F494317
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1487 | 753 | 1065 | 488 |
Family's Representative Sequence
| Representative Sequence | 3300048920|Ga0496117_0000052|Ga0496117_0000052_117844_119517 |
| Length | 557 |
| Sequence | LTLILRRTKVNNASIPLTNGILCNYEGKNLSCSFTAMHELAGAVSSAERTSSNFDFRRIADCKANSLGGEISMKSVKTAPAEREVFTEEDLGYHKALKPRQIQMIAIGGAIGTGLFLGAGGRLAQAGPALVFVYALCGFFAFLVLRALGELIMHRPSSGSFVSYAREFYGEKMAFFAGWMYXXXXAMTSVADVTAVALYMNFFKHYVPWLAGIDQWVFALTALLVVLAMNMLSVKVFGELEFWFSLIKVLALAIFLVVGVYFVIFGTPIEGHVTGFSIITDNGGFFPNGILPAFVIIQGVVFAYASIELIGTAAGETEDPRKVMPRAIRAVVLRLVVFYVGSVLLFTLLLPYTAYKAGESPFVTFFGSIGVQGADVIMNLVVLTAVLSSLNAGLYSTGRILHSMAVSGSAPAALAKMNKAGVPYGGIAVTAAVTVLGVALNAVVPAAAFEIALNLSALGIICAWAVIVLCQLKLWQLSRRGELARPDFRMFGAPYTGILTLVFLFGVLVLMAFDYPVGSWTIASLLVIIPALVIGWYMLRDRIHRLAGERAGAGASH |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2509276019 | Ensifer aridi TW10 | Isolate | Nodule |
| 3 | 2509276033 | Rhizobium leguminosarum bv. trifolii WSM2012 | Isolate | Nodule |
| 4 | 2510917022 | Rhizobium sp. AP16 | Isolate | Rhizosphere |
| 5 | 2513237159 | Rhizobium giardinii bv. giardinii H152 | Isolate | Nodule |
| 6 | 2537561587 | Agrobacterium tumefaciens Cherry 2E-2-2 | Isolate | Rhizosphere |
| 7 | 2547132111 | Streptomyces sp. TOR3209 | Isolate | Rhizosphere |
| 8 | 2547132424 | Nocardia nova SH22a | Isolate | Unclassified |
| 9 | 2554235003 | Agrobacterium tumefaciens WRT31 | Isolate | Rhizosphere |
| 10 | 2554235227 | Arthrobacter sp. PAO19 | Isolate | Rhizosphere |
| 11 | 2558860100 | Sinorhizobium sp. PC2 | Isolate | Nodule |
| 12 | 2558860242 | Agrobacterium fabacearum P4 | Isolate | Rhizosphere |
| 13 | 2558860280 | Kutzneria sp. 744 | Isolate | Unclassified |
| 14 | 2558860983 | Allorhizobium undicola ATCC 700741 | Isolate | Rhizoplane |
| 15 | 2565956761 | Rhodococcus qingshengii BKS 20-40 | Isolate | Rhizosphere |
| 16 | 2582581307 | Rhizobium sp. YR060 | Isolate | Rhizosphere |
| 17 | 2582581308 | Rhizobium sp. OK494 | Isolate | Rhizosphere |
| 18 | 2582581313 | Streptomyces mirabilis OV308 | Isolate | Rhizosphere |
| 19 | 2582581314 | Streptomyces mirabilis YR139 | Isolate | Rhizosphere |
| 20 | 2582581316 | Agrobacterium rhizogenes OK036 | Isolate | Rhizosphere |
| 21 | 2585427527 | Rhizobium lusitanum YR374 | Isolate | Rhizosphere |
| 22 | 2585427530 | Rhizobium tropici YR635 | Isolate | Rhizosphere |
| 23 | 2585427531 | Agrobacterium rhizogenes YR530 | Isolate | Rhizosphere |
| 24 | 2585427608 | Agrobacterium rhizogenes OV677 | Isolate | Rhizosphere |
| 25 | 2585427609 | Agrobacterium rhizogenes CF263 | Isolate | Rhizosphere |
| 26 | 2585427649 | Amycolatopsis japonica MG417-CF17, DSM 44213 | Isolate | Unclassified |
| 27 | 2585428125 | Agrobacterium rhizogenes CF262 | Isolate | Rhizosphere |
| 28 | 2599185210 | Rhizobium sp. NFACC06-2 | Isolate | Rhizoplane |
| 29 | 2600255279 | Rhizobium sp. NFIX01 | Isolate | Rhizoplane |
| 30 | 2600255308 | Rhizobium sp. NFIX02 | Isolate | Rhizoplane |
| 31 | 2615840624 | Rhizobium aethiopicum HBR26 | Isolate | Nodule |
| 32 | 2615840626 | Rhizobium lusitanum P1-7 | Isolate | Nodule |
| 33 | 2615840698 | Rhizobium multihospitium HAMBI 2975 | Isolate | Nodule |
| 34 | 2616644814 | Streptomyces mirabilis OK461 | Isolate | Rhizosphere |
| 35 | 2643221568 | Rhizobium sp. Root564 | Isolate | Unclassified |
| 36 | 2643221582 | Rhizobium sp. Root651 | Isolate | Unclassified |
| 37 | 2643221616 | Leifsonia sp. Root227 | Isolate | Unclassified |
| 38 | 2643221619 | Agromyces sp. Root81 | Isolate | Unclassified |
| 39 | 2643221647 | Streptomyces sp. Root369 | Isolate | Unclassified |
| 40 | 2643221678 | Streptomyces sp. Root1310 | Isolate | Unclassified |
| 41 | 2643221693 | Rhizobium sp. Root491 | Isolate | Unclassified |
| 42 | 2643221714 | Streptomyces sp. Root264 | Isolate | Unclassified |
| 43 | 2654587600 | Glutamicibacter halophytocola KLBMP5180 | Isolate | Unclassified |
| 44 | 2667528174 | Rhizobium sp. NFR17 | Isolate | Rhizoplane |
| 45 | 2690315906 | Arthrobacter sp. OY3WO11 | Isolate | Unclassified |
| 46 | 2718217927 | Rhizobium sp. N324 | Isolate | Nodule |
| 47 | 2718217997 | Rhizobium phaseoli sv. phaseoli R723 | Isolate | Nodule |
| 48 | 2718218009 | Rhizobium sp. N561 | Isolate | Nodule |
| 49 | 2718218199 | Rhizobium phaseoli sv. phaseoli N261 | Isolate | Nodule |
| 50 | 2718218232 | Rhizobium phaseoli sv. phaseoli N161 | Isolate | Nodule |
| 51 | 2718218233 | Rhizobium phaseoli sv. phaseoli R744 | Isolate | Nodule |
| 52 | 2718218235 | Rhizobium phaseoli sv. phaseoli R620 | Isolate | Nodule |
| 53 | 2718218269 | Rhizobium phaseoli sv. phaseoli N671 | Isolate | Nodule |
| 54 | 2718218363 | Rhizobium sp. N113 | Isolate | Nodule |
| 55 | 2718218365 | Rhizobium sp. N731 | Isolate | Nodule |
| 56 | 2718218366 | Rhizobium sp. N621 | Isolate | Nodule |
| 57 | 2718218423 | Rhizobium sp. N941 | Isolate | Nodule |
| 58 | 2721755514 | Rhizobium sp. N6212 | Isolate | Nodule |
| 59 | 2721755556 | Rhizobium phaseoli sv. phaseoli N931 | Isolate | Nodule |
| 60 | 2721755684 | Rhizobium phaseoli sv. phaseoli N841 | Isolate | Nodule |
| 61 | 2721755685 | Rhizobium phaseoli sv. phaseoli R611 | Isolate | Nodule |
| 62 | 2721755809 | Rhizobium sp. N541 | Isolate | Nodule |
| 63 | 2721755810 | Rhizobium sp. N871 | Isolate | Nodule |
| 64 | 2721755819 | Rhizobium phaseoli sv. phaseoli N771 | Isolate | Nodule |
| 65 | 2721755822 | Rhizobium phaseoli sv. phaseoli R650 | Isolate | Nodule |
| 66 | 2721755823 | Rhizobium phaseoli sv. phaseoli R630 | Isolate | Nodule |
| 67 | 2728369276 | Kineococcus rhizosphaerae DSM 19711 | Isolate | Rhizosphere |
| 68 | 2728369352 | Rhizobium phaseoli sv. phaseoli N831 | Isolate | Nodule |
| 69 | 2728369365 | Rhizobium sp. N1341 | Isolate | Nodule |
| 70 | 2728369397 | Rhizobium sp. N1314 | Isolate | Nodule |
| 71 | 2738543004 | Pseudomonas sp. GV085 | Isolate | Unclassified |
| 72 | 2738543034 | Rhodococcus sp. OK269 | Isolate | Unclassified |
| 73 | 2739367653 | Kocuria sp. OV113 | Isolate | Unclassified |
| 74 | 2744054900 | Paraburkholderia ginsengiterrae DCY85-1 | Isolate | Unclassified |
| 75 | 2744054901 | Paraburkholderia ginsengiterrae DCY85 | Isolate | Unclassified |
| 76 | 2751185788 | Curtobacterium pusillum AA3 | Isolate | Unclassified |
| 77 | 2751185800 | Brucella pituitosa AA2 | Isolate | Unclassified |
| 78 | 2757320536 | Microbacterium sp. NFIX05 | Isolate | Unclassified |
| 79 | 2758568016 | [Ochrobactrum] quorumnocens A44 | Isolate | Rhizosphere |
| 80 | 2773857758 | Microbacterium chocolatum 1320 | Isolate | Unclassified |
| 81 | 2773857759 | Microbacterium sp. 1294 | Isolate | Unclassified |
| 82 | 2773857762 | Nocardioides sp. SAI-095 | Isolate | Unclassified |
| 83 | 2773857763 | Microbacterium sp. SAI-030 | Isolate | Unclassified |
| 84 | 2775506735 | Arthrobacter sp. S95 1704 | Isolate | Unclassified |
| 85 | 2784132109 | Dermacoccus sp. DS28 SAI-028 | Isolate | Unclassified |
| 86 | 2784132148 | Streptomyces sp. E5N91 SAI-083 | Isolate | Unclassified |
| 87 | 2784746763 | Streptomyces ossamyceticus SAI-001 | Isolate | Unclassified |
| 88 | 2784746768 | Streptomyces griseorubiginosus SAI-142 | Isolate | Unclassified |
| 89 | 2786546132 | Streptomyces sp. W SAI-097 | Isolate | Unclassified |
| 90 | 2791355256 | Rhizobium sp. M10 | Isolate | Nodule |
| 91 | 2791355259 | Rhizobium hidalgonense FH14 | Isolate | Nodule |
| 92 | 2791355260 | Rhizobium sp. L9 | Isolate | Nodule |
| 93 | 2791355261 | Rhizobium sp. J15 | Isolate | Nodule |
| 94 | 2791355262 | Rhizobium sp. M1 | Isolate | Nodule |
| 95 | 2791355263 | Rhizobium chutanense C5 | Isolate | Nodule |
| 96 | 2791355264 | Rhizobium sp. S9 | Isolate | Nodule |
| 97 | 2791355265 | Rhizobium sp. H4 | Isolate | Nodule |
| 98 | 2791355267 | Rhizobium sp. L18 | Isolate | Nodule |
| 99 | 2791355406 | Streptomyces rhizosphaericus NRRL B-24304 | Isolate | Unclassified |
| 100 | 2802429606 | Rhizobium sophoriradicis JJW1 | Isolate | Nodule |
| 101 | 2808606357 | Arthrobacter sp. SLBN-122 | Isolate | Unclassified |
| 102 | 2808606359 | Streptomyces sp. RJA2910 | Isolate | Unclassified |
| 103 | 2808606360 | Arthrobacter sp. SLBN-112 | Isolate | Unclassified |
| 104 | 2808606366 | Arthrobacter sp. SLBN-83 | Isolate | Unclassified |
| 105 | 2808606370 | Arthrobacter sp. SLBN-100 | Isolate | Unclassified |
| 106 | 2808606371 | Arthrobacter sp. SLBN-53 | Isolate | Unclassified |
| 107 | 2808606375 | Streptomyces sp. SLBN-31 | Isolate | Unclassified |
| 108 | 2808606387 | Rhizobium sp. SJZ105 | Isolate | Rhizosphere |
| 109 | 2808606439 | Nocardioides sp. SLBN-172 | Isolate | Unclassified |
| 110 | 2808606448 | Streptomyces sp. 193411 | Isolate | Unclassified |
| 111 | 2808606522 | Amycolatopsis sp. BJA-103 | Isolate | Unclassified |
| 112 | 2811994871 | Arthrobacter sp. SLBN-179 | Isolate | Unclassified |
| 113 | 2811994878 | Nocardioides sp. SLBN-169 | Isolate | Unclassified |
| 114 | 2811994879 | Streptomyces sp. 4-17 | Isolate | Unclassified |
| 115 | 2816332305 | Kocuria rhizophila FDAARGOS_302 | Isolate | Rhizosphere |
| 116 | 2818991439 | Agrobacterium tumefaciens 1187 | Isolate | Unclassified |
| 117 | 2818991448 | Rhizobium miluonense 1234 | Isolate | Unclassified |
| 118 | 2818991453 | Rhizobium lusitanum 1158 | Isolate | Unclassified |
| 119 | 2838016132 | Rhizobium phaseoli SEMIA 4071 | Isolate | Nodule |
| 120 | 2838022645 | Rhizobium aethiopicum SEMIA 4074 | Isolate | Nodule |
| 121 | 2838029111 | Rhizobium tropici SEMIA 4079 | Isolate | Nodule |
| 122 | 2838048938 | Rhizobium pisi 27/80 | Isolate | Nodule |
| 123 | 2838061910 | Rhizobium phaseoli L15 | Isolate | Nodule |
| 124 | 2838068647 | Rhizobium esperanzae VC28 | Isolate | Nodule |
| 125 | 2838668709 | Rhizobium sophoriradicis SEMIA 403 | Isolate | Nodule |
| 126 | 2838675328 | Agrobacterium radiobacter SEMIA 410 | Isolate | Nodule |
| 127 | 2838701080 | Rhizobium aethiopicum SEMIA 428 | Isolate | Nodule |
| 128 | 2838714209 | Agrobacterium radiobacter SEMIA 435 | Isolate | Nodule |
| 129 | 2838719591 | Agrobacterium radiobacter SEMIA 436 | Isolate | Nodule |
| 130 | 2838724970 | Agrobacterium radiobacter SEMIA 437 | Isolate | Nodule |
| 131 | 2841846520 | Agrobacterium radiobacter SEMIA 440 | Isolate | Nodule |
| 132 | 2841859092 | Agrobacterium radiobacter SEMIA 4026 | Isolate | Nodule |
| 133 | 2841864319 | Rhizobium leguminosarum SEMIA 4052 | Isolate | Nodule |
| 134 | 2842124991 | Agrobacterium radiobacter SEMIA 434 | Isolate | Nodule |
| 135 | 2842130223 | Agrobacterium radiobacter SEMIA 441 | Isolate | Nodule |
| 136 | 2842146304 | Rhizobium sophoriradicis SEMIA 454 | Isolate | Nodule |
| 137 | 2842152218 | Agrobacterium radiobacter SEMIA 457 | Isolate | Nodule |
| 138 | 2842170452 | Agrobacterium radiobacter SEMIA 461 | Isolate | Nodule |
| 139 | 2842175837 | Agrobacterium radiobacter SEMIA 462 | Isolate | Nodule |
| 140 | 2842187318 | Agrobacterium radiobacter SEMIA 464 | Isolate | Nodule |
| 141 | 2842198810 | Rhizobium aethiopicum SEMIA 470 | Isolate | Nodule |
| 142 | 2842205361 | Rhizobium etli SEMIA 471 | Isolate | Nodule |
| 143 | 2842211629 | Agrobacterium radiobacter SEMIA 472 | Isolate | Nodule |
| 144 | 2842224351 | Agrobacterium radiobacter SEMIA 480 | Isolate | Nodule |
| 145 | 2842250916 | Rhizobium etli SEMIA 484 | Isolate | Nodule |
| 146 | 2842264693 | Rhizobium phaseoli SEMIA 487 | Isolate | Nodule |
| 147 | 2842278818 | Rhizobium etli SEMIA 489 | Isolate | Nodule |
| 148 | 2842285085 | Rhizobium lentis SEMIA 490 | Isolate | Nodule |
| 149 | 2842311132 | Rhizobium phaseoli SEMIA 4002 | Isolate | Nodule |
| 150 | 2842317721 | Rhizobium etli SEMIA 4004 | Isolate | Nodule |
| 151 | 2842341865 | Rhizobium leguminosarum SEMIA 4011 | Isolate | Nodule |
| 152 | 2842363717 | Rhizobium leguminosarum SEMIA 4016 | Isolate | Nodule |
| 153 | 2842395702 | Rhizobium ecuadorense SEMIA 4029 | Isolate | Nodule |
| 154 | 2842402390 | Rhizobium lentis SEMIA 4033 | Isolate | Nodule |
| 155 | 2842409023 | Rhizobium lentis SEMIA 4034 | Isolate | Nodule |
| 156 | 2842415677 | Rhizobium lentis SEMIA 4036 | Isolate | Nodule |
| 157 | 2842422224 | Rhizobium esperanzae SEMIA 4042 | Isolate | Nodule |
| 158 | 2842428310 | Rhizobium phaseoli SEMIA 4050 | Isolate | Nodule |
| 159 | 2842434925 | Rhizobium esperanzae SEMIA 4051 | Isolate | Nodule |
| 160 | 2842441272 | Rhizobium esperanzae SEMIA 4053 | Isolate | Nodule |
| 161 | 2842447887 | Rhizobium esperanzae SEMIA 4055 | Isolate | Nodule |
| 162 | 2842462802 | Rhizobium phaseoli SEMIA 4057 | Isolate | Nodule |
| 163 | 2842469257 | Rhizobium phaseoli SEMIA 4058 | Isolate | Nodule |
| 164 | 2842475841 | Rhizobium tropici SEMIA 4059 | Isolate | Nodule |
| 165 | 2842489311 | Rhizobium sophoriradicis SEMIA 4061 | Isolate | Nodule |
| 166 | 2842495871 | Rhizobium etli SEMIA 4062 | Isolate | Nodule |
| 167 | 2842502639 | Rhizobium tropici SEMIA 4063 | Isolate | Nodule |
| 168 | 2842515876 | Agrobacterium radiobacter SEMIA 4072 | Isolate | Nodule |
| 169 | 2842521101 | Rhizobium giardinii SEMIA 4084 | Isolate | Nodule |
| 170 | 2844849076 | Arthrobacter cupressi DSM 24664 | Isolate | Rhizosphere |
| 171 | 2850079185 | Ensifer aridi JNVU TP6 | Isolate | Unclassified |
| 172 | 2852635781 | Streptomyces sp. AK010 | Isolate | Rhizosphere |
| 173 | 2852663356 | Microbacterium sp. JAI119 | Isolate | Rhizosphere |
| 174 | 2854911287 | Brucella lupini LUP21 | Isolate | Unclassified |
| 175 | 2854916844 | Neorhizobium huautlense DSM 21817 | Isolate | Unclassified |
| 176 | 2857727296 | Kocuria sp. R-72562 | Isolate | Unclassified |
| 177 | 2857729791 | Plantibacter sp. R-72288 | Isolate | Unclassified |
| 178 | 2857740372 | Paenarthrobacter sp. R-74611 | Isolate | Unclassified |
| 179 | 2862281513 | Streptomyces sp. Act143 | Isolate | Rhizosphere |
| 180 | 2862290372 | Streptomyces triticagri NEAU-YY421 | Isolate | Rhizosphere |
| 181 | 2862382967 | Streptomyces scabiei NRRL B-2795 | Isolate | Nodule |
| 182 | 2862993130 | Planctomonas deserti 13S1-3 v2 | Isolate | Rhizosphere |
| 183 | 2863404153 | Streptomyces scabiei SAI-025 (Annotation) (version 2) | Isolate | Unclassified |
| 184 | 2866612099 | Amycolatopsis suaedae 8-3EHSu | Isolate | Unclassified |
| 185 | 2867428634 | Streptomyces sp. RP5T | Isolate | Unclassified |
| 186 | 2867475112 | Streptomyces sp. TM32 | Isolate | Unclassified |
| 187 | 2870782633 | Pseudonocardia eucalypti DSM 45351 | Isolate | Unclassified |
| 188 | 2873151551 | Streptomyces silaceus ACCC40021 | Isolate | Rhizosphere |
| 189 | 2877676314 | Streptomyces griseorubiginosus 3E-1 | Isolate | Unclassified |
| 190 | 2884763398 | Leifsonia sp. PS1209 | Isolate | Stem Tuber |
| 191 | 2891968417 | Nocardioides luteus SAI-037 | Isolate | Unclassified |
| 192 | 2893684298 | Kocuria palustris DSM 11925 | Isolate | Rhizosphere |
| 193 | 2899359706 | Amycolatopsis anabasis EGI 650086 | Isolate | Unclassified |
| 194 | 2899792073 | Agrobacterium deltaense CNPSo 3391 | Isolate | Nodule |
| 195 | 2899845264 | Agrobacterium fabacearum CNPSo 675 | Isolate | Unclassified |
| 196 | 2904430863 | Curtobacterium oceanosedimentum 1519 | Isolate | Rhizosphere |
| 197 | 2904497146 | Arthrobacter sp. 1276 | Isolate | Rhizosphere |
| 198 | 2904509784 | Microbacterium sp. 1676 | Isolate | Rhizosphere |
| 199 | 2904535858 | Rhodococcus erythropolis 2017 | Isolate | Unclassified |
| 200 | 2904765812 | Rhodococcus fascians 1590 | Isolate | Rhizosphere |
| 201 | 2904770941 | Rhodococcus fascians 1339 | Isolate | Rhizosphere |
| 202 | 2904776348 | Paenarthrobacter sp. 1092 | Isolate | Rhizosphere |
| 203 | 2905926851 | Arthrobacter sedimenti MIC A30 | Isolate | Rhizosphere |
| 204 | 2908674828 | Curtobacterium sp. 1517 | Isolate | Rhizosphere |
| 205 | 2908678064 | Microbacterium sp. 1518 | Isolate | Rhizosphere |
| 206 | 2908811453 | Rhodococcus sp. 1R11 | Isolate | Unclassified |
| 207 | 2909074476 | Curtobacterium sp. 1310 | Isolate | Rhizosphere |
| 208 | 2910809715 | Paenarthrobacter sp. CM16 | Isolate | Unclassified |
| 209 | 2912715099 | Streptomyces sp. Z423-1 | Isolate | Rhizosphere |
| 210 | 2912723979 | Streptomyces sp. NEAU-sy36 | Isolate | Rhizosphere |
| 211 | 2915768154 | Amycolatopsis pittospori PIP199 | Isolate | Unclassified |
| 212 | 2917736166 | Amycolatopsis dendrobii DR6-1 | Isolate | Unclassified |
| 213 | 2919034639 | Paenarthrobacter nitroguajacolicus 247 | Isolate | Rhizosphere |
| 214 | 2919039151 | Curtobacterium sp. 260 | Isolate | Rhizosphere |
| 215 | 2919051321 | Sinomonas atrocyanea 1003 | Isolate | Rhizosphere |
| 216 | 2919059106 | Arthrobacter sp. 1088 | Isolate | Rhizosphere |
| 217 | 2919069694 | Microbacterium sp. 1154 | Isolate | Unclassified |
| 218 | 2919114240 | Agrobacterium tumefaciens 1457 | Isolate | Rhizosphere |
| 219 | 2919166419 | Agrobacterium cavarae 2074 | Isolate | Unclassified |
| 220 | 2919395869 | Microbacterium resistens 2980 | Isolate | Unclassified |
| 221 | 2919408235 | Rhizobium miluonense 3199 | Isolate | Unclassified |
| 222 | 2919420072 | Rhodococcus fascians 3241 | Isolate | Rhizosphere |
| 223 | 2919432681 | Rhodococcus sp. 3258 | Isolate | Rhizosphere |
| 224 | 2919468124 | Streptomyces sp. 3330 | Isolate | Rhizosphere |
| 225 | 2919538618 | Paenarthrobacter nitroguajacolicus 3945 | Isolate | Unclassified |
| 226 | 2919713450 | Nocardia kruczakiae 4272 | Isolate | Rhizosphere |
| 227 | 2920879853 | Kocuria salina CV6 | Isolate | Unclassified |
| 228 | 2922554459 | Rhodococcus sp. 66b | Isolate | Unclassified |
| 229 | 2926754445 | Agrobacterium radiobacter SLBN-94 | Isolate | Rhizosphere |
| 230 | 2926760298 | Agrobacterium tumefaciens SLBN-170 | Isolate | Rhizosphere |
| 231 | 2928104781 | Curtobacterium sp. 1544 | Isolate | Rhizosphere |
| 232 | 2928121344 | Plantibacter flavus 1756 | Isolate | Rhizosphere |
| 233 | 2928500415 | Curtobacterium oceanosedimentum 1257 | Isolate | Rhizosphere |
| 234 | 2929138655 | Agrobacterium sp. R-72433 Hybrid assembly | Isolate | Unclassified |
| 235 | 2932426870 | Paenarthrobacter sp. 4246 | Isolate | Rhizosphere |
| 236 | 2933006813 | Rhizobium sp. SEMIA 439 | Isolate | Unclassified |
| 237 | 2933011516 | Rhizobium sp. SEMIA 4032 | Isolate | Unclassified |
| 238 | 2933418574 | Jeotgalibacillus campisalis 4120 | Isolate | Rhizosphere |
| 239 | 2933594066 | Agrobacterium fabrum 35/80 | Isolate | Nodule |
| 240 | 2933599457 | Rhizobium phaseoli M3 | Isolate | Nodule |
| 241 | 2936381700 | Rhizobium chutanense C16 | Isolate | Unclassified |
| 242 | 2939647034 | Arthrobacter sp. 2762 | Isolate | Rhizosphere |
| 243 | 2939674588 | Arthrobacter bambusae 3552 | Isolate | Rhizosphere |
| 244 | 2945916053 | Arthrobacter ulcerisalmonis W1I2 | Isolate | Rhizosphere |
| 245 | 2945920336 | Pseudarthrobacter siccitolerans W1I3 | Isolate | Rhizosphere |
| 246 | 2945941187 | Arthrobacter pascens W1I14 | Isolate | Rhizosphere |
| 247 | 2945956166 | Arthrobacter globiformus W2I3 | Isolate | Rhizosphere |
| 248 | 2946024296 | Arthrobacter woluwensis W4I2 | Isolate | Rhizosphere |
| 249 | 2946037020 | Arthrobacter sp. W4I7 | Isolate | Rhizosphere |
| 250 | 2946059875 | Arthrobacter sp. SLBN-112 | Isolate | Rhizosphere |
| 251 | 2946064051 | Streptomyces luteogriseus W4I19-1 | Isolate | Rhizosphere |
| 252 | 2946072368 | Streptomyces achromogenes W4I19-2 | Isolate | Rhizosphere |
| 253 | 2947224130 | Streptomyces afghaniensis W1I20 | Isolate | Rhizosphere |
| 254 | 2953998280 | Pseudarthrobacter sp. W1I19 | Isolate | Rhizosphere |
| 255 | 2954002825 | Streptomyces turgidiscabies W2I16 | Isolate | Rhizosphere |
| 256 | 2954380949 | Streptomyces ciscaucasicus W1I15 | Isolate | Rhizosphere |
| 257 | 2954673503 | Streptomyces sp. SAI-119 | Isolate | Rhizosphere |
| 258 | 2954682443 | Streptomyces sp. SAI-149 | Isolate | Rhizosphere |
| 259 | 2954691527 | Streptomyces sp. SAI-127 | Isolate | Rhizosphere |
| 260 | 2954701450 | Streptomyces sp. SAI-144 | Isolate | Rhizosphere |
| 261 | 2954711539 | Streptomyces sp. SAI-090 | Isolate | Rhizosphere |
| 262 | 2954721474 | Streptomyces sp. SAI-117 | Isolate | Rhizosphere |
| 263 | 2954731030 | Streptomyces sp. SAI-133 | Isolate | Rhizosphere |
| 264 | 2954740390 | Streptomyces sp. SAI-041 | Isolate | Rhizosphere |
| 265 | 2954749733 | Streptomyces sp. SAI-135 | Isolate | Rhizosphere |
| 266 | 2954759201 | Streptomyces sp. SAI-208 | Isolate | Rhizosphere |
| 267 | 2966598605 | Kitasatospora papulosa SLBN-177 | Isolate | Rhizosphere |
| 268 | 2966921586 | Rathayibacter agropyri 617 | Isolate | Rhizosphere |
| 269 | 2966924647 | Frigoribacterium sp. 2355 | Isolate | Rhizosphere |
| 270 | 2974294766 | Microbacterium proteolyticum SORGH_AS 209 | Isolate | Unclassified |
| 271 | 2974302888 | Pseudarthrobacter sp. SORGH_AS 212 | Isolate | Unclassified |
| 272 | 2974315732 | Rhodococcus sp. SORGH_AS 301 | Isolate | Unclassified |
| 273 | 2974324384 | Microbacterium sp. SORGH_AS 344 | Isolate | Unclassified |
| 274 | 2977228692 | Microbacterium sp. SORGH_AS 421 | Isolate | Unclassified |
| 275 | 2977236895 | Microbacterium testaceum SORGH_AS 426 | Isolate | Unclassified |
| 276 | 2977264416 | Microbacterium testaceum SORGH_AS 594 | Isolate | Unclassified |
