F494317

General Info

Members Datasets Scaffolds Average Seq Length
1487 753 1065 488

Family's Representative Sequence

Representative Sequence 3300048920|Ga0496117_0000052|Ga0496117_0000052_117844_119517
Length 557
Sequence LTLILRRTKVNNASIPLTNGILCNYEGKNLSCSFTAMHELAGAVSSAERTSSNFDFRRIADCKANSLGGEISMKSVKTAPAEREVFTEEDLGYHKALKPRQIQMIAIGGAIGTGLFLGAGGRLAQAGPALVFVYALCGFFAFLVLRALGELIMHRPSSGSFVSYAREFYGEKMAFFAGWMYXXXXAMTSVADVTAVALYMNFFKHYVPWLAGIDQWVFALTALLVVLAMNMLSVKVFGELEFWFSLIKVLALAIFLVVGVYFVIFGTPIEGHVTGFSIITDNGGFFPNGILPAFVIIQGVVFAYASIELIGTAAGETEDPRKVMPRAIRAVVLRLVVFYVGSVLLFTLLLPYTAYKAGESPFVTFFGSIGVQGADVIMNLVVLTAVLSSLNAGLYSTGRILHSMAVSGSAPAALAKMNKAGVPYGGIAVTAAVTVLGVALNAVVPAAAFEIALNLSALGIICAWAVIVLCQLKLWQLSRRGELARPDFRMFGAPYTGILTLVFLFGVLVLMAFDYPVGSWTIASLLVIIPALVIGWYMLRDRIHRLAGERAGAGASH

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2509276019 Ensifer aridi TW10 Isolate Nodule
3 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
4 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
5 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
6 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
7 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
8 2547132424 Nocardia nova SH22a Isolate Unclassified
9 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
10 2554235227 Arthrobacter sp. PAO19 Isolate Rhizosphere
11 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
12 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
13 2558860280 Kutzneria sp. 744 Isolate Unclassified
14 2558860983 Allorhizobium undicola ATCC 700741 Isolate Rhizoplane
15 2565956761 Rhodococcus qingshengii BKS 20-40 Isolate Rhizosphere
16 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
17 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
18 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
19 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
20 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
21 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
22 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
23 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
24 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
25 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
26 2585427649 Amycolatopsis japonica MG417-CF17, DSM 44213 Isolate Unclassified
27 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
28 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
29 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
30 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
31 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
32 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
33 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
34 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
35 2643221568 Rhizobium sp. Root564 Isolate Unclassified
36 2643221582 Rhizobium sp. Root651 Isolate Unclassified
37 2643221616 Leifsonia sp. Root227 Isolate Unclassified
38 2643221619 Agromyces sp. Root81 Isolate Unclassified
39 2643221647 Streptomyces sp. Root369 Isolate Unclassified
40 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
41 2643221693 Rhizobium sp. Root491 Isolate Unclassified
42 2643221714 Streptomyces sp. Root264 Isolate Unclassified
43 2654587600 Glutamicibacter halophytocola KLBMP5180 Isolate Unclassified
44 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
45 2690315906 Arthrobacter sp. OY3WO11 Isolate Unclassified
46 2718217927 Rhizobium sp. N324 Isolate Nodule
47 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
48 2718218009 Rhizobium sp. N561 Isolate Nodule
49 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
50 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
51 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
52 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
53 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
54 2718218363 Rhizobium sp. N113 Isolate Nodule
55 2718218365 Rhizobium sp. N731 Isolate Nodule
56 2718218366 Rhizobium sp. N621 Isolate Nodule
57 2718218423 Rhizobium sp. N941 Isolate Nodule
58 2721755514 Rhizobium sp. N6212 Isolate Nodule
59 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
60 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
61 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
62 2721755809 Rhizobium sp. N541 Isolate Nodule
63 2721755810 Rhizobium sp. N871 Isolate Nodule
64 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
65 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
66 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
67 2728369276 Kineococcus rhizosphaerae DSM 19711 Isolate Rhizosphere
68 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
69 2728369365 Rhizobium sp. N1341 Isolate Nodule
70 2728369397 Rhizobium sp. N1314 Isolate Nodule
71 2738543004 Pseudomonas sp. GV085 Isolate Unclassified
72 2738543034 Rhodococcus sp. OK269 Isolate Unclassified
73 2739367653 Kocuria sp. OV113 Isolate Unclassified
74 2744054900 Paraburkholderia ginsengiterrae DCY85-1 Isolate Unclassified
75 2744054901 Paraburkholderia ginsengiterrae DCY85 Isolate Unclassified
76 2751185788 Curtobacterium pusillum AA3 Isolate Unclassified
77 2751185800 Brucella pituitosa AA2 Isolate Unclassified
78 2757320536 Microbacterium sp. NFIX05 Isolate Unclassified
79 2758568016 [Ochrobactrum] quorumnocens A44 Isolate Rhizosphere
80 2773857758 Microbacterium chocolatum 1320 Isolate Unclassified
81 2773857759 Microbacterium sp. 1294 Isolate Unclassified
82 2773857762 Nocardioides sp. SAI-095 Isolate Unclassified
83 2773857763 Microbacterium sp. SAI-030 Isolate Unclassified
84 2775506735 Arthrobacter sp. S95 1704 Isolate Unclassified
85 2784132109 Dermacoccus sp. DS28 SAI-028 Isolate Unclassified
86 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
87 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
88 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
89 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
90 2791355256 Rhizobium sp. M10 Isolate Nodule
91 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
92 2791355260 Rhizobium sp. L9 Isolate Nodule
93 2791355261 Rhizobium sp. J15 Isolate Nodule
94 2791355262 Rhizobium sp. M1 Isolate Nodule
95 2791355263 Rhizobium chutanense C5 Isolate Nodule
96 2791355264 Rhizobium sp. S9 Isolate Nodule
97 2791355265 Rhizobium sp. H4 Isolate Nodule
98 2791355267 Rhizobium sp. L18 Isolate Nodule
99 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
100 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
101 2808606357 Arthrobacter sp. SLBN-122 Isolate Unclassified
102 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
103 2808606360 Arthrobacter sp. SLBN-112 Isolate Unclassified
104 2808606366 Arthrobacter sp. SLBN-83 Isolate Unclassified
105 2808606370 Arthrobacter sp. SLBN-100 Isolate Unclassified
106 2808606371 Arthrobacter sp. SLBN-53 Isolate Unclassified
107 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
108 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
109 2808606439 Nocardioides sp. SLBN-172 Isolate Unclassified
110 2808606448 Streptomyces sp. 193411 Isolate Unclassified
111 2808606522 Amycolatopsis sp. BJA-103 Isolate Unclassified
112 2811994871 Arthrobacter sp. SLBN-179 Isolate Unclassified
113 2811994878 Nocardioides sp. SLBN-169 Isolate Unclassified
114 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
115 2816332305 Kocuria rhizophila FDAARGOS_302 Isolate Rhizosphere
116 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
117 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
118 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
119 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
120 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
121 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
122 2838048938 Rhizobium pisi 27/80 Isolate Nodule
123 2838061910 Rhizobium phaseoli L15 Isolate Nodule
124 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
125 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
126 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
127 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
128 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
129 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
130 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
131 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
132 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
133 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
134 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
135 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
136 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
137 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
138 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
139 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
140 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
141 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
142 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
143 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
144 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
145 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
146 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
147 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
148 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
149 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
150 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
151 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
152 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
153 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
154 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
155 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
156 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
157 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
158 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
159 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
160 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
161 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
162 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
163 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
164 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
165 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
166 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
167 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
168 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
169 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
170 2844849076 Arthrobacter cupressi DSM 24664 Isolate Rhizosphere
171 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
172 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
173 2852663356 Microbacterium sp. JAI119 Isolate Rhizosphere
174 2854911287 Brucella lupini LUP21 Isolate Unclassified
175 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
176 2857727296 Kocuria sp. R-72562 Isolate Unclassified
177 2857729791 Plantibacter sp. R-72288 Isolate Unclassified
178 2857740372 Paenarthrobacter sp. R-74611 Isolate Unclassified
179 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
180 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
181 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
182 2862993130 Planctomonas deserti 13S1-3 v2 Isolate Rhizosphere
183 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
184 2866612099 Amycolatopsis suaedae 8-3EHSu Isolate Unclassified
185 2867428634 Streptomyces sp. RP5T Isolate Unclassified
186 2867475112 Streptomyces sp. TM32 Isolate Unclassified
187 2870782633 Pseudonocardia eucalypti DSM 45351 Isolate Unclassified
188 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
189 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
190 2884763398 Leifsonia sp. PS1209 Isolate Stem Tuber
191 2891968417 Nocardioides luteus SAI-037 Isolate Unclassified
192 2893684298 Kocuria palustris DSM 11925 Isolate Rhizosphere
193 2899359706 Amycolatopsis anabasis EGI 650086 Isolate Unclassified
194 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
195 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
196 2904430863 Curtobacterium oceanosedimentum 1519 Isolate Rhizosphere
197 2904497146 Arthrobacter sp. 1276 Isolate Rhizosphere
198 2904509784 Microbacterium sp. 1676 Isolate Rhizosphere
199 2904535858 Rhodococcus erythropolis 2017 Isolate Unclassified
200 2904765812 Rhodococcus fascians 1590 Isolate Rhizosphere
201 2904770941 Rhodococcus fascians 1339 Isolate Rhizosphere
202 2904776348 Paenarthrobacter sp. 1092 Isolate Rhizosphere
203 2905926851 Arthrobacter sedimenti MIC A30 Isolate Rhizosphere
204 2908674828 Curtobacterium sp. 1517 Isolate Rhizosphere
205 2908678064 Microbacterium sp. 1518 Isolate Rhizosphere
206 2908811453 Rhodococcus sp. 1R11 Isolate Unclassified
207 2909074476 Curtobacterium sp. 1310 Isolate Rhizosphere
208 2910809715 Paenarthrobacter sp. CM16 Isolate Unclassified
209 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
210 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
211 2915768154 Amycolatopsis pittospori PIP199 Isolate Unclassified
212 2917736166 Amycolatopsis dendrobii DR6-1 Isolate Unclassified
213 2919034639 Paenarthrobacter nitroguajacolicus 247 Isolate Rhizosphere
214 2919039151 Curtobacterium sp. 260 Isolate Rhizosphere
215 2919051321 Sinomonas atrocyanea 1003 Isolate Rhizosphere
216 2919059106 Arthrobacter sp. 1088 Isolate Rhizosphere
217 2919069694 Microbacterium sp. 1154 Isolate Unclassified
218 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
219 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
220 2919395869 Microbacterium resistens 2980 Isolate Unclassified
221 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
222 2919420072 Rhodococcus fascians 3241 Isolate Rhizosphere
223 2919432681 Rhodococcus sp. 3258 Isolate Rhizosphere
224 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
225 2919538618 Paenarthrobacter nitroguajacolicus 3945 Isolate Unclassified
226 2919713450 Nocardia kruczakiae 4272 Isolate Rhizosphere
227 2920879853 Kocuria salina CV6 Isolate Unclassified
228 2922554459 Rhodococcus sp. 66b Isolate Unclassified
229 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
230 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
231 2928104781 Curtobacterium sp. 1544 Isolate Rhizosphere
232 2928121344 Plantibacter flavus 1756 Isolate Rhizosphere
233 2928500415 Curtobacterium oceanosedimentum 1257 Isolate Rhizosphere
234 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
235 2932426870 Paenarthrobacter sp. 4246 Isolate Rhizosphere
236 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
237 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
238 2933418574 Jeotgalibacillus campisalis 4120 Isolate Rhizosphere
239 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
240 2933599457 Rhizobium phaseoli M3 Isolate Nodule
241 2936381700 Rhizobium chutanense C16 Isolate Unclassified
242 2939647034 Arthrobacter sp. 2762 Isolate Rhizosphere
243 2939674588 Arthrobacter bambusae 3552 Isolate Rhizosphere
244 2945916053 Arthrobacter ulcerisalmonis W1I2 Isolate Rhizosphere
245 2945920336 Pseudarthrobacter siccitolerans W1I3 Isolate Rhizosphere
246 2945941187 Arthrobacter pascens W1I14 Isolate Rhizosphere
247 2945956166 Arthrobacter globiformus W2I3 Isolate Rhizosphere
248 2946024296 Arthrobacter woluwensis W4I2 Isolate Rhizosphere
249 2946037020 Arthrobacter sp. W4I7 Isolate Rhizosphere
250 2946059875 Arthrobacter sp. SLBN-112 Isolate Rhizosphere
251 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
252 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
253 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
254 2953998280 Pseudarthrobacter sp. W1I19 Isolate Rhizosphere
255 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
256 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
257 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
258 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
259 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
260 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
261 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
262 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
263 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
264 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
265 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
266 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
267 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
268 2966921586 Rathayibacter agropyri 617 Isolate Rhizosphere
269 2966924647 Frigoribacterium sp. 2355 Isolate Rhizosphere
270 2974294766 Microbacterium proteolyticum SORGH_AS 209 Isolate Unclassified
271 2974302888 Pseudarthrobacter sp. SORGH_AS 212 Isolate Unclassified
272 2974315732 Rhodococcus sp. SORGH_AS 301 Isolate Unclassified
273 2974324384 Microbacterium sp. SORGH_AS 344 Isolate Unclassified
274 2977228692 Microbacterium sp. SORGH_AS 421 Isolate Unclassified
275 2977236895 Microbacterium testaceum SORGH_AS 426 Isolate Unclassified
276 2977264416 Microbacterium testaceum SORGH_AS 594 Isolate Unclassified
277 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
278 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
279 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
280 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
281 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
282 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
283 2984523437 Rhodococcus sp. SORGH_AS303 Isolate Aerial Root
284 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
285 2984542743 Microbacterium sp. SORGH_AS454 Isolate Aerial Root
286 2984551494 Curtobacterium sp. SORGH_AS776 Isolate Aerial Root
287 2984576629 Nocardioides zeae SORGH_AS913 Isolate Aerial Root
288 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
289 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
290 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
291 2990256926 Nocardioides zeae SORGH_AS885 Isolate Aerial Root
292 2995463766 Streptacidiphilus fuscans NEAU-YB345 Isolate Unclassified
293 2995726249 Leucobacter zeae CC-MF41 Isolate Rhizosphere
294 2996887358 Rhizobium sp. R711 Isolate Nodule
295 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
296 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
297 3002998708 Actinomadura barringtoniae GKU 128 Isolate Unclassified
298 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
299 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
300 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
301 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
302 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
303 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
304 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
305 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
306 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
307 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
308 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
309 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
310 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
311 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
312 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
313 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
314 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
315 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
316 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
317 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
318 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
319 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
320 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
321 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
322 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
323 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
324 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
325 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
326 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
327 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
328 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
329 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
330 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
331 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
332 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
333 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
334 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
335 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
336 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
337 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
338 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
339 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
340 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
341 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
342 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
343 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
344 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
345 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
346 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
347 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
348 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
349 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
350 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
351 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
352 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
353 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
354 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
355 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
356 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
357 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
358 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
359 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
360 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
361 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
362 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
363 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
364 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
365 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
366 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
367 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
368 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
369 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
370 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
371 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
372 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
373 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
374 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
375 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
376 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
377 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
378 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
379 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
380 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
381 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
382 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
383 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
384 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
385 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
386 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
387 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
388 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
389 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
390 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
391 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
392 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
393 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
394 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
395 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
396 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
397 3300015679 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.4_F08 Metagenome Unclassified
398 3300015680 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.2_H03 Metagenome Rhizosphere
399 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
400 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
401 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
402 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
403 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
404 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
405 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
406 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
407 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
408 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
409 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
410 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
411 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
412 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
413 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
414 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
415 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
416 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
417 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
418 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
419 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
420 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
421 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
422 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
423 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
424 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
425 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
426 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
427 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
428 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
429 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
430 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
431 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
432 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
433 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
434 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
435 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
436 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
437 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
438 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
439 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
440 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
441 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
442 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
443 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
444 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
445 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
446 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
447 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
448 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
449 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
450 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
451 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
452 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
453 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
454 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
455 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
456 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
457 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
458 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
459 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
460 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
461 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
462 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
463 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
464 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
465 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
466 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
467 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
468 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
469 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
470 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
471 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
472 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
473 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
474 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
475 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
476 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
477 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
478 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
479 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
480 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
481 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
482 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
483 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
484 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
485 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
486 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
487 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
488 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
489 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
490 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
491 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
492 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
493 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
494 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
495 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
496 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
497 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
498 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
499 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
500 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
501 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
502 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
503 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
504 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
505 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
506 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
507 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
508 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
509 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
510 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
511 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
512 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
513 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
514 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
515 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
516 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
517 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
518 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
519 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
520 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
521 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
522 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
523 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
524 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
525 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
526 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
527 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
528 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
529 3300044669 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2E Metagenome Unclassified
530 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
531 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
532 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
533 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
534 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
535 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
536 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
537 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
538 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
539 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
540 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
541 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
542 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
543 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
544 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
545 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
546 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
547 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
548 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
549 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
550 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
551 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
552 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
553 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
554 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
555 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
556 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
557 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
558 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
559 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
560 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
561 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
562 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
563 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
564 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
565 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
566 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
567 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
568 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
569 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
570 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
571 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
572 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
573 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
574 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
575 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
576 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
577 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
578 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
579 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
580 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
581 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
582 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
583 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
584 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
585 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
586 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
587 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
588 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
589 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
590 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
591 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
592 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
593 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
594 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
595 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
596 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
597 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
598 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
599 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
600 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
601 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
602 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
603 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
604 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
605 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
606 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
607 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
608 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
609 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
610 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
611 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
612 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
613 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
614 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
615 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
616 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
617 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
618 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
619 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
620 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
621 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
622 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
623 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
624 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
625 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
626 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
627 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
628 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
629 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
630 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
631 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
632 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
633 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
634 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
635 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
636 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
637 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
638 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
639 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
640 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
641 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
642 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
643 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
644 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
645 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
646 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
647 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
648 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
649 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
650 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
651 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
652 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
653 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
654 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
655 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
656 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
657 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
658 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
659 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
660 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
661 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
662 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
663 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
664 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
665 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
666 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
667 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
668 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
669 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
670 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
671 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
672 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
673 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
674 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
675 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
676 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
677 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
678 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
679 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
680 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
681 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
682 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
683 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
684 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
685 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
686 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
687 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
688 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
689 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
690 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
691 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
692 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
693 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
694 3300059514 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 106R_AW_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
695 3300059604 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
696 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
697 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
698 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
699 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
700 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
701 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
702 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
703 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
704 3300059660 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 161R_SW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
705 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
706 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
707 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
708 8003314358 Amycolatopsis sp. MtRt-6 Isolate Unclassified
709 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
710 8004021418 Arthrobacter sp. SDTb3-6 Isolate Rhizosphere
711 8004025490 Arthrobacter wenxiniae AETb3-4 Isolate Rhizosphere
712 8004182704 Microbacterium paraoxydans ku-mp Isolate Unclassified
713 8005275841 Rhizobium sp. N4311 Isolate Nodule
714 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
715 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
716 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
717 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
718 8005321885 Rhizobium sp. R72 Isolate Nodule
719 8005382845 Rhizobium sp. R634 Isolate Nodule
720 8005395548 Rhizobium sp. R339 Isolate Nodule
721 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
722 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
723 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
724 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
725 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
726 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
727 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
728 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
729 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
730 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
731 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
732 8016254467 Microbacterium sp. SLBN-111 (version 3) Isolate Rhizosphere
733 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
734 8018176218 Rhizobium sp. N122 Isolate Nodule
735 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
736 8024501048 Rhizobium sp. H4 Isolate Nodule
737 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
738 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
739 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
740 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
741 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
742 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
743 8054107350 Arthrobacter rhizosphaerae CCNWLXL 1-35 Isolate Rhizosphere
744 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere
745 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
746 8054929484 Pseudomonas vlassakiae RW4S1 Isolate Rhizosphere
747 8056037122 Herbiconiux gentiana CPCC 205716 Isolate Rhizosphere
748 8056207758 Saccharopolyspora indica KCTC 29208 Isolate Rhizosphere
749 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
750 8056382006 Rhizobium croatiense 13T Isolate Nodule
751 8056447290 Streptomyces huiliensis SCA2-4 Isolate Rhizosphere
752 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere
753 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 69.27
Metatranscriptomes 2.35
Isolates 28.38

Biome Distribution

Category Percentage (%)
Aerial Root 0.67
Bulb 0
Endosphere 7.67
Nodule 8.81
Rhizoplane 4.91
Rhizosphere 57.63
Stem 0
Stem Tuber 0.07
Unclassified 20.24

