystal structure of transcriptional regulator, a member of padr family, from enterococcus faecalis v583 0.9135 10 112
ID Description Score Start End Superfamily
1xmaA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9217 12 109 1.10.10.10
5x11A01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9155 17 95 1.10.10.10
af_O50432_1_88_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9038 19 95 1.10.10.10
3l7wA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8992 15 113 1.10.10.10
af_P71704_1_89_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8985 19 95 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A354GYD0-F1-model_v4 PadR family transcriptional regulator 0.9775 11 113
AF-A0A7G9GCT5-F1-model_v4 Helix-turn-helix transcriptional regulator 0.9767 9 112
AF-A0A831PUK6-F1-model_v4 Transcription regulator PadR N-terminal domain-containing protein 0.9762 12 111
AF-A0A534KDG9-F1-model_v4 PadR family transcriptional regulator 0.9755 15 111
AF-A0A1Q3MNZ4-F1-model_v4 Transcription regulator PadR N-terminal domain-containing protein 0.975 18 115

Map