| 277 | 2978969890 | Agrobacterium sp. SORGH_AS 787 | Isolate | Unclassified |
| 278 | 2979089926 | Agrobacterium sp. SORGH_AS 745 | Isolate | Unclassified |
| 279 | 2979095461 | Agrobacterium tumefaciens SORGH_AS 749 | Isolate | Unclassified |
| 280 | 2979100975 | Agrobacterium pusense SORGH_AS 755 | Isolate | Unclassified |
| 281 | 2984509177 | Agrobacterium pusense SORGH_AS260 | Isolate | Aerial Root |
| 282 | 2984518228 | Agrobacterium pusense SORGH_AS285 | Isolate | Aerial Root |
| 283 | 2984523437 | Rhodococcus sp. SORGH_AS303 | Isolate | Aerial Root |
| 284 | 2984537506 | Agrobacterium sp. SORGH_AS440 | Isolate | Aerial Root |
| 285 | 2984542743 | Microbacterium sp. SORGH_AS454 | Isolate | Aerial Root |
| 286 | 2984551494 | Curtobacterium sp. SORGH_AS776 | Isolate | Aerial Root |
| 287 | 2984576629 | Nocardioides zeae SORGH_AS913 | Isolate | Aerial Root |
| 288 | 2984587000 | Agrobacterium larrymoorei SORGH_AS974 | Isolate | Aerial Root |
| 289 | 2984601300 | Rhizobium pusense SORGH_AS1083 | Isolate | Aerial Root |
| 290 | 2990059506 | Streptomyces sp. CAP261 | Isolate | Unclassified |
| 291 | 2990256926 | Nocardioides zeae SORGH_AS885 | Isolate | Aerial Root |
| 292 | 2995463766 | Streptacidiphilus fuscans NEAU-YB345 | Isolate | Unclassified |
| 293 | 2995726249 | Leucobacter zeae CC-MF41 | Isolate | Rhizosphere |
| 294 | 2996887358 | Rhizobium sp. R711 | Isolate | Nodule |
| 295 | 2997451912 | Streptomyces piniterrae jys28 | Isolate | Rhizosphere |
| 296 | 2997600082 | Streptomyces coffeae CA1R205 | Isolate | Unclassified |
| 297 | 3002998708 | Actinomadura barringtoniae GKU 128 | Isolate | Unclassified |
| 298 | 3005416602 | Rhizobium sp. P40RR-XXII | Isolate | Rhizosphere |
| 299 | 3006393351 | Streptomyces sp. SID4985 | Isolate | Unclassified |
| 300 | 3006486233 | Streptomyces sp. BR123 | Isolate | Rhizosphere |
| 301 | 3006493962 | Streptomyces grisecoloratus TRM S81-3 | Isolate | Rhizosphere |
| 302 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 303 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 304 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 305 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 306 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 307 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 308 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 309 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 310 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 311 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 312 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 313 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 314 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 315 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 316 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 317 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 318 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 319 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 320 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 321 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 322 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 323 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 324 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 325 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 326 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 327 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 328 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 329 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 330 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 331 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 332 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 333 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 334 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 335 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 336 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 337 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 338 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 339 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 340 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 341 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 342 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 343 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 344 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 345 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 346 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 347 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 348 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 349 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 350 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 351 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 352 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 353 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 354 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 355 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 356 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 357 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 358 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 359 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 360 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 361 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 362 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 363 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 364 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 365 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 366 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 367 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 368 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 369 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 370 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 371 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 372 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 373 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 374 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 375 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 376 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 377 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 378 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 379 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 380 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 381 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 382 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 383 | 3300009766 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule | Metagenome | Nodule |
| 384 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 385 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 386 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 387 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 388 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 389 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 390 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 391 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 392 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 393 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 394 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 395 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 396 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 397 | 3300015679 | Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.4_F08 | Metagenome | Unclassified |
| 398 | 3300015680 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.2_H03 | Metagenome | Rhizosphere |
| 399 | 3300015685 | Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 | Metagenome | Unclassified |
| 400 | 3300015687 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 | Metagenome | Rhizosphere |
| 401 | 3300015688 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 | Metagenome | Rhizosphere |
| 402 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 403 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 404 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 405 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 406 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 407 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 408 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 409 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 410 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 411 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 412 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 413 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 414 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 415 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 416 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 417 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 418 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 419 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 420 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 421 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 422 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 423 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 424 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 425 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 426 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 427 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 428 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 429 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 430 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 431 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 432 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 433 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 434 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 435 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 436 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 437 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 438 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 439 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 440 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 441 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 442 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 443 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 444 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 445 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 446 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 447 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 448 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 449 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 450 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 451 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 452 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 453 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 454 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 455 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 456 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 457 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 458 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 459 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 460 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 461 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 462 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 463 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 464 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 465 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 466 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 467 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 468 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 469 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 470 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 471 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 472 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 473 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 474 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 475 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 476 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 477 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 478 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 479 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 480 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 481 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 482 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 483 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 484 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 485 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 486 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 487 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 488 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 489 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 490 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 491 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 492 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 493 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 494 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 495 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 496 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 497 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 498 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 499 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 500 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 501 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 502 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 503 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 504 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 505 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 506 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 507 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 508 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 509 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 510 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 511 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 512 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 513 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 514 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 515 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 516 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 517 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 518 | 3300042121 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 | Metagenome | Rhizosphere |
| 519 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 520 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 521 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 522 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 523 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 524 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 525 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 526 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 527 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 528 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 529 | 3300044669 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2E | Metagenome | Unclassified |
| 530 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 531 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 532 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 533 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 534 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 535 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 536 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 537 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 538 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 539 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 540 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 541 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 542 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 543 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 544 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 545 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 546 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 547 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 548 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 549 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 550 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 551 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 552 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 553 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 554 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 555 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 556 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 557 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 558 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 559 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 560 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 561 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 562 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 563 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 564 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 565 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 566 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 567 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 568 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 569 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 570 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 571 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 572 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 573 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 574 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 575 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 576 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 577 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 578 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 579 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 580 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 581 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 582 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 583 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 584 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 585 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 586 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 587 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 588 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 589 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 590 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 591 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 592 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 593 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 594 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 595 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 596 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 597 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 598 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 599 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 600 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 601 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 602 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 603 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 604 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 605 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 606 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 607 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 608 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 609 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 610 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 611 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 612 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 613 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 614 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 615 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 616 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 617 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 618 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 619 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 620 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 621 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 622 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 623 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 624 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 625 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 626 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 627 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 628 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 629 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 630 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 631 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 632 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 633 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 634 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 635 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 636 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 637 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 638 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 639 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 640 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 641 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 642 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 643 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 644 | 3300049128 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 645 | 3300049130 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 646 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 647 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 648 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 649 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 650 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 651 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 652 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 653 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 654 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 655 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 656 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 657 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 658 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 659 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 660 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 661 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 662 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 663 | 3300049778 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control | Metagenome | Rhizosphere |