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1535382 2162886007 Bacteria 14715
2 JGI24746J21847_1001213 3300001977 Bacteria 4089
3 JGI24740J21852_10003572 3300001979 Bacteria 6793
4 JGI24739J22299_10007640 3300001989 Bacteria 4045
5 JGI24737J22298_10018569 3300001990 Bacteria 2230
6 JGI24744J21845_10001770 3300002077 Bacteria 4333
7 JGI25155J39150_1000015 3300002704 Bacteria 178839
8 JGI25156J39149_1000007 3300002705 Bacteria 252108
9 JGI25162J39368_1000439 3300002737 Bacteria 33448
10 JGI25162J39368_1001972 3300002737 Bacteria 9209
11 JGI25154J39366_1000051 3300002738 Bacteria 123608
12 JGI25157J39369_1000012 3300002741 Bacteria 205167
13 JGI25164J39214_1000743 3300002772 Bacteria 12143
14 JGI25152J39213_1000175 3300002773 Bacteria 43464
15 JGI25152J39213_1000585 3300002773 Bacteria 19724
16 JGI25152J39213_1001657 3300002773 Bacteria 9267
17 JGI25165J46597_1000567 3300003214 Bacteria 33448
18 rootH2_10021729 3300003320 Bacteria 13211
19 rootL2_10000515 3300003322 Bacteria 3383
20 rootL2_10069804 3300003322 Bacteria 5006
21 rootH1_10020478 3300003323 Bacteria 4810
22 rootH1_10045263 3300003323 Bacteria 4036
23 rootH1_10072379 3300003323 Bacteria 9570
24 JGI25160J50197_1015702 3300003354 Bacteria 2475
25 Ga0055539_1000019 3300003752 Bacteria 341727
26 Ga0055533_1000023 3300003756 Bacteria 341727
27 Ga0055532_1000750 3300003758 Bacteria 11701
28 Ga0055525_1000088 3300003759 Bacteria 143732
29 Ga0055527_1000003 3300003760 Bacteria 705001
30 Ga0055527_1000025 3300003760 Bacteria 195817
31 Ga0055542_1000005 3300003762 Bacteria 550280
32 Ga0055542_1000048 3300003762 Bacteria 195800
33 Ga0055542_1002667 3300003762 Bacteria 5533
34 Ga0055529_1000006 3300003763 Bacteria 416978
35 Ga0055529_1000057 3300003763 Bacteria 195807
36 Ga0055526_1005838 3300003771 Bacteria 6915
37 Ga0055528_1000140 3300003790 Bacteria 58329
38 Ga0055540_1000102 3300003792 Bacteria 95294
39 Ga0055540_1000326 3300003792 Bacteria 41728
40 Ga0055541_1002437 3300003841 Bacteria 3721
41 Ga0058692_1000303 3300003856 Bacteria 24919
42 Ga0058692_1000351 3300003856 Bacteria 22439
43 Ga0058692_1000379 3300003856 Bacteria 21285
44 Ga0058692_1000438 3300003856 Bacteria 18964
45 Ga0058692_1000804 3300003856 Bacteria 12559
46 Ga0058692_1006585 3300003856 Bacteria 3167
47 Ga0058692_1009657 3300003856 Bacteria 2420
48 Ga0065714_10004525 3300005288 Bacteria 6178
49 Ga0065714_10019635 3300005288 Bacteria 2223
50 Ga0065704_10000345 3300005289 Bacteria 36048
51 Ga0065704_10001325 3300005289 Bacteria 9736
52 Ga0065704_10007120 3300005289 Bacteria 4728
53 Ga0065704_10009879 3300005289 Bacteria 2065
54 Ga0065704_10070742 3300005289 Bacteria 16815
55 Ga0070658_10155017 3300005327 Bacteria 1920
56 Ga0070676_10001857 3300005328 Bacteria 10758
57 Ga0070676_10067664 3300005328 Bacteria 2136
58 Ga0070670_100049013 3300005331 Bacteria 3634
59 Ga0070670_100056374 3300005331 Bacteria 3372
60 Ga0070670_100145467 3300005331 Bacteria 2050
61 Ga0070677_10005553 3300005333 Bacteria 4159
62 Ga0068869_100013259 3300005334 Bacteria 5477
63 Ga0068868_100011001 3300005338 Bacteria 6574
64 Ga0068868_100059380 3300005338 Bacteria 3025
65 Ga0070668_100011436 3300005347 Bacteria 6608
66 Ga0070668_100018267 3300005347 Bacteria 5262
67 Ga0070669_100010732 3300005353 Bacteria 6500
68 Ga0070669_100136719 3300005353 Bacteria 1886
69 Ga0070675_100012523 3300005354 Bacteria 6649
70 Ga0070675_100014679 3300005354 Bacteria 6178
71 Ga0070671_100047239 3300005355 Bacteria 3580
72 Ga0070671_100050040 3300005355 Bacteria 3476
73 Ga0070673_100105265 3300005364 Bacteria 2330
74 Ga0070688_100037254 3300005365 Bacteria 2963
75 Ga0070667_100161053 3300005367 Bacteria 1976
76 Ga0070709_10071272 3300005434 Bacteria 2243
77 Ga0070711_100016174 3300005439 Bacteria 4733
78 Ga0070663_100001810 3300005455 Bacteria 11890
79 Ga0070684_100078614 3300005535 Bacteria 2915
80 Ga0068853_100099784 3300005539 Bacteria 2565
81 Ga0068853_100117519 3300005539 Bacteria 2368
82 Ga0070665_100000998 3300005548 Bacteria 35866
83 Ga0070665_100074247 3300005548 Bacteria 3406
84 Ga0070664_100267319 3300005564 Bacteria 1540
85 Ga0068857_100007212 3300005577 Bacteria 9573
86 Ga0068856_100011072 3300005614 Bacteria 8757
87 Ga0068856_100064802 3300005614 Bacteria 3611
88 Ga0068852_100053124 3300005616 Bacteria 3486
89 Ga0068851_10053424 3300005834 Bacteria 2057
90 Ga0068858_100020381 3300005842 Bacteria 6201
91 Ga0068862_100044649 3300005844 Bacteria 3780
92 Ga0075368_10002512 3300006042 Bacteria 6002
93 Ga0075368_10002845 3300006042 Bacteria 5712
94 Ga0075368_10032139 3300006042 Bacteria 2037
95 Ga0075363_100000269 3300006048 Bacteria 14977
96 Ga0075364_10000193 3300006051 Bacteria 28203
97 Ga0075364_10002110 3300006051 Bacteria 11106
98 Ga0075364_10005201 3300006051 Bacteria 7550
99 Ga0075364_10016852 3300006051 Bacteria 4551
100 Ga0075364_10040851 3300006051 Bacteria 3009
101 Ga0075364_10041471 3300006051 Bacteria 2988
102 Ga0075364_10042550 3300006051 Bacteria 2951
103 Ga0075364_10045544 3300006051 Bacteria 2855
104 Ga0075432_10005837 3300006058 Bacteria 4189
105 Ga0075362_10001446 3300006177 Bacteria 7595
106 Ga0075362_10028876 3300006177 Bacteria 2386
107 Ga0075367_10000224 3300006178 Bacteria 18937
108 Ga0075369_10010268 3300006186 Bacteria 3659
109 Ga0075369_10020540 3300006186 Bacteria 2705
110 Ga0075369_10020933 3300006186 Bacteria 2682
111 Ga0075369_10031488 3300006186 Bacteria 2240
112 Ga0075366_10057282 3300006195 Bacteria 2316
113 Ga0097621_100135245 3300006237 Bacteria 2102
114 Ga0075370_10019191 3300006353 Bacteria 3721
115 Ga0075370_10077717 3300006353 Bacteria 1905
116 Ga0075430_100146584 3300006846 Bacteria 1966
117 Ga0079104_1000021 3300006946 Bacteria 247219
118 Ga0079104_1000109 3300006946 Bacteria 122060
119 Ga0079104_1000480 3300006946 Bacteria 44433
120 Ga0079104_1001200 3300006946 Bacteria 18428
121 Ga0079104_1004059 3300006946 Bacteria 6451
122 Ga0099826_10000059 3300006948 Bacteria 63493
123 Ga0099826_10033794 3300006948 Bacteria 3665
124 Ga0105251_10000042 3300009011 Bacteria 114031
125 Ga0105251_10000479 3300009011 Bacteria 37816
126 Ga0105251_10000566 3300009011 Bacteria 34679
127 Ga0105251_10000699 3300009011 Bacteria 30975
128 Ga0105251_10001786 3300009011 Bacteria 17879
129 Ga0105251_10002777 3300009011 Bacteria 13317
130 Ga0105251_10003838 3300009011 Bacteria 10709
131 Ga0105251_10013897 3300009011 Bacteria 4478
132 Ga0105251_10015859 3300009011 Bacteria 4099
133 Ga0105244_10000034 3300009036 Bacteria 168462
134 Ga0105244_10000327 3300009036 Bacteria 45346
135 Ga0105244_10001835 3300009036 Bacteria 16611
136 Ga0105244_10005219 3300009036 Bacteria 8686
137 Ga0105244_10013325 3300009036 Bacteria 4813
138 Ga0105244_10021407 3300009036 Bacteria 3576
139 Ga0105244_10022622 3300009036 Bacteria 3458
140 Ga0105244_10031860 3300009036 Bacteria 2796
141 Ga0105244_10071928 3300009036 Bacteria 1723
142 Ga0105250_10000002 3300009092 Bacteria 566949
143 Ga0105250_10000009 3300009092 Bacteria 330307
144 Ga0105250_10000234 3300009092 Bacteria 46425
145 Ga0105250_10005807 3300009092 Bacteria 5488
146 Ga0105250_10011665 3300009092 Bacteria 3643
147 Ga0105240_10000012 3300009093 Bacteria 496639
148 Ga0105245_10087458 3300009098 Bacteria 2860
149 Ga0105245_10196241 3300009098 Bacteria 1936
150 Ga0105247_10000018 3300009101 Bacteria 259335
151 Ga0105243_10001837 3300009148 Bacteria 18156
152 Ga0105243_10027938 3300009148 Bacteria 4328
153 Ga0105243_10046858 3300009148 Bacteria 3402
154 Ga0105243_10167044 3300009148 Bacteria 1902
155 Ga0105241_10000004 3300009174 Bacteria 803007
156 Ga0105248_10163942 3300009177 Bacteria 2506
157 Ga0105237_10006031 3300009545 Bacteria 13563
158 Ga0105237_10034447 3300009545 Bacteria 5127
159 Ga0105237_10088813 3300009545 Bacteria 3080
160 Ga0105237_10178038 3300009545 Bacteria 2127
161 Ga0105238_10075987 3300009551 Bacteria 3351
162 Ga0123342_1016048 3300009766 Bacteria 6619
163 Ga0105239_10076423 3300010375 Bacteria 3683
164 Ga0105239_10262732 3300010375 Bacteria 1940
165 Ga0105246_10000078 3300011119 Bacteria 41051
166 Ga0105246_10001187 3300011119 Bacteria 15161
167 Ga0105246_10004731 3300011119 Bacteria 8291
168 Ga0105246_10005032 3300011119 Bacteria 8040
169 Ga0105246_10031207 3300011119 Bacteria 3525
170 Ga0105246_10048375 3300011119 Bacteria 2907
171 Ga0105246_10077956 3300011119 Bacteria 2352
172 Ga0105246_10078707 3300011119 Bacteria 2342
173 Ga0157373_10000788 3300013100 Bacteria 24425
174 Ga0157373_10005732 3300013100 Bacteria 9305
175 Ga0157373_10006320 3300013100 Bacteria 8849
176 Ga0157373_10023542 3300013100 Bacteria 4463
177 Ga0157373_10091825 3300013100 Bacteria 2138
178 Ga0157371_10000002 3300013102 Bacteria 665040
179 Ga0157371_10002433 3300013102 Bacteria 17752
180 Ga0157371_10003636 3300013102 Bacteria 13884
181 Ga0157371_10007791 3300013102 Bacteria 8605
182 Ga0157371_10016879 3300013102 Bacteria 5437
183 Ga0157371_10115652 3300013102 Bacteria 1905
184 Ga0157371_10137366 3300013102 Bacteria 1741
185 Ga0157370_10000053 3300013104 Bacteria 119285
186 Ga0157370_10000078 3300013104 Bacteria 107381
187 Ga0157370_10000325 3300013104 Bacteria 59719
188 Ga0157370_10001455 3300013104 Bacteria 29311
189 Ga0157370_10002083 3300013104 Bacteria 24489
190 Ga0157369_10088708 3300013105 Bacteria 3302
191 Ga0157369_10119698 3300013105 Bacteria 2794
192 Ga0157374_10014658 3300013296 Bacteria 6861
193 Ga0163162_10007543 3300013306 Bacteria 10594
194 Ga0163162_10037249 3300013306 Bacteria 4852
195 Ga0163162_10055425 3300013306 Bacteria 3991
196 Ga0163162_10084787 3300013306 Bacteria 3245
197 Ga0157372_10020599 3300013307 Bacteria 7118
198 Ga0157372_10024667 3300013307 Bacteria 6535
199 Ga0157372_10028908 3300013307 Bacteria 6049
200 Ga0157372_10045725 3300013307 Bacteria 4858
201 Ga0157372_10173238 3300013307 Bacteria 2497
202 Ga0157372_10174033 3300013307 Bacteria 2491
203 Ga0157372_10261885 3300013307 Bacteria 2008
204 Ga0157375_10002937 3300013308 Bacteria 14781
205 Ga0157375_10107278 3300013308 Bacteria 2886
206 Ga0182008_10002953 3300014497 Bacteria 10462
207 Ga0182008_10011140 3300014497 Bacteria 4796
208 Ga0182006_1000144 3300015261 Bacteria 75603
209 Ga0182006_1007205 3300015261 Bacteria 5107
210 Ga0182007_10000467 3300015262 Bacteria 24434
211 Ga0182007_10000552 3300015262 Bacteria 22108
212 Ga0183366_1001 3300015679 Bacteria 2743932
213 Ga0183370_1001 3300015680 Bacteria 2743932
214 Ga0183369_1001 3300015685 Bacteria 2743932
215 Ga0183368_1001 3300015687 Bacteria 2743932
216 Ga0183367_1001 3300015688 Bacteria 1225545
217 Ga0183367_1003 3300015688 Bacteria 814276
218 Ga0163161_10002528 3300017792 Bacteria 13049
219 Ga0163161_10005068 3300017792 Bacteria 9167
220 Ga0163161_10072746 3300017792 Bacteria 2518
221 Ga0206355_1600119 3300020076 Bacteria 1914
222 Ga0214543_1003948 3300021327 Bacteria 28458
223 Ga0209435_100006 3300025206 Bacteria 542459
224 Ga0209566_100031 3300025225 Bacteria 341555
225 Ga0209674_100001 3300025226 Bacteria 4013750
226 Ga0209672_100003 3300025228 Bacteria 1560476
227 Ga0209672_100011 3300025228 Bacteria 856297
228 Ga0209672_105034 3300025228 Bacteria 2335
229 Ga0209147_100429 3300025229 Bacteria 27291
230 Ga0209147_101101 3300025229 Bacteria 11262
231 Ga0209563_100001 3300025230 Bacteria 4013775
232 Ga0209563_100155 3300025230 Bacteria 64311
233 Ga0207427_100028 3300025231 Bacteria 388949
234 Ga0209437_100115 3300025233 Bacteria 209911
235 Ga0209437_100454 3300025233 Bacteria 33437
236 Ga0209437_101468 3300025233 Bacteria 5696
237 Ga0209258_101738 3300025242 Bacteria 6753
238 Ga0207425_1005693 3300025245 Bacteria 3514
239 Ga0209646_1000015 3300025246 Bacteria 542459
240 Ga0209026_1000046 3300025250 Bacteria 262031
241 Ga0209677_100001 3300025253 Bacteria 4013787
242 Ga0209677_100158 3300025253 Bacteria 61587
243 Ga0209677_102523 3300025253 Bacteria 6812
244 Ga0209148_1000004 3300025254 Bacteria 1844481
245 Ga0209148_1000023 3300025254 Bacteria 680511
246 Ga0209148_1003076 3300025254 Bacteria 4902
247 Ga0209759_1000005 3300025256 Bacteria 542459
248 Ga0209129_1000130 3300025258 Bacteria 128065
249 Ga0209129_1000180 3300025258 Bacteria 90882
250 Ga0209129_1000220 3300025258 Bacteria 65268
251 Ga0209233_1000001 3300025261 Bacteria 2992747
252 Ga0209233_1000161 3300025261 Bacteria 158607
253 Ga0209233_1000230 3300025261 Bacteria 97941
254 Ga0209455_1000023 3300025272 Bacteria 680449
255 Ga0209455_1000046 3300025272 Bacteria 382681
256 Ga0209673_1000023 3300025273 Bacteria 411385
257 Ga0209673_1001357 3300025273 Bacteria 24320
258 Ga0209676_1000292 3300025292 Bacteria 101778
259 Ga0209025_1000255 3300025294 Bacteria 125764
260 Ga0209025_1000364 3300025294 Bacteria 96280
261 Ga0209025_1000586 3300025294 Bacteria 65856
262 Ga0209025_1001712 3300025294 Bacteria 26677
263 Ga0209564_1000100 3300025295 Bacteria 224016
264 Ga0209758_1003466 3300025297 Bacteria 14304
265 Ga0209256_1000221 3300025299 Bacteria 105907
266 Ga0207426_1000393 3300025302 Bacteria 74583
267 Ga0207426_1007262 3300025302 Bacteria 4665
268 Ga0209051_1000062 3300025303 Bacteria 251081
269 Ga0209051_1008810 3300025303 Bacteria 5288
270 Ga0209257_1001421 3300025304 Bacteria 28513
271 Ga0207697_10002976 3300025315 Bacteria 8551
272 Ga0207697_10010229 3300025315 Bacteria 4018
273 Ga0207697_10046927 3300025315 Bacteria 1780
274 Ga0207696_1000005 3300025711 Bacteria 642078
275 Ga0207696_1000021 3300025711 Bacteria 432606
276 Ga0207696_1000035 3300025711 Bacteria 339626
277 Ga0207696_1000088 3300025711 Bacteria 190313
278 Ga0207696_1000348 3300025711 Bacteria 47596
279 Ga0207696_1011651 3300025711 Bacteria 3153
280 Ga0207655_1000001 3300025728 Bacteria 1866413
281 Ga0207655_1000002 3300025728 Bacteria 1148694
282 Ga0207655_1000007 3300025728 Bacteria 773492
283 Ga0207655_1000046 3300025728 Bacteria 309474
284 Ga0207655_1001213 3300025728 Bacteria 24820
285 Ga0207655_1005093 3300025728 Bacteria 9083
286 Ga0207655_1005663 3300025728 Bacteria 8446
287 Ga0207655_1008878 3300025728 Bacteria 6316
288 Ga0207655_1015592 3300025728 Bacteria 4211
289 Ga0207655_1017637 3300025728 Bacteria 3839
290 Ga0207655_1030668 3300025728 Bacteria 2496
291 Ga0207655_1043696 3300025728 Bacteria 1891
292 Ga0207655_1050379 3300025728 Bacteria 1693
293 Ga0207713_1000001 3300025735 Bacteria 2295391
294 Ga0207713_1000002 3300025735 Bacteria 1061749
295 Ga0207713_1000003 3300025735 Bacteria 860698
296 Ga0207713_1000004 3300025735 Bacteria 702781
297 Ga0207713_1000026 3300025735 Bacteria 319032
298 Ga0207713_1010458 3300025735 Bacteria 5131
299 Ga0207713_1025983 3300025735 Bacteria 2692
300 Ga0207682_10000870 3300025893 Bacteria 14001
301 Ga0207682_10005202 3300025893 Bacteria 5325
302 Ga0207692_10051627 3300025898 Bacteria 2085
303 Ga0207710_10000049 3300025900 Bacteria 186492
304 Ga0207688_10003506 3300025901 Bacteria 8561
305 Ga0207688_10018592 3300025901 Bacteria 3780
306 Ga0207688_10027609 3300025901 Bacteria 3122
307 Ga0207647_10032327 3300025904 Bacteria 3363
308 Ga0207645_10001051 3300025907 Bacteria 22851
309 Ga0207645_10005766 3300025907 Bacteria 8932
310 Ga0207643_10012143 3300025908 Bacteria 4654
311 Ga0207654_10000006 3300025911 Bacteria 815027
312 Ga0207695_10000097 3300025913 Bacteria 262517
313 Ga0207671_10000023 3300025914 Bacteria 274756
314 Ga0207693_10031842 3300025915 Bacteria 4166
315 Ga0207650_10005626 3300025925 Bacteria 8560
316 Ga0207650_10037411 3300025925 Bacteria 3536
317 Ga0207659_10007512 3300025926 Bacteria 6708
318 Ga0207659_10050333 3300025926 Bacteria 2959
319 Ga0207687_10033779 3300025927 Bacteria 3471
320 Ga0207687_10135981 3300025927 Bacteria 1859
321 Ga0207706_10034324 3300025933 Bacteria 4514
322 Ga0207706_10060675 3300025933 Bacteria 3331
323 Ga0207709_10008572 3300025935 Bacteria 5650
324 Ga0207709_10011422 3300025935 Bacteria 4899
325 Ga0207709_10045900 3300025935 Bacteria 2649
326 Ga0207709_10084128 3300025935 Bacteria 2059
327 Ga0207669_10013591 3300025937 Bacteria 4050
328 Ga0207691_10012886 3300025940 Bacteria 8005
329 Ga0207691_10014615 3300025940 Bacteria 7483
330 Ga0207711_10095012 3300025941 Bacteria 2628
331 Ga0207668_10036135 3300025972 Bacteria 3295
332 Ga0207640_10063834 3300025981 Bacteria 2449
333 Ga0207677_10168114 3300026023 Bacteria 1711
334 Ga0207678_10001242 3300026067 Bacteria 23516
335 Ga0207678_10012287 3300026067 Bacteria 7519
336 Ga0207678_10048587 3300026067 Bacteria 3667
337 Ga0207708_10024834 3300026075 Bacteria 4535
338 Ga0207702_10036199 3300026078 Bacteria 4128
339 Ga0207702_10150633 3300026078 Bacteria 2115
340 Ga0207648_10012323 3300026089 Bacteria 8004
341 Ga0207674_10011834 3300026116 Bacteria 9782
342 Ga0207674_10067560 3300026116 Bacteria 3599
343 Ga0207675_100006342 3300026118 Bacteria 11212
344 Ga0207683_10006658 3300026121 Bacteria 9883
345 Ga0207683_10017060 3300026121 Bacteria 6179
346 Ga0207683_10202364 3300026121 Bacteria 1805
347 Ga0209281_1000001 3300027111 Bacteria 1933496
348 Ga0209281_1000004 3300027111 Bacteria 1253949
349 Ga0209281_1000006 3300027111 Bacteria 1170244
350 Ga0209281_1000008 3300027111 Bacteria 867470
351 Ga0209281_1000024 3300027111 Bacteria 499062
352 Ga0209281_1001417 3300027111 Bacteria 14302
353 Ga0209371_1000001 3300027312 Bacteria 2771503
354 Ga0209371_1000003 3300027312 Bacteria 1122971
355 Ga0209371_1000084 3300027312 Bacteria 180842
356 Ga0209371_1000190 3300027312 Bacteria 89981
357 Ga0209371_1000407 3300027312 Bacteria 44809
358 Ga0209371_1000480 3300027312 Bacteria 38919
359 Ga0209371_1001270 3300027312 Bacteria 17864
360 Ga0209371_1001339 3300027312 Bacteria 17098
361 Ga0209371_1001386 3300027312 Bacteria 16650
362 Ga0209371_1001534 3300027312 Bacteria 15290
363 Ga0209371_1002297 3300027312 Bacteria 10912
364 Ga0209371_1002802 3300027312 Bacteria 9281
365 Ga0209371_1003647 3300027312 Bacteria 7319
366 Ga0209371_1005377 3300027312 Bacteria 5109
367 Ga0209282_1000502 3300027666 Bacteria 19013
368 Ga0207428_10010431 3300027907 Bacteria 8299
369 Ga0268266_10002032 3300028379 Bacteria 22465
370 Ga0268266_10015356 3300028379 Bacteria 6571
371 Ga0268266_10091692 3300028379 Bacteria 2665
372 Ga0307517_10004520 3300028786 Bacteria 21344
373 Ga0307515_10000995 3300028794 Bacteria 64758
374 Ga0268256_1000001 3300030500 Bacteria 2771065
375 Ga0268256_1000004 3300030500 Bacteria 1122967
376 Ga0268256_1000069 3300030500 Bacteria 195391
377 Ga0268256_1000075 3300030500 Bacteria 180814
378 Ga0268256_1000264 3300030500 Bacteria 55541
379 Ga0268256_1001091 3300030500 Bacteria 17823
380 Ga0268256_1001426 3300030500 Bacteria 14431
381 Ga0268256_1001782 3300030500 Bacteria 12149
382 Ga0268256_1002333 3300030500 Bacteria 9788
383 Ga0268256_1004200 3300030500 Bacteria 6078
384 Ga0268256_1005052 3300030500 Bacteria 5282
385 Ga0268256_1014568 3300030500 Bacteria 2326
386 Ga0307511_10001289 3300030521 Bacteria 26561
387 Ga0307511_10003267 3300030521 Bacteria 16663
388 Ga0307511_10005918 3300030521 Bacteria 12364
389 Ga0307511_10045093 3300030521 Bacteria 3650
390 Ga0307512_10007852 3300030522 Bacteria 10495
391 Ga0307512_10021735 3300030522 Bacteria 5780
392 Ga0307512_10043303 3300030522 Bacteria 3714
393 Ga0316181_1263973 3300030744 Bacteria 2951
394 Ga0307513_10038677 3300031456 Bacteria 5296
395 Ga0307509_10019038 3300031507 Bacteria 7853
396 Ga0307509_10032432 3300031507 Bacteria 5756
397 Ga0307408_100005443 3300031548 Bacteria 8523
398 Ga0307408_100027030 3300031548 Bacteria 3951
399 Ga0307408_100085182 3300031548 Bacteria 2372
400 Ga0307408_100091679 3300031548 Bacteria 2295
401 Ga0307408_100129088 3300031548 Bacteria 1970
402 Ga0307508_10032150 3300031616 Bacteria 4741
403 Ga0307508_10038578 3300031616 Bacteria 4292
404 Ga0307508_10069406 3300031616 Bacteria 3095
405 Ga0307514_10001738 3300031649 Bacteria 24956
406 Ga0307514_10005218 3300031649 Bacteria 11704
407 Ga0307514_10015485 3300031649 Bacteria 6289
408 Ga0307516_10004980 3300031730 Bacteria 16136
409 Ga0307516_10020950 3300031730 Bacteria 6746
410 Ga0307516_10063495 3300031730 Bacteria 3575
411 Ga0307405_10061240 3300031731 Bacteria 2378
412 Ga0307405_10068937 3300031731 Bacteria 2265
413 Ga0307413_10017362 3300031824 Bacteria 3744
414 Ga0307518_10000206 3300031838 Bacteria 44689
415 Ga0307518_10000779 3300031838 Bacteria 23884
416 Ga0307518_10152854 3300031838 Bacteria 1594
417 Ga0307410_10002024 3300031852 Bacteria 9560
418 Ga0307410_10106503 3300031852 Bacteria 2020
419 Ga0307407_10028674 3300031903 Bacteria 2979
420 Ga0307407_10063097 3300031903 Bacteria 2172
421 Ga0307412_10003191 3300031911 Bacteria 9107
422 Ga0307412_10126774 3300031911 Bacteria 1847
423 Ga0307409_100068576 3300031995 Bacteria 2806
424 Ga0307409_100100232 3300031995 Bacteria 2400
425 Ga0307409_100256776 3300031995 Bacteria 1601
426 Ga0307416_100016188 3300032002 Bacteria 5174
427 Ga0307416_100050099 3300032002 Bacteria 3326
428 Ga0307415_100060700 3300032126 Bacteria 2614
429 Ga0307510_10010903 3300033180 Bacteria 10802
430 Ga0395899_0007976 3300037312 Bacteria 8157
431 Ga0395899_0010636 3300037312 Bacteria 7052
432 Ga0395899_0012838 3300037312 Bacteria 6416
433 Ga0395899_0020962 3300037312 Bacteria 4957
434 Ga0395900_0017366 3300037418 Bacteria 7345
435 Ga0395900_0022364 3300037418 Bacteria 6467
436 Ga0395900_0029516 3300037418 Bacteria 5625
437 Ga0395900_0032077 3300037418 Bacteria 5401
438 Ga0395900_0056878 3300037418 Bacteria 4026
439 Ga0395900_0142728 3300037418 Bacteria 2451
440 Ga0395900_0145962 3300037418 Bacteria 2419
441 Ga0395900_0216316 3300037418 Bacteria 1933
442 Ga0395898_0000100 3300037466 Bacteria 226446
443 Ga0395898_0000194 3300037466 Bacteria 155846
444 Ga0395898_0006197 3300037466 Bacteria 12815
445 Ga0395898_0006965 3300037466 Bacteria 12018
446 Ga0395898_0007917 3300037466 Bacteria 11274
447 Ga0395898_0008104 3300037466 Bacteria 11121
448 Ga0395898_0048647 3300037466 Bacteria 4157
449 Ga0395898_0065633 3300037466 Bacteria 3519
450 Ga0395905_0261676 3300037471 Bacteria 1615
451 Ga0436364_0423804 3300037853 Bacteria 2743
452 Ga0436364_0650390 3300037853 Bacteria 2006
453 Ga0395901_0000801 3300038443 Bacteria 34929
454 Ga0395901_0003822 3300038443 Bacteria 15180
455 Ga0395901_0010327 3300038443 Bacteria 9457
456 Ga0395901_0015381 3300038443 Bacteria 7789
457 Ga0395901_0021736 3300038443 Bacteria 6574
458 Ga0395901_0049549 3300038443 Bacteria 4364
459 Ga0395901_0329478 3300038443 Bacteria 1579
460 Ga0395901_0339581 3300038443 Bacteria 1552
461 Ga0436365_1486359 3300039437 Bacteria 9240
462 Ga0436365_1550583 3300039437 Bacteria 3640
463 Ga0436365_1804934 3300039437 Bacteria 1775
464 Ga0436363_0937583 3300039450 Bacteria 2797
465 Ga0439436_0000195 3300041404 Bacteria 14462
466 Ga0439436_0004122 3300041404 Bacteria 4453
467 Ga0439436_0011031 3300041404 Bacteria 2748
468 Ga0439438_000002 3300041405 Bacteria 618223
469 Ga0439438_008721 3300041405 Bacteria 3335
470 Ga0439438_008736 3300041405 Bacteria 3331
471 Ga0439439_0005795 3300041406 Bacteria 2837
472 Ga0439447_002146 3300041407 Bacteria 7230
473 Ga0439461_0005423 3300041410 Bacteria 2172
474 Ga0439466_0000001 3300041411 Bacteria 647258
475 Ga0439466_0008105 3300041411 Bacteria 3961
476 Ga0439466_0008217 3300041411 Bacteria 3935
477 Ga0439466_0014548 3300041411 Bacteria 2864
478 Ga0439466_0036103 3300041411 Bacteria 1670
479 Ga0439465_0001310 3300041413 Bacteria 8015
480 Ga0439465_0004124 3300041413 Bacteria 4728
481 Ga0439465_0008621 3300041413 Bacteria 3216
482 Ga0451793_0946035 3300041452 Bacteria 1948
483 Ga0451843_1271766 3300041509 Bacteria 1916
484 Ga0451853_3737571 3300041512 Bacteria 3497
485 Ga0451853_3919652 3300041512 Bacteria 3566
486 Ga0439433_0000402 3300041999 Bacteria 7834
487 Ga0439433_0001637 3300041999 Bacteria 4662
488 Ga0439433_0002433 3300041999 Bacteria 3951
489 Ga0439433_0004144 3300041999 Bacteria 3115
490 Ga0439433_0006160 3300041999 Bacteria 2579
491 Ga0439442_000315 3300042002 Bacteria 11573
492 Ga0439442_003681 3300042002 Bacteria 3036
493 Ga0439432_004071 3300042006 Bacteria 5356
494 Ga0439432_009751 3300042006 Bacteria 3340
495 Ga0439432_017875 3300042006 Bacteria 2377
496 Ga0439449_0000789 3300042007 Bacteria 12218
497 Ga0439449_0001574 3300042007 Bacteria 8948
498 Ga0439449_0013305 3300042007 Bacteria 3095
499 Ga0439449_0017073 3300042007 Bacteria 2723
500 Ga0439452_000014 3300042010 Bacteria 344969
501 Ga0439452_000015 3300042010 Bacteria 342948
502 Ga0439452_000053 3300042010 Bacteria 113190
503 Ga0439452_015017 3300042010 Bacteria 2135
504 Ga0439455_0000885 3300042012 Bacteria 4621
505 Ga0439457_000374 3300042014 Bacteria 12607
506 Ga0439457_000762 3300042014 Bacteria 9570
507 Ga0439463_003029 3300042016 Bacteria 4268
508 Ga0450919_003914 3300042121 Bacteria 1838
509 Ga0450894_000179 3300042131 Bacteria 11321
510 Ga0450902_007818 3300042137 Bacteria 1661
511 Ga0450903_000358 3300042138 Bacteria 10027
512 Ga0450903_001397 3300042138 Bacteria 4504
513 Ga0450906_001425 3300042145 Bacteria 5210
514 Ga0450907_000128 3300042146 Bacteria 28616
515 Ga0439458_0000085 3300042157 Bacteria 17626
516 Ga0439458_0001121 3300042157 Bacteria 6807
517 Ga0450908_008239 3300042184 Bacteria 1954
518 Ga0450918_000361 3300042531 Bacteria 9984
519 Ga0466969_0011923 3300044656 Bacteria 4596
520 Ga0466969_0019381 3300044656 Bacteria 3537
521 Ga0466969_0023807 3300044656 Bacteria 3153
522 Ga0466969_0033857 3300044656 Bacteria 2591
523 Ga0466972_0000697 3300044658 Bacteria 16038
524 Ga0466972_0002890 3300044658 Bacteria 8502
525 Ga0466972_0004406 3300044658 Bacteria 7037
526 Ga0466972_0009981 3300044658 Bacteria 4768
527 Ga0466981_0000004 3300044669 Bacteria 171461
528 Ga0466965_0000536 3300044683 Bacteria 13677
529 Ga0466965_0028939 3300044683 Bacteria 2694
530 Ga0466966_0000471 3300044684 Bacteria 25873