| 664 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 665 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 666 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 667 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 668 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 669 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 670 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 671 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 672 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 673 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 674 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 675 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 676 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 677 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 678 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 679 | 3300053126 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere | Metagenome | Endosphere |
| 680 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 681 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 682 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 683 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 684 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 685 | 3300059477 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 686 | 3300059490 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 687 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 688 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 689 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 690 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 691 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 692 | 3300059512 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 693 | 3300059513 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 694 | 3300059514 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 106R_AW_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 695 | 3300059604 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 696 | 3300059623 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 697 | 3300059626 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 698 | 3300059630 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 699 | 3300059639 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 700 | 3300059642 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 701 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 702 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 703 | 3300059652 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 704 | 3300059660 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 161R_SW_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 705 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 706 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 707 | 650716007 | Agrobacterium fabacearum H13-3 | Isolate | Rhizosphere |
| 708 | 8003314358 | Amycolatopsis sp. MtRt-6 | Isolate | Unclassified |
| 709 | 8003570095 | Agrobacterium rhizogenes GBBC3284 | Isolate | Unclassified |
| 710 | 8004021418 | Arthrobacter sp. SDTb3-6 | Isolate | Rhizosphere |
| 711 | 8004025490 | Arthrobacter wenxiniae AETb3-4 | Isolate | Rhizosphere |
| 712 | 8004182704 | Microbacterium paraoxydans ku-mp | Isolate | Unclassified |
| 713 | 8005275841 | Rhizobium sp. N4311 | Isolate | Nodule |
| 714 | 8005282627 | Rhizobium phaseoli NC1 | Isolate | Nodule |
| 715 | 8005289223 | Rhizobium bangladeshense 1002 | Isolate | Nodule |
| 716 | 8005301065 | Rhizobium bangladeshense 1017 | Isolate | Nodule |
| 717 | 8005314921 | Rhizobium sp. P28RR-XV | Isolate | Rhizosphere |
| 718 | 8005321885 | Rhizobium sp. R72 | Isolate | Nodule |
| 719 | 8005382845 | Rhizobium sp. R634 | Isolate | Nodule |
| 720 | 8005395548 | Rhizobium sp. R339 | Isolate | Nodule |
| 721 | 8005430974 | Rhizobium phaseoli Y20 | Isolate | Nodule |
| 722 | 8005484373 | Rhizobium tropici SARCC-755 | Isolate | Nodule |
| 723 | 8005497431 | Rhizobium phaseoli CCGM8 | Isolate | Unclassified |
| 724 | 8005619151 | Rhizobium phaseoli CCGM2 | Isolate | Unclassified |
| 725 | 8005626139 | Rhizobium phaseoli Y18 | Isolate | Nodule |
| 726 | 8005645114 | Rhizobium tropici IGFRI Rhizo-19 | Isolate | Rhizosphere |
| 727 | 8005668836 | Rhizobium phaseoli CCGM9 | Isolate | Unclassified |
| 728 | 8005682033 | Rhizobium dioscoreae S-93 | Isolate | Unclassified |
| 729 | 8005695170 | Rhizobium sp. RMa-01 | Isolate | Unclassified |
| 730 | 8008558824 | Streptomyces scabiei NRRL B-2795 | Isolate | Nodule |
| 731 | 8008574985 | Streptomyces sp. Jing01 | Isolate | Rhizosphere |
| 732 | 8016254467 | Microbacterium sp. SLBN-111 (version 3) | Isolate | Rhizosphere |
| 733 | 8018127388 | Rhizobium aegyptiacum 950 | Isolate | Nodule |
| 734 | 8018176218 | Rhizobium sp. N122 | Isolate | Nodule |
| 735 | 8023623736 | Streptomyces sp. 111WW2 | Isolate | Unclassified |
| 736 | 8024501048 | Rhizobium sp. H4 | Isolate | Nodule |
| 737 | 8047893842 | Streptomyces cangkringensis DSM 41769 | Isolate | Rhizosphere |
| 738 | 8048127548 | Streptomyces samsunensis DSM 42010 | Isolate | Rhizosphere |
| 739 | 8048356638 | Streptomyces rhizosphaericus DSM 41760 | Isolate | Rhizosphere |
| 740 | 8048369669 | Streptomyces indonesiensis DSM 41759 | Isolate | Rhizoplane |
| 741 | 8048379754 | Streptomyces asiaticus DSM 41761 | Isolate | Rhizosphere |
| 742 | 8048406513 | Streptomyces heilongjiangensis NEAU-W2 | Isolate | Unclassified |
| 743 | 8054107350 | Arthrobacter rhizosphaerae CCNWLXL 1-35 | Isolate | Rhizosphere |
| 744 | 8054160619 | Streptomyces rhizoryzae RS10V-4 | Isolate | Rhizosphere |
| 745 | 8054460903 | Agrobacterium vaccinii B7.6 | Isolate | Unclassified |
| 746 | 8054929484 | Pseudomonas vlassakiae RW4S1 | Isolate | Rhizosphere |
| 747 | 8056037122 | Herbiconiux gentiana CPCC 205716 | Isolate | Rhizosphere |
| 748 | 8056207758 | Saccharopolyspora indica KCTC 29208 | Isolate | Rhizosphere |
| 749 | 8056375014 | Rhizobium redzepovicii 18T | Isolate | Nodule |
| 750 | 8056382006 | Rhizobium croatiense 13T | Isolate | Nodule |
| 751 | 8056447290 | Streptomyces huiliensis SCA2-4 | Isolate | Rhizosphere |
| 752 | 8056667051 | Streptomyces sichuanensis SCA3-4 | Isolate | Rhizosphere |
| 753 | 8056829672 | Streptomyces barringtoniae JA03 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 69.27 |
| Metatranscriptomes | 2.35 |
| Isolates | 28.38 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.67 |
| Bulb | 0 |
| Endosphere | 7.67 |
| Nodule | 8.81 |
| Rhizoplane | 4.91 |
| Rhizosphere | 57.63 |
| Stem | 0 |
| Stem Tuber | 0.07 |
| Unclassified | 20.24 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_1535382 | 2162886007 | Bacteria | 14715 |
| 2 | JGI24746J21847_1001213 | 3300001977 | Bacteria | 4089 |
| 3 | JGI24740J21852_10003572 | 3300001979 | Bacteria | 6793 |
| 4 | JGI24739J22299_10007640 | 3300001989 | Bacteria | 4045 |
| 5 | JGI24737J22298_10018569 | 3300001990 | Bacteria | 2230 |
| 6 | JGI24744J21845_10001770 | 3300002077 | Bacteria | 4333 |
| 7 | JGI25155J39150_1000015 | 3300002704 | Bacteria | 178839 |
| 8 | JGI25156J39149_1000007 | 3300002705 | Bacteria | 252108 |
| 9 | JGI25162J39368_1000439 | 3300002737 | Bacteria | 33448 |
| 10 | JGI25162J39368_1001972 | 3300002737 | Bacteria | 9209 |
| 11 | JGI25154J39366_1000051 | 3300002738 | Bacteria | 123608 |
| 12 | JGI25157J39369_1000012 | 3300002741 | Bacteria | 205167 |
| 13 | JGI25164J39214_1000743 | 3300002772 | Bacteria | 12143 |
| 14 | JGI25152J39213_1000175 | 3300002773 | Bacteria | 43464 |
| 15 | JGI25152J39213_1000585 | 3300002773 | Bacteria | 19724 |
| 16 | JGI25152J39213_1001657 | 3300002773 | Bacteria | 9267 |
| 17 | JGI25165J46597_1000567 | 3300003214 | Bacteria | 33448 |
| 18 | rootH2_10021729 | 3300003320 | Bacteria | 13211 |
| 19 | rootL2_10000515 | 3300003322 | Bacteria | 3383 |
| 20 | rootL2_10069804 | 3300003322 | Bacteria | 5006 |
| 21 | rootH1_10020478 | 3300003323 | Bacteria | 4810 |
| 22 | rootH1_10045263 | 3300003323 | Bacteria | 4036 |
| 23 | rootH1_10072379 | 3300003323 | Bacteria | 9570 |
| 24 | JGI25160J50197_1015702 | 3300003354 | Bacteria | 2475 |
| 25 | Ga0055539_1000019 | 3300003752 | Bacteria | 341727 |
| 26 | Ga0055533_1000023 | 3300003756 | Bacteria | 341727 |
| 27 | Ga0055532_1000750 | 3300003758 | Bacteria | 11701 |
| 28 | Ga0055525_1000088 | 3300003759 | Bacteria | 143732 |
| 29 | Ga0055527_1000003 | 3300003760 | Bacteria | 705001 |
| 30 | Ga0055527_1000025 | 3300003760 | Bacteria | 195817 |
| 31 | Ga0055542_1000005 | 3300003762 | Bacteria | 550280 |
| 32 | Ga0055542_1000048 | 3300003762 | Bacteria | 195800 |
| 33 | Ga0055542_1002667 | 3300003762 | Bacteria | 5533 |
| 34 | Ga0055529_1000006 | 3300003763 | Bacteria | 416978 |
| 35 | Ga0055529_1000057 | 3300003763 | Bacteria | 195807 |
| 36 | Ga0055526_1005838 | 3300003771 | Bacteria | 6915 |
| 37 | Ga0055528_1000140 | 3300003790 | Bacteria | 58329 |
| 38 | Ga0055540_1000102 | 3300003792 | Bacteria | 95294 |
| 39 | Ga0055540_1000326 | 3300003792 | Bacteria | 41728 |
| 40 | Ga0055541_1002437 | 3300003841 | Bacteria | 3721 |
| 41 | Ga0058692_1000303 | 3300003856 | Bacteria | 24919 |
| 42 | Ga0058692_1000351 | 3300003856 | Bacteria | 22439 |
| 43 | Ga0058692_1000379 | 3300003856 | Bacteria | 21285 |
| 44 | Ga0058692_1000438 | 3300003856 | Bacteria | 18964 |
| 45 | Ga0058692_1000804 | 3300003856 | Bacteria | 12559 |
| 46 | Ga0058692_1006585 | 3300003856 | Bacteria | 3167 |
| 47 | Ga0058692_1009657 | 3300003856 | Bacteria | 2420 |
| 48 | Ga0065714_10004525 | 3300005288 | Bacteria | 6178 |
| 49 | Ga0065714_10019635 | 3300005288 | Bacteria | 2223 |
| 50 | Ga0065704_10000345 | 3300005289 | Bacteria | 36048 |
| 51 | Ga0065704_10001325 | 3300005289 | Bacteria | 9736 |
| 52 | Ga0065704_10007120 | 3300005289 | Bacteria | 4728 |
| 53 | Ga0065704_10009879 | 3300005289 | Bacteria | 2065 |
| 54 | Ga0065704_10070742 | 3300005289 | Bacteria | 16815 |
| 55 | Ga0070658_10155017 | 3300005327 | Bacteria | 1920 |
| 56 | Ga0070676_10001857 | 3300005328 | Bacteria | 10758 |
| 57 | Ga0070676_10067664 | 3300005328 | Bacteria | 2136 |
| 58 | Ga0070670_100049013 | 3300005331 | Bacteria | 3634 |
| 59 | Ga0070670_100056374 | 3300005331 | Bacteria | 3372 |
| 60 | Ga0070670_100145467 | 3300005331 | Bacteria | 2050 |
| 61 | Ga0070677_10005553 | 3300005333 | Bacteria | 4159 |
| 62 | Ga0068869_100013259 | 3300005334 | Bacteria | 5477 |
| 63 | Ga0068868_100011001 | 3300005338 | Bacteria | 6574 |
| 64 | Ga0068868_100059380 | 3300005338 | Bacteria | 3025 |
| 65 | Ga0070668_100011436 | 3300005347 | Bacteria | 6608 |
| 66 | Ga0070668_100018267 | 3300005347 | Bacteria | 5262 |
| 67 | Ga0070669_100010732 | 3300005353 | Bacteria | 6500 |
| 68 | Ga0070669_100136719 | 3300005353 | Bacteria | 1886 |
| 69 | Ga0070675_100012523 | 3300005354 | Bacteria | 6649 |
| 70 | Ga0070675_100014679 | 3300005354 | Bacteria | 6178 |
| 71 | Ga0070671_100047239 | 3300005355 | Bacteria | 3580 |
| 72 | Ga0070671_100050040 | 3300005355 | Bacteria | 3476 |
| 73 | Ga0070673_100105265 | 3300005364 | Bacteria | 2330 |
| 74 | Ga0070688_100037254 | 3300005365 | Bacteria | 2963 |
| 75 | Ga0070667_100161053 | 3300005367 | Bacteria | 1976 |
| 76 | Ga0070709_10071272 | 3300005434 | Bacteria | 2243 |
| 77 | Ga0070711_100016174 | 3300005439 | Bacteria | 4733 |
| 78 | Ga0070663_100001810 | 3300005455 | Bacteria | 11890 |
| 79 | Ga0070684_100078614 | 3300005535 | Bacteria | 2915 |
| 80 | Ga0068853_100099784 | 3300005539 | Bacteria | 2565 |
| 81 | Ga0068853_100117519 | 3300005539 | Bacteria | 2368 |
| 82 | Ga0070665_100000998 | 3300005548 | Bacteria | 35866 |
| 83 | Ga0070665_100074247 | 3300005548 | Bacteria | 3406 |
| 84 | Ga0070664_100267319 | 3300005564 | Bacteria | 1540 |
| 85 | Ga0068857_100007212 | 3300005577 | Bacteria | 9573 |
| 86 | Ga0068856_100011072 | 3300005614 | Bacteria | 8757 |
| 87 | Ga0068856_100064802 | 3300005614 | Bacteria | 3611 |
| 88 | Ga0068852_100053124 | 3300005616 | Bacteria | 3486 |
| 89 | Ga0068851_10053424 | 3300005834 | Bacteria | 2057 |
| 90 | Ga0068858_100020381 | 3300005842 | Bacteria | 6201 |
| 91 | Ga0068862_100044649 | 3300005844 | Bacteria | 3780 |
| 92 | Ga0075368_10002512 | 3300006042 | Bacteria | 6002 |
| 93 | Ga0075368_10002845 | 3300006042 | Bacteria | 5712 |
| 94 | Ga0075368_10032139 | 3300006042 | Bacteria | 2037 |
| 95 | Ga0075363_100000269 | 3300006048 | Bacteria | 14977 |
| 96 | Ga0075364_10000193 | 3300006051 | Bacteria | 28203 |
| 97 | Ga0075364_10002110 | 3300006051 | Bacteria | 11106 |
| 98 | Ga0075364_10005201 | 3300006051 | Bacteria | 7550 |
| 99 | Ga0075364_10016852 | 3300006051 | Bacteria | 4551 |
| 100 | Ga0075364_10040851 | 3300006051 | Bacteria | 3009 |
| 101 | Ga0075364_10041471 | 3300006051 | Bacteria | 2988 |
| 102 | Ga0075364_10042550 | 3300006051 | Bacteria | 2951 |
| 103 | Ga0075364_10045544 | 3300006051 | Bacteria | 2855 |
| 104 | Ga0075432_10005837 | 3300006058 | Bacteria | 4189 |
| 105 | Ga0075362_10001446 | 3300006177 | Bacteria | 7595 |
| 106 | Ga0075362_10028876 | 3300006177 | Bacteria | 2386 |
| 107 | Ga0075367_10000224 | 3300006178 | Bacteria | 18937 |
| 108 | Ga0075369_10010268 | 3300006186 | Bacteria | 3659 |
| 109 | Ga0075369_10020540 | 3300006186 | Bacteria | 2705 |
| 110 | Ga0075369_10020933 | 3300006186 | Bacteria | 2682 |
| 111 | Ga0075369_10031488 | 3300006186 | Bacteria | 2240 |
| 112 | Ga0075366_10057282 | 3300006195 | Bacteria | 2316 |
| 113 | Ga0097621_100135245 | 3300006237 | Bacteria | 2102 |
| 114 | Ga0075370_10019191 | 3300006353 | Bacteria | 3721 |
| 115 | Ga0075370_10077717 | 3300006353 | Bacteria | 1905 |
| 116 | Ga0075430_100146584 | 3300006846 | Bacteria | 1966 |
| 117 | Ga0079104_1000021 | 3300006946 | Bacteria | 247219 |
| 118 | Ga0079104_1000109 | 3300006946 | Bacteria | 122060 |
| 119 | Ga0079104_1000480 | 3300006946 | Bacteria | 44433 |
| 120 | Ga0079104_1001200 | 3300006946 | Bacteria | 18428 |
| 121 | Ga0079104_1004059 | 3300006946 | Bacteria | 6451 |
| 122 | Ga0099826_10000059 | 3300006948 | Bacteria | 63493 |
| 123 | Ga0099826_10033794 | 3300006948 | Bacteria | 3665 |
| 124 | Ga0105251_10000042 | 3300009011 | Bacteria | 114031 |
| 125 | Ga0105251_10000479 | 3300009011 | Bacteria | 37816 |
| 126 | Ga0105251_10000566 | 3300009011 | Bacteria | 34679 |
| 127 | Ga0105251_10000699 | 3300009011 | Bacteria | 30975 |
| 128 | Ga0105251_10001786 | 3300009011 | Bacteria | 17879 |
| 129 | Ga0105251_10002777 | 3300009011 | Bacteria | 13317 |
| 130 | Ga0105251_10003838 | 3300009011 | Bacteria | 10709 |
| 131 | Ga0105251_10013897 | 3300009011 | Bacteria | 4478 |
| 132 | Ga0105251_10015859 | 3300009011 | Bacteria | 4099 |
| 133 | Ga0105244_10000034 | 3300009036 | Bacteria | 168462 |
| 134 | Ga0105244_10000327 | 3300009036 | Bacteria | 45346 |
| 135 | Ga0105244_10001835 | 3300009036 | Bacteria | 16611 |
| 136 | Ga0105244_10005219 | 3300009036 | Bacteria | 8686 |
| 137 | Ga0105244_10013325 | 3300009036 | Bacteria | 4813 |
| 138 | Ga0105244_10021407 | 3300009036 | Bacteria | 3576 |
| 139 | Ga0105244_10022622 | 3300009036 | Bacteria | 3458 |
| 140 | Ga0105244_10031860 | 3300009036 | Bacteria | 2796 |
| 141 | Ga0105244_10071928 | 3300009036 | Bacteria | 1723 |
| 142 | Ga0105250_10000002 | 3300009092 | Bacteria | 566949 |
| 143 | Ga0105250_10000009 | 3300009092 | Bacteria | 330307 |
| 144 | Ga0105250_10000234 | 3300009092 | Bacteria | 46425 |
| 145 | Ga0105250_10005807 | 3300009092 | Bacteria | 5488 |
| 146 | Ga0105250_10011665 | 3300009092 | Bacteria | 3643 |
| 147 | Ga0105240_10000012 | 3300009093 | Bacteria | 496639 |
| 148 | Ga0105245_10087458 | 3300009098 | Bacteria | 2860 |
| 149 | Ga0105245_10196241 | 3300009098 | Bacteria | 1936 |
| 150 | Ga0105247_10000018 | 3300009101 | Bacteria | 259335 |
| 151 | Ga0105243_10001837 | 3300009148 | Bacteria | 18156 |
| 152 | Ga0105243_10027938 | 3300009148 | Bacteria | 4328 |
| 153 | Ga0105243_10046858 | 3300009148 | Bacteria | 3402 |
| 154 | Ga0105243_10167044 | 3300009148 | Bacteria | 1902 |
| 155 | Ga0105241_10000004 | 3300009174 | Bacteria | 803007 |
| 156 | Ga0105248_10163942 | 3300009177 | Bacteria | 2506 |
| 157 | Ga0105237_10006031 | 3300009545 | Bacteria | 13563 |
| 158 | Ga0105237_10034447 | 3300009545 | Bacteria | 5127 |
| 159 | Ga0105237_10088813 | 3300009545 | Bacteria | 3080 |
| 160 | Ga0105237_10178038 | 3300009545 | Bacteria | 2127 |
| 161 | Ga0105238_10075987 | 3300009551 | Bacteria | 3351 |
| 162 | Ga0123342_1016048 | 3300009766 | Bacteria | 6619 |
| 163 | Ga0105239_10076423 | 3300010375 | Bacteria | 3683 |
| 164 | Ga0105239_10262732 | 3300010375 | Bacteria | 1940 |
| 165 | Ga0105246_10000078 | 3300011119 | Bacteria | 41051 |
| 166 | Ga0105246_10001187 | 3300011119 | Bacteria | 15161 |
| 167 | Ga0105246_10004731 | 3300011119 | Bacteria | 8291 |
| 168 | Ga0105246_10005032 | 3300011119 | Bacteria | 8040 |
| 169 | Ga0105246_10031207 | 3300011119 | Bacteria | 3525 |
| 170 | Ga0105246_10048375 | 3300011119 | Bacteria | 2907 |
| 171 | Ga0105246_10077956 | 3300011119 | Bacteria | 2352 |
| 172 | Ga0105246_10078707 | 3300011119 | Bacteria | 2342 |
| 173 | Ga0157373_10000788 | 3300013100 | Bacteria | 24425 |
| 174 | Ga0157373_10005732 | 3300013100 | Bacteria | 9305 |
| 175 | Ga0157373_10006320 | 3300013100 | Bacteria | 8849 |
| 176 | Ga0157373_10023542 | 3300013100 | Bacteria | 4463 |
| 177 | Ga0157373_10091825 | 3300013100 | Bacteria | 2138 |
| 178 | Ga0157371_10000002 | 3300013102 | Bacteria | 665040 |
| 179 | Ga0157371_10002433 | 3300013102 | Bacteria | 17752 |
| 180 | Ga0157371_10003636 | 3300013102 | Bacteria | 13884 |
| 181 | Ga0157371_10007791 | 3300013102 | Bacteria | 8605 |
| 182 | Ga0157371_10016879 | 3300013102 | Bacteria | 5437 |
| 183 | Ga0157371_10115652 | 3300013102 | Bacteria | 1905 |
| 184 | Ga0157371_10137366 | 3300013102 | Bacteria | 1741 |
| 185 | Ga0157370_10000053 | 3300013104 | Bacteria | 119285 |
| 186 | Ga0157370_10000078 | 3300013104 | Bacteria | 107381 |
| 187 | Ga0157370_10000325 | 3300013104 | Bacteria | 59719 |
| 188 | Ga0157370_10001455 | 3300013104 | Bacteria | 29311 |
| 189 | Ga0157370_10002083 | 3300013104 | Bacteria | 24489 |
| 190 | Ga0157369_10088708 | 3300013105 | Bacteria | 3302 |
| 191 | Ga0157369_10119698 | 3300013105 | Bacteria | 2794 |
| 192 | Ga0157374_10014658 | 3300013296 | Bacteria | 6861 |
| 193 | Ga0163162_10007543 | 3300013306 | Bacteria | 10594 |
| 194 | Ga0163162_10037249 | 3300013306 | Bacteria | 4852 |
| 195 | Ga0163162_10055425 | 3300013306 | Bacteria | 3991 |
| 196 | Ga0163162_10084787 | 3300013306 | Bacteria | 3245 |
| 197 | Ga0157372_10020599 | 3300013307 | Bacteria | 7118 |
| 198 | Ga0157372_10024667 | 3300013307 | Bacteria | 6535 |
| 199 | Ga0157372_10028908 | 3300013307 | Bacteria | 6049 |
| 200 | Ga0157372_10045725 | 3300013307 | Bacteria | 4858 |
| 201 | Ga0157372_10173238 | 3300013307 | Bacteria | 2497 |
| 202 | Ga0157372_10174033 | 3300013307 | Bacteria | 2491 |
| 203 | Ga0157372_10261885 | 3300013307 | Bacteria | 2008 |
| 204 | Ga0157375_10002937 | 3300013308 | Bacteria | 14781 |
| 205 | Ga0157375_10107278 | 3300013308 | Bacteria | 2886 |
| 206 | Ga0182008_10002953 | 3300014497 | Bacteria | 10462 |
| 207 | Ga0182008_10011140 | 3300014497 | Bacteria | 4796 |
| 208 | Ga0182006_1000144 | 3300015261 | Bacteria | 75603 |
| 209 | Ga0182006_1007205 | 3300015261 | Bacteria | 5107 |
| 210 | Ga0182007_10000467 | 3300015262 | Bacteria | 24434 |
| 211 | Ga0182007_10000552 | 3300015262 | Bacteria | 22108 |
| 212 | Ga0183366_1001 | 3300015679 | Bacteria | 2743932 |
| 213 | Ga0183370_1001 | 3300015680 | Bacteria | 2743932 |
| 214 | Ga0183369_1001 | 3300015685 | Bacteria | 2743932 |
| 215 | Ga0183368_1001 | 3300015687 | Bacteria | 2743932 |
| 216 | Ga0183367_1001 | 3300015688 | Bacteria | 1225545 |
| 217 | Ga0183367_1003 | 3300015688 | Bacteria | 814276 |
| 218 | Ga0163161_10002528 | 3300017792 | Bacteria | 13049 |
| 219 | Ga0163161_10005068 | 3300017792 | Bacteria | 9167 |
| 220 | Ga0163161_10072746 | 3300017792 | Bacteria | 2518 |
| 221 | Ga0206355_1600119 | 3300020076 | Bacteria | 1914 |
| 222 | Ga0214543_1003948 | 3300021327 | Bacteria | 28458 |
| 223 | Ga0209435_100006 | 3300025206 | Bacteria | 542459 |
| 224 | Ga0209566_100031 | 3300025225 | Bacteria | 341555 |
| 225 | Ga0209674_100001 | 3300025226 | Bacteria | 4013750 |
| 226 | Ga0209672_100003 | 3300025228 | Bacteria | 1560476 |
| 227 | Ga0209672_100011 | 3300025228 | Bacteria | 856297 |
| 228 | Ga0209672_105034 | 3300025228 | Bacteria | 2335 |
| 229 | Ga0209147_100429 | 3300025229 | Bacteria | 27291 |
| 230 | Ga0209147_101101 | 3300025229 | Bacteria | 11262 |
| 231 | Ga0209563_100001 | 3300025230 | Bacteria | 4013775 |
| 232 | Ga0209563_100155 | 3300025230 | Bacteria | 64311 |
| 233 | Ga0207427_100028 | 3300025231 | Bacteria | 388949 |
| 234 | Ga0209437_100115 | 3300025233 | Bacteria | 209911 |
| 235 | Ga0209437_100454 | 3300025233 | Bacteria | 33437 |
| 236 | Ga0209437_101468 | 3300025233 | Bacteria | 5696 |
| 237 | Ga0209258_101738 | 3300025242 | Bacteria | 6753 |
| 238 | Ga0207425_1005693 | 3300025245 | Bacteria | 3514 |
| 239 | Ga0209646_1000015 | 3300025246 | Bacteria | 542459 |
| 240 | Ga0209026_1000046 | 3300025250 | Bacteria | 262031 |
| 241 | Ga0209677_100001 | 3300025253 | Bacteria | 4013787 |
| 242 | Ga0209677_100158 | 3300025253 | Bacteria | 61587 |
| 243 | Ga0209677_102523 | 3300025253 | Bacteria | 6812 |
| 244 | Ga0209148_1000004 | 3300025254 | Bacteria | 1844481 |
| 245 | Ga0209148_1000023 | 3300025254 | Bacteria | 680511 |
| 246 | Ga0209148_1003076 | 3300025254 | Bacteria | 4902 |
| 247 | Ga0209759_1000005 | 3300025256 | Bacteria | 542459 |
| 248 | Ga0209129_1000130 | 3300025258 | Bacteria | 128065 |
| 249 | Ga0209129_1000180 | 3300025258 | Bacteria | 90882 |
| 250 | Ga0209129_1000220 | 3300025258 | Bacteria | 65268 |
| 251 | Ga0209233_1000001 | 3300025261 | Bacteria | 2992747 |
| 252 | Ga0209233_1000161 | 3300025261 | Bacteria | 158607 |
| 253 | Ga0209233_1000230 | 3300025261 | Bacteria | 97941 |
| 254 | Ga0209455_1000023 | 3300025272 | Bacteria | 680449 |
| 255 | Ga0209455_1000046 | 3300025272 | Bacteria | 382681 |
| 256 | Ga0209673_1000023 | 3300025273 | Bacteria | 411385 |
| 257 | Ga0209673_1001357 | 3300025273 | Bacteria | 24320 |
| 258 | Ga0209676_1000292 | 3300025292 | Bacteria | 101778 |
| 259 | Ga0209025_1000255 | 3300025294 | Bacteria | 125764 |
| 260 | Ga0209025_1000364 | 3300025294 | Bacteria | 96280 |
| 261 | Ga0209025_1000586 | 3300025294 | Bacteria | 65856 |
| 262 | Ga0209025_1001712 | 3300025294 | Bacteria | 26677 |
| 263 | Ga0209564_1000100 | 3300025295 | Bacteria | 224016 |
| 264 | Ga0209758_1003466 | 3300025297 | Bacteria | 14304 |
| 265 | Ga0209256_1000221 | 3300025299 | Bacteria | 105907 |
| 266 | Ga0207426_1000393 | 3300025302 | Bacteria | 74583 |
| 267 | Ga0207426_1007262 | 3300025302 | Bacteria | 4665 |
| 268 | Ga0209051_1000062 | 3300025303 | Bacteria | 251081 |
| 269 | Ga0209051_1008810 | 3300025303 | Bacteria | 5288 |
| 270 | Ga0209257_1001421 | 3300025304 | Bacteria | 28513 |
| 271 | Ga0207697_10002976 | 3300025315 | Bacteria | 8551 |
| 272 | Ga0207697_10010229 | 3300025315 | Bacteria | 4018 |
| 273 | Ga0207697_10046927 | 3300025315 | Bacteria | 1780 |
| 274 | Ga0207696_1000005 | 3300025711 | Bacteria | 642078 |
| 275 | Ga0207696_1000021 | 3300025711 | Bacteria | 432606 |
| 276 | Ga0207696_1000035 | 3300025711 | Bacteria | 339626 |
| 277 | Ga0207696_1000088 | 3300025711 | Bacteria | 190313 |
| 278 | Ga0207696_1000348 | 3300025711 | Bacteria | 47596 |
| 279 | Ga0207696_1011651 | 3300025711 | Bacteria | 3153 |
| 280 | Ga0207655_1000001 | 3300025728 | Bacteria | 1866413 |
| 281 | Ga0207655_1000002 | 3300025728 | Bacteria | 1148694 |
| 282 | Ga0207655_1000007 | 3300025728 | Bacteria | 773492 |
| 283 | Ga0207655_1000046 | 3300025728 | Bacteria | 309474 |
| 284 | Ga0207655_1001213 | 3300025728 | Bacteria | 24820 |
| 285 | Ga0207655_1005093 | 3300025728 | Bacteria | 9083 |
| 286 | Ga0207655_1005663 | 3300025728 | Bacteria | 8446 |
| 287 | Ga0207655_1008878 | 3300025728 | Bacteria | 6316 |
| 288 | Ga0207655_1015592 | 3300025728 | Bacteria | 4211 |
| 289 | Ga0207655_1017637 | 3300025728 | Bacteria | 3839 |
| 290 | Ga0207655_1030668 | 3300025728 | Bacteria | 2496 |
| 291 | Ga0207655_1043696 | 3300025728 | Bacteria | 1891 |
| 292 | Ga0207655_1050379 | 3300025728 | Bacteria | 1693 |
| 293 | Ga0207713_1000001 | 3300025735 | Bacteria | 2295391 |
| 294 | Ga0207713_1000002 | 3300025735 | Bacteria | 1061749 |
| 295 | Ga0207713_1000003 | 3300025735 | Bacteria | 860698 |
| 296 | Ga0207713_1000004 | 3300025735 | Bacteria | 702781 |
| 297 | Ga0207713_1000026 | 3300025735 | Bacteria | 319032 |
| 298 | Ga0207713_1010458 | 3300025735 | Bacteria | 5131 |
| 299 | Ga0207713_1025983 | 3300025735 | Bacteria | 2692 |
| 300 | Ga0207682_10000870 | 3300025893 | Bacteria | 14001 |
| 301 | Ga0207682_10005202 | 3300025893 | Bacteria | 5325 |
| 302 | Ga0207692_10051627 | 3300025898 | Bacteria | 2085 |
| 303 | Ga0207710_10000049 | 3300025900 | Bacteria | 186492 |
| 304 | Ga0207688_10003506 | 3300025901 | Bacteria | 8561 |
| 305 | Ga0207688_10018592 | 3300025901 | Bacteria | 3780 |
| 306 | Ga0207688_10027609 | 3300025901 | Bacteria | 3122 |
| 307 | Ga0207647_10032327 | 3300025904 | Bacteria | 3363 |
| 308 | Ga0207645_10001051 | 3300025907 | Bacteria | 22851 |
| 309 | Ga0207645_10005766 | 3300025907 | Bacteria | 8932 |
| 310 | Ga0207643_10012143 | 3300025908 | Bacteria | 4654 |
| 311 | Ga0207654_10000006 | 3300025911 | Bacteria | 815027 |
| 312 | Ga0207695_10000097 | 3300025913 | Bacteria | 262517 |
| 313 | Ga0207671_10000023 | 3300025914 | Bacteria | 274756 |
| 314 | Ga0207693_10031842 | 3300025915 | Bacteria | 4166 |
| 315 | Ga0207650_10005626 | 3300025925 | Bacteria | 8560 |
| 316 | Ga0207650_10037411 | 3300025925 | Bacteria | 3536 |
| 317 | Ga0207659_10007512 | 3300025926 | Bacteria | 6708 |
| 318 | Ga0207659_10050333 | 3300025926 | Bacteria | 2959 |
| 319 | Ga0207687_10033779 | 3300025927 | Bacteria | 3471 |
| 320 | Ga0207687_10135981 | 3300025927 | Bacteria | 1859 |
| 321 | Ga0207706_10034324 | 3300025933 | Bacteria | 4514 |
| 322 | Ga0207706_10060675 | 3300025933 | Bacteria | 3331 |
| 323 | Ga0207709_10008572 | 3300025935 | Bacteria | 5650 |
| 324 | Ga0207709_10011422 | 3300025935 | Bacteria | 4899 |
| 325 | Ga0207709_10045900 | 3300025935 | Bacteria | 2649 |
| 326 | Ga0207709_10084128 | 3300025935 | Bacteria | 2059 |
| 327 | Ga0207669_10013591 | 3300025937 | Bacteria | 4050 |
| 328 | Ga0207691_10012886 | 3300025940 | Bacteria | 8005 |
| 329 | Ga0207691_10014615 | 3300025940 | Bacteria | 7483 |
| 330 | Ga0207711_10095012 | 3300025941 | Bacteria | 2628 |
| 331 | Ga0207668_10036135 | 3300025972 | Bacteria | 3295 |
| 332 | Ga0207640_10063834 | 3300025981 | Bacteria | 2449 |
| 333 | Ga0207677_10168114 | 3300026023 | Bacteria | 1711 |
| 334 | Ga0207678_10001242 | 3300026067 | Bacteria | 23516 |
| 335 | Ga0207678_10012287 | 3300026067 | Bacteria | 7519 |
| 336 | Ga0207678_10048587 | 3300026067 | Bacteria | 3667 |
| 337 | Ga0207708_10024834 | 3300026075 | Bacteria | 4535 |
| 338 | Ga0207702_10036199 | 3300026078 | Bacteria | 4128 |
| 339 | Ga0207702_10150633 | 3300026078 | Bacteria | 2115 |
| 340 | Ga0207648_10012323 | 3300026089 | Bacteria | 8004 |
| 341 | Ga0207674_10011834 | 3300026116 | Bacteria | 9782 |
| 342 | Ga0207674_10067560 | 3300026116 | Bacteria | 3599 |
| 343 | Ga0207675_100006342 | 3300026118 | Bacteria | 11212 |
| 344 | Ga0207683_10006658 | 3300026121 | Bacteria | 9883 |
| 345 | Ga0207683_10017060 | 3300026121 | Bacteria | 6179 |
| 346 | Ga0207683_10202364 | 3300026121 | Bacteria | 1805 |
| 347 | Ga0209281_1000001 | 3300027111 | Bacteria | 1933496 |
| 348 | Ga0209281_1000004 | 3300027111 | Bacteria | 1253949 |
| 349 | Ga0209281_1000006 | 3300027111 | Bacteria | 1170244 |
| 350 | Ga0209281_1000008 | 3300027111 | Bacteria | 867470 |
| 351 | Ga0209281_1000024 | 3300027111 | Bacteria | 499062 |
| 352 | Ga0209281_1001417 | 3300027111 | Bacteria | 14302 |
| 353 | Ga0209371_1000001 | 3300027312 | Bacteria | 2771503 |
| 354 | Ga0209371_1000003 | 3300027312 | Bacteria | 1122971 |
| 355 | Ga0209371_1000084 | 3300027312 | Bacteria | 180842 |
| 356 | Ga0209371_1000190 | 3300027312 | Bacteria | 89981 |
| 357 | Ga0209371_1000407 | 3300027312 | Bacteria | 44809 |
| 358 | Ga0209371_1000480 | 3300027312 | Bacteria | 38919 |
| 359 | Ga0209371_1001270 | 3300027312 | Bacteria | 17864 |
| 360 | Ga0209371_1001339 | 3300027312 | Bacteria | 17098 |
| 361 | Ga0209371_1001386 | 3300027312 | Bacteria | 16650 |
| 362 | Ga0209371_1001534 | 3300027312 | Bacteria | 15290 |
| 363 | Ga0209371_1002297 | 3300027312 | Bacteria | 10912 |
| 364 | Ga0209371_1002802 | 3300027312 | Bacteria | 9281 |
| 365 | Ga0209371_1003647 | 3300027312 | Bacteria | 7319 |
| 366 | Ga0209371_1005377 | 3300027312 | Bacteria | 5109 |
| 367 | Ga0209282_1000502 | 3300027666 | Bacteria | 19013 |
| 368 | Ga0207428_10010431 | 3300027907 | Bacteria | 8299 |
| 369 | Ga0268266_10002032 | 3300028379 | Bacteria | 22465 |
| 370 | Ga0268266_10015356 | 3300028379 | Bacteria | 6571 |
| 371 | Ga0268266_10091692 | 3300028379 | Bacteria | 2665 |
| 372 | Ga0307517_10004520 | 3300028786 | Bacteria | 21344 |
| 373 | Ga0307515_10000995 | 3300028794 | Bacteria | 64758 |
| 374 | Ga0268256_1000001 | 3300030500 | Bacteria | 2771065 |
| 375 | Ga0268256_1000004 | 3300030500 | Bacteria | 1122967 |
| 376 | Ga0268256_1000069 | 3300030500 | Bacteria | 195391 |
| 377 | Ga0268256_1000075 | 3300030500 | Bacteria | 180814 |
| 378 | Ga0268256_1000264 | 3300030500 | Bacteria | 55541 |
| 379 | Ga0268256_1001091 | 3300030500 | Bacteria | 17823 |
| 380 | Ga0268256_1001426 | 3300030500 | Bacteria | 14431 |
| 381 | Ga0268256_1001782 | 3300030500 | Bacteria | 12149 |
| 382 | Ga0268256_1002333 | 3300030500 | Bacteria | 9788 |
| 383 | Ga0268256_1004200 | 3300030500 | Bacteria | 6078 |
| 384 | Ga0268256_1005052 | 3300030500 | Bacteria | 5282 |
| 385 | Ga0268256_1014568 | 3300030500 | Bacteria | 2326 |
| 386 | Ga0307511_10001289 | 3300030521 | Bacteria | 26561 |
| 387 | Ga0307511_10003267 | 3300030521 | Bacteria | 16663 |
| 388 | Ga0307511_10005918 | 3300030521 | Bacteria | 12364 |
| 389 | Ga0307511_10045093 | 3300030521 | Bacteria | 3650 |
| 390 | Ga0307512_10007852 | 3300030522 | Bacteria | 10495 |
| 391 | Ga0307512_10021735 | 3300030522 | Bacteria | 5780 |
| 392 | Ga0307512_10043303 | 3300030522 | Bacteria | 3714 |
| 393 | Ga0316181_1263973 | 3300030744 | Bacteria | 2951 |
| 394 | Ga0307513_10038677 | 3300031456 | Bacteria | 5296 |
| 395 | Ga0307509_10019038 | 3300031507 | Bacteria | 7853 |
| 396 | Ga0307509_10032432 | 3300031507 | Bacteria | 5756 |
| 397 | Ga0307408_100005443 | 3300031548 | Bacteria | 8523 |
| 398 | Ga0307408_100027030 | 3300031548 | Bacteria | 3951 |
| 399 | Ga0307408_100085182 | 3300031548 | Bacteria | 2372 |
| 400 | Ga0307408_100091679 | 3300031548 | Bacteria | 2295 |
| 401 | Ga0307408_100129088 | 3300031548 | Bacteria | 1970 |
| 402 | Ga0307508_10032150 | 3300031616 | Bacteria | 4741 |
| 403 | Ga0307508_10038578 | 3300031616 | Bacteria | 4292 |
| 404 | Ga0307508_10069406 | 3300031616 | Bacteria | 3095 |
| 405 | Ga0307514_10001738 | 3300031649 | Bacteria | 24956 |
| 406 | Ga0307514_10005218 | 3300031649 | Bacteria | 11704 |
| 407 | Ga0307514_10015485 | 3300031649 | Bacteria | 6289 |
| 408 | Ga0307516_10004980 | 3300031730 | Bacteria | 16136 |
| 409 | Ga0307516_10020950 | 3300031730 | Bacteria | 6746 |
| 410 | Ga0307516_10063495 | 3300031730 | Bacteria | 3575 |
| 411 | Ga0307405_10061240 | 3300031731 | Bacteria | 2378 |
| 412 | Ga0307405_10068937 | 3300031731 | Bacteria | 2265 |
| 413 | Ga0307413_10017362 | 3300031824 | Bacteria | 3744 |
| 414 | Ga0307518_10000206 | 3300031838 | Bacteria | 44689 |
| 415 | Ga0307518_10000779 | 3300031838 | Bacteria | 23884 |
| 416 | Ga0307518_10152854 | 3300031838 | Bacteria | 1594 |
| 417 | Ga0307410_10002024 | 3300031852 | Bacteria | 9560 |
| 418 | Ga0307410_10106503 | 3300031852 | Bacteria | 2020 |
| 419 | Ga0307407_10028674 | 3300031903 | Bacteria | 2979 |
| 420 | Ga0307407_10063097 | 3300031903 | Bacteria | 2172 |
| 421 | Ga0307412_10003191 | 3300031911 | Bacteria | 9107 |
| 422 | Ga0307412_10126774 | 3300031911 | Bacteria | 1847 |
| 423 | Ga0307409_100068576 | 3300031995 | Bacteria | 2806 |
| 424 | Ga0307409_100100232 | 3300031995 | Bacteria | 2400 |
| 425 | Ga0307409_100256776 | 3300031995 | Bacteria | 1601 |
| 426 | Ga0307416_100016188 | 3300032002 | Bacteria | 5174 |
| 427 | Ga0307416_100050099 | 3300032002 | Bacteria | 3326 |
| 428 | Ga0307415_100060700 | 3300032126 | Bacteria | 2614 |
| 429 | Ga0307510_10010903 | 3300033180 | Bacteria | 10802 |
| 430 | Ga0395899_0007976 | 3300037312 | Bacteria | 8157 |
| 431 | Ga0395899_0010636 | 3300037312 | Bacteria | 7052 |
| 432 | Ga0395899_0012838 | 3300037312 | Bacteria | 6416 |
| 433 | Ga0395899_0020962 | 3300037312 | Bacteria | 4957 |
| 434 | Ga0395900_0017366 | 3300037418 | Bacteria | 7345 |
| 435 | Ga0395900_0022364 | 3300037418 | Bacteria | 6467 |
| 436 | Ga0395900_0029516 | 3300037418 | Bacteria | 5625 |
| 437 | Ga0395900_0032077 | 3300037418 | Bacteria | 5401 |
| 438 | Ga0395900_0056878 | 3300037418 | Bacteria | 4026 |
| 439 | Ga0395900_0142728 | 3300037418 | Bacteria | 2451 |
| 440 | Ga0395900_0145962 | 3300037418 | Bacteria | 2419 |
| 441 | Ga0395900_0216316 | 3300037418 | Bacteria | 1933 |
| 442 | Ga0395898_0000100 | 3300037466 | Bacteria | 226446 |
| 443 | Ga0395898_0000194 | 3300037466 | Bacteria | 155846 |
| 444 | Ga0395898_0006197 | 3300037466 | Bacteria | 12815 |
| 445 | Ga0395898_0006965 | 3300037466 | Bacteria | 12018 |
| 446 | Ga0395898_0007917 | 3300037466 | Bacteria | 11274 |
| 447 | Ga0395898_0008104 | 3300037466 | Bacteria | 11121 |
| 448 | Ga0395898_0048647 | 3300037466 | Bacteria | 4157 |
| 449 | Ga0395898_0065633 | 3300037466 | Bacteria | 3519 |
| 450 | Ga0395905_0261676 | 3300037471 | Bacteria | 1615 |
| 451 | Ga0436364_0423804 | 3300037853 | Bacteria | 2743 |
| 452 | Ga0436364_0650390 | 3300037853 | Bacteria | 2006 |
| 453 | Ga0395901_0000801 | 3300038443 | Bacteria | 34929 |
| 454 | Ga0395901_0003822 | 3300038443 | Bacteria | 15180 |
| 455 | Ga0395901_0010327 | 3300038443 | Bacteria | 9457 |
| 456 | Ga0395901_0015381 | 3300038443 | Bacteria | 7789 |
| 457 | Ga0395901_0021736 | 3300038443 | Bacteria | 6574 |
| 458 | Ga0395901_0049549 | 3300038443 | Bacteria | 4364 |
| 459 | Ga0395901_0329478 | 3300038443 | Bacteria | 1579 |
| 460 | Ga0395901_0339581 | 3300038443 | Bacteria | 1552 |
| 461 | Ga0436365_1486359 | 3300039437 | Bacteria | 9240 |
| 462 | Ga0436365_1550583 | 3300039437 | Bacteria | 3640 |
| 463 | Ga0436365_1804934 | 3300039437 | Bacteria | 1775 |
| 464 | Ga0436363_0937583 | 3300039450 | Bacteria | 2797 |
| 465 | Ga0439436_0000195 | 3300041404 | Bacteria | 14462 |
| 466 | Ga0439436_0004122 | 3300041404 | Bacteria | 4453 |
| 467 | Ga0439436_0011031 | 3300041404 | Bacteria | 2748 |
| 468 | Ga0439438_000002 | 3300041405 | Bacteria | 618223 |
| 469 | Ga0439438_008721 | 3300041405 | Bacteria | 3335 |
| 470 | Ga0439438_008736 | 3300041405 | Bacteria | 3331 |
| 471 | Ga0439439_0005795 | 3300041406 | Bacteria | 2837 |
| 472 | Ga0439447_002146 | 3300041407 | Bacteria | 7230 |
| 473 | Ga0439461_0005423 | 3300041410 | Bacteria | 2172 |
| 474 | Ga0439466_0000001 | 3300041411 | Bacteria | 647258 |
| 475 | Ga0439466_0008105 | 3300041411 | Bacteria | 3961 |
| 476 | Ga0439466_0008217 | 3300041411 | Bacteria | 3935 |
| 477 | Ga0439466_0014548 | 3300041411 | Bacteria | 2864 |
| 478 | Ga0439466_0036103 | 3300041411 | Bacteria | 1670 |
| 479 | Ga0439465_0001310 | 3300041413 | Bacteria | 8015 |
| 480 | Ga0439465_0004124 | 3300041413 | Bacteria | 4728 |
| 481 | Ga0439465_0008621 | 3300041413 | Bacteria | 3216 |
| 482 | Ga0451793_0946035 | 3300041452 | Bacteria | 1948 |
| 483 | Ga0451843_1271766 | 3300041509 | Bacteria | 1916 |
| 484 | Ga0451853_3737571 | 3300041512 | Bacteria | 3497 |
| 485 | Ga0451853_3919652 | 3300041512 | Bacteria | 3566 |
| 486 | Ga0439433_0000402 | 3300041999 | Bacteria | 7834 |
| 487 | Ga0439433_0001637 | 3300041999 | Bacteria | 4662 |
| 488 | Ga0439433_0002433 | 3300041999 | Bacteria | 3951 |
| 489 | Ga0439433_0004144 | 3300041999 | Bacteria | 3115 |
| 490 | Ga0439433_0006160 | 3300041999 | Bacteria | 2579 |
| 491 | Ga0439442_000315 | 3300042002 | Bacteria | 11573 |
| 492 | Ga0439442_003681 | 3300042002 | Bacteria | 3036 |
| 493 | Ga0439432_004071 | 3300042006 | Bacteria | 5356 |
| 494 | Ga0439432_009751 | 3300042006 | Bacteria | 3340 |
| 495 | Ga0439432_017875 | 3300042006 | Bacteria | 2377 |
| 496 | Ga0439449_0000789 | 3300042007 | Bacteria | 12218 |
| 497 | Ga0439449_0001574 | 3300042007 | Bacteria | 8948 |
| 498 | Ga0439449_0013305 | 3300042007 | Bacteria | 3095 |
| 499 | Ga0439449_0017073 | 3300042007 | Bacteria | 2723 |
| 500 | Ga0439452_000014 | 3300042010 | Bacteria | 344969 |
| 501 | Ga0439452_000015 | 3300042010 | Bacteria | 342948 |
| 502 | Ga0439452_000053 | 3300042010 | Bacteria | 113190 |
| 503 | Ga0439452_015017 | 3300042010 | Bacteria | 2135 |
| 504 | Ga0439455_0000885 | 3300042012 | Bacteria | 4621 |
| 505 | Ga0439457_000374 | 3300042014 | Bacteria | 12607 |
| 506 | Ga0439457_000762 | 3300042014 | Bacteria | 9570 |
| 507 | Ga0439463_003029 | 3300042016 | Bacteria | 4268 |
| 508 | Ga0450919_003914 | 3300042121 | Bacteria | 1838 |
| 509 | Ga0450894_000179 | 3300042131 | Bacteria | 11321 |
| 510 | Ga0450902_007818 | 3300042137 | Bacteria | 1661 |
| 511 | Ga0450903_000358 | 3300042138 | Bacteria | 10027 |
| 512 | Ga0450903_001397 | 3300042138 | Bacteria | 4504 |
| 513 | Ga0450906_001425 | 3300042145 | Bacteria | 5210 |
| 514 | Ga0450907_000128 | 3300042146 | Bacteria | 28616 |
| 515 | Ga0439458_0000085 | 3300042157 | Bacteria | 17626 |
| 516 | Ga0439458_0001121 | 3300042157 | Bacteria | 6807 |
| 517 | Ga0450908_008239 | 3300042184 | Bacteria | 1954 |
| 518 | Ga0450918_000361 | 3300042531 | Bacteria | 9984 |
| 519 | Ga0466969_0011923 | 3300044656 | Bacteria | 4596 |
| 520 | Ga0466969_0019381 | 3300044656 | Bacteria | 3537 |
| 521 | Ga0466969_0023807 | 3300044656 | Bacteria | 3153 |
| 522 | Ga0466969_0033857 | 3300044656 | Bacteria | 2591 |
| 523 | Ga0466972_0000697 | 3300044658 | Bacteria | 16038 |
| 524 | Ga0466972_0002890 | 3300044658 | Bacteria | 8502 |
| 525 | Ga0466972_0004406 | 3300044658 | Bacteria | 7037 |
| 526 | Ga0466972_0009981 | 3300044658 | Bacteria | 4768 |
| 527 | Ga0466981_0000004 | 3300044669 | Bacteria | 171461 |
| 528 | Ga0466965_0000536 | 3300044683 | Bacteria | 13677 |
| 529 | Ga0466965_0028939 | 3300044683 | Bacteria | 2694 |
| 530 | Ga0466966_0000471 | 3300044684 | Bacteria | 25873 |
| 531 | Ga0466966_0001189 | 3300044684 | Bacteria | 16712 |
| 532 | Ga0466966_0001258 | 3300044684 | Bacteria | 16227 |
| 533 | Ga0466966_0006139 | 3300044684 | Bacteria | 7938 |
| 534 | Ga0466966_0007052 | 3300044684 | Bacteria | 7443 |
| 535 | Ga0466966_0014776 | 3300044684 | Bacteria | 5164 |
| 536 | Ga0466966_0021232 | 3300044684 | Bacteria | 4264 |
| 537 | Ga0466966_0033424 | 3300044684 | Bacteria | 3330 |
| 538 | Ga0466966_0036525 | 3300044684 | Bacteria | 3172 |
| 539 | Ga0466961_0002061 | 3300044693 | Bacteria | 12524 |
| 540 | Ga0466961_0005046 | 3300044693 | Bacteria | 8302 |
| 541 | Ga0466961_0014753 | 3300044693 | Bacteria | 5020 |
| 542 | Ga0466961_0017295 | 3300044693 | Bacteria | 4630 |
| 543 | Ga0466961_0020629 | 3300044693 | Bacteria | 4241 |
| 544 | Ga0466961_0021523 | 3300044693 | Bacteria | 4149 |
| 545 | Ga0466961_0023957 | 3300044693 | Bacteria | 3927 |
| 546 | Ga0466961_0026854 | 3300044693 | Bacteria | 3702 |
| 547 | Ga0466961_0046272 | 3300044693 | Bacteria | 2783 |
| 548 | Ga0466961_0076304 | 3300044693 | Bacteria | 2124 |
| 549 | Ga0466961_0079591 | 3300044693 | Bacteria | 2075 |
| 550 | Ga0466961_0080319 | 3300044693 | Bacteria | 2064 |
| 551 | Ga0466963_0000555 | 3300044694 | Bacteria | 17588 |
| 552 | Ga0466963_0020357 | 3300044694 | Bacteria | 4171 |
| 553 | Ga0466963_0039333 | 3300044694 | Bacteria | 3097 |
| 554 | Ga0466964_0008030 | 3300044706 | Bacteria | 3955 |
| 555 | Ga0466971_0000732 | 3300044719 | Bacteria | 13143 |
| 556 | Ga0466971_0002086 | 3300044719 | Bacteria | 8477 |
| 557 | Ga0466971_0002190 | 3300044719 | Bacteria | 8263 |