531 Ga0466966_0001189 3300044684 Bacteria 16712
532 Ga0466966_0001258 3300044684 Bacteria 16227
533 Ga0466966_0006139 3300044684 Bacteria 7938
534 Ga0466966_0007052 3300044684 Bacteria 7443
535 Ga0466966_0014776 3300044684 Bacteria 5164
536 Ga0466966_0021232 3300044684 Bacteria 4264
537 Ga0466966_0033424 3300044684 Bacteria 3330
538 Ga0466966_0036525 3300044684 Bacteria 3172
539 Ga0466961_0002061 3300044693 Bacteria 12524
540 Ga0466961_0005046 3300044693 Bacteria 8302
541 Ga0466961_0014753 3300044693 Bacteria 5020
542 Ga0466961_0017295 3300044693 Bacteria 4630
543 Ga0466961_0020629 3300044693 Bacteria 4241
544 Ga0466961_0021523 3300044693 Bacteria 4149
545 Ga0466961_0023957 3300044693 Bacteria 3927
546 Ga0466961_0026854 3300044693 Bacteria 3702
547 Ga0466961_0046272 3300044693 Bacteria 2783
548 Ga0466961_0076304 3300044693 Bacteria 2124
549 Ga0466961_0079591 3300044693 Bacteria 2075
550 Ga0466961_0080319 3300044693 Bacteria 2064
551 Ga0466963_0000555 3300044694 Bacteria 17588
552 Ga0466963_0020357 3300044694 Bacteria 4171
553 Ga0466963_0039333 3300044694 Bacteria 3097
554 Ga0466964_0008030 3300044706 Bacteria 3955
555 Ga0466971_0000732 3300044719 Bacteria 13143
556 Ga0466971_0002086 3300044719 Bacteria 8477
557 Ga0466971_0002190 3300044719 Bacteria 8263
558 Ga0466971_0005854 3300044719 Bacteria 5352
559 Ga0466968_0009112 3300044735 Bacteria 3815
560 Ga0466968_0010429 3300044735 Bacteria 3603
561 Ga0466968_0013034 3300044735 Bacteria 3264
562 Ga0466970_0000125 3300044765 Bacteria 34778
563 Ga0466970_0000147 3300044765 Bacteria 32640
564 Ga0466970_0001147 3300044765 Bacteria 12846
565 Ga0466970_0002680 3300044765 Bacteria 8588
566 Ga0466970_0003159 3300044765 Bacteria 8003
567 Ga0466970_0003166 3300044765 Bacteria 7997
568 Ga0466970_0005144 3300044765 Bacteria 6468
569 Ga0466970_0007014 3300044765 Bacteria 5639
570 Ga0466970_0011408 3300044765 Bacteria 4529
571 Ga0466970_0012299 3300044765 Bacteria 4373
572 Ga0466970_0032398 3300044765 Bacteria 2761
573 Ga0466970_0052948 3300044765 Bacteria 2167
574 Ga0466970_0069383 3300044765 Bacteria 1894
575 Ga0466957_0000483 3300044842 Bacteria 19817
576 Ga0466957_0002882 3300044842 Bacteria 9319
577 Ga0466957_0074184 3300044842 Bacteria 2109
578 Ga0466960_0002389 3300044901 Bacteria 7065
579 Ga0466960_0024589 3300044901 Bacteria 2719
580 Ga0466960_0028193 3300044901 Bacteria 2568
581 Ga0466959_0000339 3300045049 Bacteria 27646
582 Ga0466959_0003458 3300045049 Bacteria 10335
583 Ga0466959_0004914 3300045049 Bacteria 9053
584 Ga0466959_0005365 3300045049 Bacteria 8778
585 Ga0466959_0006338 3300045049 Bacteria 8184
586 Ga0466959_0019321 3300045049 Bacteria 5010
587 Ga0466959_0043937 3300045049 Bacteria 3292
588 Ga0466959_0054522 3300045049 Bacteria 2920
589 Ga0466959_0066533 3300045049 Bacteria 2614
590 Ga0466958_0001557 3300045836 Bacteria 10993
591 Ga0466958_0001611 3300045836 Bacteria 10858
592 Ga0466958_0003383 3300045836 Bacteria 8271
593 Ga0466958_0003456 3300045836 Bacteria 8195
594 Ga0466958_0021927 3300045836 Bacteria 3735
595 Ga0466958_0034414 3300045836 Bacteria 3022
596 Ga0466958_0050343 3300045836 Bacteria 2522
597 Ga0466967_0002131 3300045976 Bacteria 12131
598 Ga0466967_0016365 3300045976 Bacteria 5846
599 Ga0466967_0090239 3300045976 Bacteria 2783
600 Ga0495617_004081 3300046452 Bacteria 5360
601 Ga0495603_0012082 3300046455 Bacteria 5228
602 Ga0495603_0075899 3300046455 Bacteria 1972
603 Ga0495591_000001 3300046458 Bacteria 503087
604 Ga0495591_000003 3300046458 Bacteria 449825
605 Ga0495591_000069 3300046458 Bacteria 117122
606 Ga0495629_0084971 3300046459 Bacteria 2208
607 Ga0495651_0000505 3300046462 Bacteria 30320
608 Ga0495651_0049803 3300046462 Bacteria 3233
609 Ga0495651_0089835 3300046462 Bacteria 2305
610 Ga0495653_0000466 3300046463 Bacteria 31452
611 Ga0495653_0011692 3300046463 Bacteria 7164
612 Ga0495650_0000005 3300046471 Bacteria 766553
613 Ga0495650_0000149 3300046471 Bacteria 159524
614 Ga0495650_0000228 3300046471 Bacteria 114154
615 Ga0495580_0004805 3300046472 Bacteria 11313
616 Ga0495580_0019312 3300046472 Bacteria 5064
617 Ga0495582_0060366 3300046473 Bacteria 2092
618 Ga0495605_0000828 3300046474 Bacteria 21934
619 Ga0495639_0030573 3300046475 Bacteria 2393
620 Ga0495662_0006897 3300046476 Bacteria 5642
621 Ga0495664_0000742 3300046477 Bacteria 16670
622 Ga0495664_0008887 3300046477 Bacteria 5614
623 Ga0495664_0011257 3300046477 Bacteria 5040
624 Ga0495664_0024462 3300046477 Bacteria 3511
625 Ga0495664_0027542 3300046477 Bacteria 3314
626 Ga0495585_0000087 3300046492 Bacteria 97091
627 Ga0495585_0001786 3300046492 Bacteria 16349
628 Ga0495585_0054994 3300046492 Bacteria 2200
629 Ga0495594_0022557 3300046499 Bacteria 3367
630 Ga0495594_0028964 3300046499 Bacteria 2990
631 Ga0495594_0036708 3300046499 Bacteria 2673
632 Ga0495596_0028639 3300046500 Bacteria 2235
633 Ga0495607_0027479 3300046501 Bacteria 3516
634 Ga0495607_0050434 3300046501 Bacteria 2422
635 Ga0495607_0064271 3300046501 Bacteria 2073
636 Ga0495583_0056821 3300046506 Bacteria 1762
637 Ga0495606_0000318 3300046507 Bacteria 82802
638 Ga0495606_0016139 3300046507 Bacteria 5713
639 Ga0495610_0000069 3300046512 Bacteria 121713
640 Ga0495610_0033859 3300046512 Bacteria 2636
641 Ga0495616_0006775 3300046513 Bacteria 6906
642 Ga0495616_0023037 3300046513 Bacteria 3356
643 Ga0495618_0028458 3300046514 Bacteria 3482
644 Ga0495618_0051403 3300046514 Bacteria 2603
645 Ga0495628_0079386 3300046516 Bacteria 2551
646 Ga0495630_0011755 3300046517 Bacteria 6344
647 Ga0495630_0078275 3300046517 Bacteria 2493
648 Ga0495631_0001116 3300046518 Bacteria 16669
649 Ga0495631_0033175 3300046518 Bacteria 2321
650 Ga0495637_0000904 3300046520 Bacteria 19141
651 Ga0495643_0001005 3300046522 Bacteria 28801
652 Ga0495643_0011614 3300046522 Bacteria 5354
653 Ga0495648_0002385 3300046524 Bacteria 17443
654 Ga0495648_0026341 3300046524 Bacteria 3916
655 Ga0495666_0002702 3300046526 Bacteria 8854
656 Ga0495642_0000004 3300046528 Bacteria 182675
657 Ga0495642_0012576 3300046528 Bacteria 3263
658 Ga0495652_0004408 3300046529 Bacteria 13458
659 Ga0495652_0076188 3300046529 Bacteria 2783
660 Ga0495654_0000033 3300046530 Bacteria 201799
661 Ga0495654_0000055 3300046530 Bacteria 142121
662 Ga0495654_0000256 3300046530 Bacteria 48724
663 Ga0495654_0007714 3300046530 Bacteria 5989
664 Ga0495654_0017690 3300046530 Bacteria 3742
665 Ga0495665_0003646 3300046531 Bacteria 8359
666 Ga0495665_0007776 3300046531 Bacteria 5798
667 Ga0495665_0058587 3300046531 Bacteria 2034
668 Ga0495640_0022132 3300046533 Bacteria 4653
669 Ga0495640_0023944 3300046533 Bacteria 4442
670 Ga0495586_0009888 3300046535 Bacteria 5078
671 Ga0495586_0057727 3300046535 Bacteria 2106
672 Ga0495586_0061666 3300046535 Bacteria 2041
673 Ga0495586_0094107 3300046535 Bacteria 1657
674 Ga0495587_0002568 3300046536 Bacteria 12134
675 Ga0495587_0003374 3300046536 Bacteria 10647
676 Ga0495587_0012618 3300046536 Bacteria 5314
677 Ga0495597_0019216 3300046542 Bacteria 3199
678 Ga0495645_0004124 3300046543 Bacteria 9921
679 Ga0495645_0006857 3300046543 Bacteria 7919
680 Ga0495645_0076957 3300046543 Bacteria 2399
681 Ga0495645_0079914 3300046543 Bacteria 2348
682 Ga0495622_0042990 3300046557 Bacteria 2100
683 Ga0495633_0021197 3300046558 Bacteria 3253
684 Ga0495667_0003973 3300046559 Bacteria 9926
685 Ga0495667_0005045 3300046559 Bacteria 8925
686 Ga0495667_0058585 3300046559 Bacteria 2530
687 Ga0495656_0004184 3300046615 Bacteria 4927
688 Ga0495656_0004570 3300046615 Bacteria 4748
689 Ga0495668_0000294 3300046616 Bacteria 68626
690 Ga0495668_0007928 3300046616 Bacteria 6700
691 Ga0495634_0000378 3300046642 Bacteria 43514
692 Ga0495625_0002090 3300046660 Bacteria 22320
693 Ga0495625_0010488 3300046660 Bacteria 7663
694 Ga0495635_0000283 3300046663 Bacteria 32627
695 Ga0495635_0015722 3300046663 Bacteria 5287
696 Ga0495588_0003440 3300046674 Bacteria 6883
697 Ga0495588_0004259 3300046674 Bacteria 6310
698 Ga0495588_0024546 3300046674 Bacteria 2995
699 Ga0495588_0048544 3300046674 Bacteria 2181
700 Ga0495657_0000049 3300046675 Bacteria 103042
701 Ga0495657_0032047 3300046675 Bacteria 3671
702 Ga0495623_0001555 3300046679 Bacteria 15454
703 Ga0495623_0017148 3300046679 Bacteria 4677
704 Ga0495623_0037430 3300046679 Bacteria 3104
705 Ga0495613_0001423 3300046689 Bacteria 18253
706 Ga0495624_0015165 3300046690 Bacteria 5213
707 Ga0495670_0003593 3300046691 Bacteria 7613
708 Ga0495670_0005066 3300046691 Bacteria 6482
709 Ga0495671_0006848 3300046692 Bacteria 6550
710 Ga0495589_0003485 3300046794 Bacteria 8512
711 Ga0495589_0015969 3300046794 Bacteria 3859
712 Ga0495589_0017182 3300046794 Bacteria 3714
713 Ga0495589_0020250 3300046794 Bacteria 3403
714 Ga0495589_0060200 3300046794 Bacteria 1865
715 Ga0495600_0000176 3300046809 Bacteria 37383
716 Ga0495600_0014267 3300046809 Bacteria 5006
717 Ga0495600_0028844 3300046809 Bacteria 3591
718 Ga0495600_0064174 3300046809 Bacteria 2401
719 Ga0495600_0136144 3300046809 Bacteria 1595
720 Ga0495660_0000017 3300046810 Bacteria 320655
721 Ga0495660_0052356 3300046810 Bacteria 2217
722 Ga0495660_0052408 3300046810 Bacteria 2216
723 Ga0495581_0023949 3300047315 Bacteria 3537
724 Ga0495581_0024488 3300047315 Bacteria 3498
725 Ga0495604_0001396 3300047317 Bacteria 19783
726 Ga0495604_0001987 3300047317 Bacteria 16510
727 Ga0495604_0035514 3300047317 Bacteria 3937
728 Ga0495604_0055593 3300047317 Bacteria 3050
729 Ga0495604_0065020 3300047317 Bacteria 2778
730 Ga0495636_0004898 3300047318 Bacteria 5246
731 Ga0495636_0006035 3300047318 Bacteria 4752
732 Ga0495636_0010687 3300047318 Bacteria 3628
733 Ga0495636_0011881 3300047318 Bacteria 3450
734 Ga0495636_0029339 3300047318 Bacteria 2245
735 Ga0495674_0165798 3300047319 Bacteria 1846
736 Ga0495674_0190311 3300047319 Bacteria 1706
737 Ga0495672_0000001 3300047320 Bacteria 1458820
738 Ga0495672_0000052 3300047320 Bacteria 236266
739 Ga0495676_0002192 3300047321 Bacteria 17299
740 Ga0495676_0005295 3300047321 Bacteria 11809
741 Ga0495676_0009992 3300047321 Bacteria 8622
742 Ga0495676_0026688 3300047321 Bacteria 4967
743 Ga0495676_0104666 3300047321 Bacteria 2087
744 Ga0495680_0000066 3300047322 Bacteria 89327
745 Ga0495680_0014506 3300047322 Bacteria 6820
746 Ga0495683_0000192 3300047323 Bacteria 58135
747 Ga0495683_0001028 3300047323 Bacteria 19439
748 Ga0495683_0039006 3300047323 Bacteria 2401
749 Ga0495687_003038 3300047443 Bacteria 12619
750 Ga0495675_0000026 3300047444 Bacteria 108709
751 Ga0495675_0009185 3300047444 Bacteria 6147
752 Ga0495675_0070964 3300047444 Bacteria 2199
753 Ga0495675_0072350 3300047444 Bacteria 2175
754 Ga0495677_0004977 3300047445 Bacteria 5068
755 Ga0495685_003995 3300047447 Bacteria 4742
756 Ga0495685_006104 3300047447 Bacteria 3942
757 Ga0495673_0000007 3300047469 Bacteria 796722
758 Ga0495673_0000019 3300047469 Bacteria 554389
759 Ga0495681_0000769 3300047470 Bacteria 24687
760 Ga0495681_0010307 3300047470 Bacteria 5662
761 Ga0495684_0089737 3300047471 Bacteria 2329
762 Ga0495593_0002496 3300047673 Bacteria 11069
763 Ga0495593_0040956 3300047673 Bacteria 2492
764 Ga0495615_0010729 3300048090 Bacteria 1841
765 Ga0495626_0013857 3300048091 Bacteria 4177
766 Ga0496100_0027780 3300048903 Bacteria 3482
767 Ga0496100_0070600 3300048903 Bacteria 2329
768 Ga0496100_0086666 3300048903 Bacteria 2127
769 Ga0496101_0004230 3300048904 Bacteria 9001
770 Ga0496101_0013834 3300048904 Bacteria 5416
771 Ga0496102_0034508 3300048905 Bacteria 4550
772 Ga0496102_0034937 3300048905 Bacteria 4524
773 Ga0496102_0072077 3300048905 Bacteria 3173
774 Ga0496102_0116561 3300048905 Bacteria 2492
775 Ga0496102_0147520 3300048905 Bacteria 2208
776 Ga0496103_0002458 3300048906 Bacteria 11641
777 Ga0496103_0002535 3300048906 Bacteria 11448
778 Ga0496103_0003246 3300048906 Bacteria 9972
779 Ga0496103_0005572 3300048906 Bacteria 7530
780 Ga0496103_0082219 3300048906 Bacteria 2026
781 Ga0496103_0093038 3300048906 Bacteria 1903
782 Ga0496104_0000633 3300048907 Bacteria 30119
783 Ga0496104_0022013 3300048907 Bacteria 5856
784 Ga0496104_0045963 3300048907 Bacteria 4108
785 Ga0496105_0012197 3300048908 Bacteria 6804
786 Ga0496105_0016719 3300048908 Bacteria 5862
787 Ga0496105_0017915 3300048908 Bacteria 5684
788 Ga0496105_0029356 3300048908 Bacteria 4501
789 Ga0496105_0123063 3300048908 Bacteria 2138
790 Ga0496106_0013608 3300048909 Bacteria 6006
791 Ga0496106_0014747 3300048909 Bacteria 5777
792 Ga0496106_0042915 3300048909 Bacteria 3392
793 Ga0496106_0091902 3300048909 Bacteria 2343
794 Ga0496106_0129451 3300048909 Bacteria 1978
795 Ga0496107_0001472 3300048910 Bacteria 14564
796 Ga0496107_0010664 3300048910 Bacteria 6390
797 Ga0496107_0012130 3300048910 Bacteria 6011
798 Ga0496107_0023999 3300048910 Bacteria 4311
799 Ga0496108_0000368 3300048911 Bacteria 37916
800 Ga0496108_0014016 3300048911 Bacteria 6540
801 Ga0496108_0024226 3300048911 Bacteria 4997
802 Ga0496108_0044250 3300048911 Bacteria 3717
803 Ga0496108_0085898 3300048911 Bacteria 2671
804 Ga0496108_0175398 3300048911 Bacteria 1855
805 Ga0496109_0001044 3300048912 Bacteria 22912
806 Ga0496109_0005730 3300048912 Bacteria 10392
807 Ga0496109_0007728 3300048912 Bacteria 9104
808 Ga0496109_0105305 3300048912 Bacteria 2619
809 Ga0496110_0000574 3300048913 Bacteria 25238
810 Ga0496110_0028337 3300048913 Bacteria 4810
811 Ga0496110_0147545 3300048913 Bacteria 2128
812 Ga0496110_0178049 3300048913 Bacteria 1930
813 Ga0496111_0000389 3300048914 Bacteria 21995
814 Ga0496111_0001626 3300048914 Bacteria 13016
815 Ga0496111_0056392 3300048914 Bacteria 2842
816 Ga0496111_0073280 3300048914 Bacteria 2493
817 Ga0496111_0155067 3300048914 Bacteria 1699
818 Ga0496112_0006644 3300048915 Bacteria 10184
819 Ga0496112_0016759 3300048915 Bacteria 6872
820 Ga0496112_0072862 3300048915 Bacteria 3395
821 Ga0496112_0090052 3300048915 Bacteria 3037
822 Ga0496112_0150397 3300048915 Bacteria 2295
823 Ga0496113_0026795 3300048916 Bacteria 4125
824 Ga0496113_0056348 3300048916 Bacteria 2950
825 Ga0496114_0001123 3300048917 Bacteria 20224
826 Ga0496114_0005471 3300048917 Bacteria 9937
827 Ga0496114_0019171 3300048917 Bacteria 5542
828 Ga0496114_0137337 3300048917 Bacteria 2114
829 Ga0496115_0061048 3300048918 Bacteria 3038
830 Ga0496115_0088507 3300048918 Bacteria 2528
831 Ga0496115_0167767 3300048918 Bacteria 1815
832 Ga0496116_0000167 3300048919 Bacteria 132540
833 Ga0496116_0000204 3300048919 Bacteria 113862
834 Ga0496116_0000237 3300048919 Bacteria 100835
835 Ga0496116_0005450 3300048919 Bacteria 11783
836 Ga0496116_0015029 3300048919 Bacteria 6139
837 Ga0496117_0000020 3300048920 Bacteria 458405
838 Ga0496117_0000052 3300048920 Bacteria 280463
839 Ga0496117_0000073 3300048920 Bacteria 236223
840 Ga0496117_0000294 3300048920 Bacteria 89536
841 Ga0496117_0000993 3300048920 Bacteria 43383
842 Ga0496117_0001351 3300048920 Bacteria 35913
843 Ga0496117_0002025 3300048920 Bacteria 26845
844 Ga0496117_0003132 3300048920 Bacteria 19732
845 Ga0496117_0056492 3300048920 Bacteria 2733
846 Ga0496117_0071218 3300048920 Bacteria 2331
847 Ga0496118_0000015 3300048921 Bacteria 551359
848 Ga0496118_0000432 3300048921 Bacteria 69605
849 Ga0496118_0000449 3300048921 Bacteria 68182
850 Ga0496118_0000508 3300048921 Bacteria 64418
851 Ga0496118_0000640 3300048921 Bacteria 57413
852 Ga0496118_0003588 3300048921 Bacteria 19306
853 Ga0496118_0003969 3300048921 Bacteria 18055
854 Ga0496118_0004643 3300048921 Bacteria 16116
855 Ga0496118_0014037 3300048921 Bacteria 7522
856 Ga0496118_0016244 3300048921 Bacteria 6836
857 Ga0496118_0040502 3300048921 Bacteria 3704
858 Ga0496118_0042228 3300048921 Bacteria 3600
859 Ga0496119_0000193 3300048922 Bacteria 85647
860 Ga0496119_0000400 3300048922 Bacteria 59582
861 Ga0496119_0000487 3300048922 Bacteria 54233
862 Ga0496119_0001810 3300048922 Bacteria 24832
863 Ga0496119_0002729 3300048922 Bacteria 19021
864 Ga0496119_0007347 3300048922 Bacteria 9960
865 Ga0496119_0010461 3300048922 Bacteria 7805
866 Ga0496119_0017983 3300048922 Bacteria 5286
867 Ga0496119_0045962 3300048922 Bacteria 2731
868 Ga0496119_0055959 3300048922 Bacteria 2392
869 Ga0496120_0000019 3300048923 Bacteria 260115
870 Ga0496120_0000096 3300048923 Bacteria 145880
871 Ga0496120_0000127 3300048923 Bacteria 128189
872 Ga0496120_0000261 3300048923 Bacteria 88296
873 Ga0496120_0000524 3300048923 Bacteria 59374
874 Ga0496120_0001020 3300048923 Bacteria 37462
875 Ga0496120_0001247 3300048923 Bacteria 32027
876 Ga0496120_0001736 3300048923 Bacteria 24783
877 Ga0496120_0002192 3300048923 Bacteria 20660
878 Ga0496120_0005314 3300048923 Bacteria 10322
879 Ga0496120_0021217 3300048923 Bacteria 4108
880 Ga0496120_0087619 3300048923 Bacteria 1671
881 Ga0496121_0000005 3300048924 Bacteria 1034486
882 Ga0496121_0000337 3300048924 Bacteria 97711
883 Ga0496121_0001063 3300048924 Bacteria 48657
884 Ga0496121_0001133 3300048924 Bacteria 46813
885 Ga0496121_0002230 3300048924 Bacteria 30233
886 Ga0496121_0002957 3300048924 Bacteria 24766
887 Ga0496121_0003286 3300048924 Bacteria 23211
888 Ga0496121_0005652 3300048924 Bacteria 15906
889 Ga0496121_0012935 3300048924 Bacteria 9021
890 Ga0496121_0127415 3300048924 Bacteria 1912
891 Ga0496122_0000005 3300048925 Bacteria 630659
892 Ga0496122_0000031 3300048925 Bacteria 329726
893 Ga0496122_0000053 3300048925 Bacteria 260120
894 Ga0496122_0001255 3300048925 Bacteria 42535
895 Ga0496122_0001545 3300048925 Bacteria 36554
896 Ga0496122_0002107 3300048925 Bacteria 29490
897 Ga0496122_0003761 3300048925 Bacteria 19564
898 Ga0496122_0004580 3300048925 Bacteria 17027
899 Ga0496122_0005324 3300048925 Bacteria 15380
900 Ga0496122_0005341 3300048925 Bacteria 15360
901 Ga0496122_0005506 3300048925 Bacteria 15044
902 Ga0496122_0008092 3300048925 Bacteria 11463
903 Ga0496122_0015973 3300048925 Bacteria 7140
904 Ga0496122_0046280 3300048925 Bacteria 3371
905 Ga0496122_0066908 3300048925 Bacteria 2591
906 Ga0496122_0068136 3300048925 Bacteria 2557
907 Ga0496122_0091768 3300048925 Bacteria 2067
908 Ga0496122_0096629 3300048925 Bacteria 1991
909 Ga0496122_0138562 3300048925 Bacteria 1527
910 Ga0496123_0000008 3300048926 Bacteria 630628
911 Ga0496123_0000013 3300048926 Bacteria 439694
912 Ga0496123_0000038 3300048926 Bacteria 260120
913 Ga0496123_0000994 3300048926 Bacteria 43566
914 Ga0496123_0003666 3300048926 Bacteria 16946
915 Ga0496123_0008679 3300048926 Bacteria 9286
916 Ga0496123_0019254 3300048926 Bacteria 5386
917 Ga0496123_0031787 3300048926 Bacteria 3833
918 Ga0496123_0043706 3300048926 Bacteria 3073
919 Ga0496124_0000070 3300048927 Bacteria 220875
920 Ga0496124_0000600 3300048927 Bacteria 60608
921 Ga0496124_0000984 3300048927 Bacteria 45205
922 Ga0496124_0003218 3300048927 Bacteria 20170
923 Ga0496124_0003597 3300048927 Bacteria 18831
924 Ga0496124_0006099 3300048927 Bacteria 13255
925 Ga0496124_0017263 3300048927 Bacteria 6808
926 Ga0496124_0028720 3300048927 Bacteria 4971
927 Ga0496124_0043699 3300048927 Bacteria 3850
928 Ga0496124_0048055 3300048927 Bacteria 3648
929 Ga0496124_0053042 3300048927 Bacteria 3441
930 Ga0496124_0062501 3300048927 Bacteria 3115
931 Ga0496125_0000009 3300048928 Bacteria 677678
932 Ga0496125_0000068 3300048928 Bacteria 247765
933 Ga0496125_0000163 3300048928 Bacteria 148473
934 Ga0496125_0000358 3300048928 Bacteria 86281
935 Ga0496125_0001579 3300048928 Bacteria 32442
936 Ga0496125_0006056 3300048928 Bacteria 13219
937 Ga0496125_0007198 3300048928 Bacteria 11861
938 Ga0496125_0008355 3300048928 Bacteria 10854
939 Ga0496125_0013099 3300048928 Bacteria 8176
940 Ga0496125_0014219 3300048928 Bacteria 7760
941 Ga0496125_0108077 3300048928 Bacteria 2025
942 Ga0496126_0000349 3300048929 Bacteria 96786
943 Ga0496126_0000717 3300048929 Bacteria 60241
944 Ga0496126_0000768 3300048929 Bacteria 58074
945 Ga0496126_0052530 3300048929 Bacteria 3702
946 Ga0496126_0080724 3300048929 Bacteria 2877
947 Ga0496126_0098036 3300048929 Bacteria 2568
948 Ga0501308_001792 3300049128 Bacteria 1792
949 Ga0501310_000011 3300049130 Bacteria 18314
950 Ga0501310_000451 3300049130 Bacteria 3601
951 Ga0495678_000493 3300049459 Bacteria 39034
952 Ga0495682_0000011 3300049460 Bacteria 278474
953 Ga0501032_0003609 3300049569 Bacteria 11782
954 Ga0501032_0114679 3300049569 Bacteria 1782
955 Ga0501033_0017554 3300049570 Bacteria 5406
956 Ga0501033_0026256 3300049570 Bacteria 4384
957 Ga0501033_0029317 3300049570 Bacteria 4136
958 Ga0501034_0000038 3300049571 Bacteria 237795
959 Ga0501034_0002524 3300049571 Bacteria 21942
960 Ga0501034_0009919 3300049571 Bacteria 9952
961 Ga0501034_0027798 3300049571 Bacteria 5751
962 Ga0501036_0000951 3300049572 Bacteria 21789
963 Ga0501036_0000952 3300049572 Bacteria 21786
964 Ga0501036_0005942 3300049572 Bacteria 9889
965 Ga0501037_0010001 3300049573 Bacteria 6959
966 Ga0501037_0010374 3300049573 Bacteria 6834
967 Ga0501037_0070992 3300049573 Bacteria 2533
968 Ga0501038_0014219 3300049574 Bacteria 7251
969 Ga0501038_0026283 3300049574 Bacteria 5185
970 Ga0501038_0026353 3300049574 Bacteria 5177
971 Ga0501039_0010233 3300049575 Bacteria 7147
972 Ga0501042_0000193 3300049578 Bacteria 28734
973 Ga0501042_0007693 3300049578 Bacteria 7075
974 Ga0501043_0008392 3300049579 Bacteria 8136
975 Ga0501043_0051108 3300049579 Bacteria 3248
976 Ga0501043_0128852 3300049579 Bacteria 1983
977 Ga0501047_0007414 3300049581 Bacteria 10320
978 Ga0501047_0036860 3300049581 Bacteria 4726
979 Ga0501048_0011491 3300049582 Bacteria 6603
980 Ga0501070_0000065 3300049586 Bacteria 88506
981 Ga0501070_0002167 3300049586 Bacteria 17251
982 Ga0501070_0002311 3300049586 Bacteria 16731
983 Ga0501070_0067482 3300049586 Bacteria 2962
984 Ga0501074_0006292 3300049590 Bacteria 8574
985 Ga0501074_0049037 3300049590 Bacteria 3049
986 Ga0501080_0031536 3300049742 Bacteria 4938
987 Ga0501083_0000047 3300049744 Bacteria 88014
988 Ga0501083_0002277 3300049744 Bacteria 13130
989 Ga0501282_004066 3300049778 Bacteria 1568
990 Ga0501035_0000121 3300049822 Bacteria 94497
991 Ga0501035_0003457 3300049822 Bacteria 15115
992 Ga0501035_0028739 3300049822 Bacteria 5073
993 Ga0501035_0060475 3300049822 Bacteria 3372
994 Ga0501044_0001588 3300049823 Bacteria 26614
995 Ga0501044_0008984 3300049823 Bacteria 10927
996 Ga0501044_0036839 3300049823 Bacteria 5116
997 Ga0501044_0117842 3300049823 Bacteria 2659
998 Ga0501044_0130605 3300049823 Bacteria 2506
999 Ga0501044_0156074 3300049823 Bacteria 2262
1000 Ga0501044_0216947 3300049823 Bacteria 1865
1001 Ga0501044_0244116 3300049823 Bacteria 1739
1002 nmdc:mga03683_132_c1 3300050489 Bacteria 24967
1003 nmdc:mga03n38_4590_c1 3300050490 Bacteria 4598
1004 nmdc:mga00v17_11_c1 3300050491 Bacteria 135478
1005 nmdc:mga00v17_12627_c1 3300050491 Bacteria 4664
1006 nmdc:mga00v17_178_c1 3300050491 Bacteria 37572
1007 nmdc:mga00v17_61394_c1 3300050491 Bacteria 2310
1008 nmdc:mga0yw44_96_c1 3300050492 Bacteria 30976
1009 nmdc:mga06z11_14488_c1 3300050494 Bacteria 3494
1010 nmdc:mga06z11_3132_c1 3300050494 Bacteria 6381
1011 nmdc:mga04h51_6837_c1 3300050495 Bacteria 2980
1012 nmdc:mga07m45_17350_c1 3300050496 Bacteria 3865
1013 nmdc:mga07m45_71866_c1 3300050496 Bacteria 1969
1014 nmdc:mga05p37_174620_c1 3300050507 Bacteria 2618
1015 nmdc:mga0qj67_139496_c1 3300050509 Bacteria 1965
1016 nmdc:mga0qj67_34060_c1 3300050509 Bacteria 3977
1017 nmdc:mga0sz30_1378_c2 3300050516 Bacteria 4545
1018 nmdc:mga0sz30_15304_c1 3300050516 Bacteria 3030
1019 nmdc:mga0sz30_485_c1 3300050516 Bacteria 14930
1020 Ga0495601_0116409 3300053077 Bacteria 1733
1021 Ga0495612_0007165 3300053078 Bacteria 4563
1022 Ga0500650_0011205 3300053098 Bacteria 3680
1023 Ga0500621_000005 3300053126 Bacteria 320383
1024 Ga0500561_0000033 3300053137 Bacteria 28489
1025 Ga0500573_0042062 3300053140 Bacteria 2639
1026 Ga0500624_000520 3300053157 Bacteria 11108
1027 Ga0500624_001218 3300053157 Bacteria 4607
1028 Ga0500634_0003753 3300053161 Bacteria 6858
1029 Ga0500636_0000039 3300053177 Bacteria 69891
1030 Ga0500636_0007158 3300053177 Bacteria 6446
1031 Ga0587084_000309 3300059477 Bacteria 3575
1032 Ga0587084_004059 3300059477 Bacteria 1651
1033 Ga0587066_000629 3300059490 Bacteria 3025
1034 Ga0587070_001326 3300059491 Bacteria 2518
1035 Ga0587083_0008002 3300059505 Bacteria 1639
1036 Ga0587088_001153 3300059508 Bacteria 2637
1037 Ga0587088_001235 3300059508 Bacteria 2588
1038 Ga0587088_005574 3300059508 Bacteria 1662
1039 Ga0587090_000123 3300059510 Bacteria 4901
1040 Ga0587090_000138 3300059510 Bacteria 4802
1041 Ga0587090_000982 3300059510 Bacteria 2709
1042 Ga0587090_002985 3300059510 Bacteria 1917
1043 Ga0587091_000092 3300059511 Bacteria 5058
1044 Ga0587091_002210 3300059511 Bacteria 2275
1045 Ga0587092_000499 3300059512 Bacteria 3177
1046 Ga0587094_002376 3300059513 Bacteria 1943
1047 Ga0587095_000115 3300059514 Bacteria 3240
1048 Ga0587098_000351 3300059604 Bacteria 2667
1049 Ga0587101_000289 3300059623 Bacteria 3234
1050 Ga0587115_000278 3300059626 Bacteria 3448
1051 Ga0587128_000022 3300059630 Bacteria 6164
1052 Ga0587128_000197 3300059630 Bacteria 3668
1053 Ga0587128_001628 3300059630 Bacteria 2167
1054 Ga0587062_000796 3300059639 Bacteria 2429
1055 Ga0587062_001343 3300059639 Bacteria 2094
1056 Ga0587069_002201 3300059642 Bacteria 1941
1057 Ga0587072_002733 3300059643 Bacteria 2399
1058 Ga0587079_000356 3300059647 Bacteria 3817
1059 Ga0587107_001234 3300059652 Bacteria 2019
1060 Ga0587124_000008 3300059660 Bacteria 6134
1061 Ga0587071_009129 3300060344 Bacteria 1623
1062 Ga0466962_0000081 3300061719 Bacteria 38408
1063 Ga0466962_0001178 3300061719 Bacteria 12052
1064 Ga0466962_0013373 3300061719 Bacteria 3950
1065 Ga0466962_0019540 3300061719 Bacteria 3256