| 558 | Ga0466971_0005854 | 3300044719 | Bacteria | 5352 |
| 559 | Ga0466968_0009112 | 3300044735 | Bacteria | 3815 |
| 560 | Ga0466968_0010429 | 3300044735 | Bacteria | 3603 |
| 561 | Ga0466968_0013034 | 3300044735 | Bacteria | 3264 |
| 562 | Ga0466970_0000125 | 3300044765 | Bacteria | 34778 |
| 563 | Ga0466970_0000147 | 3300044765 | Bacteria | 32640 |
| 564 | Ga0466970_0001147 | 3300044765 | Bacteria | 12846 |
| 565 | Ga0466970_0002680 | 3300044765 | Bacteria | 8588 |
| 566 | Ga0466970_0003159 | 3300044765 | Bacteria | 8003 |
| 567 | Ga0466970_0003166 | 3300044765 | Bacteria | 7997 |
| 568 | Ga0466970_0005144 | 3300044765 | Bacteria | 6468 |
| 569 | Ga0466970_0007014 | 3300044765 | Bacteria | 5639 |
| 570 | Ga0466970_0011408 | 3300044765 | Bacteria | 4529 |
| 571 | Ga0466970_0012299 | 3300044765 | Bacteria | 4373 |
| 572 | Ga0466970_0032398 | 3300044765 | Bacteria | 2761 |
| 573 | Ga0466970_0052948 | 3300044765 | Bacteria | 2167 |
| 574 | Ga0466970_0069383 | 3300044765 | Bacteria | 1894 |
| 575 | Ga0466957_0000483 | 3300044842 | Bacteria | 19817 |
| 576 | Ga0466957_0002882 | 3300044842 | Bacteria | 9319 |
| 577 | Ga0466957_0074184 | 3300044842 | Bacteria | 2109 |
| 578 | Ga0466960_0002389 | 3300044901 | Bacteria | 7065 |
| 579 | Ga0466960_0024589 | 3300044901 | Bacteria | 2719 |
| 580 | Ga0466960_0028193 | 3300044901 | Bacteria | 2568 |
| 581 | Ga0466959_0000339 | 3300045049 | Bacteria | 27646 |
| 582 | Ga0466959_0003458 | 3300045049 | Bacteria | 10335 |
| 583 | Ga0466959_0004914 | 3300045049 | Bacteria | 9053 |
| 584 | Ga0466959_0005365 | 3300045049 | Bacteria | 8778 |
| 585 | Ga0466959_0006338 | 3300045049 | Bacteria | 8184 |
| 586 | Ga0466959_0019321 | 3300045049 | Bacteria | 5010 |
| 587 | Ga0466959_0043937 | 3300045049 | Bacteria | 3292 |
| 588 | Ga0466959_0054522 | 3300045049 | Bacteria | 2920 |
| 589 | Ga0466959_0066533 | 3300045049 | Bacteria | 2614 |
| 590 | Ga0466958_0001557 | 3300045836 | Bacteria | 10993 |
| 591 | Ga0466958_0001611 | 3300045836 | Bacteria | 10858 |
| 592 | Ga0466958_0003383 | 3300045836 | Bacteria | 8271 |
| 593 | Ga0466958_0003456 | 3300045836 | Bacteria | 8195 |
| 594 | Ga0466958_0021927 | 3300045836 | Bacteria | 3735 |
| 595 | Ga0466958_0034414 | 3300045836 | Bacteria | 3022 |
| 596 | Ga0466958_0050343 | 3300045836 | Bacteria | 2522 |
| 597 | Ga0466967_0002131 | 3300045976 | Bacteria | 12131 |
| 598 | Ga0466967_0016365 | 3300045976 | Bacteria | 5846 |
| 599 | Ga0466967_0090239 | 3300045976 | Bacteria | 2783 |
| 600 | Ga0495617_004081 | 3300046452 | Bacteria | 5360 |
| 601 | Ga0495603_0012082 | 3300046455 | Bacteria | 5228 |
| 602 | Ga0495603_0075899 | 3300046455 | Bacteria | 1972 |
| 603 | Ga0495591_000001 | 3300046458 | Bacteria | 503087 |
| 604 | Ga0495591_000003 | 3300046458 | Bacteria | 449825 |
| 605 | Ga0495591_000069 | 3300046458 | Bacteria | 117122 |
| 606 | Ga0495629_0084971 | 3300046459 | Bacteria | 2208 |
| 607 | Ga0495651_0000505 | 3300046462 | Bacteria | 30320 |
| 608 | Ga0495651_0049803 | 3300046462 | Bacteria | 3233 |
| 609 | Ga0495651_0089835 | 3300046462 | Bacteria | 2305 |
| 610 | Ga0495653_0000466 | 3300046463 | Bacteria | 31452 |
| 611 | Ga0495653_0011692 | 3300046463 | Bacteria | 7164 |
| 612 | Ga0495650_0000005 | 3300046471 | Bacteria | 766553 |
| 613 | Ga0495650_0000149 | 3300046471 | Bacteria | 159524 |
| 614 | Ga0495650_0000228 | 3300046471 | Bacteria | 114154 |
| 615 | Ga0495580_0004805 | 3300046472 | Bacteria | 11313 |
| 616 | Ga0495580_0019312 | 3300046472 | Bacteria | 5064 |
| 617 | Ga0495582_0060366 | 3300046473 | Bacteria | 2092 |
| 618 | Ga0495605_0000828 | 3300046474 | Bacteria | 21934 |
| 619 | Ga0495639_0030573 | 3300046475 | Bacteria | 2393 |
| 620 | Ga0495662_0006897 | 3300046476 | Bacteria | 5642 |
| 621 | Ga0495664_0000742 | 3300046477 | Bacteria | 16670 |
| 622 | Ga0495664_0008887 | 3300046477 | Bacteria | 5614 |
| 623 | Ga0495664_0011257 | 3300046477 | Bacteria | 5040 |
| 624 | Ga0495664_0024462 | 3300046477 | Bacteria | 3511 |
| 625 | Ga0495664_0027542 | 3300046477 | Bacteria | 3314 |
| 626 | Ga0495585_0000087 | 3300046492 | Bacteria | 97091 |
| 627 | Ga0495585_0001786 | 3300046492 | Bacteria | 16349 |
| 628 | Ga0495585_0054994 | 3300046492 | Bacteria | 2200 |
| 629 | Ga0495594_0022557 | 3300046499 | Bacteria | 3367 |
| 630 | Ga0495594_0028964 | 3300046499 | Bacteria | 2990 |
| 631 | Ga0495594_0036708 | 3300046499 | Bacteria | 2673 |
| 632 | Ga0495596_0028639 | 3300046500 | Bacteria | 2235 |
| 633 | Ga0495607_0027479 | 3300046501 | Bacteria | 3516 |
| 634 | Ga0495607_0050434 | 3300046501 | Bacteria | 2422 |
| 635 | Ga0495607_0064271 | 3300046501 | Bacteria | 2073 |
| 636 | Ga0495583_0056821 | 3300046506 | Bacteria | 1762 |
| 637 | Ga0495606_0000318 | 3300046507 | Bacteria | 82802 |
| 638 | Ga0495606_0016139 | 3300046507 | Bacteria | 5713 |
| 639 | Ga0495610_0000069 | 3300046512 | Bacteria | 121713 |
| 640 | Ga0495610_0033859 | 3300046512 | Bacteria | 2636 |
| 641 | Ga0495616_0006775 | 3300046513 | Bacteria | 6906 |
| 642 | Ga0495616_0023037 | 3300046513 | Bacteria | 3356 |
| 643 | Ga0495618_0028458 | 3300046514 | Bacteria | 3482 |
| 644 | Ga0495618_0051403 | 3300046514 | Bacteria | 2603 |
| 645 | Ga0495628_0079386 | 3300046516 | Bacteria | 2551 |
| 646 | Ga0495630_0011755 | 3300046517 | Bacteria | 6344 |
| 647 | Ga0495630_0078275 | 3300046517 | Bacteria | 2493 |
| 648 | Ga0495631_0001116 | 3300046518 | Bacteria | 16669 |
| 649 | Ga0495631_0033175 | 3300046518 | Bacteria | 2321 |
| 650 | Ga0495637_0000904 | 3300046520 | Bacteria | 19141 |
| 651 | Ga0495643_0001005 | 3300046522 | Bacteria | 28801 |
| 652 | Ga0495643_0011614 | 3300046522 | Bacteria | 5354 |
| 653 | Ga0495648_0002385 | 3300046524 | Bacteria | 17443 |
| 654 | Ga0495648_0026341 | 3300046524 | Bacteria | 3916 |
| 655 | Ga0495666_0002702 | 3300046526 | Bacteria | 8854 |
| 656 | Ga0495642_0000004 | 3300046528 | Bacteria | 182675 |
| 657 | Ga0495642_0012576 | 3300046528 | Bacteria | 3263 |
| 658 | Ga0495652_0004408 | 3300046529 | Bacteria | 13458 |
| 659 | Ga0495652_0076188 | 3300046529 | Bacteria | 2783 |
| 660 | Ga0495654_0000033 | 3300046530 | Bacteria | 201799 |
| 661 | Ga0495654_0000055 | 3300046530 | Bacteria | 142121 |
| 662 | Ga0495654_0000256 | 3300046530 | Bacteria | 48724 |
| 663 | Ga0495654_0007714 | 3300046530 | Bacteria | 5989 |
| 664 | Ga0495654_0017690 | 3300046530 | Bacteria | 3742 |
| 665 | Ga0495665_0003646 | 3300046531 | Bacteria | 8359 |
| 666 | Ga0495665_0007776 | 3300046531 | Bacteria | 5798 |
| 667 | Ga0495665_0058587 | 3300046531 | Bacteria | 2034 |
| 668 | Ga0495640_0022132 | 3300046533 | Bacteria | 4653 |
| 669 | Ga0495640_0023944 | 3300046533 | Bacteria | 4442 |
| 670 | Ga0495586_0009888 | 3300046535 | Bacteria | 5078 |
| 671 | Ga0495586_0057727 | 3300046535 | Bacteria | 2106 |
| 672 | Ga0495586_0061666 | 3300046535 | Bacteria | 2041 |
| 673 | Ga0495586_0094107 | 3300046535 | Bacteria | 1657 |
| 674 | Ga0495587_0002568 | 3300046536 | Bacteria | 12134 |
| 675 | Ga0495587_0003374 | 3300046536 | Bacteria | 10647 |
| 676 | Ga0495587_0012618 | 3300046536 | Bacteria | 5314 |
| 677 | Ga0495597_0019216 | 3300046542 | Bacteria | 3199 |
| 678 | Ga0495645_0004124 | 3300046543 | Bacteria | 9921 |
| 679 | Ga0495645_0006857 | 3300046543 | Bacteria | 7919 |
| 680 | Ga0495645_0076957 | 3300046543 | Bacteria | 2399 |
| 681 | Ga0495645_0079914 | 3300046543 | Bacteria | 2348 |
| 682 | Ga0495622_0042990 | 3300046557 | Bacteria | 2100 |
| 683 | Ga0495633_0021197 | 3300046558 | Bacteria | 3253 |
| 684 | Ga0495667_0003973 | 3300046559 | Bacteria | 9926 |
| 685 | Ga0495667_0005045 | 3300046559 | Bacteria | 8925 |
| 686 | Ga0495667_0058585 | 3300046559 | Bacteria | 2530 |
| 687 | Ga0495656_0004184 | 3300046615 | Bacteria | 4927 |
| 688 | Ga0495656_0004570 | 3300046615 | Bacteria | 4748 |
| 689 | Ga0495668_0000294 | 3300046616 | Bacteria | 68626 |
| 690 | Ga0495668_0007928 | 3300046616 | Bacteria | 6700 |
| 691 | Ga0495634_0000378 | 3300046642 | Bacteria | 43514 |
| 692 | Ga0495625_0002090 | 3300046660 | Bacteria | 22320 |
| 693 | Ga0495625_0010488 | 3300046660 | Bacteria | 7663 |
| 694 | Ga0495635_0000283 | 3300046663 | Bacteria | 32627 |
| 695 | Ga0495635_0015722 | 3300046663 | Bacteria | 5287 |
| 696 | Ga0495588_0003440 | 3300046674 | Bacteria | 6883 |
| 697 | Ga0495588_0004259 | 3300046674 | Bacteria | 6310 |
| 698 | Ga0495588_0024546 | 3300046674 | Bacteria | 2995 |
| 699 | Ga0495588_0048544 | 3300046674 | Bacteria | 2181 |
| 700 | Ga0495657_0000049 | 3300046675 | Bacteria | 103042 |
| 701 | Ga0495657_0032047 | 3300046675 | Bacteria | 3671 |
| 702 | Ga0495623_0001555 | 3300046679 | Bacteria | 15454 |
| 703 | Ga0495623_0017148 | 3300046679 | Bacteria | 4677 |
| 704 | Ga0495623_0037430 | 3300046679 | Bacteria | 3104 |
| 705 | Ga0495613_0001423 | 3300046689 | Bacteria | 18253 |
| 706 | Ga0495624_0015165 | 3300046690 | Bacteria | 5213 |
| 707 | Ga0495670_0003593 | 3300046691 | Bacteria | 7613 |
| 708 | Ga0495670_0005066 | 3300046691 | Bacteria | 6482 |
| 709 | Ga0495671_0006848 | 3300046692 | Bacteria | 6550 |
| 710 | Ga0495589_0003485 | 3300046794 | Bacteria | 8512 |
| 711 | Ga0495589_0015969 | 3300046794 | Bacteria | 3859 |
| 712 | Ga0495589_0017182 | 3300046794 | Bacteria | 3714 |
| 713 | Ga0495589_0020250 | 3300046794 | Bacteria | 3403 |
| 714 | Ga0495589_0060200 | 3300046794 | Bacteria | 1865 |
| 715 | Ga0495600_0000176 | 3300046809 | Bacteria | 37383 |
| 716 | Ga0495600_0014267 | 3300046809 | Bacteria | 5006 |
| 717 | Ga0495600_0028844 | 3300046809 | Bacteria | 3591 |
| 718 | Ga0495600_0064174 | 3300046809 | Bacteria | 2401 |
| 719 | Ga0495600_0136144 | 3300046809 | Bacteria | 1595 |
| 720 | Ga0495660_0000017 | 3300046810 | Bacteria | 320655 |
| 721 | Ga0495660_0052356 | 3300046810 | Bacteria | 2217 |
| 722 | Ga0495660_0052408 | 3300046810 | Bacteria | 2216 |
| 723 | Ga0495581_0023949 | 3300047315 | Bacteria | 3537 |
| 724 | Ga0495581_0024488 | 3300047315 | Bacteria | 3498 |
| 725 | Ga0495604_0001396 | 3300047317 | Bacteria | 19783 |
| 726 | Ga0495604_0001987 | 3300047317 | Bacteria | 16510 |
| 727 | Ga0495604_0035514 | 3300047317 | Bacteria | 3937 |
| 728 | Ga0495604_0055593 | 3300047317 | Bacteria | 3050 |
| 729 | Ga0495604_0065020 | 3300047317 | Bacteria | 2778 |
| 730 | Ga0495636_0004898 | 3300047318 | Bacteria | 5246 |
| 731 | Ga0495636_0006035 | 3300047318 | Bacteria | 4752 |
| 732 | Ga0495636_0010687 | 3300047318 | Bacteria | 3628 |
| 733 | Ga0495636_0011881 | 3300047318 | Bacteria | 3450 |
| 734 | Ga0495636_0029339 | 3300047318 | Bacteria | 2245 |
| 735 | Ga0495674_0165798 | 3300047319 | Bacteria | 1846 |
| 736 | Ga0495674_0190311 | 3300047319 | Bacteria | 1706 |
| 737 | Ga0495672_0000001 | 3300047320 | Bacteria | 1458820 |
| 738 | Ga0495672_0000052 | 3300047320 | Bacteria | 236266 |
| 739 | Ga0495676_0002192 | 3300047321 | Bacteria | 17299 |
| 740 | Ga0495676_0005295 | 3300047321 | Bacteria | 11809 |
| 741 | Ga0495676_0009992 | 3300047321 | Bacteria | 8622 |
| 742 | Ga0495676_0026688 | 3300047321 | Bacteria | 4967 |
| 743 | Ga0495676_0104666 | 3300047321 | Bacteria | 2087 |
| 744 | Ga0495680_0000066 | 3300047322 | Bacteria | 89327 |
| 745 | Ga0495680_0014506 | 3300047322 | Bacteria | 6820 |
| 746 | Ga0495683_0000192 | 3300047323 | Bacteria | 58135 |
| 747 | Ga0495683_0001028 | 3300047323 | Bacteria | 19439 |
| 748 | Ga0495683_0039006 | 3300047323 | Bacteria | 2401 |
| 749 | Ga0495687_003038 | 3300047443 | Bacteria | 12619 |
| 750 | Ga0495675_0000026 | 3300047444 | Bacteria | 108709 |
| 751 | Ga0495675_0009185 | 3300047444 | Bacteria | 6147 |
| 752 | Ga0495675_0070964 | 3300047444 | Bacteria | 2199 |
| 753 | Ga0495675_0072350 | 3300047444 | Bacteria | 2175 |
| 754 | Ga0495677_0004977 | 3300047445 | Bacteria | 5068 |
| 755 | Ga0495685_003995 | 3300047447 | Bacteria | 4742 |
| 756 | Ga0495685_006104 | 3300047447 | Bacteria | 3942 |
| 757 | Ga0495673_0000007 | 3300047469 | Bacteria | 796722 |
| 758 | Ga0495673_0000019 | 3300047469 | Bacteria | 554389 |
| 759 | Ga0495681_0000769 | 3300047470 | Bacteria | 24687 |
| 760 | Ga0495681_0010307 | 3300047470 | Bacteria | 5662 |
| 761 | Ga0495684_0089737 | 3300047471 | Bacteria | 2329 |
| 762 | Ga0495593_0002496 | 3300047673 | Bacteria | 11069 |
| 763 | Ga0495593_0040956 | 3300047673 | Bacteria | 2492 |
| 764 | Ga0495615_0010729 | 3300048090 | Bacteria | 1841 |
| 765 | Ga0495626_0013857 | 3300048091 | Bacteria | 4177 |
| 766 | Ga0496100_0027780 | 3300048903 | Bacteria | 3482 |
| 767 | Ga0496100_0070600 | 3300048903 | Bacteria | 2329 |
| 768 | Ga0496100_0086666 | 3300048903 | Bacteria | 2127 |
| 769 | Ga0496101_0004230 | 3300048904 | Bacteria | 9001 |
| 770 | Ga0496101_0013834 | 3300048904 | Bacteria | 5416 |
| 771 | Ga0496102_0034508 | 3300048905 | Bacteria | 4550 |
| 772 | Ga0496102_0034937 | 3300048905 | Bacteria | 4524 |
| 773 | Ga0496102_0072077 | 3300048905 | Bacteria | 3173 |
| 774 | Ga0496102_0116561 | 3300048905 | Bacteria | 2492 |
| 775 | Ga0496102_0147520 | 3300048905 | Bacteria | 2208 |
| 776 | Ga0496103_0002458 | 3300048906 | Bacteria | 11641 |
| 777 | Ga0496103_0002535 | 3300048906 | Bacteria | 11448 |
| 778 | Ga0496103_0003246 | 3300048906 | Bacteria | 9972 |
| 779 | Ga0496103_0005572 | 3300048906 | Bacteria | 7530 |
| 780 | Ga0496103_0082219 | 3300048906 | Bacteria | 2026 |
| 781 | Ga0496103_0093038 | 3300048906 | Bacteria | 1903 |
| 782 | Ga0496104_0000633 | 3300048907 | Bacteria | 30119 |
| 783 | Ga0496104_0022013 | 3300048907 | Bacteria | 5856 |
| 784 | Ga0496104_0045963 | 3300048907 | Bacteria | 4108 |
| 785 | Ga0496105_0012197 | 3300048908 | Bacteria | 6804 |
| 786 | Ga0496105_0016719 | 3300048908 | Bacteria | 5862 |
| 787 | Ga0496105_0017915 | 3300048908 | Bacteria | 5684 |
| 788 | Ga0496105_0029356 | 3300048908 | Bacteria | 4501 |
| 789 | Ga0496105_0123063 | 3300048908 | Bacteria | 2138 |
| 790 | Ga0496106_0013608 | 3300048909 | Bacteria | 6006 |
| 791 | Ga0496106_0014747 | 3300048909 | Bacteria | 5777 |
| 792 | Ga0496106_0042915 | 3300048909 | Bacteria | 3392 |
| 793 | Ga0496106_0091902 | 3300048909 | Bacteria | 2343 |
| 794 | Ga0496106_0129451 | 3300048909 | Bacteria | 1978 |
| 795 | Ga0496107_0001472 | 3300048910 | Bacteria | 14564 |
| 796 | Ga0496107_0010664 | 3300048910 | Bacteria | 6390 |
| 797 | Ga0496107_0012130 | 3300048910 | Bacteria | 6011 |
| 798 | Ga0496107_0023999 | 3300048910 | Bacteria | 4311 |
| 799 | Ga0496108_0000368 | 3300048911 | Bacteria | 37916 |
| 800 | Ga0496108_0014016 | 3300048911 | Bacteria | 6540 |
| 801 | Ga0496108_0024226 | 3300048911 | Bacteria | 4997 |
| 802 | Ga0496108_0044250 | 3300048911 | Bacteria | 3717 |
| 803 | Ga0496108_0085898 | 3300048911 | Bacteria | 2671 |
| 804 | Ga0496108_0175398 | 3300048911 | Bacteria | 1855 |
| 805 | Ga0496109_0001044 | 3300048912 | Bacteria | 22912 |
| 806 | Ga0496109_0005730 | 3300048912 | Bacteria | 10392 |
| 807 | Ga0496109_0007728 | 3300048912 | Bacteria | 9104 |
| 808 | Ga0496109_0105305 | 3300048912 | Bacteria | 2619 |
| 809 | Ga0496110_0000574 | 3300048913 | Bacteria | 25238 |
| 810 | Ga0496110_0028337 | 3300048913 | Bacteria | 4810 |
| 811 | Ga0496110_0147545 | 3300048913 | Bacteria | 2128 |
| 812 | Ga0496110_0178049 | 3300048913 | Bacteria | 1930 |
| 813 | Ga0496111_0000389 | 3300048914 | Bacteria | 21995 |
| 814 | Ga0496111_0001626 | 3300048914 | Bacteria | 13016 |
| 815 | Ga0496111_0056392 | 3300048914 | Bacteria | 2842 |
| 816 | Ga0496111_0073280 | 3300048914 | Bacteria | 2493 |
| 817 | Ga0496111_0155067 | 3300048914 | Bacteria | 1699 |
| 818 | Ga0496112_0006644 | 3300048915 | Bacteria | 10184 |
| 819 | Ga0496112_0016759 | 3300048915 | Bacteria | 6872 |
| 820 | Ga0496112_0072862 | 3300048915 | Bacteria | 3395 |
| 821 | Ga0496112_0090052 | 3300048915 | Bacteria | 3037 |
| 822 | Ga0496112_0150397 | 3300048915 | Bacteria | 2295 |
| 823 | Ga0496113_0026795 | 3300048916 | Bacteria | 4125 |
| 824 | Ga0496113_0056348 | 3300048916 | Bacteria | 2950 |
| 825 | Ga0496114_0001123 | 3300048917 | Bacteria | 20224 |
| 826 | Ga0496114_0005471 | 3300048917 | Bacteria | 9937 |
| 827 | Ga0496114_0019171 | 3300048917 | Bacteria | 5542 |
| 828 | Ga0496114_0137337 | 3300048917 | Bacteria | 2114 |
| 829 | Ga0496115_0061048 | 3300048918 | Bacteria | 3038 |
| 830 | Ga0496115_0088507 | 3300048918 | Bacteria | 2528 |
| 831 | Ga0496115_0167767 | 3300048918 | Bacteria | 1815 |
| 832 | Ga0496116_0000167 | 3300048919 | Bacteria | 132540 |
| 833 | Ga0496116_0000204 | 3300048919 | Bacteria | 113862 |
| 834 | Ga0496116_0000237 | 3300048919 | Bacteria | 100835 |
| 835 | Ga0496116_0005450 | 3300048919 | Bacteria | 11783 |
| 836 | Ga0496116_0015029 | 3300048919 | Bacteria | 6139 |
| 837 | Ga0496117_0000020 | 3300048920 | Bacteria | 458405 |
| 838 | Ga0496117_0000052 | 3300048920 | Bacteria | 280463 |
| 839 | Ga0496117_0000073 | 3300048920 | Bacteria | 236223 |
| 840 | Ga0496117_0000294 | 3300048920 | Bacteria | 89536 |
| 841 | Ga0496117_0000993 | 3300048920 | Bacteria | 43383 |
| 842 | Ga0496117_0001351 | 3300048920 | Bacteria | 35913 |
| 843 | Ga0496117_0002025 | 3300048920 | Bacteria | 26845 |
| 844 | Ga0496117_0003132 | 3300048920 | Bacteria | 19732 |
| 845 | Ga0496117_0056492 | 3300048920 | Bacteria | 2733 |
| 846 | Ga0496117_0071218 | 3300048920 | Bacteria | 2331 |
| 847 | Ga0496118_0000015 | 3300048921 | Bacteria | 551359 |
| 848 | Ga0496118_0000432 | 3300048921 | Bacteria | 69605 |
| 849 | Ga0496118_0000449 | 3300048921 | Bacteria | 68182 |
| 850 | Ga0496118_0000508 | 3300048921 | Bacteria | 64418 |
| 851 | Ga0496118_0000640 | 3300048921 | Bacteria | 57413 |
| 852 | Ga0496118_0003588 | 3300048921 | Bacteria | 19306 |
| 853 | Ga0496118_0003969 | 3300048921 | Bacteria | 18055 |
| 854 | Ga0496118_0004643 | 3300048921 | Bacteria | 16116 |
| 855 | Ga0496118_0014037 | 3300048921 | Bacteria | 7522 |
| 856 | Ga0496118_0016244 | 3300048921 | Bacteria | 6836 |
| 857 | Ga0496118_0040502 | 3300048921 | Bacteria | 3704 |
| 858 | Ga0496118_0042228 | 3300048921 | Bacteria | 3600 |
| 859 | Ga0496119_0000193 | 3300048922 | Bacteria | 85647 |
| 860 | Ga0496119_0000400 | 3300048922 | Bacteria | 59582 |
| 861 | Ga0496119_0000487 | 3300048922 | Bacteria | 54233 |
| 862 | Ga0496119_0001810 | 3300048922 | Bacteria | 24832 |
| 863 | Ga0496119_0002729 | 3300048922 | Bacteria | 19021 |
| 864 | Ga0496119_0007347 | 3300048922 | Bacteria | 9960 |
| 865 | Ga0496119_0010461 | 3300048922 | Bacteria | 7805 |
| 866 | Ga0496119_0017983 | 3300048922 | Bacteria | 5286 |
| 867 | Ga0496119_0045962 | 3300048922 | Bacteria | 2731 |
| 868 | Ga0496119_0055959 | 3300048922 | Bacteria | 2392 |
| 869 | Ga0496120_0000019 | 3300048923 | Bacteria | 260115 |
| 870 | Ga0496120_0000096 | 3300048923 | Bacteria | 145880 |
| 871 | Ga0496120_0000127 | 3300048923 | Bacteria | 128189 |
| 872 | Ga0496120_0000261 | 3300048923 | Bacteria | 88296 |
| 873 | Ga0496120_0000524 | 3300048923 | Bacteria | 59374 |
| 874 | Ga0496120_0001020 | 3300048923 | Bacteria | 37462 |
| 875 | Ga0496120_0001247 | 3300048923 | Bacteria | 32027 |
| 876 | Ga0496120_0001736 | 3300048923 | Bacteria | 24783 |
| 877 | Ga0496120_0002192 | 3300048923 | Bacteria | 20660 |
| 878 | Ga0496120_0005314 | 3300048923 | Bacteria | 10322 |
| 879 | Ga0496120_0021217 | 3300048923 | Bacteria | 4108 |
| 880 | Ga0496120_0087619 | 3300048923 | Bacteria | 1671 |
| 881 | Ga0496121_0000005 | 3300048924 | Bacteria | 1034486 |
| 882 | Ga0496121_0000337 | 3300048924 | Bacteria | 97711 |
| 883 | Ga0496121_0001063 | 3300048924 | Bacteria | 48657 |
| 884 | Ga0496121_0001133 | 3300048924 | Bacteria | 46813 |
| 885 | Ga0496121_0002230 | 3300048924 | Bacteria | 30233 |
| 886 | Ga0496121_0002957 | 3300048924 | Bacteria | 24766 |
| 887 | Ga0496121_0003286 | 3300048924 | Bacteria | 23211 |
| 888 | Ga0496121_0005652 | 3300048924 | Bacteria | 15906 |
| 889 | Ga0496121_0012935 | 3300048924 | Bacteria | 9021 |
| 890 | Ga0496121_0127415 | 3300048924 | Bacteria | 1912 |
| 891 | Ga0496122_0000005 | 3300048925 | Bacteria | 630659 |
| 892 | Ga0496122_0000031 | 3300048925 | Bacteria | 329726 |
| 893 | Ga0496122_0000053 | 3300048925 | Bacteria | 260120 |
| 894 | Ga0496122_0001255 | 3300048925 | Bacteria | 42535 |
| 895 | Ga0496122_0001545 | 3300048925 | Bacteria | 36554 |
| 896 | Ga0496122_0002107 | 3300048925 | Bacteria | 29490 |
| 897 | Ga0496122_0003761 | 3300048925 | Bacteria | 19564 |
| 898 | Ga0496122_0004580 | 3300048925 | Bacteria | 17027 |
| 899 | Ga0496122_0005324 | 3300048925 | Bacteria | 15380 |
| 900 | Ga0496122_0005341 | 3300048925 | Bacteria | 15360 |
| 901 | Ga0496122_0005506 | 3300048925 | Bacteria | 15044 |
| 902 | Ga0496122_0008092 | 3300048925 | Bacteria | 11463 |
| 903 | Ga0496122_0015973 | 3300048925 | Bacteria | 7140 |
| 904 | Ga0496122_0046280 | 3300048925 | Bacteria | 3371 |
| 905 | Ga0496122_0066908 | 3300048925 | Bacteria | 2591 |
| 906 | Ga0496122_0068136 | 3300048925 | Bacteria | 2557 |
| 907 | Ga0496122_0091768 | 3300048925 | Bacteria | 2067 |
| 908 | Ga0496122_0096629 | 3300048925 | Bacteria | 1991 |
| 909 | Ga0496122_0138562 | 3300048925 | Bacteria | 1527 |
| 910 | Ga0496123_0000008 | 3300048926 | Bacteria | 630628 |
| 911 | Ga0496123_0000013 | 3300048926 | Bacteria | 439694 |
| 912 | Ga0496123_0000038 | 3300048926 | Bacteria | 260120 |
| 913 | Ga0496123_0000994 | 3300048926 | Bacteria | 43566 |
| 914 | Ga0496123_0003666 | 3300048926 | Bacteria | 16946 |
| 915 | Ga0496123_0008679 | 3300048926 | Bacteria | 9286 |
| 916 | Ga0496123_0019254 | 3300048926 | Bacteria | 5386 |
| 917 | Ga0496123_0031787 | 3300048926 | Bacteria | 3833 |
| 918 | Ga0496123_0043706 | 3300048926 | Bacteria | 3073 |
| 919 | Ga0496124_0000070 | 3300048927 | Bacteria | 220875 |
| 920 | Ga0496124_0000600 | 3300048927 | Bacteria | 60608 |
| 921 | Ga0496124_0000984 | 3300048927 | Bacteria | 45205 |
| 922 | Ga0496124_0003218 | 3300048927 | Bacteria | 20170 |
| 923 | Ga0496124_0003597 | 3300048927 | Bacteria | 18831 |
| 924 | Ga0496124_0006099 | 3300048927 | Bacteria | 13255 |
| 925 | Ga0496124_0017263 | 3300048927 | Bacteria | 6808 |
| 926 | Ga0496124_0028720 | 3300048927 | Bacteria | 4971 |
| 927 | Ga0496124_0043699 | 3300048927 | Bacteria | 3850 |
| 928 | Ga0496124_0048055 | 3300048927 | Bacteria | 3648 |
| 929 | Ga0496124_0053042 | 3300048927 | Bacteria | 3441 |
| 930 | Ga0496124_0062501 | 3300048927 | Bacteria | 3115 |
| 931 | Ga0496125_0000009 | 3300048928 | Bacteria | 677678 |
| 932 | Ga0496125_0000068 | 3300048928 | Bacteria | 247765 |
| 933 | Ga0496125_0000163 | 3300048928 | Bacteria | 148473 |
| 934 | Ga0496125_0000358 | 3300048928 | Bacteria | 86281 |
| 935 | Ga0496125_0001579 | 3300048928 | Bacteria | 32442 |
| 936 | Ga0496125_0006056 | 3300048928 | Bacteria | 13219 |
| 937 | Ga0496125_0007198 | 3300048928 | Bacteria | 11861 |
| 938 | Ga0496125_0008355 | 3300048928 | Bacteria | 10854 |
| 939 | Ga0496125_0013099 | 3300048928 | Bacteria | 8176 |
| 940 | Ga0496125_0014219 | 3300048928 | Bacteria | 7760 |
| 941 | Ga0496125_0108077 | 3300048928 | Bacteria | 2025 |
| 942 | Ga0496126_0000349 | 3300048929 | Bacteria | 96786 |
| 943 | Ga0496126_0000717 | 3300048929 | Bacteria | 60241 |
| 944 | Ga0496126_0000768 | 3300048929 | Bacteria | 58074 |
| 945 | Ga0496126_0052530 | 3300048929 | Bacteria | 3702 |
| 946 | Ga0496126_0080724 | 3300048929 | Bacteria | 2877 |
| 947 | Ga0496126_0098036 | 3300048929 | Bacteria | 2568 |
| 948 | Ga0501308_001792 | 3300049128 | Bacteria | 1792 |
| 949 | Ga0501310_000011 | 3300049130 | Bacteria | 18314 |
| 950 | Ga0501310_000451 | 3300049130 | Bacteria | 3601 |
| 951 | Ga0495678_000493 | 3300049459 | Bacteria | 39034 |
| 952 | Ga0495682_0000011 | 3300049460 | Bacteria | 278474 |
| 953 | Ga0501032_0003609 | 3300049569 | Bacteria | 11782 |
| 954 | Ga0501032_0114679 | 3300049569 | Bacteria | 1782 |
| 955 | Ga0501033_0017554 | 3300049570 | Bacteria | 5406 |
| 956 | Ga0501033_0026256 | 3300049570 | Bacteria | 4384 |
| 957 | Ga0501033_0029317 | 3300049570 | Bacteria | 4136 |
| 958 | Ga0501034_0000038 | 3300049571 | Bacteria | 237795 |
| 959 | Ga0501034_0002524 | 3300049571 | Bacteria | 21942 |
| 960 | Ga0501034_0009919 | 3300049571 | Bacteria | 9952 |
| 961 | Ga0501034_0027798 | 3300049571 | Bacteria | 5751 |
| 962 | Ga0501036_0000951 | 3300049572 | Bacteria | 21789 |
| 963 | Ga0501036_0000952 | 3300049572 | Bacteria | 21786 |
| 964 | Ga0501036_0005942 | 3300049572 | Bacteria | 9889 |
| 965 | Ga0501037_0010001 | 3300049573 | Bacteria | 6959 |
| 966 | Ga0501037_0010374 | 3300049573 | Bacteria | 6834 |
| 967 | Ga0501037_0070992 | 3300049573 | Bacteria | 2533 |
| 968 | Ga0501038_0014219 | 3300049574 | Bacteria | 7251 |
| 969 | Ga0501038_0026283 | 3300049574 | Bacteria | 5185 |
| 970 | Ga0501038_0026353 | 3300049574 | Bacteria | 5177 |
| 971 | Ga0501039_0010233 | 3300049575 | Bacteria | 7147 |
| 972 | Ga0501042_0000193 | 3300049578 | Bacteria | 28734 |
| 973 | Ga0501042_0007693 | 3300049578 | Bacteria | 7075 |
| 974 | Ga0501043_0008392 | 3300049579 | Bacteria | 8136 |
| 975 | Ga0501043_0051108 | 3300049579 | Bacteria | 3248 |
| 976 | Ga0501043_0128852 | 3300049579 | Bacteria | 1983 |
| 977 | Ga0501047_0007414 | 3300049581 | Bacteria | 10320 |
| 978 | Ga0501047_0036860 | 3300049581 | Bacteria | 4726 |
| 979 | Ga0501048_0011491 | 3300049582 | Bacteria | 6603 |
| 980 | Ga0501070_0000065 | 3300049586 | Bacteria | 88506 |
| 981 | Ga0501070_0002167 | 3300049586 | Bacteria | 17251 |
| 982 | Ga0501070_0002311 | 3300049586 | Bacteria | 16731 |
| 983 | Ga0501070_0067482 | 3300049586 | Bacteria | 2962 |
| 984 | Ga0501074_0006292 | 3300049590 | Bacteria | 8574 |
| 985 | Ga0501074_0049037 | 3300049590 | Bacteria | 3049 |
| 986 | Ga0501080_0031536 | 3300049742 | Bacteria | 4938 |
| 987 | Ga0501083_0000047 | 3300049744 | Bacteria | 88014 |
| 988 | Ga0501083_0002277 | 3300049744 | Bacteria | 13130 |
| 989 | Ga0501282_004066 | 3300049778 | Bacteria | 1568 |
| 990 | Ga0501035_0000121 | 3300049822 | Bacteria | 94497 |
| 991 | Ga0501035_0003457 | 3300049822 | Bacteria | 15115 |
| 992 | Ga0501035_0028739 | 3300049822 | Bacteria | 5073 |
| 993 | Ga0501035_0060475 | 3300049822 | Bacteria | 3372 |
| 994 | Ga0501044_0001588 | 3300049823 | Bacteria | 26614 |
| 995 | Ga0501044_0008984 | 3300049823 | Bacteria | 10927 |
| 996 | Ga0501044_0036839 | 3300049823 | Bacteria | 5116 |
| 997 | Ga0501044_0117842 | 3300049823 | Bacteria | 2659 |
| 998 | Ga0501044_0130605 | 3300049823 | Bacteria | 2506 |
| 999 | Ga0501044_0156074 | 3300049823 | Bacteria | 2262 |
| 1000 | Ga0501044_0216947 | 3300049823 | Bacteria | 1865 |
| 1001 | Ga0501044_0244116 | 3300049823 | Bacteria | 1739 |
| 1002 | nmdc:mga03683_132_c1 | 3300050489 | Bacteria | 24967 |
| 1003 | nmdc:mga03n38_4590_c1 | 3300050490 | Bacteria | 4598 |
| 1004 | nmdc:mga00v17_11_c1 | 3300050491 | Bacteria | 135478 |
| 1005 | nmdc:mga00v17_12627_c1 | 3300050491 | Bacteria | 4664 |
| 1006 | nmdc:mga00v17_178_c1 | 3300050491 | Bacteria | 37572 |
| 1007 | nmdc:mga00v17_61394_c1 | 3300050491 | Bacteria | 2310 |
| 1008 | nmdc:mga0yw44_96_c1 | 3300050492 | Bacteria | 30976 |
| 1009 | nmdc:mga06z11_14488_c1 | 3300050494 | Bacteria | 3494 |
| 1010 | nmdc:mga06z11_3132_c1 | 3300050494 | Bacteria | 6381 |
| 1011 | nmdc:mga04h51_6837_c1 | 3300050495 | Bacteria | 2980 |
| 1012 | nmdc:mga07m45_17350_c1 | 3300050496 | Bacteria | 3865 |
| 1013 | nmdc:mga07m45_71866_c1 | 3300050496 | Bacteria | 1969 |
| 1014 | nmdc:mga05p37_174620_c1 | 3300050507 | Bacteria | 2618 |
| 1015 | nmdc:mga0qj67_139496_c1 | 3300050509 | Bacteria | 1965 |
| 1016 | nmdc:mga0qj67_34060_c1 | 3300050509 | Bacteria | 3977 |
| 1017 | nmdc:mga0sz30_1378_c2 | 3300050516 | Bacteria | 4545 |
| 1018 | nmdc:mga0sz30_15304_c1 | 3300050516 | Bacteria | 3030 |
| 1019 | nmdc:mga0sz30_485_c1 | 3300050516 | Bacteria | 14930 |
| 1020 | Ga0495601_0116409 | 3300053077 | Bacteria | 1733 |
| 1021 | Ga0495612_0007165 | 3300053078 | Bacteria | 4563 |
| 1022 | Ga0500650_0011205 | 3300053098 | Bacteria | 3680 |
| 1023 | Ga0500621_000005 | 3300053126 | Bacteria | 320383 |
| 1024 | Ga0500561_0000033 | 3300053137 | Bacteria | 28489 |
| 1025 | Ga0500573_0042062 | 3300053140 | Bacteria | 2639 |
| 1026 | Ga0500624_000520 | 3300053157 | Bacteria | 11108 |
| 1027 | Ga0500624_001218 | 3300053157 | Bacteria | 4607 |
| 1028 | Ga0500634_0003753 | 3300053161 | Bacteria | 6858 |
| 1029 | Ga0500636_0000039 | 3300053177 | Bacteria | 69891 |
| 1030 | Ga0500636_0007158 | 3300053177 | Bacteria | 6446 |
| 1031 | Ga0587084_000309 | 3300059477 | Bacteria | 3575 |
| 1032 | Ga0587084_004059 | 3300059477 | Bacteria | 1651 |
| 1033 | Ga0587066_000629 | 3300059490 | Bacteria | 3025 |
| 1034 | Ga0587070_001326 | 3300059491 | Bacteria | 2518 |
| 1035 | Ga0587083_0008002 | 3300059505 | Bacteria | 1639 |
| 1036 | Ga0587088_001153 | 3300059508 | Bacteria | 2637 |
| 1037 | Ga0587088_001235 | 3300059508 | Bacteria | 2588 |
| 1038 | Ga0587088_005574 | 3300059508 | Bacteria | 1662 |
| 1039 | Ga0587090_000123 | 3300059510 | Bacteria | 4901 |
| 1040 | Ga0587090_000138 | 3300059510 | Bacteria | 4802 |
| 1041 | Ga0587090_000982 | 3300059510 | Bacteria | 2709 |
| 1042 | Ga0587090_002985 | 3300059510 | Bacteria | 1917 |
| 1043 | Ga0587091_000092 | 3300059511 | Bacteria | 5058 |
| 1044 | Ga0587091_002210 | 3300059511 | Bacteria | 2275 |
| 1045 | Ga0587092_000499 | 3300059512 | Bacteria | 3177 |
| 1046 | Ga0587094_002376 | 3300059513 | Bacteria | 1943 |
| 1047 | Ga0587095_000115 | 3300059514 | Bacteria | 3240 |
| 1048 | Ga0587098_000351 | 3300059604 | Bacteria | 2667 |
| 1049 | Ga0587101_000289 | 3300059623 | Bacteria | 3234 |
| 1050 | Ga0587115_000278 | 3300059626 | Bacteria | 3448 |
| 1051 | Ga0587128_000022 | 3300059630 | Bacteria | 6164 |
| 1052 | Ga0587128_000197 | 3300059630 | Bacteria | 3668 |
| 1053 | Ga0587128_001628 | 3300059630 | Bacteria | 2167 |
| 1054 | Ga0587062_000796 | 3300059639 | Bacteria | 2429 |
| 1055 | Ga0587062_001343 | 3300059639 | Bacteria | 2094 |
| 1056 | Ga0587069_002201 | 3300059642 | Bacteria | 1941 |
| 1057 | Ga0587072_002733 | 3300059643 | Bacteria | 2399 |
| 1058 | Ga0587079_000356 | 3300059647 | Bacteria | 3817 |
| 1059 | Ga0587107_001234 | 3300059652 | Bacteria | 2019 |
| 1060 | Ga0587124_000008 | 3300059660 | Bacteria | 6134 |
| 1061 | Ga0587071_009129 | 3300060344 | Bacteria | 1623 |
| 1062 | Ga0466962_0000081 | 3300061719 | Bacteria | 38408 |
| 1063 | Ga0466962_0001178 | 3300061719 | Bacteria | 12052 |
| 1064 | Ga0466962_0013373 | 3300061719 | Bacteria | 3950 |
| 1065 | Ga0466962_0019540 | 3300061719 | Bacteria | 3256 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048905 | Ga0496102_0072077 | Ga0496102_0072077_65_1291 | 386 |
| 2 | 3300046794 | Ga0495589_0017182 | Ga0495589_0017182_2513_3688 | 387 |
| 3 | 3300048905 | Ga0496102_0034508 | Ga0496102_0034508_21_1328 | 417 |
| 4 | 3300028379 | Ga0268266_10002032 | Ga0268266_1000203215 | 418 |
| 5 | 3300013307 | Ga0157372_10173238 | Ga0157372_101732382 | 419 |
| 6 | 3300048920 | Ga0496117_0071218 | Ga0496117_0071218_720_2102 | 430 |
| 7 | 3300048923 | Ga0496120_0005314 | Ga0496120_0005314_64_1446 | 430 |
| 8 | 3300030521 | Ga0307511_10001289 | Ga0307511_1000128914 | 432 |
| 9 | 3300009011 | Ga0105251_10000479 | Ga0105251_1000047917 | 435 |
| 10 | 3300009174 | Ga0105241_10000004 | Ga0105241_10000004501 | 435 |
| 11 | 3300013100 | Ga0157373_10005732 | Ga0157373_100057329 | 435 |
| 12 | 3300014497 | Ga0182008_10011140 | Ga0182008_100111403 | 435 |
| 13 | 3300041411 | Ga0439466_0014548 | Ga0439466_0014548_72_1448 | 435 |
| 14 | 3300042006 | Ga0439432_009751 | Ga0439432_009751_225_1601 | 435 |
| 15 | 3300046530 | Ga0495654_0007714 | Ga0495654_0007714_1756_3132 | 435 |
| 16 | 3300042006 | Ga0439432_004071 | Ga0439432_004071_2513_3955 | 438 |
| 17 | 3300042010 | Ga0439452_000015 | Ga0439452_000015_206720_208162 | 438 |
| 18 | 3300048919 | Ga0496116_0000237 | Ga0496116_0000237_55489_56931 | 438 |
| 19 | 3300048920 | Ga0496117_0001351 | Ga0496117_0001351_29765_31207 | 438 |
| 20 | 3300048921 | Ga0496118_0014037 | Ga0496118_0014037_4707_6149 | 438 |
| 21 | 3300048927 | Ga0496124_0062501 | Ga0496124_0062501_1056_2498 | 438 |
| 22 | 3300044684 | Ga0466966_0033424 | Ga0466966_0033424_1787_3121 | 440 |
| 23 | 3300044693 | Ga0466961_0002061 | Ga0466961_0002061_9532_10866 | 440 |
| 24 | 3300044694 | Ga0466963_0000555 | Ga0466963_0000555_7935_9269 | 440 |
| 25 | 3300044706 | Ga0466964_0008030 | Ga0466964_0008030_2569_3903 | 440 |
| 26 | 3300044719 | Ga0466971_0005854 | Ga0466971_0005854_3451_4785 | 440 |
| 27 | 3300044765 | Ga0466970_0000125 | Ga0466970_0000125_23998_25332 | 440 |
| 28 | 3300044842 | Ga0466957_0000483 | Ga0466957_0000483_17916_19250 | 440 |
| 29 | 3300045049 | Ga0466959_0004914 | Ga0466959_0004914_1659_2993 | 440 |
| 30 | 3300045836 | Ga0466958_0001557 | Ga0466958_0001557_8448_9782 | 440 |
| 31 | 3300045976 | Ga0466967_0002131 | Ga0466967_0002131_2954_4288 | 440 |
| 32 | 3300061719 | Ga0466962_0000081 | Ga0466962_0000081_7935_9269 | 440 |
| 33 | 3300046501 | Ga0495607_0050434 | Ga0495607_0050434_26_1363 | 441 |
| 34 | 3300048922 | Ga0496119_0000487 | Ga0496119_0000487_30864_32312 | 441 |
| 35 | 3300037466 | Ga0395898_0065633 | Ga0395898_0065633_2153_3493 | 442 |
| 36 | 3300048922 | Ga0496119_0000193 | Ga0496119_0000193_35644_37092 | 442 |
| 37 | 3300048923 | Ga0496120_0000261 | Ga0496120_0000261_15050_16498 | 442 |
| 38 | 3300041413 | Ga0439465_0008621 | Ga0439465_0008621_1665_3164 | 443 |
| 39 | 3300001989 | JGI24739J22299_10007640 | JGI24739J22299_100076403 | 444 |
| 40 | 3300009011 | Ga0105251_10002777 | Ga0105251_100027774 | 444 |
| 41 | 3300009036 | Ga0105244_10000327 | Ga0105244_1000032714 | 444 |
| 42 | 3300013102 | Ga0157371_10002433 | Ga0157371_100024338 | 444 |
| 43 | 3300013104 | Ga0157370_10000053 | Ga0157370_1000005341 | 444 |
| 44 | 3300025728 | Ga0207655_1008878 | Ga0207655_10088784 | 444 |
| 45 | 3300025735 | Ga0207713_1010458 | Ga0207713_10104583 | 444 |
| 46 | 3300031730 | Ga0307516_10063495 | Ga0307516_100634952 | 444 |
| 47 | 3300044765 | Ga0466970_0052948 | Ga0466970_0052948_22_1356 | 444 |
| 48 | 3300003856 | Ga0058692_1009657 | Ga0058692_10096571 | 445 |
| 49 | 3300027312 | Ga0209371_1002802 | Ga0209371_10028026 | 445 |
| 50 | 3300030500 | Ga0268256_1002333 | Ga0268256_10023335 | 445 |
| 51 | 3300031616 | Ga0307508_10032150 | Ga0307508_100321502 | 445 |
| 52 | 3300046514 | Ga0495618_0028458 | Ga0495618_0028458_145_1599 | 445 |
| 53 | 3300046529 | Ga0495652_0004408 | Ga0495652_0004408_5182_6636 | 445 |
| 54 | 3300046543 | Ga0495645_0076957 | Ga0495645_0076957_567_2021 | 445 |
| 55 | 3300047318 | Ga0495636_0010687 | Ga0495636_0010687_1635_2984 | 445 |
| 56 | 3300044693 | Ga0466961_0014753 | Ga0466961_0014753_3272_4816 | 446 |
| 57 | 3300044719 | Ga0466971_0000732 | Ga0466971_0000732_4492_6036 | 446 |
| 58 | 3300045049 | Ga0466959_0000339 | Ga0466959_0000339_10126_11670 | 446 |
| 59 | 3300045836 | Ga0466958_0034414 | Ga0466958_0034414_1123_2667 | 446 |
| 60 | 3300061719 | Ga0466962_0001178 | Ga0466962_0001178_1527_3071 | 446 |
| 61 | 3300045049 | Ga0466959_0066533 | Ga0466959_0066533_29_1453 | 448 |
| 62 | 3300002737 | JGI25162J39368_1001972 | JGI25162J39368_10019725 | 449 |
| 63 | 3300003856 | Ga0058692_1000351 | Ga0058692_100035114 | 449 |
| 64 | 3300003856 | Ga0058692_1000438 | Ga0058692_10004386 | 449 |
| 65 | 3300005347 | Ga0070668_100018267 | Ga0070668_1000182673 | 449 |
| 66 | 3300005548 | Ga0070665_100074247 | Ga0070665_1000742472 | 449 |
| 67 | 3300006051 | Ga0075364_10016852 | Ga0075364_100168523 | 449 |
| 68 | 3300006353 | Ga0075370_10019191 | Ga0075370_100191912 | 449 |
| 69 | 3300009011 | Ga0105251_10003838 | Ga0105251_100038388 | 449 |
| 70 | 3300009011 | Ga0105251_10013897 | Ga0105251_100138972 | 449 |
| 71 | 3300009036 | Ga0105244_10071928 | Ga0105244_100719281 | 449 |
| 72 | 3300009092 | Ga0105250_10011665 | Ga0105250_100116653 | 449 |
| 73 | 3300009545 | Ga0105237_10088813 | Ga0105237_100888133 | 449 |
| 74 | 3300011119 | Ga0105246_10001187 | Ga0105246_100011878 | 449 |
| 75 | 3300013100 | Ga0157373_10091825 | Ga0157373_100918252 | 449 |
| 76 | 3300013306 | Ga0163162_10007543 | Ga0163162_100075433 | 449 |
| 77 | 3300013307 | Ga0157372_10028908 | Ga0157372_100289084 | 449 |
| 78 | 3300013307 | Ga0157372_10174033 | Ga0157372_101740332 | 449 |
| 79 | 3300015261 | Ga0182006_1007205 | Ga0182006_10072054 | 449 |
| 80 | 3300017792 | Ga0163161_10005068 | Ga0163161_100050684 | 449 |
| 81 | 3300025233 | Ga0209437_100115 | Ga0209437_100115169 | 449 |
| 82 | 3300025711 | Ga0207696_1000348 | Ga0207696_100034843 | 449 |
| 83 | 3300025728 | Ga0207655_1015592 | Ga0207655_10155924 | 449 |
| 84 | 3300025735 | Ga0207713_1000001 | Ga0207713_10000012047 | 449 |
| 85 | 3300027312 | Ga0209371_1000190 | Ga0209371_100019060 | 449 |
| 86 | 3300027312 | Ga0209371_1000480 | Ga0209371_100048013 | 449 |
| 87 | 3300027312 | Ga0209371_1001270 | Ga0209371_100127012 | 449 |
| 88 | 3300027312 | Ga0209371_1001386 | Ga0209371_10013867 | 449 |
| 89 | 3300027312 | Ga0209371_1002297 | Ga0209371_10022976 | 449 |
| 90 | 3300030500 | Ga0268256_1000069 | Ga0268256_1000069151 | 449 |
| 91 | 3300030500 | Ga0268256_1000264 | Ga0268256_100026413 | 449 |
| 92 | 3300030500 | Ga0268256_1001091 | Ga0268256_10010914 | 449 |
| 93 | 3300041405 | Ga0439438_008721 | Ga0439438_008721_615_2111 | 449 |
| 94 | 3300041411 | Ga0439466_0000001 | Ga0439466_0000001_524059_525555 | 449 |
| 95 | 3300042016 | Ga0439463_003029 | Ga0439463_003029_614_2110 | 449 |
| 96 | 3300042146 | Ga0450907_000128 | Ga0450907_000128_13408_14904 | 449 |
| 97 | 3300046522 | Ga0495643_0011614 | Ga0495643_0011614_1340_2836 | 449 |
| 98 | 3300047320 | Ga0495672_0000052 | Ga0495672_0000052_166785_168281 | 449 |
| 99 | 3300048920 | Ga0496117_0000073 | Ga0496117_0000073_29112_30608 | 449 |
| 100 | 3300048920 | Ga0496117_0000294 | Ga0496117_0000294_58641_60137 | 449 |
| 101 | 3300048921 | Ga0496118_0000449 | Ga0496118_0000449_29112_30608 | 449 |
| 102 | 3300048921 | Ga0496118_0000508 | Ga0496118_0000508_29301_30797 | 449 |
| 103 | 3300048922 | Ga0496119_0000400 | Ga0496119_0000400_28839_30335 | 449 |
| 104 | 3300048922 | Ga0496119_0001810 | Ga0496119_0001810_9943_11439 | 449 |
| 105 | 3300048923 | Ga0496120_0000524 | Ga0496120_0000524_29040_30536 | 449 |
| 106 | 3300048923 | Ga0496120_0001736 | Ga0496120_0001736_13394_14890 | 449 |
| 107 | 3300048924 | Ga0496121_0001133 | Ga0496121_0001133_8676_10172 | 449 |
| 108 | 3300048925 | Ga0496122_0001545 | Ga0496122_0001545_19951_21447 | 449 |
| 109 | 3300048925 | Ga0496122_0068136 | Ga0496122_0068136_573_2069 | 449 |
| 110 | 3300048926 | Ga0496123_0008679 | Ga0496123_0008679_7556_9052 | 449 |
| 111 | 3300048927 | Ga0496124_0000600 | Ga0496124_0000600_54756_56252 | 449 |
| 112 | 3300048928 | Ga0496125_0008355 | Ga0496125_0008355_3244_4740 | 449 |
| 113 | 3300048929 | Ga0496126_0080724 | Ga0496126_0080724_1023_2519 | 449 |
| 114 | 3300003856 | Ga0058692_1000303 | Ga0058692_10003039 | 450 |
| 115 | 3300009036 | Ga0105244_10005219 | Ga0105244_100052193 | 450 |
| 116 | 3300013307 | Ga0157372_10045725 | Ga0157372_100457255 | 450 |
| 117 | 3300025728 | Ga0207655_1000007 | Ga0207655_1000007723 | 450 |
| 118 | 3300027312 | Ga0209371_1000084 | Ga0209371_1000084150 | 450 |
| 119 | 3300030500 | Ga0268256_1000075 | Ga0268256_100007515 | 450 |
| 120 | 3300038443 | Ga0395901_0329478 | Ga0395901_0329478_33_1442 | 450 |
| 121 | 3300048919 | Ga0496116_0005450 | Ga0496116_0005450_8198_9700 | 450 |
| 122 | 3300048923 | Ga0496120_0000127 | Ga0496120_0000127_15488_16990 | 450 |
| 123 | 3300006051 | Ga0075364_10040851 | Ga0075364_100408512 | 451 |
| 124 | 3300009092 | Ga0105250_10005807 | Ga0105250_100058072 | 451 |
| 125 | 3300013100 | Ga0157373_10000788 | Ga0157373_1000078810 | 451 |
| 126 | 3300013102 | Ga0157371_10016879 | Ga0157371_100168792 | 451 |
| 127 | 3300013306 | Ga0163162_10055425 | Ga0163162_100554252 | 451 |
| 128 | 3300025711 | Ga0207696_1000035 | Ga0207696_100003564 | 451 |
| 129 | 3300025728 | Ga0207655_1050379 | Ga0207655_10503791 | 451 |
| 130 | 3300025898 | Ga0207692_10051627 | Ga0207692_100516271 | 451 |
| 131 | 3300038443 | Ga0395901_0339581 | Ga0395901_0339581_24_1427 | 451 |
| 132 | 3300044656 | Ga0466969_0023807 | Ga0466969_0023807_182_1588 | 451 |
| 133 | 3300044693 | Ga0466961_0079591 | Ga0466961_0079591_341_1747 | 451 |
| 134 | 3300046458 | Ga0495591_000001 | Ga0495591_000001_117951_119453 | 451 |
| 135 | 3300046530 | Ga0495654_0000033 | Ga0495654_0000033_43509_45011 | 451 |
| 136 | 3300048922 | Ga0496119_0010461 | Ga0496119_0010461_3189_4691 | 451 |
| 137 | 3300048923 | Ga0496120_0001247 | Ga0496120_0001247_16952_18454 | 451 |
| 138 | 3300048925 | Ga0496122_0008092 | Ga0496122_0008092_3589_5091 | 451 |
| 139 | 3300048926 | Ga0496123_0003666 | Ga0496123_0003666_2962_4464 | 451 |
| 140 | 3300049570 | Ga0501033_0029317 | Ga0501033_0029317_1591_2961 | 451 |
| 141 | 3300049822 | Ga0501035_0000121 | Ga0501035_0000121_55212_56582 | 451 |
| 142 | 3300049823 | Ga0501044_0001588 | Ga0501044_0001588_1229_2599 | 451 |
| 143 | 3300017792 | Ga0163161_10072746 | Ga0163161_100727462 | 452 |
| 144 | 3300037471 | Ga0395905_0261676 | Ga0395905_0261676_192_1595 | 452 |
| 145 | 3300046462 | Ga0495651_0000505 | Ga0495651_0000505_18544_19998 | 453 |
| 146 | 3300042006 | Ga0439432_017875 | Ga0439432_017875_484_1869 | 454 |
| 147 | 3300042531 | Ga0450918_000361 | Ga0450918_000361_8524_9909 | 454 |
| 148 | 3300044656 | Ga0466969_0011923 | Ga0466969_0011923_1526_2926 | 454 |
| 149 | 3300044683 | Ga0466965_0000536 | Ga0466965_0000536_10804_12204 | 454 |
| 150 | 3300044684 | Ga0466966_0006139 | Ga0466966_0006139_3991_5391 | 454 |
| 151 | 3300044693 | Ga0466961_0021523 | Ga0466961_0021523_2651_4051 | 454 |
| 152 | 3300044694 | Ga0466963_0020357 | Ga0466963_0020357_2373_3773 | 454 |
| 153 | 3300044719 | Ga0466971_0002190 | Ga0466971_0002190_2294_3694 | 454 |
| 154 | 3300044765 | Ga0466970_0003159 | Ga0466970_0003159_4539_5939 | 454 |
| 155 | 3300044842 | Ga0466957_0002882 | Ga0466957_0002882_2765_4165 | 454 |
| 156 | 3300045049 | Ga0466959_0003458 | Ga0466959_0003458_4538_5938 | 454 |
| 157 | 3300045836 | Ga0466958_0021927 | Ga0466958_0021927_2065_3465 | 454 |
| 158 | 3300045976 | Ga0466967_0090239 | Ga0466967_0090239_154_1554 | 454 |
| 159 | 3300046674 | Ga0495588_0024546 | Ga0495588_0024546_1582_2967 | 454 |
| 160 | 3300050509 | nmdc:mga0qj67_34060_c1 | nmdc:mga0qj67_34060_c1_267_1772 | 454 |
| 161 | 3300061719 | Ga0466962_0019540 | Ga0466962_0019540_512_1912 | 454 |
| 162 | 3300048925 | Ga0496122_0138562 | Ga0496122_0138562_117_1496 | 455 |