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048905 Ga0496102_0072077 Ga0496102_0072077_65_1291 386
2 3300046794 Ga0495589_0017182 Ga0495589_0017182_2513_3688 387
3 3300048905 Ga0496102_0034508 Ga0496102_0034508_21_1328 417
4 3300028379 Ga0268266_10002032 Ga0268266_1000203215 418
5 3300013307 Ga0157372_10173238 Ga0157372_101732382 419
6 3300048920 Ga0496117_0071218 Ga0496117_0071218_720_2102 430
7 3300048923 Ga0496120_0005314 Ga0496120_0005314_64_1446 430
8 3300030521 Ga0307511_10001289 Ga0307511_1000128914 432
9 3300009011 Ga0105251_10000479 Ga0105251_1000047917 435
10 3300009174 Ga0105241_10000004 Ga0105241_10000004501 435
11 3300013100 Ga0157373_10005732 Ga0157373_100057329 435
12 3300014497 Ga0182008_10011140 Ga0182008_100111403 435
13 3300041411 Ga0439466_0014548 Ga0439466_0014548_72_1448 435
14 3300042006 Ga0439432_009751 Ga0439432_009751_225_1601 435
15 3300046530 Ga0495654_0007714 Ga0495654_0007714_1756_3132 435
16 3300042006 Ga0439432_004071 Ga0439432_004071_2513_3955 438
17 3300042010 Ga0439452_000015 Ga0439452_000015_206720_208162 438
18 3300048919 Ga0496116_0000237 Ga0496116_0000237_55489_56931 438
19 3300048920 Ga0496117_0001351 Ga0496117_0001351_29765_31207 438
20 3300048921 Ga0496118_0014037 Ga0496118_0014037_4707_6149 438
21 3300048927 Ga0496124_0062501 Ga0496124_0062501_1056_2498 438
22 3300044684 Ga0466966_0033424 Ga0466966_0033424_1787_3121 440
23 3300044693 Ga0466961_0002061 Ga0466961_0002061_9532_10866 440
24 3300044694 Ga0466963_0000555 Ga0466963_0000555_7935_9269 440
25 3300044706 Ga0466964_0008030 Ga0466964_0008030_2569_3903 440
26 3300044719 Ga0466971_0005854 Ga0466971_0005854_3451_4785 440
27 3300044765 Ga0466970_0000125 Ga0466970_0000125_23998_25332 440
28 3300044842 Ga0466957_0000483 Ga0466957_0000483_17916_19250 440
29 3300045049 Ga0466959_0004914 Ga0466959_0004914_1659_2993 440
30 3300045836 Ga0466958_0001557 Ga0466958_0001557_8448_9782 440
31 3300045976 Ga0466967_0002131 Ga0466967_0002131_2954_4288 440
32 3300061719 Ga0466962_0000081 Ga0466962_0000081_7935_9269 440
33 3300046501 Ga0495607_0050434 Ga0495607_0050434_26_1363 441
34 3300048922 Ga0496119_0000487 Ga0496119_0000487_30864_32312 441
35 3300037466 Ga0395898_0065633 Ga0395898_0065633_2153_3493 442
36 3300048922 Ga0496119_0000193 Ga0496119_0000193_35644_37092 442
37 3300048923 Ga0496120_0000261 Ga0496120_0000261_15050_16498 442
38 3300041413 Ga0439465_0008621 Ga0439465_0008621_1665_3164 443
39 3300001989 JGI24739J22299_10007640 JGI24739J22299_100076403 444
40 3300009011 Ga0105251_10002777 Ga0105251_100027774 444
41 3300009036 Ga0105244_10000327 Ga0105244_1000032714 444
42 3300013102 Ga0157371_10002433 Ga0157371_100024338 444
43 3300013104 Ga0157370_10000053 Ga0157370_1000005341 444
44 3300025728 Ga0207655_1008878 Ga0207655_10088784 444
45 3300025735 Ga0207713_1010458 Ga0207713_10104583 444
46 3300031730 Ga0307516_10063495 Ga0307516_100634952 444
47 3300044765 Ga0466970_0052948 Ga0466970_0052948_22_1356 444
48 3300003856 Ga0058692_1009657 Ga0058692_10096571 445
49 3300027312 Ga0209371_1002802 Ga0209371_10028026 445
50 3300030500 Ga0268256_1002333 Ga0268256_10023335 445
51 3300031616 Ga0307508_10032150 Ga0307508_100321502 445
52 3300046514 Ga0495618_0028458 Ga0495618_0028458_145_1599 445
53 3300046529 Ga0495652_0004408 Ga0495652_0004408_5182_6636 445
54 3300046543 Ga0495645_0076957 Ga0495645_0076957_567_2021 445
55 3300047318 Ga0495636_0010687 Ga0495636_0010687_1635_2984 445
56 3300044693 Ga0466961_0014753 Ga0466961_0014753_3272_4816 446
57 3300044719 Ga0466971_0000732 Ga0466971_0000732_4492_6036 446
58 3300045049 Ga0466959_0000339 Ga0466959_0000339_10126_11670 446
59 3300045836 Ga0466958_0034414 Ga0466958_0034414_1123_2667 446
60 3300061719 Ga0466962_0001178 Ga0466962_0001178_1527_3071 446
61 3300045049 Ga0466959_0066533 Ga0466959_0066533_29_1453 448
62 3300002737 JGI25162J39368_1001972 JGI25162J39368_10019725 449
63 3300003856 Ga0058692_1000351 Ga0058692_100035114 449
64 3300003856 Ga0058692_1000438 Ga0058692_10004386 449
65 3300005347 Ga0070668_100018267 Ga0070668_1000182673 449
66 3300005548 Ga0070665_100074247 Ga0070665_1000742472 449
67 3300006051 Ga0075364_10016852 Ga0075364_100168523 449
68 3300006353 Ga0075370_10019191 Ga0075370_100191912 449
69 3300009011 Ga0105251_10003838 Ga0105251_100038388 449
70 3300009011 Ga0105251_10013897 Ga0105251_100138972 449
71 3300009036 Ga0105244_10071928 Ga0105244_100719281 449
72 3300009092 Ga0105250_10011665 Ga0105250_100116653 449
73 3300009545 Ga0105237_10088813 Ga0105237_100888133 449
74 3300011119 Ga0105246_10001187 Ga0105246_100011878 449
75 3300013100 Ga0157373_10091825 Ga0157373_100918252 449
76 3300013306 Ga0163162_10007543 Ga0163162_100075433 449
77 3300013307 Ga0157372_10028908 Ga0157372_100289084 449
78 3300013307 Ga0157372_10174033 Ga0157372_101740332 449
79 3300015261 Ga0182006_1007205 Ga0182006_10072054 449
80 3300017792 Ga0163161_10005068 Ga0163161_100050684 449
81 3300025233 Ga0209437_100115 Ga0209437_100115169 449
82 3300025711 Ga0207696_1000348 Ga0207696_100034843 449
83 3300025728 Ga0207655_1015592 Ga0207655_10155924 449
84 3300025735 Ga0207713_1000001 Ga0207713_10000012047 449
85 3300027312 Ga0209371_1000190 Ga0209371_100019060 449
86 3300027312 Ga0209371_1000480 Ga0209371_100048013 449
87 3300027312 Ga0209371_1001270 Ga0209371_100127012 449
88 3300027312 Ga0209371_1001386 Ga0209371_10013867 449
89 3300027312 Ga0209371_1002297 Ga0209371_10022976 449
90 3300030500 Ga0268256_1000069 Ga0268256_1000069151 449
91 3300030500 Ga0268256_1000264 Ga0268256_100026413 449
92 3300030500 Ga0268256_1001091 Ga0268256_10010914 449
93 3300041405 Ga0439438_008721 Ga0439438_008721_615_2111 449
94 3300041411 Ga0439466_0000001 Ga0439466_0000001_524059_525555 449
95 3300042016 Ga0439463_003029 Ga0439463_003029_614_2110 449
96 3300042146 Ga0450907_000128 Ga0450907_000128_13408_14904 449
97 3300046522 Ga0495643_0011614 Ga0495643_0011614_1340_2836 449
98 3300047320 Ga0495672_0000052 Ga0495672_0000052_166785_168281 449
99 3300048920 Ga0496117_0000073 Ga0496117_0000073_29112_30608 449
100 3300048920 Ga0496117_0000294 Ga0496117_0000294_58641_60137 449
101 3300048921 Ga0496118_0000449 Ga0496118_0000449_29112_30608 449
102 3300048921 Ga0496118_0000508 Ga0496118_0000508_29301_30797 449
103 3300048922 Ga0496119_0000400 Ga0496119_0000400_28839_30335 449
104 3300048922 Ga0496119_0001810 Ga0496119_0001810_9943_11439 449
105 3300048923 Ga0496120_0000524 Ga0496120_0000524_29040_30536 449
106 3300048923 Ga0496120_0001736 Ga0496120_0001736_13394_14890 449
107 3300048924 Ga0496121_0001133 Ga0496121_0001133_8676_10172 449
108 3300048925 Ga0496122_0001545 Ga0496122_0001545_19951_21447 449
109 3300048925 Ga0496122_0068136 Ga0496122_0068136_573_2069 449
110 3300048926 Ga0496123_0008679 Ga0496123_0008679_7556_9052 449
111 3300048927 Ga0496124_0000600 Ga0496124_0000600_54756_56252 449
112 3300048928 Ga0496125_0008355 Ga0496125_0008355_3244_4740 449
113 3300048929 Ga0496126_0080724 Ga0496126_0080724_1023_2519 449
114 3300003856 Ga0058692_1000303 Ga0058692_10003039 450
115 3300009036 Ga0105244_10005219 Ga0105244_100052193 450
116 3300013307 Ga0157372_10045725 Ga0157372_100457255 450
117 3300025728 Ga0207655_1000007 Ga0207655_1000007723 450
118 3300027312 Ga0209371_1000084 Ga0209371_1000084150 450
119 3300030500 Ga0268256_1000075 Ga0268256_100007515 450
120 3300038443 Ga0395901_0329478 Ga0395901_0329478_33_1442 450
121 3300048919 Ga0496116_0005450 Ga0496116_0005450_8198_9700 450
122 3300048923 Ga0496120_0000127 Ga0496120_0000127_15488_16990 450
123 3300006051 Ga0075364_10040851 Ga0075364_100408512 451
124 3300009092 Ga0105250_10005807 Ga0105250_100058072 451
125 3300013100 Ga0157373_10000788 Ga0157373_1000078810 451
126 3300013102 Ga0157371_10016879 Ga0157371_100168792 451
127 3300013306 Ga0163162_10055425 Ga0163162_100554252 451
128 3300025711 Ga0207696_1000035 Ga0207696_100003564 451
129 3300025728 Ga0207655_1050379 Ga0207655_10503791 451
130 3300025898 Ga0207692_10051627 Ga0207692_100516271 451
131 3300038443 Ga0395901_0339581 Ga0395901_0339581_24_1427 451
132 3300044656 Ga0466969_0023807 Ga0466969_0023807_182_1588 451
133 3300044693 Ga0466961_0079591 Ga0466961_0079591_341_1747 451
134 3300046458 Ga0495591_000001 Ga0495591_000001_117951_119453 451
135 3300046530 Ga0495654_0000033 Ga0495654_0000033_43509_45011 451
136 3300048922 Ga0496119_0010461 Ga0496119_0010461_3189_4691 451
137 3300048923 Ga0496120_0001247 Ga0496120_0001247_16952_18454 451
138 3300048925 Ga0496122_0008092 Ga0496122_0008092_3589_5091 451
139 3300048926 Ga0496123_0003666 Ga0496123_0003666_2962_4464 451
140 3300049570 Ga0501033_0029317 Ga0501033_0029317_1591_2961 451
141 3300049822 Ga0501035_0000121 Ga0501035_0000121_55212_56582 451
142 3300049823 Ga0501044_0001588 Ga0501044_0001588_1229_2599 451
143 3300017792 Ga0163161_10072746 Ga0163161_100727462 452
144 3300037471 Ga0395905_0261676 Ga0395905_0261676_192_1595 452
145 3300046462 Ga0495651_0000505 Ga0495651_0000505_18544_19998 453
146 3300042006 Ga0439432_017875 Ga0439432_017875_484_1869 454
147 3300042531 Ga0450918_000361 Ga0450918_000361_8524_9909 454
148 3300044656 Ga0466969_0011923 Ga0466969_0011923_1526_2926 454
149 3300044683 Ga0466965_0000536 Ga0466965_0000536_10804_12204 454
150 3300044684 Ga0466966_0006139 Ga0466966_0006139_3991_5391 454
151 3300044693 Ga0466961_0021523 Ga0466961_0021523_2651_4051 454
152 3300044694 Ga0466963_0020357 Ga0466963_0020357_2373_3773 454
153 3300044719 Ga0466971_0002190 Ga0466971_0002190_2294_3694 454
154 3300044765 Ga0466970_0003159 Ga0466970_0003159_4539_5939 454
155 3300044842 Ga0466957_0002882 Ga0466957_0002882_2765_4165 454
156 3300045049 Ga0466959_0003458 Ga0466959_0003458_4538_5938 454
157 3300045836 Ga0466958_0021927 Ga0466958_0021927_2065_3465 454
158 3300045976 Ga0466967_0090239 Ga0466967_0090239_154_1554 454
159 3300046674 Ga0495588_0024546 Ga0495588_0024546_1582_2967 454
160 3300050509 nmdc:mga0qj67_34060_c1 nmdc:mga0qj67_34060_c1_267_1772 454
161 3300061719 Ga0466962_0019540 Ga0466962_0019540_512_1912 454
162 3300048925 Ga0496122_0138562 Ga0496122_0138562_117_1496 455
163 3300001977 JGI24746J21847_1001213 JGI24746J21847_10012132 456
164 3300002077 JGI24744J21845_10001770 JGI24744J21845_100017703 456
165 3300005334 Ga0068869_100013259 Ga0068869_1000132593 456
166 3300005338 Ga0068868_100011001 Ga0068868_1000110013 456
167 3300005353 Ga0070669_100136719 Ga0070669_1001367192 456
168 3300005365 Ga0070688_100037254 Ga0070688_1000372542 456
169 3300005434 Ga0070709_10071272 Ga0070709_100712722 456
170 3300005539 Ga0068853_100117519 Ga0068853_1001175192 456
171 3300005834 Ga0068851_10053424 Ga0068851_100534242 456
172 3300005842 Ga0068858_100020381 Ga0068858_1000203813 456
173 3300005844 Ga0068862_100044649 Ga0068862_1000446493 456
174 3300006237 Ga0097621_100135245 Ga0097621_1001352452 456
175 3300010375 Ga0105239_10262732 Ga0105239_102627321 456
176 3300013296 Ga0157374_10014658 Ga0157374_100146584 456
177 3300015261 Ga0182006_1000144 Ga0182006_100014460 456
178 3300025315 Ga0207697_10046927 Ga0207697_100469271 456
179 3300025901 Ga0207688_10003506 Ga0207688_100035063 456
180 3300025927 Ga0207687_10033779 Ga0207687_100337792 456
181 3300025933 Ga0207706_10034324 Ga0207706_100343244 456
182 3300025941 Ga0207711_10095012 Ga0207711_100950122 456
183 3300026067 Ga0207678_10012287 Ga0207678_100122876 456
184 3300026075 Ga0207708_10024834 Ga0207708_100248343 456
185 3300026089 Ga0207648_10012323 Ga0207648_100123235 456
186 3300026118 Ga0207675_100006342 Ga0207675_1000063429 456
187 3300042002 Ga0439442_003681 Ga0439442_003681_10_1422 456
188 3300044684 Ga0466966_0036525 Ga0466966_0036525_70_1515 456
189 3300048908 Ga0496105_0123063 Ga0496105_0123063_300_1814 456
190 3300048911 Ga0496108_0000368 Ga0496108_0000368_19777_21228 456
191 3300048912 Ga0496109_0007728 Ga0496109_0007728_5139_6590 456
192 3300048915 Ga0496112_0016759 Ga0496112_0016759_3523_4974 456
193 iso_pu_bacteria 2862382967 2862385538 456
194 iso_pu_bacteria 8008558824 8008560323 456
195 3300048925 Ga0496122_0003761 Ga0496122_0003761_17557_18963 457
196 3300005439 Ga0070711_100016174 Ga0070711_1000161745 458
197 3300025915 Ga0207693_10031842 Ga0207693_100318422 458
198 3300037853 Ga0436364_0650390 Ga0436364_0650390_53_1447 458
199 3300003856 Ga0058692_1000804 Ga0058692_10008041 459
200 3300006946 Ga0079104_1004059 Ga0079104_10040596 459
201 3300025735 Ga0207713_1000026 Ga0207713_1000026285 459
202 3300025911 Ga0207654_10000006 Ga0207654_10000006518 459
203 3300027111 Ga0209281_1000008 Ga0209281_1000008294 459
204 3300049586 Ga0501070_0002311 Ga0501070_0002311_15183_16631 459
205 3300003760 Ga0055527_1000003 Ga0055527_1000003193 460
206 3300003762 Ga0055542_1000005 Ga0055542_100000557 460
207 3300003763 Ga0055529_1000006 Ga0055529_1000006193 460
208 3300009036 Ga0105244_10000034 Ga0105244_1000003468 460
209 3300009092 Ga0105250_10000002 Ga0105250_10000002306 460
210 3300013308 Ga0157375_10107278 Ga0157375_101072781 460
211 3300025228 Ga0209672_100003 Ga0209672_1000031031 460
212 3300025229 Ga0209147_100429 Ga0209147_1004299 460
213 3300025254 Ga0209148_1000004 Ga0209148_10000041326 460
214 3300025272 Ga0209455_1000046 Ga0209455_1000046345 460
215 3300025711 Ga0207696_1000021 Ga0207696_1000021202 460
216 3300025728 Ga0207655_1000046 Ga0207655_1000046107 460
217 3300048918 Ga0496115_0061048 Ga0496115_0061048_1088_2539 460
218 3300048924 Ga0496121_0127415 Ga0496121_0127415_332_1783 460
219 iso_pu_bacteria 2866612099 2866616472 460
220 3300006946 Ga0079104_1000021 Ga0079104_100002132 461
221 3300009092 Ga0105250_10000234 Ga0105250_1000023438 461
222 3300025711 Ga0207696_1000088 Ga0207696_100008873 461
223 3300027111 Ga0209281_1000001 Ga0209281_1000001652 461
224 3300042138 Ga0450903_000358 Ga0450903_000358_2643_4109 461
225 3300042157 Ga0439458_0001121 Ga0439458_0001121_860_2326 461
226 3300044658 Ga0466972_0009981 Ga0466972_0009981_2685_4160 461
227 3300048927 Ga0496124_0017263 Ga0496124_0017263_500_1942 461
228 3300048928 Ga0496125_0000009 Ga0496125_0000009_319539_320981 461
229 3300048929 Ga0496126_0098036 Ga0496126_0098036_331_1773 461
230 3300049570 Ga0501033_0017554 Ga0501033_0017554_142_1617 461
231 3300049822 Ga0501035_0028739 Ga0501035_0028739_2455_3930 461
232 3300009766 Ga0123342_1016048 Ga0123342_10160481 462
233 3300049573 Ga0501037_0010001 Ga0501037_0010001_327_1835 462
234 3300048921 Ga0496118_0003969 Ga0496118_0003969_2124_3587 463
235 3300025735 Ga0207713_1000003 Ga0207713_1000003626 464
236 3300031995 Ga0307409_100068576 Ga0307409_1000685763 464
237 3300049778 Ga0501282_004066 Ga0501282_004066_19_1425 464
238 3300050516 nmdc:mga0sz30_15304_c1 nmdc:mga0sz30_15304_c1_38_1453 464
239 3300003354 JGI25160J50197_1015702 JGI25160J50197_10157022 465
240 3300013307 Ga0157372_10020599 Ga0157372_100205994 465
241 3300025302 Ga0207426_1007262 Ga0207426_10072622 465
242 3300027312 Ga0209371_1001339 Ga0209371_10013391 465
243 3300030500 Ga0268256_1001426 Ga0268256_10014269 465
244 3300039437 Ga0436365_1550583 Ga0436365_1550583_666_2156 465
245 3300044684 Ga0466966_0000471 Ga0466966_0000471_5134_6549 465
246 3300044684 Ga0466966_0007052 Ga0466966_0007052_1015_2490 465
247 3300044693 Ga0466961_0017295 Ga0466961_0017295_2223_3698 465
248 3300044694 Ga0466963_0039333 Ga0466963_0039333_100_1575 465
249 3300044735 Ga0466968_0009112 Ga0466968_0009112_1701_3176 465
250 3300045049 Ga0466959_0054522 Ga0466959_0054522_1000_2415 465
251 3300045836 Ga0466958_0050343 Ga0466958_0050343_682_2157 465
252 3300050509 nmdc:mga0qj67_139496_c1 nmdc:mga0qj67_139496_c1_130_1569 465
253 iso_pu_bacteria 2870782633 2870786129 465
254 3300002737 JGI25162J39368_1000439 JGI25162J39368_100043923 466
255 3300003214 JGI25165J46597_1000567 JGI25165J46597_100056723 466
256 3300003771 Ga0055526_1005838 Ga0055526_10058384 466
257 3300003790 Ga0055528_1000140 Ga0055528_10001404 466
258 3300005535 Ga0070684_100078614 Ga0070684_1000786141 466
259 3300006186 Ga0075369_10020540 Ga0075369_100205402 466
260 3300009011 Ga0105251_10000699 Ga0105251_100006991 466
261 3300013102 Ga0157371_10115652 Ga0157371_101156521 466
262 3300025233 Ga0209437_100454 Ga0209437_10045411 466
263 3300025261 Ga0209233_1000230 Ga0209233_100023077 466
264 3300025273 Ga0209673_1000023 Ga0209673_1000023314 466
265 3300025273 Ga0209673_1001357 Ga0209673_100135710 466
266 3300025295 Ga0209564_1000100 Ga0209564_100010068 466
267 3300025299 Ga0209256_1000221 Ga0209256_100022147 466
268 3300025711 Ga0207696_1000005 Ga0207696_1000005177 466
269 3300025735 Ga0207713_1000002 Ga0207713_1000002420 466
270 3300025900 Ga0207710_10000049 Ga0207710_1000004995 466
271 3300026067 Ga0207678_10048587 Ga0207678_100485872 466
272 3300027312 Ga0209371_1005377 Ga0209371_10053772 466
273 3300030500 Ga0268256_1005052 Ga0268256_10050524 466
274 3300037312 Ga0395899_0012838 Ga0395899_0012838_762_2288 466
275 3300037418 Ga0395900_0145962 Ga0395900_0145962_143_1669 466
276 3300037466 Ga0395898_0006965 Ga0395898_0006965_200_1726 466
277 3300037466 Ga0395898_0008104 Ga0395898_0008104_5103_6578 466
278 3300038443 Ga0395901_0003822 Ga0395901_0003822_7571_9097 466
279 3300038443 Ga0395901_0015381 Ga0395901_0015381_1654_3129 466
280 3300044735 Ga0466968_0013034 Ga0466968_0013034_833_2368 466
281 3300048912 Ga0496109_0005730 Ga0496109_0005730_8806_10296 466
282 3300048922 Ga0496119_0007347 Ga0496119_0007347_1611_3089 466
283 3300048925 Ga0496122_0015973 Ga0496122_0015973_1408_2886 466
284 3300048926 Ga0496123_0031787 Ga0496123_0031787_1501_2979 466
285 3300049571 Ga0501034_0009919 Ga0501034_0009919_5291_6742 466
286 3300049572 Ga0501036_0005942 Ga0501036_0005942_2804_4255 466
287 3300049573 Ga0501037_0010374 Ga0501037_0010374_3273_4724 466
288 3300049574 Ga0501038_0026283 Ga0501038_0026283_1951_3402 466
289 3300049578 Ga0501042_0007693 Ga0501042_0007693_3735_5186 466
290 3300049579 Ga0501043_0008392 Ga0501043_0008392_1231_2682 466
291 3300049581 Ga0501047_0007414 Ga0501047_0007414_3054_4505 466
292 3300049582 Ga0501048_0011491 Ga0501048_0011491_2277_3728 466
293 3300049590 Ga0501074_0049037 Ga0501074_0049037_927_2378 466
294 3300050516 nmdc:mga0sz30_1378_c2 nmdc:mga0sz30_1378_c2_394_1947 466
295 iso_pu_bacteria 8056207758 8056208008 466
296 3300003792 Ga0055540_1000326 Ga0055540_100032627 467
297 3300009101 Ga0105247_10000018 Ga0105247_10000018211 467
298 3300025303 Ga0209051_1000062 Ga0209051_1000062110 467
299 3300025304 Ga0209257_1001421 Ga0209257_100142121 467
300 3300031548 Ga0307408_100129088 Ga0307408_1001290882 467
301 3300037312 Ga0395899_0007976 Ga0395899_0007976_4712_6238 467
302 3300037312 Ga0395899_0020962 Ga0395899_0020962_2499_3974 467
303 3300037418 Ga0395900_0017366 Ga0395900_0017366_5700_7175 467
304 3300037466 Ga0395898_0000194 Ga0395898_0000194_148653_150128 467
305 iso_pu_bacteria 2995463766 2995464608 467
306 3300009011 Ga0105251_10000042 Ga0105251_1000004263 468
307 3300009092 Ga0105250_10000009 Ga0105250_10000009289 468
308 3300030521 Ga0307511_10045093 Ga0307511_100450933 468
309 3300038443 Ga0395901_0010327 Ga0395901_0010327_2523_4055 468
310 3300044656 Ga0466969_0019381 Ga0466969_0019381_85_1554 468
311 3300044684 Ga0466966_0001189 Ga0466966_0001189_10997_12475 468
312 3300044693 Ga0466961_0023957 Ga0466961_0023957_900_2378 468
313 3300044693 Ga0466961_0046272 Ga0466961_0046272_1227_2696 468
314 3300045049 Ga0466959_0005365 Ga0466959_0005365_5532_7010 468
315 3300048929 Ga0496126_0052530 Ga0496126_0052530_912_2405 468
316 3300002704 JGI25155J39150_1000015 JGI25155J39150_1000015157 469
317 3300002705 JGI25156J39149_1000007 JGI25156J39149_1000007158 469
318 3300002738 JGI25154J39366_1000051 JGI25154J39366_100005114 469
319 3300002741 JGI25157J39369_1000012 JGI25157J39369_100001242 469
320 3300025206 Ga0209435_100006 Ga0209435_100006366 469
321 3300025246 Ga0209646_1000015 Ga0209646_1000015168 469
322 3300025250 Ga0209026_1000046 Ga0209026_1000046168 469
323 3300025256 Ga0209759_1000005 Ga0209759_1000005366 469
324 3300030521 Ga0307511_10003267 Ga0307511_100032677 469
325 3300031507 Ga0307509_10032432 Ga0307509_100324325 469
326 3300033180 Ga0307510_10010903 Ga0307510_100109032 469
327 3300041411 Ga0439466_0036103 Ga0439466_0036103_58_1581 469
328 3300041999 Ga0439433_0002433 Ga0439433_0002433_1201_2724 469
329 3300044658 Ga0466972_0004406 Ga0466972_0004406_4174_5601 469
330 3300044684 Ga0466966_0001258 Ga0466966_0001258_13633_15045 469
331 3300044693 Ga0466961_0026854 Ga0466961_0026854_776_2203 469
332 3300044901 Ga0466960_0002389 Ga0466960_0002389_1283_2710 469
333 3300045049 Ga0466959_0006338 Ga0466959_0006338_256_1668 469
334 3300046477 Ga0495664_0000742 Ga0495664_0000742_10589_12031 469
335 3300046517 Ga0495630_0011755 Ga0495630_0011755_4537_5979 469
336 3300046536 Ga0495587_0002568 Ga0495587_0002568_9941_11383 469
337 3300046642 Ga0495634_0000378 Ga0495634_0000378_11999_13441 469
338 3300046663 Ga0495635_0000283 Ga0495635_0000283_21722_23164 469
339 3300046675 Ga0495657_0000049 Ga0495657_0000049_95109_96551 469
340 3300046689 Ga0495613_0001423 Ga0495613_0001423_1194_2636 469
341 3300047317 Ga0495604_0001396 Ga0495604_0001396_5843_7285 469
342 3300047321 Ga0495676_0026688 Ga0495676_0026688_2878_4320 469
343 3300047444 Ga0495675_0072350 Ga0495675_0072350_301_1743 469
344 3300047673 Ga0495593_0002496 Ga0495593_0002496_2671_4113 469
345 3300049571 Ga0501034_0000038 Ga0501034_0000038_230728_232236 469
346 3300049579 Ga0501043_0128852 Ga0501043_0128852_442_1950 469
347 iso_pu_bacteria 2862281513 2862283104 469
348 3300003320 rootH2_10021729 rootH2_100217294 470
349 3300003322 rootL2_10069804 rootL2_100698043 470
350 3300003856 Ga0058692_1006585 Ga0058692_10065851 470
351 3300005289 Ga0065704_10000345 Ga0065704_1000034513 470
352 3300005289 Ga0065704_10001325 Ga0065704_100013252 470
353 3300005289 Ga0065704_10007120 Ga0065704_100071202 470
354 3300005289 Ga0065704_10009879 Ga0065704_100098791 470
355 3300005338 Ga0068868_100059380 Ga0068868_1000593802 470
356 3300005548 Ga0070665_100000998 Ga0070665_10000099816 470
357 3300005577 Ga0068857_100007212 Ga0068857_1000072129 470
358 3300005616 Ga0068852_100053124 Ga0068852_1000531241 470
359 3300006051 Ga0075364_10002110 Ga0075364_100021103 470
360 3300006051 Ga0075364_10005201 Ga0075364_100052018 470
361 3300006195 Ga0075366_10057282 Ga0075366_100572822 470
362 3300006946 Ga0079104_1000109 Ga0079104_100010971 470
363 3300006946 Ga0079104_1000480 Ga0079104_100048023 470
364 3300006946 Ga0079104_1001200 Ga0079104_100120012 470
365 3300009011 Ga0105251_10001786 Ga0105251_1000178614 470
366 3300009036 Ga0105244_10001835 Ga0105244_1000183512 470
367 3300009036 Ga0105244_10022622 Ga0105244_100226223 470
368 3300013102 Ga0157371_10137366 Ga0157371_101373662 470
369 3300013104 Ga0157370_10000325 Ga0157370_1000032521 470
370 3300015679 Ga0183366_1001 Ga0183366_10011611 470
371 3300015680 Ga0183370_1001 Ga0183370_10011611 470
372 3300015685 Ga0183369_1001 Ga0183369_10011611 470
373 3300015687 Ga0183368_1001 Ga0183368_10011611 470
374 3300025711 Ga0207696_1011651 Ga0207696_10116512 470
375 3300025728 Ga0207655_1000001 Ga0207655_10000011525 470
376 3300025728 Ga0207655_1000002 Ga0207655_1000002932 470
377 3300025728 Ga0207655_1001213 Ga0207655_100121313 470
378 3300025735 Ga0207713_1000004 Ga0207713_1000004609 470
379 3300025901 Ga0207688_10027609 Ga0207688_100276092 470
380 3300026023 Ga0207677_10168114 Ga0207677_101681141 470
381 3300026116 Ga0207674_10011834 Ga0207674_100118343 470
382 3300027111 Ga0209281_1000004 Ga0209281_1000004937 470
383 3300027111 Ga0209281_1000006 Ga0209281_1000006687 470
384 3300027111 Ga0209281_1000024 Ga0209281_1000024126 470
385 3300027111 Ga0209281_1001417 Ga0209281_10014172 470
386 3300027312 Ga0209371_1000001 Ga0209371_10000011578 470
387 3300027312 Ga0209371_1003647 Ga0209371_10036473 470
388 3300028379 Ga0268266_10091692 Ga0268266_100916922 470
389 3300030500 Ga0268256_1000001 Ga0268256_10000011064 470
390 3300030500 Ga0268256_1004200 Ga0268256_10042006 470
391 3300042010 Ga0439452_000014 Ga0439452_000014_305137_306633 470
392 3300044669 Ga0466981_0000004 Ga0466981_0000004_140600_142096 470
393 3300044765 Ga0466970_0000147 Ga0466970_0000147_8246_9766 470
394 3300046458 Ga0495591_000003 Ga0495591_000003_178105_179601 470
395 3300046471 Ga0495650_0000005 Ga0495650_0000005_251508_253004 470
396 3300046471 Ga0495650_0000149 Ga0495650_0000149_5452_6921 470
397 3300046507 Ga0495606_0000318 Ga0495606_0000318_40461_41930 470
398 3300046524 Ga0495648_0026341 Ga0495648_0026341_1147_2616 470
399 3300046530 Ga0495654_0000055 Ga0495654_0000055_139984_141453 470
400 3300046660 Ga0495625_0010488 Ga0495625_0010488_134_1585 470
401 3300046692 Ga0495671_0006848 Ga0495671_0006848_4952_6421 470
402 3300046810 Ga0495660_0000017 Ga0495660_0000017_171888_173357 470
403 3300047320 Ga0495672_0000001 Ga0495672_0000001_1304213_1305682 470
404 3300047469 Ga0495673_0000007 Ga0495673_0000007_618309_619805 470
405 3300047469 Ga0495673_0000019 Ga0495673_0000019_405692_407161 470
406 3300048907 Ga0496104_0000633 Ga0496104_0000633_5771_7267 470
407 3300048908 Ga0496105_0029356 Ga0496105_0029356_2543_4039 470
408 3300048919 Ga0496116_0000204 Ga0496116_0000204_71083_72579 470
409 3300048920 Ga0496117_0000020 Ga0496117_0000020_25555_27051 470
410 3300048920 Ga0496117_0000993 Ga0496117_0000993_6573_8069 470
411 3300048921 Ga0496118_0000015 Ga0496118_0000015_40773_42269 470
412 3300048921 Ga0496118_0016244 Ga0496118_0016244_3723_5219 470
413 3300048922 Ga0496119_0017983 Ga0496119_0017983_1282_2778 470
414 3300048922 Ga0496119_0045962 Ga0496119_0045962_989_2485 470
415 3300048923 Ga0496120_0000096 Ga0496120_0000096_98565_100061 470
416 3300048923 Ga0496120_0001020 Ga0496120_0001020_24160_25656 470
417 3300048924 Ga0496121_0001063 Ga0496121_0001063_29764_31260 470
418 3300048924 Ga0496121_0002957 Ga0496121_0002957_6017_7513 470
419 3300048924 Ga0496121_0005652 Ga0496121_0005652_11623_13119 470
420 3300048924 Ga0496121_0012935 Ga0496121_0012935_5044_6540 470
421 3300048925 Ga0496122_0000005 Ga0496122_0000005_455997_457493 470
422 3300048925 Ga0496122_0001255 Ga0496122_0001255_4472_5968 470
423 3300048925 Ga0496122_0005324 Ga0496122_0005324_11335_12831 470
424 3300048925 Ga0496122_0005341 Ga0496122_0005341_10681_12177 470
425 3300048926 Ga0496123_0000008 Ga0496123_0000008_173136_174632 470
426 3300048926 Ga0496123_0000994 Ga0496123_0000994_4472_5968 470
427 3300048927 Ga0496124_0000984 Ga0496124_0000984_7774_9270 470
428 3300048928 Ga0496125_0001579 Ga0496125_0001579_9326_10822 470
429 3300048928 Ga0496125_0006056 Ga0496125_0006056_7838_9334 470
430 3300048928 Ga0496125_0013099 Ga0496125_0013099_1800_3296 470
431 3300048929 Ga0496126_0000349 Ga0496126_0000349_87122_88618 470
432 3300048929 Ga0496126_0000717 Ga0496126_0000717_56203_57699 470
433 3300049459 Ga0495678_000493 Ga0495678_000493_26490_27959 470
434 3300049460 Ga0495682_0000011 Ga0495682_0000011_164087_165556 470
435 3300053126 Ga0500621_000005 Ga0500621_000005_162401_163870 470
436 iso_pu_bacteria 2558860280 2559425583 470
437 iso_pu_bacteria 2738543034 2739366422 470
438 iso_pu_bacteria 2773857762 2774392942 470
439 iso_pu_bacteria 2784746763 2785346659 470
440 iso_pu_bacteria 2791355406 2793984119 470
441 iso_pu_bacteria 2808606439 2809196763 470
442 iso_pu_bacteria 2862382967 2862391537 470
443 iso_pu_bacteria 2891968417 2891971344 470
444 iso_pu_bacteria 8003314358 8003322324 470
445 iso_pu_bacteria 8008558824 8008560494 470
446 iso_pu_bacteria 8008574985 8008581307 470
447 iso_pu_bacteria 8047893842 8047901276 470
448 iso_pu_bacteria 8048127548 8048135668 470
449 iso_pu_bacteria 8048356638 8048357623 470
450 iso_pu_bacteria 8048369669 8048378217 470
451 iso_pu_bacteria 8048379754 8048387315 470
452 iso_pu_bacteria 8048406513 8048413949 470
453 iso_pu_bacteria 8056829672 8056830880 470
454 3300003856 Ga0058692_1000379 Ga0058692_100037912 471
455 3300005328 Ga0070676_10067664 Ga0070676_100676642 471
456 3300005364 Ga0070673_100105265 Ga0070673_1001052651 471
457 3300005455 Ga0070663_100001810 Ga0070663_1000018105 471
458 3300006177 Ga0075362_10028876 Ga0075362_100288762 471
459 3300006353 Ga0075370_10077717 Ga0075370_100777172 471
460 3300009011 Ga0105251_10000566 Ga0105251_1000056611 471
461 3300025908 Ga0207643_10012143 Ga0207643_100121432 471
462 3300026067 Ga0207678_10001242 Ga0207678_1000124217 471
463 3300026116 Ga0207674_10067560 Ga0207674_100675602 471
464 3300026121 Ga0207683_10202364 Ga0207683_102023642 471
465 3300027312 Ga0209371_1000407 Ga0209371_100040727 471
466 3300030500 Ga0268256_1001782 Ga0268256_10017825 471
467 3300037418 Ga0395900_0032077 Ga0395900_0032077_3135_4646 471
468 3300048906 Ga0496103_0082219 Ga0496103_0082219_284_1867 471
469 iso_pu_bacteria 2582581314 2585315247 471
470 iso_pu_bacteria 2616644814 2616693437 471
471 iso_pu_bacteria 2728369276 2729908860 471
472 iso_pu_bacteria 2811994878 2812351102 471
473 iso_pu_bacteria 2811994879 2812361344 471
474 iso_pu_bacteria 2852635781 2852642657 471
475 iso_pu_bacteria 2863404153 2863408175 471
476 iso_pu_bacteria 2899359706 2899367203 471
477 iso_pu_bacteria 2917736166 2917740940 471
478 iso_pu_bacteria 2946064051 2946064742 471
479 iso_pu_bacteria 2947224130 2947224705 471
480 iso_pu_bacteria 2990059506 2990065726 471
481 iso_pu_bacteria 2997600082 2997603380 471
482 iso_pu_bacteria 8056037122 8056038428 471
483 3300005347 Ga0070668_100011436 Ga0070668_1000114363 472
484 3300013100 Ga0157373_10006320 Ga0157373_100063203 472
485 3300013102 Ga0157371_10003636 Ga0157371_1000363612 472
486 3300013307 Ga0157372_10261885 Ga0157372_102618852 472
487 3300025972 Ga0207668_10036135 Ga0207668_100361352 472
488 3300031456 Ga0307513_10038677 Ga0307513_100386775 472
489 3300031507 Ga0307509_10019038 Ga0307509_100190385 472
490 3300031838 Ga0307518_10000779 Ga0307518_100007795 472
491 3300037418 Ga0395900_0022364 Ga0395900_0022364_3686_5125 472
492 3300037466 Ga0395898_0006197 Ga0395898_0006197_8487_9926 472
493 3300038443 Ga0395901_0021736 Ga0395901_0021736_2780_4219 472
494 3300039450 Ga0436363_0937583 Ga0436363_0937583_511_2043 472
495 3300041405 Ga0439438_000002 Ga0439438_000002_471231_472700 472
496 3300042014 Ga0439457_000762 Ga0439457_000762_6843_8285 472
497 3300044683 Ga0466965_0028939 Ga0466965_0028939_432_1856 472
498 3300046501 Ga0495607_0064271 Ga0495607_0064271_281_1756 472
499 3300046663 Ga0495635_0015722 Ga0495635_0015722_681_2135 472
500 3300048924 Ga0496121_0003286 Ga0496121_0003286_18471_20054 472
501 3300049130 Ga0501310_000011 Ga0501310_000011_10013_11524 472
502 3300050491 nmdc:mga00v17_12627_c1 nmdc:mga00v17_12627_c1_955_2538 472
503 3300053077 Ga0495601_0116409 Ga0495601_0116409_84_1538 472
504 3300053078 Ga0495612_0007165 Ga0495612_0007165_1434_2888 472
505 iso_pu_bacteria 2558860983 2561467691 472
506 iso_pu_bacteria 2585427649 2586059447 472
507 iso_pu_bacteria 2654587600 2655033852 472
508 iso_pu_bacteria 2808606359 2808845273 472
509 iso_pu_bacteria 2808606522 2809591799 472
510 iso_pu_bacteria 2915768154 2915768717 472
511 iso_pu_bacteria 3006486233 3006489723 472
512 iso_pu_bacteria 8056667051 8056668363 472
513 3300003322 rootL2_10000515 rootL2_100005152 473
514 3300003323 rootH1_10045263 rootH1_100452632 473
515 3300005539 Ga0068853_100099784 Ga0068853_1000997842 473
516 3300009545 Ga0105237_10178038 Ga0105237_101780381 473
517 3300009551 Ga0105238_10075987 Ga0105238_100759873 473
518 3300015688 Ga0183367_1001 Ga0183367_1001842 473
519 3300028786 Ga0307517_10004520 Ga0307517_1000452017 473
520 3300028794 Ga0307515_10000995 Ga0307515_1000099517 473
521 3300030521 Ga0307511_10005918 Ga0307511_100059182 473
522 3300031730 Ga0307516_10020950 Ga0307516_100209502 473
523 3300031838 Ga0307518_10152854 Ga0307518_101528541 473
524 3300038443 Ga0395901_0000801 Ga0395901_0000801_26953_28503 473
525 3300041512 Ga0451853_3737571 Ga0451853_3737571_1523_2971 473
526 3300041999 Ga0439433_0000402 Ga0439433_0000402_3342_4784 473
527 3300042131 Ga0450894_000179 Ga0450894_000179_1166_2614 473
528 3300042145 Ga0450906_001425 Ga0450906_001425_3298_4746 473
529 3300044656 Ga0466969_0033857 Ga0466969_0033857_867_2309 473
530 3300044684 Ga0466966_0021232 Ga0466966_0021232_2585_4027 473
531 3300044693 Ga0466961_0005046 Ga0466961_0005046_1411_2853 473
532 3300044735 Ga0466968_0010429 Ga0466968_0010429_1667_3109 473
533 3300046452 Ga0495617_004081 Ga0495617_004081_1233_2681 473
534 3300046455 Ga0495603_0012082 Ga0495603_0012082_3044_4492 473
535 3300046462 Ga0495651_0049803 Ga0495651_0049803_334_1782 473
536 3300046477 Ga0495664_0011257 Ga0495664_0011257_3546_4994 473
537 3300046499 Ga0495594_0022557 Ga0495594_0022557_1459_2907 473
538 3300046500 Ga0495596_0028639 Ga0495596_0028639_204_1652 473
539 3300046506 Ga0495583_0056821 Ga0495583_0056821_261_1709 473
540 3300046512 Ga0495610_0033859 Ga0495610_0033859_545_1993 473
541 3300046513 Ga0495616_0023037 Ga0495616_0023037_639_2087 473
542 3300046518 Ga0495631_0001116 Ga0495631_0001116_7749_9197 473
543 3300046522 Ga0495643_0001005 Ga0495643_0001005_4064_5512 473
544 3300046526 Ga0495666_0002702 Ga0495666_0002702_2855_4303 473
545 3300046528 Ga0495642_0012576 Ga0495642_0012576_540_1988 473
546 3300046529 Ga0495652_0076188 Ga0495652_0076188_706_2154 473
547 3300046530 Ga0495654_0017690 Ga0495654_0017690_1224_2672 473
548 3300046531 Ga0495665_0058587 Ga0495665_0058587_384_1832 473
549 3300046533 Ga0495640_0022132 Ga0495640_0022132_2229_3677 473
550 3300046542 Ga0495597_0019216 Ga0495597_0019216_348_1796 473
551 3300046559 Ga0495667_0058585 Ga0495667_0058585_151_1599 473
552 3300046616 Ga0495668_0007928 Ga0495668_0007928_4363_5811 473
553 3300046660 Ga0495625_0002090 Ga0495625_0002090_9986_11449 473
554 3300046674 Ga0495588_0004259 Ga0495588_0004259_512_1975 473
555 3300046794 Ga0495589_0060200 Ga0495589_0060200_328_1776 473
556 3300046809 Ga0495600_0136144 Ga0495600_0136144_89_1537 473
557 3300046810 Ga0495660_0052356 Ga0495660_0052356_500_1948 473
558 3300047317 Ga0495604_0055593 Ga0495604_0055593_1160_2608 473
559 3300047318 Ga0495636_0006035 Ga0495636_0006035_502_1956 473
560 3300047318 Ga0495636_0029339 Ga0495636_0029339_197_1645 473
561 3300047319 Ga0495674_0165798 Ga0495674_0165798_89_1537 473
562 3300047321 Ga0495676_0002192 Ga0495676_0002192_12676_14124 473
563 3300047321 Ga0495676_0005295 Ga0495676_0005295_1873_3321 473
564 3300047323 Ga0495683_0039006 Ga0495683_0039006_762_2210 473
565 3300047443 Ga0495687_003038 Ga0495687_003038_3645_5099 473
566 3300047470 Ga0495681_0000769 Ga0495681_0000769_16105_17568 473
567 3300048091 Ga0495626_0013857 Ga0495626_0013857_734_2182 473
568 3300048928 Ga0496125_0014219 Ga0496125_0014219_4209_5630 473
569 3300049130 Ga0501310_000451 Ga0501310_000451_1150_2598 473
570 3300053157 Ga0500624_001218 Ga0500624_001218_343_1791 473
571 iso_pu_bacteria 2784132109 2784471224 473
572 iso_pu_bacteria 2808606375 2808917713 473
573 iso_pu_bacteria 2873151551 2873152676 473
574 iso_pu_bacteria 2904765812 2904767701 473
575 iso_pu_bacteria 2904770941 2904774522 473
576 iso_pu_bacteria 2908811453 2908813345 473
577 iso_pu_bacteria 2919420072 2919424687 473
578 iso_pu_bacteria 2919432681 2919436932 473
579 iso_pu_bacteria 2933418574 2933420306 473
580 3300005564 Ga0070664_100267319 Ga0070664_1002673191 474
581 3300009148 Ga0105243_10046858 Ga0105243_100468582 474
582 3300011119 Ga0105246_10078707 Ga0105246_100787072 474
583 3300013102 Ga0157371_10007791 Ga0157371_100077913 474
584 3300025935 Ga0207709_10045900 Ga0207709_100459002 474
585 3300031649 Ga0307514_10005218 Ga0307514_100052182 474
586 3300031730 Ga0307516_10004980 Ga0307516_100049808 474
587 3300041405 Ga0439438_008736 Ga0439438_008736_1641_3155 474
588 3300041406 Ga0439439_0005795 Ga0439439_0005795_82_1596 474
589 3300041410 Ga0439461_0005423 Ga0439461_0005423_13_1527 474
590 3300042010 Ga0439452_015017 Ga0439452_015017_578_2092 474
591 3300042184 Ga0450908_008239 Ga0450908_008239_44_1558 474
592 3300044765 Ga0466970_0011408 Ga0466970_0011408_14_1492 474
593 3300046463 Ga0495653_0011692 Ga0495653_0011692_3912_5480 474
594 3300046501 Ga0495607_0027479 Ga0495607_0027479_1340_2926 474
595 3300046794 Ga0495589_0020250 Ga0495589_0020250_1009_2460 474
596 3300047321 Ga0495676_0009992 Ga0495676_0009992_5602_7053 474
597 3300047447 Ga0495685_003995 Ga0495685_003995_782_2233 474
598 3300048919 Ga0496116_0000167 Ga0496116_0000167_37906_39408 474
599 3300048925 Ga0496122_0096629 Ga0496122_0096629_421_1923 474
600 3300048927 Ga0496124_0048055 Ga0496124_0048055_659_2161 474
601 3300048929 Ga0496126_0000768 Ga0496126_0000768_19051_20553 474
602 3300059508 Ga0587088_001235 Ga0587088_001235_1013_2527 474
603 3300059510 Ga0587090_000123 Ga0587090_000123_3208_4722 474
604 iso_pu_bacteria 2554235227 2555230970 474
605 iso_pu_bacteria 2582581313 2585305871 474
606 iso_pu_bacteria 2643221616 2644094668 474
607 iso_pu_bacteria 2643221647 2644270237 474
608 iso_pu_bacteria 2643221678 2644441935 474
609 iso_pu_bacteria 2643221714 2644630642 474
610 iso_pu_bacteria 2728369276 2729909953 474
611 iso_pu_bacteria 2784132109 2784471226 474
612 iso_pu_bacteria 2784746768 2785366361 474
613 iso_pu_bacteria 2808606359 2808847002 474
614 iso_pu_bacteria 2867428634 2867435045 474
615 iso_pu_bacteria 2912715099 2912723471 474
616 iso_pu_bacteria 2919468124 2919470116 474
617 iso_pu_bacteria 2946072368 2946073111 474
618 iso_pu_bacteria 2954380949 2954389462 474
619 iso_pu_bacteria 2954691527 2954700240 474
620 iso_pu_bacteria 2954701450 2954701989 474
621 iso_pu_bacteria 2954711539 2954719009 474
622 iso_pu_bacteria 2954721474 2954728980 474
623 iso_pu_bacteria 2954731030 2954732831 474
624 iso_pu_bacteria 2954740390 2954747879 474
625 iso_pu_bacteria 2954749733 2954751709 474
626 iso_pu_bacteria 2954759201 2954767005 474
627 3300013105 Ga0157369_10119698 Ga0157369_101196983 475
628 3300042121 Ga0450919_003914 Ga0450919_003914_70_1518 475
629 3300046531 Ga0495665_0003646 Ga0495665_0003646_574_2016 475
630 3300048925 Ga0496122_0046280 Ga0496122_0046280_796_2265 475
631 3300048926 Ga0496123_0043706 Ga0496123_0043706_806_2275 475
632 iso_pu_bacteria 2565956761 2566993732 475
633 iso_pu_bacteria 2786546132 2786667351 475
634 iso_pu_bacteria 2802429606 2805936707 475
635 iso_pu_bacteria 2838016132 2838022309 475
636 iso_pu_bacteria 2838668709 2838671587 475
637 iso_pu_bacteria 2838701080 2838704147 475
638 iso_pu_bacteria 2842146304 2842149236 475
639 iso_pu_bacteria 2842250916 2842253597 475
640 iso_pu_bacteria 2842489311 2842491545 475
641 iso_pu_bacteria 2857740372 2857744197 475
642 iso_pu_bacteria 2862281513 2862282504 475
643 iso_pu_bacteria 2877676314 2877684155 475
644 iso_pu_bacteria 2904535858 2904536821 475
645 iso_pu_bacteria 2919034639 2919036552 475
646 iso_pu_bacteria 2919538618 2919541019 475
647 iso_pu_bacteria 2922554459 2922555257 475
648 iso_pu_bacteria 2932426870 2932427158 475
649 iso_pu_bacteria 2933418574 2933419778 475
650 iso_pu_bacteria 2939674588 2939677005 475
651 iso_pu_bacteria 2954673503 2954673505 475
652 iso_pu_bacteria 2954682443 2954690485 475
653 iso_pu_bacteria 2966598605 2966605176 475
654 iso_pu_bacteria 8024501048 8024505671 475
655 3300001990 JGI24737J22298_10018569 JGI24737J22298_100185692 476
656 3300006051 Ga0075364_10041471 Ga0075364_100414712 476
657 3300009098 Ga0105245_10196241 Ga0105245_101962412 476
658 3300025297 Ga0209758_1003466 Ga0209758_10034663 476
659 3300025933 Ga0207706_10060675 Ga0207706_100606753 476
660 3300030522 Ga0307512_10021735 Ga0307512_100217353 476
661 3300031649 Ga0307514_10015485 Ga0307514_100154855 476
662 3300041512 Ga0451853_3919652 Ga0451853_3919652_926_2365 476
663 3300042007 Ga0439449_0000789 Ga0439449_0000789_2943_4394 476
664 3300046616 Ga0495668_0000294 Ga0495668_0000294_56648_58093 476
665 3300050496 nmdc:mga07m45_17350_c1 nmdc:mga07m45_17350_c1_1548_2993 476
666 3300050496 nmdc:mga07m45_71866_c1 nmdc:mga07m45_71866_c1_251_1696 476
667 iso_pu_bacteria 2582581308 2585278115 476
668 iso_pu_bacteria 2582581316 2585332766 476
669 iso_pu_bacteria 2585427527 2585532225 476
670 iso_pu_bacteria 2585427530 2585552585 476
671 iso_pu_bacteria 2615840626 2616307633 476
672 iso_pu_bacteria 2615840698 2616552081 476
673 iso_pu_bacteria 2667528174 2671117026 476
674 iso_pu_bacteria 2791355261 2793325742 476
675 iso_pu_bacteria 2818991448 2819607362 476
676 iso_pu_bacteria 2818991453 2819640470 476
677 iso_pu_bacteria 2838022645 2838027284 476
678 iso_pu_bacteria 2838029111 2838032633 476
679 iso_pu_bacteria 2838048938 2838050650 476
680 iso_pu_bacteria 2838061910 2838062942 476
681 iso_pu_bacteria 2838068647 2838071890 476
682 iso_pu_bacteria 2841864319 2841869378 476
683 iso_pu_bacteria 2842198810 2842203343 476
684 iso_pu_bacteria 2842205361 2842210370 476
685 iso_pu_bacteria 2842264693 2842269706 476
686 iso_pu_bacteria 2842278818 2842283824 476
687 iso_pu_bacteria 2842285085 2842290825 476
688 iso_pu_bacteria 2842311132 2842311683 476
689 iso_pu_bacteria 2842317721 2842319095 476
690 iso_pu_bacteria 2842341865 2842344081 476
691 iso_pu_bacteria 2842363717 2842369608 476
692 iso_pu_bacteria 2842395702 2842396440 476
693 iso_pu_bacteria 2842402390 2842408759 476
694 iso_pu_bacteria 2842409023 2842415412 476
695 iso_pu_bacteria 2842415677 2842422034 476
696 iso_pu_bacteria 2842422224 2842425523 476
697 iso_pu_bacteria 2842428310 2842432570 476
698 iso_pu_bacteria 2842434925 2842438983 476
699 iso_pu_bacteria 2842441272 2842445612 476
700 iso_pu_bacteria 2842447887 2842450063 476
701 iso_pu_bacteria 2842462802 2842468002 476
702 iso_pu_bacteria 2842469257 2842473597 476
703 iso_pu_bacteria 2842475841 2842479365 476
704 iso_pu_bacteria 2842495871 2842499612 476
705 iso_pu_bacteria 2842502639 2842506476 476
706 iso_pu_bacteria 2904497146 2904500186 476
707 iso_pu_bacteria 2904776348 2904777026 476
708 iso_pu_bacteria 2919408235 2919412577 476
709 iso_pu_bacteria 2996887358 2996889589 476
710 iso_pu_bacteria 3005416602 3005417336 476
711 iso_pu_bacteria 8005314921 8005320416 476
712 iso_pu_bacteria 8005321885 8005324116 476
713 iso_pu_bacteria 8005484373 8005487388 476
714 iso_pu_bacteria 8005645114 8005651074 476
715 iso_pu_bacteria 8005682033 8005684360 476
716 iso_pu_bacteria 8054160619 8054162492 476
717 3300006042 Ga0075368_10002512 Ga0075368_100025124 477
718 3300006178 Ga0075367_10000224 Ga0075367_100002245 477
719 3300014497 Ga0182008_10002953 Ga0182008_100029535 477
720 3300015262 Ga0182007_10000552 Ga0182007_1000055214 477
721 3300015688 Ga0183367_1003 Ga0183367_1003530 477
722 3300025303 Ga0209051_1008810 Ga0209051_10088104 477
723 3300030522 Ga0307512_10007852 Ga0307512_100078524 477
724 3300031616 Ga0307508_10069406 Ga0307508_100694063 477
725 3300031838 Ga0307518_10000206 Ga0307518_1000020626 477
726 3300042012 Ga0439455_0000885 Ga0439455_0000885_970_2424 477
727 3300042138 Ga0450903_001397 Ga0450903_001397_1484_2938 477
728 3300042157 Ga0439458_0000085 Ga0439458_0000085_15918_17372 477
729 3300045836 Ga0466958_0001611 Ga0466958_0001611_9198_10742 477
730 3300046535 Ga0495586_0057727 Ga0495586_0057727_408_1988 477
731 3300046794 Ga0495589_0003485 Ga0495589_0003485_583_2052 477
732 3300049572 Ga0501036_0000951 Ga0501036_0000951_10173_11636 477
733 3300050494 nmdc:mga06z11_3132_c1 nmdc:mga06z11_3132_c1_1799_3256 477
734 iso_pu_bacteria 2509276033 2509448367 477