| 163 | 3300001977 | JGI24746J21847_1001213 | JGI24746J21847_10012132 | 456 |
| 164 | 3300002077 | JGI24744J21845_10001770 | JGI24744J21845_100017703 | 456 |
| 165 | 3300005334 | Ga0068869_100013259 | Ga0068869_1000132593 | 456 |
| 166 | 3300005338 | Ga0068868_100011001 | Ga0068868_1000110013 | 456 |
| 167 | 3300005353 | Ga0070669_100136719 | Ga0070669_1001367192 | 456 |
| 168 | 3300005365 | Ga0070688_100037254 | Ga0070688_1000372542 | 456 |
| 169 | 3300005434 | Ga0070709_10071272 | Ga0070709_100712722 | 456 |
| 170 | 3300005539 | Ga0068853_100117519 | Ga0068853_1001175192 | 456 |
| 171 | 3300005834 | Ga0068851_10053424 | Ga0068851_100534242 | 456 |
| 172 | 3300005842 | Ga0068858_100020381 | Ga0068858_1000203813 | 456 |
| 173 | 3300005844 | Ga0068862_100044649 | Ga0068862_1000446493 | 456 |
| 174 | 3300006237 | Ga0097621_100135245 | Ga0097621_1001352452 | 456 |
| 175 | 3300010375 | Ga0105239_10262732 | Ga0105239_102627321 | 456 |
| 176 | 3300013296 | Ga0157374_10014658 | Ga0157374_100146584 | 456 |
| 177 | 3300015261 | Ga0182006_1000144 | Ga0182006_100014460 | 456 |
| 178 | 3300025315 | Ga0207697_10046927 | Ga0207697_100469271 | 456 |
| 179 | 3300025901 | Ga0207688_10003506 | Ga0207688_100035063 | 456 |
| 180 | 3300025927 | Ga0207687_10033779 | Ga0207687_100337792 | 456 |
| 181 | 3300025933 | Ga0207706_10034324 | Ga0207706_100343244 | 456 |
| 182 | 3300025941 | Ga0207711_10095012 | Ga0207711_100950122 | 456 |
| 183 | 3300026067 | Ga0207678_10012287 | Ga0207678_100122876 | 456 |
| 184 | 3300026075 | Ga0207708_10024834 | Ga0207708_100248343 | 456 |
| 185 | 3300026089 | Ga0207648_10012323 | Ga0207648_100123235 | 456 |
| 186 | 3300026118 | Ga0207675_100006342 | Ga0207675_1000063429 | 456 |
| 187 | 3300042002 | Ga0439442_003681 | Ga0439442_003681_10_1422 | 456 |
| 188 | 3300044684 | Ga0466966_0036525 | Ga0466966_0036525_70_1515 | 456 |
| 189 | 3300048908 | Ga0496105_0123063 | Ga0496105_0123063_300_1814 | 456 |
| 190 | 3300048911 | Ga0496108_0000368 | Ga0496108_0000368_19777_21228 | 456 |
| 191 | 3300048912 | Ga0496109_0007728 | Ga0496109_0007728_5139_6590 | 456 |
| 192 | 3300048915 | Ga0496112_0016759 | Ga0496112_0016759_3523_4974 | 456 |
| 193 | iso_pu_bacteria | 2862382967 | 2862385538 | 456 |
| 194 | iso_pu_bacteria | 8008558824 | 8008560323 | 456 |
| 195 | 3300048925 | Ga0496122_0003761 | Ga0496122_0003761_17557_18963 | 457 |
| 196 | 3300005439 | Ga0070711_100016174 | Ga0070711_1000161745 | 458 |
| 197 | 3300025915 | Ga0207693_10031842 | Ga0207693_100318422 | 458 |
| 198 | 3300037853 | Ga0436364_0650390 | Ga0436364_0650390_53_1447 | 458 |
| 199 | 3300003856 | Ga0058692_1000804 | Ga0058692_10008041 | 459 |
| 200 | 3300006946 | Ga0079104_1004059 | Ga0079104_10040596 | 459 |
| 201 | 3300025735 | Ga0207713_1000026 | Ga0207713_1000026285 | 459 |
| 202 | 3300025911 | Ga0207654_10000006 | Ga0207654_10000006518 | 459 |
| 203 | 3300027111 | Ga0209281_1000008 | Ga0209281_1000008294 | 459 |
| 204 | 3300049586 | Ga0501070_0002311 | Ga0501070_0002311_15183_16631 | 459 |
| 205 | 3300003760 | Ga0055527_1000003 | Ga0055527_1000003193 | 460 |
| 206 | 3300003762 | Ga0055542_1000005 | Ga0055542_100000557 | 460 |
| 207 | 3300003763 | Ga0055529_1000006 | Ga0055529_1000006193 | 460 |
| 208 | 3300009036 | Ga0105244_10000034 | Ga0105244_1000003468 | 460 |
| 209 | 3300009092 | Ga0105250_10000002 | Ga0105250_10000002306 | 460 |
| 210 | 3300013308 | Ga0157375_10107278 | Ga0157375_101072781 | 460 |
| 211 | 3300025228 | Ga0209672_100003 | Ga0209672_1000031031 | 460 |
| 212 | 3300025229 | Ga0209147_100429 | Ga0209147_1004299 | 460 |
| 213 | 3300025254 | Ga0209148_1000004 | Ga0209148_10000041326 | 460 |
| 214 | 3300025272 | Ga0209455_1000046 | Ga0209455_1000046345 | 460 |
| 215 | 3300025711 | Ga0207696_1000021 | Ga0207696_1000021202 | 460 |
| 216 | 3300025728 | Ga0207655_1000046 | Ga0207655_1000046107 | 460 |
| 217 | 3300048918 | Ga0496115_0061048 | Ga0496115_0061048_1088_2539 | 460 |
| 218 | 3300048924 | Ga0496121_0127415 | Ga0496121_0127415_332_1783 | 460 |
| 219 | iso_pu_bacteria | 2866612099 | 2866616472 | 460 |
| 220 | 3300006946 | Ga0079104_1000021 | Ga0079104_100002132 | 461 |
| 221 | 3300009092 | Ga0105250_10000234 | Ga0105250_1000023438 | 461 |
| 222 | 3300025711 | Ga0207696_1000088 | Ga0207696_100008873 | 461 |
| 223 | 3300027111 | Ga0209281_1000001 | Ga0209281_1000001652 | 461 |
| 224 | 3300042138 | Ga0450903_000358 | Ga0450903_000358_2643_4109 | 461 |
| 225 | 3300042157 | Ga0439458_0001121 | Ga0439458_0001121_860_2326 | 461 |
| 226 | 3300044658 | Ga0466972_0009981 | Ga0466972_0009981_2685_4160 | 461 |
| 227 | 3300048927 | Ga0496124_0017263 | Ga0496124_0017263_500_1942 | 461 |
| 228 | 3300048928 | Ga0496125_0000009 | Ga0496125_0000009_319539_320981 | 461 |
| 229 | 3300048929 | Ga0496126_0098036 | Ga0496126_0098036_331_1773 | 461 |
| 230 | 3300049570 | Ga0501033_0017554 | Ga0501033_0017554_142_1617 | 461 |
| 231 | 3300049822 | Ga0501035_0028739 | Ga0501035_0028739_2455_3930 | 461 |
| 232 | 3300009766 | Ga0123342_1016048 | Ga0123342_10160481 | 462 |
| 233 | 3300049573 | Ga0501037_0010001 | Ga0501037_0010001_327_1835 | 462 |
| 234 | 3300048921 | Ga0496118_0003969 | Ga0496118_0003969_2124_3587 | 463 |
| 235 | 3300025735 | Ga0207713_1000003 | Ga0207713_1000003626 | 464 |
| 236 | 3300031995 | Ga0307409_100068576 | Ga0307409_1000685763 | 464 |
| 237 | 3300049778 | Ga0501282_004066 | Ga0501282_004066_19_1425 | 464 |
| 238 | 3300050516 | nmdc:mga0sz30_15304_c1 | nmdc:mga0sz30_15304_c1_38_1453 | 464 |
| 239 | 3300003354 | JGI25160J50197_1015702 | JGI25160J50197_10157022 | 465 |
| 240 | 3300013307 | Ga0157372_10020599 | Ga0157372_100205994 | 465 |
| 241 | 3300025302 | Ga0207426_1007262 | Ga0207426_10072622 | 465 |
| 242 | 3300027312 | Ga0209371_1001339 | Ga0209371_10013391 | 465 |
| 243 | 3300030500 | Ga0268256_1001426 | Ga0268256_10014269 | 465 |
| 244 | 3300039437 | Ga0436365_1550583 | Ga0436365_1550583_666_2156 | 465 |
| 245 | 3300044684 | Ga0466966_0000471 | Ga0466966_0000471_5134_6549 | 465 |
| 246 | 3300044684 | Ga0466966_0007052 | Ga0466966_0007052_1015_2490 | 465 |
| 247 | 3300044693 | Ga0466961_0017295 | Ga0466961_0017295_2223_3698 | 465 |
| 248 | 3300044694 | Ga0466963_0039333 | Ga0466963_0039333_100_1575 | 465 |
| 249 | 3300044735 | Ga0466968_0009112 | Ga0466968_0009112_1701_3176 | 465 |
| 250 | 3300045049 | Ga0466959_0054522 | Ga0466959_0054522_1000_2415 | 465 |
| 251 | 3300045836 | Ga0466958_0050343 | Ga0466958_0050343_682_2157 | 465 |
| 252 | 3300050509 | nmdc:mga0qj67_139496_c1 | nmdc:mga0qj67_139496_c1_130_1569 | 465 |
| 253 | iso_pu_bacteria | 2870782633 | 2870786129 | 465 |
| 254 | 3300002737 | JGI25162J39368_1000439 | JGI25162J39368_100043923 | 466 |
| 255 | 3300003214 | JGI25165J46597_1000567 | JGI25165J46597_100056723 | 466 |
| 256 | 3300003771 | Ga0055526_1005838 | Ga0055526_10058384 | 466 |
| 257 | 3300003790 | Ga0055528_1000140 | Ga0055528_10001404 | 466 |
| 258 | 3300005535 | Ga0070684_100078614 | Ga0070684_1000786141 | 466 |
| 259 | 3300006186 | Ga0075369_10020540 | Ga0075369_100205402 | 466 |
| 260 | 3300009011 | Ga0105251_10000699 | Ga0105251_100006991 | 466 |
| 261 | 3300013102 | Ga0157371_10115652 | Ga0157371_101156521 | 466 |
| 262 | 3300025233 | Ga0209437_100454 | Ga0209437_10045411 | 466 |
| 263 | 3300025261 | Ga0209233_1000230 | Ga0209233_100023077 | 466 |
| 264 | 3300025273 | Ga0209673_1000023 | Ga0209673_1000023314 | 466 |
| 265 | 3300025273 | Ga0209673_1001357 | Ga0209673_100135710 | 466 |
| 266 | 3300025295 | Ga0209564_1000100 | Ga0209564_100010068 | 466 |
| 267 | 3300025299 | Ga0209256_1000221 | Ga0209256_100022147 | 466 |
| 268 | 3300025711 | Ga0207696_1000005 | Ga0207696_1000005177 | 466 |
| 269 | 3300025735 | Ga0207713_1000002 | Ga0207713_1000002420 | 466 |
| 270 | 3300025900 | Ga0207710_10000049 | Ga0207710_1000004995 | 466 |
| 271 | 3300026067 | Ga0207678_10048587 | Ga0207678_100485872 | 466 |
| 272 | 3300027312 | Ga0209371_1005377 | Ga0209371_10053772 | 466 |
| 273 | 3300030500 | Ga0268256_1005052 | Ga0268256_10050524 | 466 |
| 274 | 3300037312 | Ga0395899_0012838 | Ga0395899_0012838_762_2288 | 466 |
| 275 | 3300037418 | Ga0395900_0145962 | Ga0395900_0145962_143_1669 | 466 |
| 276 | 3300037466 | Ga0395898_0006965 | Ga0395898_0006965_200_1726 | 466 |
| 277 | 3300037466 | Ga0395898_0008104 | Ga0395898_0008104_5103_6578 | 466 |
| 278 | 3300038443 | Ga0395901_0003822 | Ga0395901_0003822_7571_9097 | 466 |
| 279 | 3300038443 | Ga0395901_0015381 | Ga0395901_0015381_1654_3129 | 466 |
| 280 | 3300044735 | Ga0466968_0013034 | Ga0466968_0013034_833_2368 | 466 |
| 281 | 3300048912 | Ga0496109_0005730 | Ga0496109_0005730_8806_10296 | 466 |
| 282 | 3300048922 | Ga0496119_0007347 | Ga0496119_0007347_1611_3089 | 466 |
| 283 | 3300048925 | Ga0496122_0015973 | Ga0496122_0015973_1408_2886 | 466 |
| 284 | 3300048926 | Ga0496123_0031787 | Ga0496123_0031787_1501_2979 | 466 |
| 285 | 3300049571 | Ga0501034_0009919 | Ga0501034_0009919_5291_6742 | 466 |
| 286 | 3300049572 | Ga0501036_0005942 | Ga0501036_0005942_2804_4255 | 466 |
| 287 | 3300049573 | Ga0501037_0010374 | Ga0501037_0010374_3273_4724 | 466 |
| 288 | 3300049574 | Ga0501038_0026283 | Ga0501038_0026283_1951_3402 | 466 |
| 289 | 3300049578 | Ga0501042_0007693 | Ga0501042_0007693_3735_5186 | 466 |
| 290 | 3300049579 | Ga0501043_0008392 | Ga0501043_0008392_1231_2682 | 466 |
| 291 | 3300049581 | Ga0501047_0007414 | Ga0501047_0007414_3054_4505 | 466 |
| 292 | 3300049582 | Ga0501048_0011491 | Ga0501048_0011491_2277_3728 | 466 |
| 293 | 3300049590 | Ga0501074_0049037 | Ga0501074_0049037_927_2378 | 466 |
| 294 | 3300050516 | nmdc:mga0sz30_1378_c2 | nmdc:mga0sz30_1378_c2_394_1947 | 466 |
| 295 | iso_pu_bacteria | 8056207758 | 8056208008 | 466 |
| 296 | 3300003792 | Ga0055540_1000326 | Ga0055540_100032627 | 467 |
| 297 | 3300009101 | Ga0105247_10000018 | Ga0105247_10000018211 | 467 |
| 298 | 3300025303 | Ga0209051_1000062 | Ga0209051_1000062110 | 467 |
| 299 | 3300025304 | Ga0209257_1001421 | Ga0209257_100142121 | 467 |
| 300 | 3300031548 | Ga0307408_100129088 | Ga0307408_1001290882 | 467 |
| 301 | 3300037312 | Ga0395899_0007976 | Ga0395899_0007976_4712_6238 | 467 |
| 302 | 3300037312 | Ga0395899_0020962 | Ga0395899_0020962_2499_3974 | 467 |
| 303 | 3300037418 | Ga0395900_0017366 | Ga0395900_0017366_5700_7175 | 467 |
| 304 | 3300037466 | Ga0395898_0000194 | Ga0395898_0000194_148653_150128 | 467 |
| 305 | iso_pu_bacteria | 2995463766 | 2995464608 | 467 |
| 306 | 3300009011 | Ga0105251_10000042 | Ga0105251_1000004263 | 468 |
| 307 | 3300009092 | Ga0105250_10000009 | Ga0105250_10000009289 | 468 |
| 308 | 3300030521 | Ga0307511_10045093 | Ga0307511_100450933 | 468 |
| 309 | 3300038443 | Ga0395901_0010327 | Ga0395901_0010327_2523_4055 | 468 |
| 310 | 3300044656 | Ga0466969_0019381 | Ga0466969_0019381_85_1554 | 468 |
| 311 | 3300044684 | Ga0466966_0001189 | Ga0466966_0001189_10997_12475 | 468 |
| 312 | 3300044693 | Ga0466961_0023957 | Ga0466961_0023957_900_2378 | 468 |
| 313 | 3300044693 | Ga0466961_0046272 | Ga0466961_0046272_1227_2696 | 468 |
| 314 | 3300045049 | Ga0466959_0005365 | Ga0466959_0005365_5532_7010 | 468 |
| 315 | 3300048929 | Ga0496126_0052530 | Ga0496126_0052530_912_2405 | 468 |
| 316 | 3300002704 | JGI25155J39150_1000015 | JGI25155J39150_1000015157 | 469 |
| 317 | 3300002705 | JGI25156J39149_1000007 | JGI25156J39149_1000007158 | 469 |
| 318 | 3300002738 | JGI25154J39366_1000051 | JGI25154J39366_100005114 | 469 |
| 319 | 3300002741 | JGI25157J39369_1000012 | JGI25157J39369_100001242 | 469 |
| 320 | 3300025206 | Ga0209435_100006 | Ga0209435_100006366 | 469 |
| 321 | 3300025246 | Ga0209646_1000015 | Ga0209646_1000015168 | 469 |
| 322 | 3300025250 | Ga0209026_1000046 | Ga0209026_1000046168 | 469 |
| 323 | 3300025256 | Ga0209759_1000005 | Ga0209759_1000005366 | 469 |
| 324 | 3300030521 | Ga0307511_10003267 | Ga0307511_100032677 | 469 |
| 325 | 3300031507 | Ga0307509_10032432 | Ga0307509_100324325 | 469 |
| 326 | 3300033180 | Ga0307510_10010903 | Ga0307510_100109032 | 469 |
| 327 | 3300041411 | Ga0439466_0036103 | Ga0439466_0036103_58_1581 | 469 |
| 328 | 3300041999 | Ga0439433_0002433 | Ga0439433_0002433_1201_2724 | 469 |
| 329 | 3300044658 | Ga0466972_0004406 | Ga0466972_0004406_4174_5601 | 469 |
| 330 | 3300044684 | Ga0466966_0001258 | Ga0466966_0001258_13633_15045 | 469 |
| 331 | 3300044693 | Ga0466961_0026854 | Ga0466961_0026854_776_2203 | 469 |
| 332 | 3300044901 | Ga0466960_0002389 | Ga0466960_0002389_1283_2710 | 469 |
| 333 | 3300045049 | Ga0466959_0006338 | Ga0466959_0006338_256_1668 | 469 |
| 334 | 3300046477 | Ga0495664_0000742 | Ga0495664_0000742_10589_12031 | 469 |
| 335 | 3300046517 | Ga0495630_0011755 | Ga0495630_0011755_4537_5979 | 469 |
| 336 | 3300046536 | Ga0495587_0002568 | Ga0495587_0002568_9941_11383 | 469 |
| 337 | 3300046642 | Ga0495634_0000378 | Ga0495634_0000378_11999_13441 | 469 |
| 338 | 3300046663 | Ga0495635_0000283 | Ga0495635_0000283_21722_23164 | 469 |
| 339 | 3300046675 | Ga0495657_0000049 | Ga0495657_0000049_95109_96551 | 469 |
| 340 | 3300046689 | Ga0495613_0001423 | Ga0495613_0001423_1194_2636 | 469 |
| 341 | 3300047317 | Ga0495604_0001396 | Ga0495604_0001396_5843_7285 | 469 |
| 342 | 3300047321 | Ga0495676_0026688 | Ga0495676_0026688_2878_4320 | 469 |
| 343 | 3300047444 | Ga0495675_0072350 | Ga0495675_0072350_301_1743 | 469 |
| 344 | 3300047673 | Ga0495593_0002496 | Ga0495593_0002496_2671_4113 | 469 |
| 345 | 3300049571 | Ga0501034_0000038 | Ga0501034_0000038_230728_232236 | 469 |
| 346 | 3300049579 | Ga0501043_0128852 | Ga0501043_0128852_442_1950 | 469 |
| 347 | iso_pu_bacteria | 2862281513 | 2862283104 | 469 |
| 348 | 3300003320 | rootH2_10021729 | rootH2_100217294 | 470 |
| 349 | 3300003322 | rootL2_10069804 | rootL2_100698043 | 470 |
| 350 | 3300003856 | Ga0058692_1006585 | Ga0058692_10065851 | 470 |
| 351 | 3300005289 | Ga0065704_10000345 | Ga0065704_1000034513 | 470 |
| 352 | 3300005289 | Ga0065704_10001325 | Ga0065704_100013252 | 470 |
| 353 | 3300005289 | Ga0065704_10007120 | Ga0065704_100071202 | 470 |
| 354 | 3300005289 | Ga0065704_10009879 | Ga0065704_100098791 | 470 |
| 355 | 3300005338 | Ga0068868_100059380 | Ga0068868_1000593802 | 470 |
| 356 | 3300005548 | Ga0070665_100000998 | Ga0070665_10000099816 | 470 |
| 357 | 3300005577 | Ga0068857_100007212 | Ga0068857_1000072129 | 470 |
| 358 | 3300005616 | Ga0068852_100053124 | Ga0068852_1000531241 | 470 |
| 359 | 3300006051 | Ga0075364_10002110 | Ga0075364_100021103 | 470 |
| 360 | 3300006051 | Ga0075364_10005201 | Ga0075364_100052018 | 470 |
| 361 | 3300006195 | Ga0075366_10057282 | Ga0075366_100572822 | 470 |
| 362 | 3300006946 | Ga0079104_1000109 | Ga0079104_100010971 | 470 |
| 363 | 3300006946 | Ga0079104_1000480 | Ga0079104_100048023 | 470 |
| 364 | 3300006946 | Ga0079104_1001200 | Ga0079104_100120012 | 470 |
| 365 | 3300009011 | Ga0105251_10001786 | Ga0105251_1000178614 | 470 |
| 366 | 3300009036 | Ga0105244_10001835 | Ga0105244_1000183512 | 470 |
| 367 | 3300009036 | Ga0105244_10022622 | Ga0105244_100226223 | 470 |
| 368 | 3300013102 | Ga0157371_10137366 | Ga0157371_101373662 | 470 |
| 369 | 3300013104 | Ga0157370_10000325 | Ga0157370_1000032521 | 470 |
| 370 | 3300015679 | Ga0183366_1001 | Ga0183366_10011611 | 470 |
| 371 | 3300015680 | Ga0183370_1001 | Ga0183370_10011611 | 470 |
| 372 | 3300015685 | Ga0183369_1001 | Ga0183369_10011611 | 470 |
| 373 | 3300015687 | Ga0183368_1001 | Ga0183368_10011611 | 470 |
| 374 | 3300025711 | Ga0207696_1011651 | Ga0207696_10116512 | 470 |
| 375 | 3300025728 | Ga0207655_1000001 | Ga0207655_10000011525 | 470 |
| 376 | 3300025728 | Ga0207655_1000002 | Ga0207655_1000002932 | 470 |
| 377 | 3300025728 | Ga0207655_1001213 | Ga0207655_100121313 | 470 |
| 378 | 3300025735 | Ga0207713_1000004 | Ga0207713_1000004609 | 470 |
| 379 | 3300025901 | Ga0207688_10027609 | Ga0207688_100276092 | 470 |
| 380 | 3300026023 | Ga0207677_10168114 | Ga0207677_101681141 | 470 |
| 381 | 3300026116 | Ga0207674_10011834 | Ga0207674_100118343 | 470 |
| 382 | 3300027111 | Ga0209281_1000004 | Ga0209281_1000004937 | 470 |
| 383 | 3300027111 | Ga0209281_1000006 | Ga0209281_1000006687 | 470 |
| 384 | 3300027111 | Ga0209281_1000024 | Ga0209281_1000024126 | 470 |
| 385 | 3300027111 | Ga0209281_1001417 | Ga0209281_10014172 | 470 |
| 386 | 3300027312 | Ga0209371_1000001 | Ga0209371_10000011578 | 470 |
| 387 | 3300027312 | Ga0209371_1003647 | Ga0209371_10036473 | 470 |
| 388 | 3300028379 | Ga0268266_10091692 | Ga0268266_100916922 | 470 |
| 389 | 3300030500 | Ga0268256_1000001 | Ga0268256_10000011064 | 470 |
| 390 | 3300030500 | Ga0268256_1004200 | Ga0268256_10042006 | 470 |
| 391 | 3300042010 | Ga0439452_000014 | Ga0439452_000014_305137_306633 | 470 |
| 392 | 3300044669 | Ga0466981_0000004 | Ga0466981_0000004_140600_142096 | 470 |
| 393 | 3300044765 | Ga0466970_0000147 | Ga0466970_0000147_8246_9766 | 470 |
| 394 | 3300046458 | Ga0495591_000003 | Ga0495591_000003_178105_179601 | 470 |
| 395 | 3300046471 | Ga0495650_0000005 | Ga0495650_0000005_251508_253004 | 470 |
| 396 | 3300046471 | Ga0495650_0000149 | Ga0495650_0000149_5452_6921 | 470 |
| 397 | 3300046507 | Ga0495606_0000318 | Ga0495606_0000318_40461_41930 | 470 |
| 398 | 3300046524 | Ga0495648_0026341 | Ga0495648_0026341_1147_2616 | 470 |
| 399 | 3300046530 | Ga0495654_0000055 | Ga0495654_0000055_139984_141453 | 470 |
| 400 | 3300046660 | Ga0495625_0010488 | Ga0495625_0010488_134_1585 | 470 |
| 401 | 3300046692 | Ga0495671_0006848 | Ga0495671_0006848_4952_6421 | 470 |
| 402 | 3300046810 | Ga0495660_0000017 | Ga0495660_0000017_171888_173357 | 470 |
| 403 | 3300047320 | Ga0495672_0000001 | Ga0495672_0000001_1304213_1305682 | 470 |
| 404 | 3300047469 | Ga0495673_0000007 | Ga0495673_0000007_618309_619805 | 470 |
| 405 | 3300047469 | Ga0495673_0000019 | Ga0495673_0000019_405692_407161 | 470 |
| 406 | 3300048907 | Ga0496104_0000633 | Ga0496104_0000633_5771_7267 | 470 |
| 407 | 3300048908 | Ga0496105_0029356 | Ga0496105_0029356_2543_4039 | 470 |
| 408 | 3300048919 | Ga0496116_0000204 | Ga0496116_0000204_71083_72579 | 470 |
| 409 | 3300048920 | Ga0496117_0000020 | Ga0496117_0000020_25555_27051 | 470 |
| 410 | 3300048920 | Ga0496117_0000993 | Ga0496117_0000993_6573_8069 | 470 |
| 411 | 3300048921 | Ga0496118_0000015 | Ga0496118_0000015_40773_42269 | 470 |
| 412 | 3300048921 | Ga0496118_0016244 | Ga0496118_0016244_3723_5219 | 470 |
| 413 | 3300048922 | Ga0496119_0017983 | Ga0496119_0017983_1282_2778 | 470 |
| 414 | 3300048922 | Ga0496119_0045962 | Ga0496119_0045962_989_2485 | 470 |
| 415 | 3300048923 | Ga0496120_0000096 | Ga0496120_0000096_98565_100061 | 470 |
| 416 | 3300048923 | Ga0496120_0001020 | Ga0496120_0001020_24160_25656 | 470 |
| 417 | 3300048924 | Ga0496121_0001063 | Ga0496121_0001063_29764_31260 | 470 |
| 418 | 3300048924 | Ga0496121_0002957 | Ga0496121_0002957_6017_7513 | 470 |
| 419 | 3300048924 | Ga0496121_0005652 | Ga0496121_0005652_11623_13119 | 470 |
| 420 | 3300048924 | Ga0496121_0012935 | Ga0496121_0012935_5044_6540 | 470 |
| 421 | 3300048925 | Ga0496122_0000005 | Ga0496122_0000005_455997_457493 | 470 |
| 422 | 3300048925 | Ga0496122_0001255 | Ga0496122_0001255_4472_5968 | 470 |
| 423 | 3300048925 | Ga0496122_0005324 | Ga0496122_0005324_11335_12831 | 470 |
| 424 | 3300048925 | Ga0496122_0005341 | Ga0496122_0005341_10681_12177 | 470 |
| 425 | 3300048926 | Ga0496123_0000008 | Ga0496123_0000008_173136_174632 | 470 |
| 426 | 3300048926 | Ga0496123_0000994 | Ga0496123_0000994_4472_5968 | 470 |
| 427 | 3300048927 | Ga0496124_0000984 | Ga0496124_0000984_7774_9270 | 470 |
| 428 | 3300048928 | Ga0496125_0001579 | Ga0496125_0001579_9326_10822 | 470 |
| 429 | 3300048928 | Ga0496125_0006056 | Ga0496125_0006056_7838_9334 | 470 |
| 430 | 3300048928 | Ga0496125_0013099 | Ga0496125_0013099_1800_3296 | 470 |
| 431 | 3300048929 | Ga0496126_0000349 | Ga0496126_0000349_87122_88618 | 470 |
| 432 | 3300048929 | Ga0496126_0000717 | Ga0496126_0000717_56203_57699 | 470 |
| 433 | 3300049459 | Ga0495678_000493 | Ga0495678_000493_26490_27959 | 470 |
| 434 | 3300049460 | Ga0495682_0000011 | Ga0495682_0000011_164087_165556 | 470 |
| 435 | 3300053126 | Ga0500621_000005 | Ga0500621_000005_162401_163870 | 470 |
| 436 | iso_pu_bacteria | 2558860280 | 2559425583 | 470 |
| 437 | iso_pu_bacteria | 2738543034 | 2739366422 | 470 |
| 438 | iso_pu_bacteria | 2773857762 | 2774392942 | 470 |
| 439 | iso_pu_bacteria | 2784746763 | 2785346659 | 470 |
| 440 | iso_pu_bacteria | 2791355406 | 2793984119 | 470 |
| 441 | iso_pu_bacteria | 2808606439 | 2809196763 | 470 |
| 442 | iso_pu_bacteria | 2862382967 | 2862391537 | 470 |
| 443 | iso_pu_bacteria | 2891968417 | 2891971344 | 470 |
| 444 | iso_pu_bacteria | 8003314358 | 8003322324 | 470 |
| 445 | iso_pu_bacteria | 8008558824 | 8008560494 | 470 |
| 446 | iso_pu_bacteria | 8008574985 | 8008581307 | 470 |
| 447 | iso_pu_bacteria | 8047893842 | 8047901276 | 470 |
| 448 | iso_pu_bacteria | 8048127548 | 8048135668 | 470 |
| 449 | iso_pu_bacteria | 8048356638 | 8048357623 | 470 |
| 450 | iso_pu_bacteria | 8048369669 | 8048378217 | 470 |
| 451 | iso_pu_bacteria | 8048379754 | 8048387315 | 470 |
| 452 | iso_pu_bacteria | 8048406513 | 8048413949 | 470 |
| 453 | iso_pu_bacteria | 8056829672 | 8056830880 | 470 |
| 454 | 3300003856 | Ga0058692_1000379 | Ga0058692_100037912 | 471 |