735 iso_pu_bacteria 2582581313 2585304046 477
736 iso_pu_bacteria 2643221647 2644263809 477
737 iso_pu_bacteria 2784132148 2784591904 477
738 iso_pu_bacteria 2784746768 2785373129 477
739 iso_pu_bacteria 2786546132 2786674907 477
740 iso_pu_bacteria 2791355259 2793317350 477
741 iso_pu_bacteria 2808606448 2809235515 477
742 iso_pu_bacteria 2852635781 2852636061 477
743 iso_pu_bacteria 2867428634 2867430794 477
744 iso_pu_bacteria 2877676314 2877677769 477
745 iso_pu_bacteria 2912715099 2912716058 477
746 iso_pu_bacteria 2912723979 2912729014 477
747 iso_pu_bacteria 2919468124 2919470936 477
748 iso_pu_bacteria 2947224130 2947225481 477
749 iso_pu_bacteria 2954380949 2954382554 477
750 iso_pu_bacteria 2954673503 2954680495 477
751 iso_pu_bacteria 2954682443 2954683657 477
752 iso_pu_bacteria 2954691527 2954693352 477
753 iso_pu_bacteria 2954701450 2954708446 477
754 iso_pu_bacteria 3006393351 3006393973 477
755 iso_pu_bacteria 3006493962 3006494775 477
756 iso_pu_bacteria 8005619151 8005625299 477
757 iso_pu_bacteria 8008574985 8008575920 477
758 iso_pu_bacteria 8056829672 8056836053 477
759 3300006846 Ga0075430_100146584 Ga0075430_1001465842 478
760 3300037853 Ga0436364_0423804 Ga0436364_0423804_506_2014 478
761 3300046674 Ga0495588_0003440 Ga0495588_0003440_3187_4761 478
762 3300048915 Ga0496112_0150397 Ga0496112_0150397_307_1785 478
763 3300049571 Ga0501034_0002524 Ga0501034_0002524_99_1562 478
764 3300049572 Ga0501036_0000952 Ga0501036_0000952_2062_3525 478
765 3300049575 Ga0501039_0010233 Ga0501039_0010233_5644_7107 478
766 3300049579 Ga0501043_0051108 Ga0501043_0051108_34_1497 478
767 3300049586 Ga0501070_0002167 Ga0501070_0002167_7692_9155 478
768 3300049590 Ga0501074_0006292 Ga0501074_0006292_71_1534 478
769 3300049822 Ga0501035_0003457 Ga0501035_0003457_13576_15039 478
770 3300049823 Ga0501044_0216947 Ga0501044_0216947_315_1778 478
771 iso_pu_bacteria 2547132424 2548696753 478
772 iso_pu_bacteria 2615840624 2616295292 478
773 iso_pu_bacteria 2718217927 2719388522 478
774 iso_pu_bacteria 2718217997 2719668148 478
775 iso_pu_bacteria 2718218009 2719728311 478
776 iso_pu_bacteria 2718218199 2720494911 478
777 iso_pu_bacteria 2718218232 2720611231 478
778 iso_pu_bacteria 2718218233 2720616404 478
779 iso_pu_bacteria 2718218235 2720629478 478
780 iso_pu_bacteria 2718218269 2720772049 478
781 iso_pu_bacteria 2718218363 2721145172 478
782 iso_pu_bacteria 2718218365 2721155910 478
783 iso_pu_bacteria 2718218366 2721167259 478
784 iso_pu_bacteria 2718218423 2721403145 478
785 iso_pu_bacteria 2721755514 2722838237 478
786 iso_pu_bacteria 2721755556 2723029480 478
787 iso_pu_bacteria 2721755684 2723563095 478
788 iso_pu_bacteria 2721755685 2723571076 478
789 iso_pu_bacteria 2721755809 2724035502 478
790 iso_pu_bacteria 2721755810 2724042505 478
791 iso_pu_bacteria 2721755819 2724086869 478
792 iso_pu_bacteria 2721755822 2724107027 478
793 iso_pu_bacteria 2721755823 2724107837 478
794 iso_pu_bacteria 2728369352 2730105794 478
795 iso_pu_bacteria 2728369365 2730162010 478
796 iso_pu_bacteria 2728369397 2730301017 478
797 iso_pu_bacteria 2791355256 2793298982 478
798 iso_pu_bacteria 2791355260 2793323943 478
799 iso_pu_bacteria 2791355262 2793333162 478
800 iso_pu_bacteria 2791355263 2793340051 478
801 iso_pu_bacteria 2791355264 2793346344 478
802 iso_pu_bacteria 2791355265 2793355547 478
803 iso_pu_bacteria 2791355267 2793369793 478
804 iso_pu_bacteria 2862290372 2862293801 478
805 iso_pu_bacteria 2919059106 2919059437 478
806 iso_pu_bacteria 2919713450 2919717633 478
807 iso_pu_bacteria 2933599457 2933602684 478
808 iso_pu_bacteria 2936381700 2936386521 478
809 iso_pu_bacteria 2939647034 2939651204 478
810 iso_pu_bacteria 2954002825 2954008325 478
811 iso_pu_bacteria 8005275841 8005277238 478
812 iso_pu_bacteria 8005282627 8005287752 478
813 iso_pu_bacteria 8005289223 8005289321 478
814 iso_pu_bacteria 8005301065 8005304913 478
815 iso_pu_bacteria 8005382845 8005388749 478
816 iso_pu_bacteria 8005395548 8005397548 478
817 iso_pu_bacteria 8005430974 8005436909 478
818 iso_pu_bacteria 8005497431 8005503162 478
819 iso_pu_bacteria 8005626139 8005630702 478
820 iso_pu_bacteria 8005668836 8005675080 478
821 iso_pu_bacteria 8005695170 8005701848 478
822 iso_pu_bacteria 8018127388 8018127878 478
823 iso_pu_bacteria 8018176218 8018182315 478
824 iso_pu_bacteria 8023623736 8023631442 478
825 iso_pu_bacteria 8056375014 8056375084 478
826 iso_pu_bacteria 8056382006 8056383618 478
827 3300003323 rootH1_10020478 rootH1_100204785 479
828 3300005614 Ga0068856_100011072 Ga0068856_1000110726 479
829 3300005614 Ga0068856_100064802 Ga0068856_1000648023 479
830 3300009093 Ga0105240_10000012 Ga0105240_10000012383 479
831 3300009545 Ga0105237_10034447 Ga0105237_100344473 479
832 3300010375 Ga0105239_10076423 Ga0105239_100764232 479
833 3300011119 Ga0105246_10077956 Ga0105246_100779562 479
834 3300013104 Ga0157370_10000078 Ga0157370_100000784 479
835 3300015262 Ga0182007_10000467 Ga0182007_100004677 479
836 3300025228 Ga0209672_105034 Ga0209672_1050342 479
837 3300025253 Ga0209677_100158 Ga0209677_10015812 479
838 3300025261 Ga0209233_1000161 Ga0209233_100016183 479
839 3300025315 Ga0207697_10002976 Ga0207697_100029763 479
840 3300025904 Ga0207647_10032327 Ga0207647_100323272 479
841 3300025913 Ga0207695_10000097 Ga0207695_10000097175 479
842 3300025914 Ga0207671_10000023 Ga0207671_10000023257 479
843 3300025981 Ga0207640_10063834 Ga0207640_100638342 479
844 3300026078 Ga0207702_10036199 Ga0207702_100361992 479
845 3300026078 Ga0207702_10150633 Ga0207702_101506332 479
846 3300030522 Ga0307512_10043303 Ga0307512_100433032 479
847 3300031616 Ga0307508_10038578 Ga0307508_100385783 479
848 3300031649 Ga0307514_10001738 Ga0307514_100017389 479
849 3300037466 Ga0395898_0048647 Ga0395898_0048647_2028_3494 479
850 3300041404 Ga0439436_0004122 Ga0439436_0004122_1792_3315 479
851 3300041999 Ga0439433_0006160 Ga0439433_0006160_520_2043 479
852 3300042007 Ga0439449_0013305 Ga0439449_0013305_590_2113 479
853 3300042014 Ga0439457_000374 Ga0439457_000374_4375_5898 479
854 3300044658 Ga0466972_0000697 Ga0466972_0000697_5914_7380 479
855 3300044658 Ga0466972_0002890 Ga0466972_0002890_1380_2846 479
856 3300044684 Ga0466966_0014776 Ga0466966_0014776_2295_3755 479
857 3300044693 Ga0466961_0020629 Ga0466961_0020629_2463_3998 479
858 3300044693 Ga0466961_0076304 Ga0466961_0076304_71_1537 479
859 3300044719 Ga0466971_0002086 Ga0466971_0002086_3039_4499 479
860 3300044765 Ga0466970_0001147 Ga0466970_0001147_2516_3982 479
861 3300044765 Ga0466970_0003166 Ga0466970_0003166_2376_3836 479
862 3300044765 Ga0466970_0005144 Ga0466970_0005144_2978_4429 479
863 3300044901 Ga0466960_0028193 Ga0466960_0028193_616_2082 479
864 3300045049 Ga0466959_0019321 Ga0466959_0019321_2947_4407 479
865 3300045836 Ga0466958_0003383 Ga0466958_0003383_3929_5389 479
866 3300045836 Ga0466958_0003456 Ga0466958_0003456_2958_4409 479
867 3300045976 Ga0466967_0016365 Ga0466967_0016365_97_1557 479
868 3300046455 Ga0495603_0075899 Ga0495603_0075899_384_1850 479
869 3300046462 Ga0495651_0089835 Ga0495651_0089835_301_1767 479
870 3300046477 Ga0495664_0024462 Ga0495664_0024462_1655_3121 479
871 3300046492 Ga0495585_0054994 Ga0495585_0054994_426_1892 479
872 3300046499 Ga0495594_0028964 Ga0495594_0028964_251_1717 479
873 3300046507 Ga0495606_0016139 Ga0495606_0016139_856_2322 479
874 3300046513 Ga0495616_0006775 Ga0495616_0006775_4465_5931 479
875 3300046514 Ga0495618_0051403 Ga0495618_0051403_594_2060 479
876 3300046516 Ga0495628_0079386 Ga0495628_0079386_282_1748 479
877 3300046517 Ga0495630_0078275 Ga0495630_0078275_280_1752 479
878 3300046533 Ga0495640_0023944 Ga0495640_0023944_2937_4403 479
879 3300046543 Ga0495645_0079914 Ga0495645_0079914_641_2107 479
880 3300046557 Ga0495622_0042990 Ga0495622_0042990_384_1850 479
881 3300046679 Ga0495623_0001555 Ga0495623_0001555_3054_4526 479
882 3300046679 Ga0495623_0037430 Ga0495623_0037430_763_2229 479
883 3300046690 Ga0495624_0015165 Ga0495624_0015165_1018_2484 479
884 3300046794 Ga0495589_0015969 Ga0495589_0015969_1402_2868 479
885 3300046809 Ga0495600_0014267 Ga0495600_0014267_1230_2696 479
886 3300046809 Ga0495600_0064174 Ga0495600_0064174_328_1800 479
887 3300046810 Ga0495660_0052408 Ga0495660_0052408_341_1807 479
888 3300047317 Ga0495604_0001987 Ga0495604_0001987_10916_12388 479
889 3300047321 Ga0495676_0104666 Ga0495676_0104666_499_1965 479
890 3300047322 Ga0495680_0014506 Ga0495680_0014506_4147_5613 479
891 3300047444 Ga0495675_0070964 Ga0495675_0070964_22_1488 479
892 3300047447 Ga0495685_006104 Ga0495685_006104_1298_2764 479
893 3300047471 Ga0495684_0089737 Ga0495684_0089737_527_1993 479
894 3300047673 Ga0495593_0040956 Ga0495593_0040956_205_1671 479
895 3300048906 Ga0496103_0003246 Ga0496103_0003246_4304_5755 479
896 3300048909 Ga0496106_0042915 Ga0496106_0042915_1729_3231 479
897 3300048920 Ga0496117_0002025 Ga0496117_0002025_14776_16227 479
898 3300048921 Ga0496118_0003588 Ga0496118_0003588_8266_9717 479
899 3300048921 Ga0496118_0004643 Ga0496118_0004643_10789_12348 479
900 3300048923 Ga0496120_0021217 Ga0496120_0021217_1929_3380 479
901 3300048926 Ga0496123_0019254 Ga0496123_0019254_1912_3363 479
902 3300048927 Ga0496124_0006099 Ga0496124_0006099_372_1823 479
903 3300048928 Ga0496125_0007198 Ga0496125_0007198_1579_3030 479
904 3300049569 Ga0501032_0114679 Ga0501032_0114679_291_1757 479
905 3300049571 Ga0501034_0027798 Ga0501034_0027798_3128_4594 479
906 3300049574 Ga0501038_0014219 Ga0501038_0014219_3437_4903 479
907 3300049574 Ga0501038_0026353 Ga0501038_0026353_3655_5121 479
908 3300049581 Ga0501047_0036860 Ga0501047_0036860_2861_4327 479
909 3300049742 Ga0501080_0031536 Ga0501080_0031536_2563_4029 479
910 3300049822 Ga0501035_0060475 Ga0501035_0060475_1816_3282 479
911 3300049823 Ga0501044_0008984 Ga0501044_0008984_1620_3089 479
912 3300049823 Ga0501044_0036839 Ga0501044_0036839_291_1757 479
913 3300060344 Ga0587071_009129 Ga0587071_009129_48_1562 479
914 3300061719 Ga0466962_0013373 Ga0466962_0013373_1692_3152 479
915 iso_pu_bacteria 2537561587 2537872925 479
916 iso_pu_bacteria 2547132111 2547412146 479
917 iso_pu_bacteria 2554235003 2554245161 479
918 iso_pu_bacteria 2558860242 2559297008 479
919 iso_pu_bacteria 2599185210 2599605078 479
920 iso_pu_bacteria 2600255279 2601611145 479
921 iso_pu_bacteria 2600255308 2601747918 479
922 iso_pu_bacteria 2616644814 2616698997 479
923 iso_pu_bacteria 2643221693 2644521251 479
924 iso_pu_bacteria 2808606387 2808989031 479
925 iso_pu_bacteria 2811994879 2812354439 479
926 iso_pu_bacteria 2818991439 2819557158 479
927 iso_pu_bacteria 2838675328 2838678304 479
928 iso_pu_bacteria 2838714209 2838716790 479
929 iso_pu_bacteria 2838719591 2838722600 479
930 iso_pu_bacteria 2838724970 2838727539 479
931 iso_pu_bacteria 2841846520 2841849145 479
932 iso_pu_bacteria 2841859092 2841861794 479
933 iso_pu_bacteria 2842124991 2842128106 479
934 iso_pu_bacteria 2842130223 2842133197 479
935 iso_pu_bacteria 2842152218 2842155191 479
936 iso_pu_bacteria 2842170452 2842173690 479
937 iso_pu_bacteria 2842175837 2842178812 479
938 iso_pu_bacteria 2842187318 2842189897 479
939 iso_pu_bacteria 2842211629 2842214211 479
940 iso_pu_bacteria 2842224351 2842226930 479
941 iso_pu_bacteria 2842515876 2842517940 479
942 iso_pu_bacteria 2867475112 2867476033 479
943 iso_pu_bacteria 2899792073 2899792884 479
944 iso_pu_bacteria 2899845264 2899845391 479
945 iso_pu_bacteria 2919114240 2919116981 479
946 iso_pu_bacteria 2926754445 2926758494 479
947 iso_pu_bacteria 2926760298 2926763974 479
948 iso_pu_bacteria 2933006813 2933009430 479
949 iso_pu_bacteria 2933011516 2933013569 479
950 iso_pu_bacteria 2933594066 2933598178 479
951 iso_pu_bacteria 2946064051 2946071264 479
952 iso_pu_bacteria 2954711539 2954713060 479
953 iso_pu_bacteria 2954721474 2954723020 479
954 iso_pu_bacteria 2954731030 2954738809 479
955 iso_pu_bacteria 2954740390 2954741929 479
956 iso_pu_bacteria 2954749733 2954757669 479
957 iso_pu_bacteria 2954759201 2954760906 479
958 iso_pu_bacteria 2979089926 2979090928 479
959 iso_pu_bacteria 2979095461 2979096453 479
960 iso_pu_bacteria 2979100975 2979102189 479
961 iso_pu_bacteria 2984509177 2984509862 479
962 iso_pu_bacteria 2984518228 2984519441 479
963 iso_pu_bacteria 2984537506 2984538201 479
964 iso_pu_bacteria 2984601300 2984604953 479
965 iso_pu_bacteria 2997451912 2997455168 479
966 iso_pu_bacteria 3002998708 3003001700 479
967 iso_pu_bacteria 650716007 650843434 479
968 iso_pu_bacteria 8004182704 8004184680 479
969 iso_pu_bacteria 8054160619 8054166223 479
970 3300009036 Ga0105244_10031860 Ga0105244_100318602 480
971 3300025728 Ga0207655_1043696 Ga0207655_10436961 480
972 3300046473 Ga0495582_0060366 Ga0495582_0060366_432_2000 480
973 3300046477 Ga0495664_0027542 Ga0495664_0027542_1560_3128 480
974 3300046499 Ga0495594_0036708 Ga0495594_0036708_691_2259 480
975 3300046531 Ga0495665_0007776 Ga0495665_0007776_3151_4719 480
976 3300046535 Ga0495586_0009888 Ga0495586_0009888_1493_3061 480
977 3300046536 Ga0495587_0012618 Ga0495587_0012618_1076_2644 480
978 3300046543 Ga0495645_0006857 Ga0495645_0006857_853_2421 480
979 3300046559 Ga0495667_0003973 Ga0495667_0003973_5005_6573 480
980 3300046679 Ga0495623_0017148 Ga0495623_0017148_1750_3318 480
981 3300046809 Ga0495600_0028844 Ga0495600_0028844_408_1976 480
982 3300047315 Ga0495581_0023949 Ga0495581_0023949_1320_2888 480
983 3300047317 Ga0495604_0065020 Ga0495604_0065020_20_1588 480
984 3300047444 Ga0495675_0009185 Ga0495675_0009185_683_2251 480
985 iso_pu_bacteria 2510917022 2511132629 480
986 iso_pu_bacteria 2582581307 2585275559 480
987 iso_pu_bacteria 2585427531 2585562585 480
988 iso_pu_bacteria 2585427608 2585899254 480
989 iso_pu_bacteria 2585427609 2585906247 480
990 iso_pu_bacteria 2585428125 2587981669 480
991 iso_pu_bacteria 2643221582 2643916884 480
992 iso_pu_bacteria 2784132109 2784471225 480
993 iso_pu_bacteria 2910809715 2910811841 480
994 iso_pu_bacteria 2974315732 2974316512 480
995 iso_pu_bacteria 2984523437 2984524685 480
996 iso_pu_bacteria 2984576629 2984578005 480
997 iso_pu_bacteria 2990256926 2990257519 480
998 iso_pu_bacteria 8003570095 8003573029 480
999 3300002773 JGI25152J39213_1001657 JGI25152J39213_10016576 481
1000 3300006042 Ga0075368_10002845 Ga0075368_100028457 481
1001 3300006048 Ga0075363_100000269 Ga0075363_10000026913 481
1002 3300006177 Ga0075362_10001446 Ga0075362_100014466 481
1003 3300006186 Ga0075369_10010268 Ga0075369_100102685 481
1004 3300006186 Ga0075369_10031488 Ga0075369_100314881 481
1005 3300006948 Ga0099826_10000059 Ga0099826_1000005928 481
1006 3300006948 Ga0099826_10033794 Ga0099826_100337942 481
1007 3300025258 Ga0209129_1000180 Ga0209129_10001809 481
1008 3300025294 Ga0209025_1000255 Ga0209025_1000255111 481
1009 3300025294 Ga0209025_1001712 Ga0209025_10017122 481
1010 3300027312 Ga0209371_1000003 Ga0209371_1000003825 481
1011 3300027312 Ga0209371_1001534 Ga0209371_10015345 481
1012 3300027666 Ga0209282_1000502 Ga0209282_100050211 481
1013 3300028379 Ga0268266_10015356 Ga0268266_100153565 481
1014 3300030500 Ga0268256_1000004 Ga0268256_1000004225 481
1015 3300030500 Ga0268256_1014568 Ga0268256_10145683 481
1016 3300030744 Ga0316181_1263973 Ga0316181_12639732 481
1017 3300037418 Ga0395900_0056878 Ga0395900_0056878_365_1852 481
1018 3300046535 Ga0495586_0094107 Ga0495586_0094107_160_1647 481
1019 3300047323 Ga0495683_0000192 Ga0495683_0000192_40741_42210 481
1020 3300048920 Ga0496117_0056492 Ga0496117_0056492_1158_2615 481
1021 3300048921 Ga0496118_0042228 Ga0496118_0042228_1202_2659 481
1022 3300050490 nmdc:mga03n38_4590_c1 nmdc:mga03n38_4590_c1_414_1880 481
1023 3300050491 nmdc:mga00v17_61394_c1 nmdc:mga00v17_61394_c1_180_1703 481
1024 3300059477 Ga0587084_004059 Ga0587084_004059_12_1463 481
1025 3300059505 Ga0587083_0008002 Ga0587083_0008002_156_1607 481
1026 3300059508 Ga0587088_005574 Ga0587088_005574_193_1644 481
1027 3300059510 Ga0587090_000982 Ga0587090_000982_1064_2515 481
1028 3300059511 Ga0587091_002210 Ga0587091_002210_630_2081 481
1029 3300059639 Ga0587062_000796 Ga0587062_000796_780_2231 481
1030 3300059643 Ga0587072_002733 Ga0587072_002733_199_1650 481
1031 iso_pu_bacteria 2509276019 2509376017 481
1032 iso_pu_bacteria 2558860100 2558862019 481
1033 iso_pu_bacteria 2744054900 2746087974 481
1034 iso_pu_bacteria 2744054901 2746097531 481
1035 iso_pu_bacteria 2758568016 2758639916 481
1036 iso_pu_bacteria 2775506735 2775657603 481
1037 iso_pu_bacteria 2808606357 2808829880 481
1038 iso_pu_bacteria 2808606360 2808851057 481
1039 iso_pu_bacteria 2808606370 2808894161 481
1040 iso_pu_bacteria 2808606371 2808897946 481
1041 iso_pu_bacteria 2811994871 2812318421 481
1042 iso_pu_bacteria 2850079185 2850083961 481
1043 iso_pu_bacteria 2945916053 2945916171 481
1044 iso_pu_bacteria 2945956166 2945959239 481
1045 iso_pu_bacteria 2946037020 2946040534 481
1046 iso_pu_bacteria 2946059875 2946059982 481
1047 iso_pu_bacteria 8056447290 8056451620 481
1048 iso_pu_bacteria 8056667051 8056673503 481
1049 3300003752 Ga0055539_1000019 Ga0055539_1000019201 482
1050 3300003756 Ga0055533_1000023 Ga0055533_1000023124 482
1051 3300003759 Ga0055525_1000088 Ga0055525_100008847 482
1052 3300003841 Ga0055541_1002437 Ga0055541_10024371 482
1053 3300025315 Ga0207697_10010229 Ga0207697_100102292 482
1054 3300031548 Ga0307408_100027030 Ga0307408_1000270302 482
1055 3300037418 Ga0395900_0029516 Ga0395900_0029516_1782_3296 482
1056 3300044765 Ga0466970_0032398 Ga0466970_0032398_993_2564 482
1057 3300045049 Ga0466959_0043937 Ga0466959_0043937_565_2136 482
1058 iso_pu_bacteria 2513237159 2513999219 482
1059 iso_pu_bacteria 2643221568 2643858020 482
1060 iso_pu_bacteria 2751185800 2753357415 482
1061 iso_pu_bacteria 2757320536 2758225455 482
1062 iso_pu_bacteria 2842521101 2842524966 482
1063 iso_pu_bacteria 2844849076 2844850572 482
1064 iso_pu_bacteria 2854911287 2854913429 482
1065 iso_pu_bacteria 2854916844 2854921109 482
1066 iso_pu_bacteria 2857740372 2857744851 482
1067 iso_pu_bacteria 2904497146 2904499116 482
1068 iso_pu_bacteria 2904776348 2904780606 482
1069 iso_pu_bacteria 2910809715 2910811436 482
1070 iso_pu_bacteria 2919034639 2919039088 482
1071 iso_pu_bacteria 2919166419 2919171016 482
1072 iso_pu_bacteria 2919538618 2919541319 482
1073 iso_pu_bacteria 2932426870 2932430170 482
1074 iso_pu_bacteria 2933418574 2933422143 482
1075 iso_pu_bacteria 2939674588 2939678951 482
1076 iso_pu_bacteria 2966924647 2966926360 482
1077 iso_pu_bacteria 2978969890 2978970447 482
1078 iso_pu_bacteria 2984587000 2984587478 482
1079 iso_pu_bacteria 8054460903 8054463608 482
1080 3300011119 Ga0105246_10004731 Ga0105246_100047316 483
1081 3300013100 Ga0157373_10023542 Ga0157373_100235422 483
1082 3300013102 Ga0157371_10000002 Ga0157371_1000000238 483
1083 3300013104 Ga0157370_10001455 Ga0157370_1000145515 483
1084 3300031548 Ga0307408_100085182 Ga0307408_1000851822 483
1085 3300046674 Ga0495588_0048544 Ga0495588_0048544_299_1840 483
1086 3300047470 Ga0495681_0010307 Ga0495681_0010307_383_2053 483
1087 3300048919 Ga0496116_0015029 Ga0496116_0015029_810_2375 483
1088 3300048920 Ga0496117_0000052 Ga0496117_0000052_117844_119517 483
1089 3300048921 Ga0496118_0000432 Ga0496118_0000432_13918_15591 483
1090 3300048922 Ga0496119_0055959 Ga0496119_0055959_263_1828 483
1091 3300048923 Ga0496120_0000019 Ga0496120_0000019_117844_119517 483
1092 3300048925 Ga0496122_0000053 Ga0496122_0000053_117844_119517 483
1093 3300048926 Ga0496123_0000038 Ga0496123_0000038_117844_119517 483
1094 3300050489 nmdc:mga03683_132_c1 nmdc:mga03683_132_c1_693_2258 483
1095 3300050491 nmdc:mga00v17_11_c1 nmdc:mga00v17_11_c1_3802_5367 483
1096 3300050492 nmdc:mga0yw44_96_c1 nmdc:mga0yw44_96_c1_17889_19454 483
1097 3300050494 nmdc:mga06z11_14488_c1 nmdc:mga06z11_14488_c1_484_2049 483
1098 3300050495 nmdc:mga04h51_6837_c1 nmdc:mga04h51_6837_c1_484_2049 483
1099 3300050516 nmdc:mga0sz30_485_c1 nmdc:mga0sz30_485_c1_5497_7062 483
1100 3300053137 Ga0500561_0000033 Ga0500561_0000033_15642_17207 483
1101 iso_pu_bacteria 2919051321 2919055147 483
1102 iso_pu_bacteria 2919059106 2919060900 483
1103 iso_pu_bacteria 2929138655 2929143285 483
1104 iso_pu_bacteria 2939647034 2939651245 483
1105 iso_pu_bacteria 2974294766 2974295645 483
1106 iso_pu_bacteria 2974324384 2974324552 483
1107 3300005288 Ga0065714_10004525 Ga0065714_100045251 484
1108 3300005328 Ga0070676_10001857 Ga0070676_100018573 484
1109 3300005331 Ga0070670_100049013 Ga0070670_1000490133 484
1110 3300005331 Ga0070670_100056374 Ga0070670_1000563742 484
1111 3300005353 Ga0070669_100010732 Ga0070669_1000107323 484
1112 3300005354 Ga0070675_100012523 Ga0070675_1000125234 484
1113 3300005355 Ga0070671_100047239 Ga0070671_1000472392 484
1114 3300006051 Ga0075364_10000193 Ga0075364_1000019317 484
1115 3300006058 Ga0075432_10005837 Ga0075432_100058373 484
1116 3300009011 Ga0105251_10015859 Ga0105251_100158591 484
1117 3300009036 Ga0105244_10013325 Ga0105244_100133254 484
1118 3300009098 Ga0105245_10087458 Ga0105245_100874582 484
1119 3300011119 Ga0105246_10031207 Ga0105246_100312072 484
1120 3300013306 Ga0163162_10084787 Ga0163162_100847873 484
1121 3300021327 Ga0214543_1003948 Ga0214543_10039488 484
1122 3300025728 Ga0207655_1017637 Ga0207655_10176373 484
1123 3300025735 Ga0207713_1025983 Ga0207713_10259832 484
1124 3300025893 Ga0207682_10005202 Ga0207682_100052022 484
1125 3300025907 Ga0207645_10001051 Ga0207645_1000105112 484
1126 3300025925 Ga0207650_10005626 Ga0207650_100056267 484
1127 3300025926 Ga0207659_10007512 Ga0207659_100075123 484
1128 3300025927 Ga0207687_10135981 Ga0207687_101359811 484
1129 3300025935 Ga0207709_10084128 Ga0207709_100841282 484
1130 3300025937 Ga0207669_10013591 Ga0207669_100135912 484
1131 3300025940 Ga0207691_10012886 Ga0207691_100128864 484
1132 3300026121 Ga0207683_10006658 Ga0207683_100066585 484
1133 3300031824 Ga0307413_10017362 Ga0307413_100173622 484
1134 3300031852 Ga0307410_10002024 Ga0307410_100020244 484
1135 3300031911 Ga0307412_10003191 Ga0307412_100031916 484
1136 3300041404 Ga0439436_0000195 Ga0439436_0000195_1880_3355 484
1137 3300041411 Ga0439466_0008105 Ga0439466_0008105_1584_3098 484
1138 3300041413 Ga0439465_0001310 Ga0439465_0001310_3508_4983 484
1139 3300041413 Ga0439465_0004124 Ga0439465_0004124_2741_4255 484
1140 3300041999 Ga0439433_0004144 Ga0439433_0004144_1270_2784 484
1141 3300042007 Ga0439449_0001574 Ga0439449_0001574_4290_5804 484
1142 3300046475 Ga0495639_0030573 Ga0495639_0030573_25_1539 484
1143 3300046476 Ga0495662_0006897 Ga0495662_0006897_97_1611 484
1144 3300046477 Ga0495664_0008887 Ga0495664_0008887_24_1538 484
1145 3300046536 Ga0495587_0003374 Ga0495587_0003374_1573_3087 484
1146 3300046543 Ga0495645_0004124 Ga0495645_0004124_7501_9015 484
1147 3300046559 Ga0495667_0005045 Ga0495667_0005045_6169_7683 484
1148 3300046675 Ga0495657_0032047 Ga0495657_0032047_161_1675 484
1149 3300047315 Ga0495581_0024488 Ga0495581_0024488_1167_2681 484
1150 3300047317 Ga0495604_0035514 Ga0495604_0035514_2312_3826 484
1151 3300047319 Ga0495674_0190311 Ga0495674_0190311_155_1669 484
1152 3300048903 Ga0496100_0086666 Ga0496100_0086666_134_1648 484
1153 3300048904 Ga0496101_0013834 Ga0496101_0013834_2658_4172 484
1154 3300048905 Ga0496102_0116561 Ga0496102_0116561_256_1770 484
1155 3300048906 Ga0496103_0005572 Ga0496103_0005572_1679_3181 484
1156 3300048906 Ga0496103_0093038 Ga0496103_0093038_256_1770 484
1157 3300048907 Ga0496104_0022013 Ga0496104_0022013_2020_3534 484
1158 3300048908 Ga0496105_0016719 Ga0496105_0016719_359_1873 484
1159 3300048909 Ga0496106_0091902 Ga0496106_0091902_67_1581 484
1160 3300048910 Ga0496107_0023999 Ga0496107_0023999_908_2422 484
1161 3300048911 Ga0496108_0024226 Ga0496108_0024226_3408_4922 484
1162 3300048911 Ga0496108_0044250 Ga0496108_0044250_1472_2986 484
1163 3300048911 Ga0496108_0085898 Ga0496108_0085898_237_1754 484
1164 3300048912 Ga0496109_0105305 Ga0496109_0105305_908_2422 484
1165 3300048913 Ga0496110_0147545 Ga0496110_0147545_256_1770 484
1166 3300048914 Ga0496111_0073280 Ga0496111_0073280_67_1581 484
1167 3300048916 Ga0496113_0056348 Ga0496113_0056348_908_2422 484
1168 3300048917 Ga0496114_0019171 Ga0496114_0019171_3252_4766 484
1169 3300048918 Ga0496115_0088507 Ga0496115_0088507_541_2055 484
1170 3300048924 Ga0496121_0000337 Ga0496121_0000337_52085_53560 484
1171 3300048927 Ga0496124_0028720 Ga0496124_0028720_626_2140 484
1172 3300050491 nmdc:mga00v17_178_c1 nmdc:mga00v17_178_c1_17185_18660 484
1173 3300053157 Ga0500624_000520 Ga0500624_000520_5571_7175 484
1174 3300053161 Ga0500634_0003753 Ga0500634_0003753_315_1790 484
1175 3300053177 Ga0500636_0000039 Ga0500636_0000039_53052_54521 484
1176 3300059514 Ga0587095_000115 Ga0587095_000115_1552_3078 484
1177 iso_pu_bacteria 2690315906 2691511824 484
1178 iso_pu_bacteria 2773857759 2774383207 484
1179 iso_pu_bacteria 2773857762 2774397213 484
1180 iso_pu_bacteria 2775506735 2775657246 484
1181 iso_pu_bacteria 2808606357 2808829010 484
1182 iso_pu_bacteria 2808606360 2808850235 484
1183 iso_pu_bacteria 2808606366 2808877212 484
1184 iso_pu_bacteria 2808606370 2808893254 484
1185 iso_pu_bacteria 2808606371 2808898671 484
1186 iso_pu_bacteria 2811994871 2812319253 484
1187 iso_pu_bacteria 2945916053 2945917006 484
1188 iso_pu_bacteria 2945920336 2945922746 484
1189 iso_pu_bacteria 2945920336 2945923720 484
1190 iso_pu_bacteria 2946024296 2946024944 484
1191 iso_pu_bacteria 2946037020 2946041569 484
1192 iso_pu_bacteria 2946059875 2946060836 484
1193 iso_pu_bacteria 2953998280 2954001794 484
1194 iso_pu_bacteria 2953998280 2954002770 484
1195 iso_pu_bacteria 2974302888 2974305010 484
1196 iso_pu_bacteria 2974302888 2974305418 484
1197 iso_pu_bacteria 2997451912 2997452375 484
1198 3300003323 rootH1_10072379 rootH1_100723798 485
1199 3300005327 Ga0070658_10155017 Ga0070658_101550172 485
1200 3300025253 Ga0209677_102523 Ga0209677_1025233 485
1201 3300031731 Ga0307405_10068937 Ga0307405_100689371 485
1202 3300031903 Ga0307407_10063097 Ga0307407_100630972 485
1203 3300037312 Ga0395899_0010636 Ga0395899_0010636_1752_3320 485
1204 3300037466 Ga0395898_0007917 Ga0395898_0007917_9647_11185 485
1205 3300039437 Ga0436365_1804934 Ga0436365_1804934_36_1592 485
1206 3300042002 Ga0439442_000315 Ga0439442_000315_2944_4518 485
1207 3300044765 Ga0466970_0007014 Ga0466970_0007014_1269_2804 485
1208 3300046615 Ga0495656_0004570 Ga0495656_0004570_1883_3406 485
1209 3300048925 Ga0496122_0005506 Ga0496122_0005506_3412_4881 485
1210 3300048928 Ga0496125_0000358 Ga0496125_0000358_36082_37551 485
1211 3300049569 Ga0501032_0003609 Ga0501032_0003609_7069_8583 485
1212 3300049573 Ga0501037_0070992 Ga0501037_0070992_304_1818 485
1213 3300049823 Ga0501044_0117842 Ga0501044_0117842_911_2425 485
1214 3300050507 nmdc:mga05p37_174620_c1 nmdc:mga05p37_174620_c1_376_1917 485
1215 3300059508 Ga0587088_001153 Ga0587088_001153_32_1546 485
1216 3300059510 Ga0587090_000138 Ga0587090_000138_1506_3047 485
1217 3300059604 Ga0587098_000351 Ga0587098_000351_1115_2635 485
1218 3300059626 Ga0587115_000278 Ga0587115_000278_182_1723 485
1219 3300059630 Ga0587128_000022 Ga0587128_000022_3311_4852 485
1220 3300059660 Ga0587124_000008 Ga0587124_000008_1282_2823 485
1221 iso_pu_bacteria 2690315906 2691512637 485
1222 iso_pu_bacteria 2773857758 2774379589 485
1223 iso_pu_bacteria 2904430863 2904434036 485
1224 iso_pu_bacteria 2904509784 2904512970 485
1225 iso_pu_bacteria 2908674828 2908676789 485
1226 iso_pu_bacteria 2908678064 2908679388 485
1227 iso_pu_bacteria 2909074476 2909077018 485
1228 iso_pu_bacteria 2919039151 2919039630 485
1229 iso_pu_bacteria 2919069694 2919070027 485
1230 iso_pu_bacteria 2928500415 2928503328 485
1231 iso_pu_bacteria 2945956166 2945956222 485
1232 iso_pu_bacteria 2977228692 2977229585 485
1233 iso_pu_bacteria 2977236895 2977238368 485
1234 iso_pu_bacteria 2984542743 2984543851 485
1235 iso_pu_bacteria 8054107350 8054108883 485
1236 3300003792 Ga0055540_1000102 Ga0055540_100010282 486
1237 3300005331 Ga0070670_100145467 Ga0070670_1001454671 486
1238 3300005333 Ga0070677_10005553 Ga0070677_100055533 486
1239 3300005354 Ga0070675_100014679 Ga0070675_1000146795 486
1240 3300005355 Ga0070671_100050040 Ga0070671_1000500402 486
1241 3300005367 Ga0070667_100161053 Ga0070667_1001610532 486
1242 3300009036 Ga0105244_10021407 Ga0105244_100214071 486
1243 3300009177 Ga0105248_10163942 Ga0105248_101639422 486
1244 3300025225 Ga0209566_100031 Ga0209566_100031124 486
1245 3300025226 Ga0209674_100001 Ga0209674_1000012028 486
1246 3300025230 Ga0209563_100001 Ga0209563_1000012028 486
1247 3300025230 Ga0209563_100155 Ga0209563_1001559 486
1248 3300025253 Ga0209677_100001 Ga0209677_1000012028 486
1249 3300025728 Ga0207655_1005663 Ga0207655_10056636 486
1250 3300025893 Ga0207682_10000870 Ga0207682_100008705 486
1251 3300025901 Ga0207688_10018592 Ga0207688_100185922 486
1252 3300025907 Ga0207645_10005766 Ga0207645_100057662 486
1253 3300025925 Ga0207650_10037411 Ga0207650_100374112 486
1254 3300025926 Ga0207659_10050333 Ga0207659_100503331 486
1255 3300025940 Ga0207691_10014615 Ga0207691_100146156 486
1256 3300026121 Ga0207683_10017060 Ga0207683_100170602 486
1257 3300031995 Ga0307409_100256776 Ga0307409_1002567761 486
1258 3300032002 Ga0307416_100050099 Ga0307416_1000500992 486
1259 3300037418 Ga0395900_0142728 Ga0395900_0142728_642_2180 486
1260 3300038443 Ga0395901_0049549 Ga0395901_0049549_1548_3086 486
1261 3300039437 Ga0436365_1486359 Ga0436365_1486359_4032_5522 486
1262 3300044693 Ga0466961_0080319 Ga0466961_0080319_152_1720 486
1263 3300044765 Ga0466970_0012299 Ga0466970_0012299_601_2148 486
1264 3300044842 Ga0466957_0074184 Ga0466957_0074184_444_2012 486
1265 3300048090 Ga0495615_0010729 Ga0495615_0010729_44_1618 486
1266 3300048909 Ga0496106_0129451 Ga0496106_0129451_308_1891 486
1267 3300048911 Ga0496108_0175398 Ga0496108_0175398_18_1601 486
1268 3300048913 Ga0496110_0178049 Ga0496110_0178049_227_1810 486
1269 3300048915 Ga0496112_0072862 Ga0496112_0072862_355_1938 486
1270 3300048918 Ga0496115_0167767 Ga0496115_0167767_62_1645 486
1271 3300048920 Ga0496117_0003132 Ga0496117_0003132_13140_14684 486
1272 3300048921 Ga0496118_0000640 Ga0496118_0000640_33057_34601 486
1273 3300048924 Ga0496121_0000005 Ga0496121_0000005_664224_665702 486
1274 3300048925 Ga0496122_0004580 Ga0496122_0004580_8201_9676 486
1275 3300048925 Ga0496122_0066908 Ga0496122_0066908_362_1897 486
1276 3300048927 Ga0496124_0000070 Ga0496124_0000070_3784_5319 486
1277 3300048927 Ga0496124_0003218 Ga0496124_0003218_7406_8977 486
1278 3300048927 Ga0496124_0043699 Ga0496124_0043699_1503_2981 486
1279 3300048928 Ga0496125_0000163 Ga0496125_0000163_31953_33431 486
1280 3300048928 Ga0496125_0108077 Ga0496125_0108077_154_1737 486
1281 3300049128 Ga0501308_001792 Ga0501308_001792_24_1538 486
1282 3300049586 Ga0501070_0000065 Ga0501070_0000065_21168_22739 486
1283 iso_pu_bacteria 2751185788 2753302520 486
1284 iso_pu_bacteria 2893684298 2893686171 486
1285 iso_pu_bacteria 2928104781 2928105845 486
1286 iso_pu_bacteria 2984551494 2984554682 486
1287 3300003758 Ga0055532_1000750 Ga0055532_10007507 487
1288 3300031548 Ga0307408_100091679 Ga0307408_1000916791 487
1289 3300041404 Ga0439436_0011031 Ga0439436_0011031_352_1902 487
1290 3300041999 Ga0439433_0001637 Ga0439433_0001637_2922_4472 487
1291 3300042007 Ga0439449_0017073 Ga0439449_0017073_1134_2684 487
1292 3300044901 Ga0466960_0024589 Ga0466960_0024589_26_1624 487
1293 3300046472 Ga0495580_0004805 Ga0495580_0004805_6411_7928 487
1294 3300048915 Ga0496112_0006644 Ga0496112_0006644_8607_10124 487
1295 3300048921 Ga0496118_0040502 Ga0496118_0040502_2155_3657 487
1296 3300048922 Ga0496119_0002729 Ga0496119_0002729_16362_17864 487
1297 3300048923 Ga0496120_0002192 Ga0496120_0002192_9632_11134 487
1298 3300048925 Ga0496122_0000031 Ga0496122_0000031_173122_174624 487
1299 3300048926 Ga0496123_0000013 Ga0496123_0000013_173132_174634 487
1300 3300053177 Ga0500636_0007158 Ga0500636_0007158_4701_6185 487
1301 3300059477 Ga0587084_000309 Ga0587084_000309_1881_3392 487
1302 3300059490 Ga0587066_000629 Ga0587066_000629_1499_3010 487
1303 3300059491 Ga0587070_001326 Ga0587070_001326_968_2488 487
1304 3300059510 Ga0587090_002985 Ga0587090_002985_373_1884 487
1305 3300059511 Ga0587091_000092 Ga0587091_000092_3314_4825 487
1306 3300059512 Ga0587092_000499 Ga0587092_000499_1550_3061 487
1307 3300059513 Ga0587094_002376 Ga0587094_002376_420_1931 487
1308 3300059623 Ga0587101_000289 Ga0587101_000289_1541_3052 487
1309 3300059630 Ga0587128_000197 Ga0587128_000197_17_1528 487
1310 3300059630 Ga0587128_001628 Ga0587128_001628_97_1614 487
1311 3300059639 Ga0587062_001343 Ga0587062_001343_408_1919 487
1312 3300059642 Ga0587069_002201 Ga0587069_002201_418_1929 487
1313 3300059647 Ga0587079_000356 Ga0587079_000356_236_1747 487
1314 3300059652 Ga0587107_001234 Ga0587107_001234_350_1861 487
1315 iso_pu_bacteria 2643221616 2644097966 487
1316 iso_pu_bacteria 2891968417 2891969856 487
1317 iso_pu_bacteria 2977264416 2977264850 487
1318 iso_pu_bacteria 8016254467 8016255872 487
1319 3300002773 JGI25152J39213_1000585 JGI25152J39213_100058513 488
1320 3300003760 Ga0055527_1000025 Ga0055527_1000025171 488
1321 3300003762 Ga0055542_1000048 Ga0055542_1000048171 488
1322 3300003763 Ga0055529_1000057 Ga0055529_100005710 488
1323 3300009148 Ga0105243_10167044 Ga0105243_101670441 488
1324 3300011119 Ga0105246_10005032 Ga0105246_100050325 488
1325 3300013308 Ga0157375_10002937 Ga0157375_100029374 488
1326 3300025228 Ga0209672_100011 Ga0209672_100011829 488
1327 3300025229 Ga0209147_101101 Ga0209147_1011016 488
1328 3300025242 Ga0209258_101738 Ga0209258_1017384 488
1329 3300025245 Ga0207425_1005693 Ga0207425_10056932 488
1330 3300025254 Ga0209148_1000023 Ga0209148_1000023667 488
1331 3300025258 Ga0209129_1000130 Ga0209129_100013043 488
1332 3300025272 Ga0209455_1000023 Ga0209455_1000023667 488
1333 3300025294 Ga0209025_1000364 Ga0209025_100036483 488
1334 3300031548 Ga0307408_100005443 Ga0307408_1000054438 488
1335 3300031731 Ga0307405_10061240 Ga0307405_100612402 488
1336 3300031852 Ga0307410_10106503 Ga0307410_101065031 488
1337 3300031903 Ga0307407_10028674 Ga0307407_100286742 488
1338 3300031911 Ga0307412_10126774 Ga0307412_101267741 488
1339 3300031995 Ga0307409_100100232 Ga0307409_1001002322 488
1340 3300032002 Ga0307416_100016188 Ga0307416_1000161882 488
1341 3300032126 Ga0307415_100060700 Ga0307415_1000607002 488
1342 3300046518 Ga0495631_0033175 Ga0495631_0033175_525_2105 488
1343 3300046558 Ga0495633_0021197 Ga0495633_0021197_830_2410 488
1344 3300046615 Ga0495656_0004184 Ga0495656_0004184_332_1912 488
1345 3300046691 Ga0495670_0005066 Ga0495670_0005066_4876_6456 488
1346 3300047318 Ga0495636_0011881 Ga0495636_0011881_155_1735 488
1347 3300048905 Ga0496102_0147520 Ga0496102_0147520_359_1870 488
1348 3300048906 Ga0496103_0002458 Ga0496103_0002458_2637_4148 488
1349 3300048908 Ga0496105_0017915 Ga0496105_0017915_4016_5527 488
1350 3300048909 Ga0496106_0013608 Ga0496106_0013608_130_1641 488
1351 3300048910 Ga0496107_0012130 Ga0496107_0012130_1864_3375 488
1352 3300048914 Ga0496111_0000389 Ga0496111_0000389_8177_9688 488
1353 3300048927 Ga0496124_0053042 Ga0496124_0053042_1401_2924 488
1354 iso_pu_bacteria 2773857763 2774398577 488
1355 iso_pu_bacteria 2808606439 2809198850 488
1356 iso_pu_bacteria 2884763398 2884766758 488
1357 iso_pu_bacteria 2905926851 2905926893 488
1358 iso_pu_bacteria 2945941187 2945943515 488
1359 iso_pu_bacteria 2945941187 2945945048 488
1360 3300003762 Ga0055542_1002667 Ga0055542_10026676 489
1361 3300006042 Ga0075368_10032139 Ga0075368_100321391 489
1362 3300009545 Ga0105237_10006031 Ga0105237_100060317 489
1363 3300025254 Ga0209148_1003076 Ga0209148_10030762 489
1364 3300049744 Ga0501083_0000047 Ga0501083_0000047_39127_40746 489
1365 iso_pu_bacteria 2739367653 2739603847 489
1366 iso_pu_bacteria 2844849076 2844850129 489
1367 iso_pu_bacteria 2857727296 2857729424 489
1368 iso_pu_bacteria 2945941187 2945945473 489
1369 3300044765 Ga0466970_0069383 Ga0466970_0069383_79_1710 490
1370 3300048903 Ga0496100_0070600 Ga0496100_0070600_322_1917 490
1371 3300048909 Ga0496106_0014747 Ga0496106_0014747_158_1753 490
1372 3300048910 Ga0496107_0001472 Ga0496107_0001472_5348_6943 490
1373 3300048914 Ga0496111_0056392 Ga0496111_0056392_387_1982 490
1374 3300048914 Ga0496111_0155067 Ga0496111_0155067_30_1625 490
1375 3300049570 Ga0501033_0026256 Ga0501033_0026256_273_1874 490
1376 3300049578 Ga0501042_0000193 Ga0501042_0000193_12109_13716 490
1377 3300049823 Ga0501044_0130605 Ga0501044_0130605_474_2075 490
1378 3300049823 Ga0501044_0156074 Ga0501044_0156074_68_1657 490
1379 iso_pu_bacteria 2811994878 2812352547 490
1380 iso_pu_bacteria 2893684298 2893686172 490
1381 iso_pu_bacteria 2920879853 2920883836 490
1382 iso_pu_bacteria 2966921586 2966923287 490
1383 3300002773 JGI25152J39213_1000175 JGI25152J39213_10001756 491
1384 3300009148 Ga0105243_10001837 Ga0105243_100018375 491
1385 3300011119 Ga0105246_10000078 Ga0105246_1000007822 491
1386 3300025258 Ga0209129_1000220 Ga0209129_100022040 491
1387 3300025294 Ga0209025_1000586 Ga0209025_100058617 491
1388 3300025302 Ga0207426_1000393 Ga0207426_100039310 491
1389 3300025935 Ga0207709_10008572 Ga0207709_100085722 491
1390 3300048917 Ga0496114_0005471 Ga0496114_0005471_3549_5102 491
1391 3300002772 JGI25164J39214_1000743 JGI25164J39214_10007437 492
1392 3300013104 Ga0157370_10002083 Ga0157370_100020836 492
1393 3300025231 Ga0207427_100028 Ga0207427_100028306 492
1394 3300025233 Ga0209437_101468 Ga0209437_1014683 492
1395 3300025261 Ga0209233_1000001 Ga0209233_1000001804 492
1396 3300027907 Ga0207428_10010431 Ga0207428_100104314 492
1397 3300046691 Ga0495670_0003593 Ga0495670_0003593_3624_5147 492
1398 3300047318 Ga0495636_0004898 Ga0495636_0004898_1207_2730 492
1399 3300047445 Ga0495677_0004977 Ga0495677_0004977_2380_3903 492
1400 3300049744 Ga0501083_0002277 Ga0501083_0002277_2329_3915 492
1401 iso_pu_bacteria 2643221619 2644112537 492
1402 iso_pu_bacteria 2816332305 2817510033 492
1403 3300006186 Ga0075369_10020933 Ga0075369_100209332 493
1404 iso_pu_bacteria 2773857763 2774398866 493
1405 iso_pu_bacteria 2852663356 2852664371 493
1406 iso_pu_bacteria 2862993130 2862996795 493
1407 iso_pu_bacteria 2919395869 2919396210 493
1408 3300046524 Ga0495648_0002385 Ga0495648_0002385_7998_9518 494
1409 3300053098 Ga0500650_0011205 Ga0500650_0011205_109_1764 494
1410 3300001979 JGI24740J21852_10003572 JGI24740J21852_100035722 495
1411 3300009148 Ga0105243_10027938 Ga0105243_100279383 495
1412 3300011119 Ga0105246_10048375 Ga0105246_100483751 495
1413 3300025728 Ga0207655_1030668 Ga0207655_10306682 495
1414 3300025935 Ga0207709_10011422 Ga0207709_100114222 495
1415 3300044765 Ga0466970_0002680 Ga0466970_0002680_3218_4852 495
1416 3300047323 Ga0495683_0001028 Ga0495683_0001028_12726_14294 495
1417 3300053140 Ga0500573_0042062 Ga0500573_0042062_553_2133 495
1418 iso_pu_bacteria 2547132424 2548694785 495
1419 iso_pu_bacteria 8004021418 8004023584 495
1420 3300046472 Ga0495580_0019312 Ga0495580_0019312_2202_3800 496
1421 3300046535 Ga0495586_0061666 Ga0495586_0061666_96_1694 496
1422 3300048917 Ga0496114_0001123 Ga0496114_0001123_17046_18629 496
1423 iso_pu_bacteria 2995726249 2995728997 496
1424 3300020076 Ga0206355_1600119 Ga0206355_16001191 497
1425 3300037418 Ga0395900_0216316 Ga0395900_0216316_220_1800 497
1426 3300037466 Ga0395898_0000100 Ga0395898_0000100_99304_100884 497
1427 iso_pu_bacteria 2857729791 2857733107 497
1428 iso_pu_bacteria 2867475112 2867476488 497
1429 iso_pu_bacteria 2928121344 2928121812 497
1430 iso_pu_bacteria 8004021418 8004025287 497
1431 3300013306 Ga0163162_10037249 Ga0163162_100372493 498
1432 3300013307 Ga0157372_10024667 Ga0157372_100246675 498
1433 3300048903 Ga0496100_0027780 Ga0496100_0027780_1429_3012 498
1434 3300048904 Ga0496101_0004230 Ga0496101_0004230_5150_6733 498
1435 3300048905 Ga0496102_0034937 Ga0496102_0034937_2881_4464 498
1436 3300048906 Ga0496103_0002535 Ga0496103_0002535_6248_7831 498
1437 3300048910 Ga0496107_0010664 Ga0496107_0010664_1083_2666 498
1438 3300048913 Ga0496110_0028337 Ga0496110_0028337_829_2412 498
1439 3300048915 Ga0496112_0090052 Ga0496112_0090052_32_1615 498
1440 3300048916 Ga0496113_0026795 Ga0496113_0026795_2454_4037 498
1441 3300048923 Ga0496120_0087619 Ga0496120_0087619_55_1638 498
1442 iso_pu_bacteria 8004025490 8004026852 498
1443 3300006051 Ga0075364_10045544 Ga0075364_100455442 499
1444 3300013105 Ga0157369_10088708 Ga0157369_100887082 499
1445 3300048925 Ga0496122_0091768 Ga0496122_0091768_323_1915 499
1446 3300049586 Ga0501070_0067482 Ga0501070_0067482_129_1739 501
1447 3300049823 Ga0501044_0244116 Ga0501044_0244116_90_1643 501
1448 3300042137 Ga0450902_007818 Ga0450902_007818_11_1519 502
1449 3300041452 Ga0451793_0946035 Ga0451793_0946035_197_1792 503
1450 3300041509 Ga0451843_1271766 Ga0451843_1271766_161_1765 504
1451 3300046459 Ga0495629_0084971 Ga0495629_0084971_599_2197 504
1452 3300048907 Ga0496104_0045963 Ga0496104_0045963_346_1944 504
1453 3300048908 Ga0496105_0012197 Ga0496105_0012197_2875_4473 504
1454 3300048911 Ga0496108_0014016 Ga0496108_0014016_4849_6447 504
1455 3300048912 Ga0496109_0001044 Ga0496109_0001044_377_1975 504
1456 3300048913 Ga0496110_0000574 Ga0496110_0000574_2876_4474 504
1457 3300048914 Ga0496111_0001626 Ga0496111_0001626_377_1975 504
1458 3300048917 Ga0496114_0137337 Ga0496114_0137337_489_2087 504
1459 iso_pu_bacteria 8054929484 8054930360 506
1460 iso_pu_bacteria 2738543004 2739199348 508
1461 3300046474 Ga0495605_0000828 Ga0495605_0000828_163_1695 509
1462 3300046492 Ga0495585_0000087 Ga0495585_0000087_22321_23871 509
1463 3300025292 Ga0209676_1000292 Ga0209676_100029274 510
1464 3300046492 Ga0495585_0001786 Ga0495585_0001786_11385_12917 510
1465 3300046528 Ga0495642_0000004 Ga0495642_0000004_19587_21119 510
1466 3300048928 Ga0496125_0000068 Ga0496125_0000068_104746_106299 510
1467 3300046512 Ga0495610_0000069 Ga0495610_0000069_95045_96580 511
1468 3300005288 Ga0065714_10019635 Ga0065714_100196352 512
1469 3300006051 Ga0075364_10042550 Ga0075364_100425502 512
1470 3300017792 Ga0163161_10002528 Ga0163161_100025282 512
1471 3300025728 Ga0207655_1005093 Ga0207655_10050935 512
1472 3300041407 Ga0439447_002146 Ga0439447_002146_2748_4316 512
1473 3300041411 Ga0439466_0008217 Ga0439466_0008217_685_2223 512
1474 3300042010 Ga0439452_000053 Ga0439452_000053_60518_62056 512
1475 3300046458 Ga0495591_000069 Ga0495591_000069_50053_51591 512
1476 3300046463 Ga0495653_0000466 Ga0495653_0000466_23118_24686 512
1477 3300046471 Ga0495650_0000228 Ga0495650_0000228_15214_16752 512
1478 3300046520 Ga0495637_0000904 Ga0495637_0000904_13539_15077 512
1479 3300046530 Ga0495654_0000256 Ga0495654_0000256_14928_16496 512
1480 3300046809 Ga0495600_0000176 Ga0495600_0000176_5361_6929 512
1481 3300047322 Ga0495680_0000066 Ga0495680_0000066_33548_35116 512
1482 3300047444 Ga0495675_0000026 Ga0495675_0000026_34760_36328 512
1483 3300048924 Ga0496121_0002230 Ga0496121_0002230_16085_17653 512
1484 3300048925 Ga0496122_0002107 Ga0496122_0002107_15986_17554 512
1485 2162886007 SwRhRL2b_contig_1535382 SwRhRL2b_0462.00001210 522
1486 3300005289 Ga0065704_10070742 Ga0065704_100707429 522
1487 3300048927 Ga0496124_0003597 Ga0496124_0003597_3710_5320 522

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00324

AA_permease

Amino acid permease

101

547

0.92

PF13520

AA_permease_2

Amino acid permease

97

536

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
3l1l-assembly1.cif.gz_A-2 structure of arg-bound escherichia coli adic 0.851 34 473
5j4i-assembly1.cif.gz_A crystal structure of the l-arginine/agmatine antiporter from e. coli at 2.2 angstroem resolution 0.8479 34 475
6f2g-assembly1.cif.gz_A bacterial asc transporter crystal structure in open to in conformation 0.8437 38 479
5oqt-assembly1.cif.gz_A crystal structure of a bacterial cationic amino acid transporter (cat) homologue 0.8417 23 478
6f34-assembly1.cif.gz_A crystal structure of a bacterial cationic amino acid transporter (cat) homologue bound to arginine. 0.8397 1 475
ID Description Score Start End Superfamily
af_P9WQM9_17_470_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.9868 29 485 1.20.1740.10
af_P9WQM9_17_470_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.9825 29 485 1.20.1740.10
af_Q2FVI1_4_463_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.9456 30 485 1.20.1740.10
af_P24207_19_458_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.9441 29 476 1.20.1740.10
af_P27837_7_458_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.9435 30 480 1.20.1740.10
ID Description Score Start End GO Terms
AF-A0A0H3NSD2-F1-model_v4 L-asparagine permease 0.9788 12 485 GO:0005886
GO:0006865
GO:0055085
AF-A0A034T0E9-F1-model_v4 deleted 0.9782 12 485
AF-M1TUI6-F1-model_v4 Amino acid permease/ SLC12A domain-containing protein 0.9778 23 484 GO:0005886
GO:0006865
GO:0055085
AF-M2XUX3-F1-model_v4 L-asparagine permease 0.9728 22 485 GO:0005886
GO:0006865
GO:0055085
AF-A0A5Q0H7E5-F1-model_v4 Amino acid permease 0.9707 29 478 GO:0005886
GO:0006865
GO:0055085

Feature Viewer

pLDDT pTM Quality
83.68 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map