| 455 | 3300005328 | Ga0070676_10067664 | Ga0070676_100676642 | 471 |
| 456 | 3300005364 | Ga0070673_100105265 | Ga0070673_1001052651 | 471 |
| 457 | 3300005455 | Ga0070663_100001810 | Ga0070663_1000018105 | 471 |
| 458 | 3300006177 | Ga0075362_10028876 | Ga0075362_100288762 | 471 |
| 459 | 3300006353 | Ga0075370_10077717 | Ga0075370_100777172 | 471 |
| 460 | 3300009011 | Ga0105251_10000566 | Ga0105251_1000056611 | 471 |
| 461 | 3300025908 | Ga0207643_10012143 | Ga0207643_100121432 | 471 |
| 462 | 3300026067 | Ga0207678_10001242 | Ga0207678_1000124217 | 471 |
| 463 | 3300026116 | Ga0207674_10067560 | Ga0207674_100675602 | 471 |
| 464 | 3300026121 | Ga0207683_10202364 | Ga0207683_102023642 | 471 |
| 465 | 3300027312 | Ga0209371_1000407 | Ga0209371_100040727 | 471 |
| 466 | 3300030500 | Ga0268256_1001782 | Ga0268256_10017825 | 471 |
| 467 | 3300037418 | Ga0395900_0032077 | Ga0395900_0032077_3135_4646 | 471 |
| 468 | 3300048906 | Ga0496103_0082219 | Ga0496103_0082219_284_1867 | 471 |
| 469 | iso_pu_bacteria | 2582581314 | 2585315247 | 471 |
| 470 | iso_pu_bacteria | 2616644814 | 2616693437 | 471 |
| 471 | iso_pu_bacteria | 2728369276 | 2729908860 | 471 |
| 472 | iso_pu_bacteria | 2811994878 | 2812351102 | 471 |
| 473 | iso_pu_bacteria | 2811994879 | 2812361344 | 471 |
| 474 | iso_pu_bacteria | 2852635781 | 2852642657 | 471 |
| 475 | iso_pu_bacteria | 2863404153 | 2863408175 | 471 |
| 476 | iso_pu_bacteria | 2899359706 | 2899367203 | 471 |
| 477 | iso_pu_bacteria | 2917736166 | 2917740940 | 471 |
| 478 | iso_pu_bacteria | 2946064051 | 2946064742 | 471 |
| 479 | iso_pu_bacteria | 2947224130 | 2947224705 | 471 |
| 480 | iso_pu_bacteria | 2990059506 | 2990065726 | 471 |
| 481 | iso_pu_bacteria | 2997600082 | 2997603380 | 471 |
| 482 | iso_pu_bacteria | 8056037122 | 8056038428 | 471 |
| 483 | 3300005347 | Ga0070668_100011436 | Ga0070668_1000114363 | 472 |
| 484 | 3300013100 | Ga0157373_10006320 | Ga0157373_100063203 | 472 |
| 485 | 3300013102 | Ga0157371_10003636 | Ga0157371_1000363612 | 472 |
| 486 | 3300013307 | Ga0157372_10261885 | Ga0157372_102618852 | 472 |
| 487 | 3300025972 | Ga0207668_10036135 | Ga0207668_100361352 | 472 |
| 488 | 3300031456 | Ga0307513_10038677 | Ga0307513_100386775 | 472 |
| 489 | 3300031507 | Ga0307509_10019038 | Ga0307509_100190385 | 472 |
| 490 | 3300031838 | Ga0307518_10000779 | Ga0307518_100007795 | 472 |
| 491 | 3300037418 | Ga0395900_0022364 | Ga0395900_0022364_3686_5125 | 472 |
| 492 | 3300037466 | Ga0395898_0006197 | Ga0395898_0006197_8487_9926 | 472 |
| 493 | 3300038443 | Ga0395901_0021736 | Ga0395901_0021736_2780_4219 | 472 |
| 494 | 3300039450 | Ga0436363_0937583 | Ga0436363_0937583_511_2043 | 472 |
| 495 | 3300041405 | Ga0439438_000002 | Ga0439438_000002_471231_472700 | 472 |
| 496 | 3300042014 | Ga0439457_000762 | Ga0439457_000762_6843_8285 | 472 |
| 497 | 3300044683 | Ga0466965_0028939 | Ga0466965_0028939_432_1856 | 472 |
| 498 | 3300046501 | Ga0495607_0064271 | Ga0495607_0064271_281_1756 | 472 |
| 499 | 3300046663 | Ga0495635_0015722 | Ga0495635_0015722_681_2135 | 472 |
| 500 | 3300048924 | Ga0496121_0003286 | Ga0496121_0003286_18471_20054 | 472 |
| 501 | 3300049130 | Ga0501310_000011 | Ga0501310_000011_10013_11524 | 472 |
| 502 | 3300050491 | nmdc:mga00v17_12627_c1 | nmdc:mga00v17_12627_c1_955_2538 | 472 |
| 503 | 3300053077 | Ga0495601_0116409 | Ga0495601_0116409_84_1538 | 472 |
| 504 | 3300053078 | Ga0495612_0007165 | Ga0495612_0007165_1434_2888 | 472 |
| 505 | iso_pu_bacteria | 2558860983 | 2561467691 | 472 |
| 506 | iso_pu_bacteria | 2585427649 | 2586059447 | 472 |
| 507 | iso_pu_bacteria | 2654587600 | 2655033852 | 472 |
| 508 | iso_pu_bacteria | 2808606359 | 2808845273 | 472 |
| 509 | iso_pu_bacteria | 2808606522 | 2809591799 | 472 |
| 510 | iso_pu_bacteria | 2915768154 | 2915768717 | 472 |
| 511 | iso_pu_bacteria | 3006486233 | 3006489723 | 472 |
| 512 | iso_pu_bacteria | 8056667051 | 8056668363 | 472 |
| 513 | 3300003322 | rootL2_10000515 | rootL2_100005152 | 473 |
| 514 | 3300003323 | rootH1_10045263 | rootH1_100452632 | 473 |
| 515 | 3300005539 | Ga0068853_100099784 | Ga0068853_1000997842 | 473 |
| 516 | 3300009545 | Ga0105237_10178038 | Ga0105237_101780381 | 473 |
| 517 | 3300009551 | Ga0105238_10075987 | Ga0105238_100759873 | 473 |
| 518 | 3300015688 | Ga0183367_1001 | Ga0183367_1001842 | 473 |
| 519 | 3300028786 | Ga0307517_10004520 | Ga0307517_1000452017 | 473 |
| 520 | 3300028794 | Ga0307515_10000995 | Ga0307515_1000099517 | 473 |
| 521 | 3300030521 | Ga0307511_10005918 | Ga0307511_100059182 | 473 |
| 522 | 3300031730 | Ga0307516_10020950 | Ga0307516_100209502 | 473 |
| 523 | 3300031838 | Ga0307518_10152854 | Ga0307518_101528541 | 473 |
| 524 | 3300038443 | Ga0395901_0000801 | Ga0395901_0000801_26953_28503 | 473 |
| 525 | 3300041512 | Ga0451853_3737571 | Ga0451853_3737571_1523_2971 | 473 |
| 526 | 3300041999 | Ga0439433_0000402 | Ga0439433_0000402_3342_4784 | 473 |
| 527 | 3300042131 | Ga0450894_000179 | Ga0450894_000179_1166_2614 | 473 |
| 528 | 3300042145 | Ga0450906_001425 | Ga0450906_001425_3298_4746 | 473 |
| 529 | 3300044656 | Ga0466969_0033857 | Ga0466969_0033857_867_2309 | 473 |
| 530 | 3300044684 | Ga0466966_0021232 | Ga0466966_0021232_2585_4027 | 473 |
| 531 | 3300044693 | Ga0466961_0005046 | Ga0466961_0005046_1411_2853 | 473 |
| 532 | 3300044735 | Ga0466968_0010429 | Ga0466968_0010429_1667_3109 | 473 |
| 533 | 3300046452 | Ga0495617_004081 | Ga0495617_004081_1233_2681 | 473 |
| 534 | 3300046455 | Ga0495603_0012082 | Ga0495603_0012082_3044_4492 | 473 |
| 535 | 3300046462 | Ga0495651_0049803 | Ga0495651_0049803_334_1782 | 473 |
| 536 | 3300046477 | Ga0495664_0011257 | Ga0495664_0011257_3546_4994 | 473 |
| 537 | 3300046499 | Ga0495594_0022557 | Ga0495594_0022557_1459_2907 | 473 |
| 538 | 3300046500 | Ga0495596_0028639 | Ga0495596_0028639_204_1652 | 473 |
| 539 | 3300046506 | Ga0495583_0056821 | Ga0495583_0056821_261_1709 | 473 |
| 540 | 3300046512 | Ga0495610_0033859 | Ga0495610_0033859_545_1993 | 473 |
| 541 | 3300046513 | Ga0495616_0023037 | Ga0495616_0023037_639_2087 | 473 |
| 542 | 3300046518 | Ga0495631_0001116 | Ga0495631_0001116_7749_9197 | 473 |
| 543 | 3300046522 | Ga0495643_0001005 | Ga0495643_0001005_4064_5512 | 473 |
| 544 | 3300046526 | Ga0495666_0002702 | Ga0495666_0002702_2855_4303 | 473 |
| 545 | 3300046528 | Ga0495642_0012576 | Ga0495642_0012576_540_1988 | 473 |
| 546 | 3300046529 | Ga0495652_0076188 | Ga0495652_0076188_706_2154 | 473 |
| 547 | 3300046530 | Ga0495654_0017690 | Ga0495654_0017690_1224_2672 | 473 |
| 548 | 3300046531 | Ga0495665_0058587 | Ga0495665_0058587_384_1832 | 473 |
| 549 | 3300046533 | Ga0495640_0022132 | Ga0495640_0022132_2229_3677 | 473 |
| 550 | 3300046542 | Ga0495597_0019216 | Ga0495597_0019216_348_1796 | 473 |
| 551 | 3300046559 | Ga0495667_0058585 | Ga0495667_0058585_151_1599 | 473 |
| 552 | 3300046616 | Ga0495668_0007928 | Ga0495668_0007928_4363_5811 | 473 |
| 553 | 3300046660 | Ga0495625_0002090 | Ga0495625_0002090_9986_11449 | 473 |
| 554 | 3300046674 | Ga0495588_0004259 | Ga0495588_0004259_512_1975 | 473 |
| 555 | 3300046794 | Ga0495589_0060200 | Ga0495589_0060200_328_1776 | 473 |
| 556 | 3300046809 | Ga0495600_0136144 | Ga0495600_0136144_89_1537 | 473 |
| 557 | 3300046810 | Ga0495660_0052356 | Ga0495660_0052356_500_1948 | 473 |
| 558 | 3300047317 | Ga0495604_0055593 | Ga0495604_0055593_1160_2608 | 473 |
| 559 | 3300047318 | Ga0495636_0006035 | Ga0495636_0006035_502_1956 | 473 |
| 560 | 3300047318 | Ga0495636_0029339 | Ga0495636_0029339_197_1645 | 473 |
| 561 | 3300047319 | Ga0495674_0165798 | Ga0495674_0165798_89_1537 | 473 |
| 562 | 3300047321 | Ga0495676_0002192 | Ga0495676_0002192_12676_14124 | 473 |
| 563 | 3300047321 | Ga0495676_0005295 | Ga0495676_0005295_1873_3321 | 473 |
| 564 | 3300047323 | Ga0495683_0039006 | Ga0495683_0039006_762_2210 | 473 |
| 565 | 3300047443 | Ga0495687_003038 | Ga0495687_003038_3645_5099 | 473 |
| 566 | 3300047470 | Ga0495681_0000769 | Ga0495681_0000769_16105_17568 | 473 |
| 567 | 3300048091 | Ga0495626_0013857 | Ga0495626_0013857_734_2182 | 473 |
| 568 | 3300048928 | Ga0496125_0014219 | Ga0496125_0014219_4209_5630 | 473 |
| 569 | 3300049130 | Ga0501310_000451 | Ga0501310_000451_1150_2598 | 473 |
| 570 | 3300053157 | Ga0500624_001218 | Ga0500624_001218_343_1791 | 473 |
| 571 | iso_pu_bacteria | 2784132109 | 2784471224 | 473 |
| 572 | iso_pu_bacteria | 2808606375 | 2808917713 | 473 |
| 573 | iso_pu_bacteria | 2873151551 | 2873152676 | 473 |
| 574 | iso_pu_bacteria | 2904765812 | 2904767701 | 473 |
| 575 | iso_pu_bacteria | 2904770941 | 2904774522 | 473 |
| 576 | iso_pu_bacteria | 2908811453 | 2908813345 | 473 |
| 577 | iso_pu_bacteria | 2919420072 | 2919424687 | 473 |
| 578 | iso_pu_bacteria | 2919432681 | 2919436932 | 473 |
| 579 | iso_pu_bacteria | 2933418574 | 2933420306 | 473 |
| 580 | 3300005564 | Ga0070664_100267319 | Ga0070664_1002673191 | 474 |
| 581 | 3300009148 | Ga0105243_10046858 | Ga0105243_100468582 | 474 |
| 582 | 3300011119 | Ga0105246_10078707 | Ga0105246_100787072 | 474 |
| 583 | 3300013102 | Ga0157371_10007791 | Ga0157371_100077913 | 474 |
| 584 | 3300025935 | Ga0207709_10045900 | Ga0207709_100459002 | 474 |
| 585 | 3300031649 | Ga0307514_10005218 | Ga0307514_100052182 | 474 |
| 586 | 3300031730 | Ga0307516_10004980 | Ga0307516_100049808 | 474 |
| 587 | 3300041405 | Ga0439438_008736 | Ga0439438_008736_1641_3155 | 474 |
| 588 | 3300041406 | Ga0439439_0005795 | Ga0439439_0005795_82_1596 | 474 |
| 589 | 3300041410 | Ga0439461_0005423 | Ga0439461_0005423_13_1527 | 474 |
| 590 | 3300042010 | Ga0439452_015017 | Ga0439452_015017_578_2092 | 474 |
| 591 | 3300042184 | Ga0450908_008239 | Ga0450908_008239_44_1558 | 474 |
| 592 | 3300044765 | Ga0466970_0011408 | Ga0466970_0011408_14_1492 | 474 |
| 593 | 3300046463 | Ga0495653_0011692 | Ga0495653_0011692_3912_5480 | 474 |
| 594 | 3300046501 | Ga0495607_0027479 | Ga0495607_0027479_1340_2926 | 474 |
| 595 | 3300046794 | Ga0495589_0020250 | Ga0495589_0020250_1009_2460 | 474 |
| 596 | 3300047321 | Ga0495676_0009992 | Ga0495676_0009992_5602_7053 | 474 |
| 597 | 3300047447 | Ga0495685_003995 | Ga0495685_003995_782_2233 | 474 |
| 598 | 3300048919 | Ga0496116_0000167 | Ga0496116_0000167_37906_39408 | 474 |
| 599 | 3300048925 | Ga0496122_0096629 | Ga0496122_0096629_421_1923 | 474 |
| 600 | 3300048927 | Ga0496124_0048055 | Ga0496124_0048055_659_2161 | 474 |
| 601 | 3300048929 | Ga0496126_0000768 | Ga0496126_0000768_19051_20553 | 474 |
| 602 | 3300059508 | Ga0587088_001235 | Ga0587088_001235_1013_2527 | 474 |
| 603 | 3300059510 | Ga0587090_000123 | Ga0587090_000123_3208_4722 | 474 |
| 604 | iso_pu_bacteria | 2554235227 | 2555230970 | 474 |
| 605 | iso_pu_bacteria | 2582581313 | 2585305871 | 474 |
| 606 | iso_pu_bacteria | 2643221616 | 2644094668 | 474 |
| 607 | iso_pu_bacteria | 2643221647 | 2644270237 | 474 |
| 608 | iso_pu_bacteria | 2643221678 | 2644441935 | 474 |
| 609 | iso_pu_bacteria | 2643221714 | 2644630642 | 474 |
| 610 | iso_pu_bacteria | 2728369276 | 2729909953 | 474 |
| 611 | iso_pu_bacteria | 2784132109 | 2784471226 | 474 |
| 612 | iso_pu_bacteria | 2784746768 | 2785366361 | 474 |
| 613 | iso_pu_bacteria | 2808606359 | 2808847002 | 474 |
| 614 | iso_pu_bacteria | 2867428634 | 2867435045 | 474 |
| 615 | iso_pu_bacteria | 2912715099 | 2912723471 | 474 |
| 616 | iso_pu_bacteria | 2919468124 | 2919470116 | 474 |
| 617 | iso_pu_bacteria | 2946072368 | 2946073111 | 474 |
| 618 | iso_pu_bacteria | 2954380949 | 2954389462 | 474 |
| 619 | iso_pu_bacteria | 2954691527 | 2954700240 | 474 |
| 620 | iso_pu_bacteria | 2954701450 | 2954701989 | 474 |
| 621 | iso_pu_bacteria | 2954711539 | 2954719009 | 474 |
| 622 | iso_pu_bacteria | 2954721474 | 2954728980 | 474 |
| 623 | iso_pu_bacteria | 2954731030 | 2954732831 | 474 |
| 624 | iso_pu_bacteria | 2954740390 | 2954747879 | 474 |
| 625 | iso_pu_bacteria | 2954749733 | 2954751709 | 474 |
| 626 | iso_pu_bacteria | 2954759201 | 2954767005 | 474 |
| 627 | 3300013105 | Ga0157369_10119698 | Ga0157369_101196983 | 475 |
| 628 | 3300042121 | Ga0450919_003914 | Ga0450919_003914_70_1518 | 475 |
| 629 | 3300046531 | Ga0495665_0003646 | Ga0495665_0003646_574_2016 | 475 |
| 630 | 3300048925 | Ga0496122_0046280 | Ga0496122_0046280_796_2265 | 475 |
| 631 | 3300048926 | Ga0496123_0043706 | Ga0496123_0043706_806_2275 | 475 |
| 632 | iso_pu_bacteria | 2565956761 | 2566993732 | 475 |
| 633 | iso_pu_bacteria | 2786546132 | 2786667351 | 475 |
| 634 | iso_pu_bacteria | 2802429606 | 2805936707 | 475 |
| 635 | iso_pu_bacteria | 2838016132 | 2838022309 | 475 |
| 636 | iso_pu_bacteria | 2838668709 | 2838671587 | 475 |
| 637 | iso_pu_bacteria | 2838701080 | 2838704147 | 475 |
| 638 | iso_pu_bacteria | 2842146304 | 2842149236 | 475 |
| 639 | iso_pu_bacteria | 2842250916 | 2842253597 | 475 |
| 640 | iso_pu_bacteria | 2842489311 | 2842491545 | 475 |
| 641 | iso_pu_bacteria | 2857740372 | 2857744197 | 475 |
| 642 | iso_pu_bacteria | 2862281513 | 2862282504 | 475 |
| 643 | iso_pu_bacteria | 2877676314 | 2877684155 | 475 |
| 644 | iso_pu_bacteria | 2904535858 | 2904536821 | 475 |
| 645 | iso_pu_bacteria | 2919034639 | 2919036552 | 475 |
| 646 | iso_pu_bacteria | 2919538618 | 2919541019 | 475 |
| 647 | iso_pu_bacteria | 2922554459 | 2922555257 | 475 |
| 648 | iso_pu_bacteria | 2932426870 | 2932427158 | 475 |
| 649 | iso_pu_bacteria | 2933418574 | 2933419778 | 475 |
| 650 | iso_pu_bacteria | 2939674588 | 2939677005 | 475 |
| 651 | iso_pu_bacteria | 2954673503 | 2954673505 | 475 |
| 652 | iso_pu_bacteria | 2954682443 | 2954690485 | 475 |
| 653 | iso_pu_bacteria | 2966598605 | 2966605176 | 475 |
| 654 | iso_pu_bacteria | 8024501048 | 8024505671 | 475 |
| 655 | 3300001990 | JGI24737J22298_10018569 | JGI24737J22298_100185692 | 476 |
| 656 | 3300006051 | Ga0075364_10041471 | Ga0075364_100414712 | 476 |
| 657 | 3300009098 | Ga0105245_10196241 | Ga0105245_101962412 | 476 |
| 658 | 3300025297 | Ga0209758_1003466 | Ga0209758_10034663 | 476 |
| 659 | 3300025933 | Ga0207706_10060675 | Ga0207706_100606753 | 476 |
| 660 | 3300030522 | Ga0307512_10021735 | Ga0307512_100217353 | 476 |
| 661 | 3300031649 | Ga0307514_10015485 | Ga0307514_100154855 | 476 |
| 662 | 3300041512 | Ga0451853_3919652 | Ga0451853_3919652_926_2365 | 476 |
| 663 | 3300042007 | Ga0439449_0000789 | Ga0439449_0000789_2943_4394 | 476 |
| 664 | 3300046616 | Ga0495668_0000294 | Ga0495668_0000294_56648_58093 | 476 |
| 665 | 3300050496 | nmdc:mga07m45_17350_c1 | nmdc:mga07m45_17350_c1_1548_2993 | 476 |
| 666 | 3300050496 | nmdc:mga07m45_71866_c1 | nmdc:mga07m45_71866_c1_251_1696 | 476 |
| 667 | iso_pu_bacteria | 2582581308 | 2585278115 | 476 |
| 668 | iso_pu_bacteria | 2582581316 | 2585332766 | 476 |
| 669 | iso_pu_bacteria | 2585427527 | 2585532225 | 476 |
| 670 | iso_pu_bacteria | 2585427530 | 2585552585 | 476 |
| 671 | iso_pu_bacteria | 2615840626 | 2616307633 | 476 |
| 672 | iso_pu_bacteria | 2615840698 | 2616552081 | 476 |
| 673 | iso_pu_bacteria | 2667528174 | 2671117026 | 476 |
| 674 | iso_pu_bacteria | 2791355261 | 2793325742 | 476 |
| 675 | iso_pu_bacteria | 2818991448 | 2819607362 | 476 |
| 676 | iso_pu_bacteria | 2818991453 | 2819640470 | 476 |
| 677 | iso_pu_bacteria | 2838022645 | 2838027284 | 476 |
| 678 | iso_pu_bacteria | 2838029111 | 2838032633 | 476 |
| 679 | iso_pu_bacteria | 2838048938 | 2838050650 | 476 |
| 680 | iso_pu_bacteria | 2838061910 | 2838062942 | 476 |
| 681 | iso_pu_bacteria | 2838068647 | 2838071890 | 476 |
| 682 | iso_pu_bacteria | 2841864319 | 2841869378 | 476 |
| 683 | iso_pu_bacteria | 2842198810 | 2842203343 | 476 |
| 684 | iso_pu_bacteria | 2842205361 | 2842210370 | 476 |
| 685 | iso_pu_bacteria | 2842264693 | 2842269706 | 476 |
| 686 | iso_pu_bacteria | 2842278818 | 2842283824 | 476 |
| 687 | iso_pu_bacteria | 2842285085 | 2842290825 | 476 |
| 688 | iso_pu_bacteria | 2842311132 | 2842311683 | 476 |
| 689 | iso_pu_bacteria | 2842317721 | 2842319095 | 476 |
| 690 | iso_pu_bacteria | 2842341865 | 2842344081 | 476 |
| 691 | iso_pu_bacteria | 2842363717 | 2842369608 | 476 |
| 692 | iso_pu_bacteria | 2842395702 | 2842396440 | 476 |
| 693 | iso_pu_bacteria | 2842402390 | 2842408759 | 476 |
| 694 | iso_pu_bacteria | 2842409023 | 2842415412 | 476 |
| 695 | iso_pu_bacteria | 2842415677 | 2842422034 | 476 |
| 696 | iso_pu_bacteria | 2842422224 | 2842425523 | 476 |
| 697 | iso_pu_bacteria | 2842428310 | 2842432570 | 476 |
| 698 | iso_pu_bacteria | 2842434925 | 2842438983 | 476 |
| 699 | iso_pu_bacteria | 2842441272 | 2842445612 | 476 |
| 700 | iso_pu_bacteria | 2842447887 | 2842450063 | 476 |
| 701 | iso_pu_bacteria | 2842462802 | 2842468002 | 476 |
| 702 | iso_pu_bacteria | 2842469257 | 2842473597 | 476 |
| 703 | iso_pu_bacteria | 2842475841 | 2842479365 | 476 |
| 704 | iso_pu_bacteria | 2842495871 | 2842499612 | 476 |
| 705 | iso_pu_bacteria | 2842502639 | 2842506476 | 476 |
| 706 | iso_pu_bacteria | 2904497146 | 2904500186 | 476 |
| 707 | iso_pu_bacteria | 2904776348 | 2904777026 | 476 |
| 708 | iso_pu_bacteria | 2919408235 | 2919412577 | 476 |
| 709 | iso_pu_bacteria | 2996887358 | 2996889589 | 476 |
| 710 | iso_pu_bacteria | 3005416602 | 3005417336 | 476 |
| 711 | iso_pu_bacteria | 8005314921 | 8005320416 | 476 |
| 712 | iso_pu_bacteria | 8005321885 | 8005324116 | 476 |
| 713 | iso_pu_bacteria | 8005484373 | 8005487388 | 476 |
| 714 | iso_pu_bacteria | 8005645114 | 8005651074 | 476 |
| 715 | iso_pu_bacteria | 8005682033 | 8005684360 | 476 |
| 716 | iso_pu_bacteria | 8054160619 | 8054162492 | 476 |
| 717 | 3300006042 | Ga0075368_10002512 | Ga0075368_100025124 | 477 |
| 718 | 3300006178 | Ga0075367_10000224 | Ga0075367_100002245 | 477 |
| 719 | 3300014497 | Ga0182008_10002953 | Ga0182008_100029535 | 477 |
| 720 | 3300015262 | Ga0182007_10000552 | Ga0182007_1000055214 | 477 |
| 721 | 3300015688 | Ga0183367_1003 | Ga0183367_1003530 | 477 |
| 722 | 3300025303 | Ga0209051_1008810 | Ga0209051_10088104 | 477 |
| 723 | 3300030522 | Ga0307512_10007852 | Ga0307512_100078524 | 477 |
| 724 | 3300031616 | Ga0307508_10069406 | Ga0307508_100694063 | 477 |
| 725 | 3300031838 | Ga0307518_10000206 | Ga0307518_1000020626 | 477 |
| 726 | 3300042012 | Ga0439455_0000885 | Ga0439455_0000885_970_2424 | 477 |
| 727 | 3300042138 | Ga0450903_001397 | Ga0450903_001397_1484_2938 | 477 |
| 728 | 3300042157 | Ga0439458_0000085 | Ga0439458_0000085_15918_17372 | 477 |
| 729 | 3300045836 | Ga0466958_0001611 | Ga0466958_0001611_9198_10742 | 477 |
| 730 | 3300046535 | Ga0495586_0057727 | Ga0495586_0057727_408_1988 | 477 |
| 731 | 3300046794 | Ga0495589_0003485 | Ga0495589_0003485_583_2052 | 477 |
| 732 | 3300049572 | Ga0501036_0000951 | Ga0501036_0000951_10173_11636 | 477 |
| 733 | 3300050494 | nmdc:mga06z11_3132_c1 | nmdc:mga06z11_3132_c1_1799_3256 | 477 |
| 734 | iso_pu_bacteria | 2509276033 | 2509448367 | 477 |
| 735 | iso_pu_bacteria | 2582581313 | 2585304046 | 477 |
| 736 | iso_pu_bacteria | 2643221647 | 2644263809 | 477 |
| 737 | iso_pu_bacteria | 2784132148 | 2784591904 | 477 |
| 738 | iso_pu_bacteria | 2784746768 | 2785373129 | 477 |
| 739 | iso_pu_bacteria | 2786546132 | 2786674907 | 477 |
| 740 | iso_pu_bacteria | 2791355259 | 2793317350 | 477 |
| 741 | iso_pu_bacteria | 2808606448 | 2809235515 | 477 |
| 742 | iso_pu_bacteria | 2852635781 | 2852636061 | 477 |
| 743 | iso_pu_bacteria | 2867428634 | 2867430794 | 477 |
| 744 | iso_pu_bacteria | 2877676314 | 2877677769 | 477 |
| 745 | iso_pu_bacteria | 2912715099 | 2912716058 | 477 |
| 746 | iso_pu_bacteria | 2912723979 | 2912729014 | 477 |
| 747 | iso_pu_bacteria | 2919468124 | 2919470936 | 477 |
| 748 | iso_pu_bacteria | 2947224130 | 2947225481 | 477 |
| 749 | iso_pu_bacteria | 2954380949 | 2954382554 | 477 |
| 750 | iso_pu_bacteria | 2954673503 | 2954680495 | 477 |
| 751 | iso_pu_bacteria | 2954682443 | 2954683657 | 477 |
| 752 | iso_pu_bacteria | 2954691527 | 2954693352 | 477 |
| 753 | iso_pu_bacteria | 2954701450 | 2954708446 | 477 |
| 754 | iso_pu_bacteria | 3006393351 | 3006393973 | 477 |
| 755 | iso_pu_bacteria | 3006493962 | 3006494775 | 477 |
| 756 | iso_pu_bacteria | 8005619151 | 8005625299 | 477 |
| 757 | iso_pu_bacteria | 8008574985 | 8008575920 | 477 |
| 758 | iso_pu_bacteria | 8056829672 | 8056836053 | 477 |
| 759 | 3300006846 | Ga0075430_100146584 | Ga0075430_1001465842 | 478 |
| 760 | 3300037853 | Ga0436364_0423804 | Ga0436364_0423804_506_2014 | 478 |
| 761 | 3300046674 | Ga0495588_0003440 | Ga0495588_0003440_3187_4761 | 478 |
| 762 | 3300048915 | Ga0496112_0150397 | Ga0496112_0150397_307_1785 | 478 |
| 763 | 3300049571 | Ga0501034_0002524 | Ga0501034_0002524_99_1562 | 478 |
| 764 | 3300049572 | Ga0501036_0000952 | Ga0501036_0000952_2062_3525 | 478 |
| 765 | 3300049575 | Ga0501039_0010233 | Ga0501039_0010233_5644_7107 | 478 |
| 766 | 3300049579 | Ga0501043_0051108 | Ga0501043_0051108_34_1497 | 478 |
| 767 | 3300049586 | Ga0501070_0002167 | Ga0501070_0002167_7692_9155 | 478 |
| 768 | 3300049590 | Ga0501074_0006292 | Ga0501074_0006292_71_1534 | 478 |
| 769 | 3300049822 | Ga0501035_0003457 | Ga0501035_0003457_13576_15039 | 478 |
| 770 | 3300049823 | Ga0501044_0216947 | Ga0501044_0216947_315_1778 | 478 |
| 771 | iso_pu_bacteria | 2547132424 | 2548696753 | 478 |
| 772 | iso_pu_bacteria | 2615840624 | 2616295292 | 478 |
| 773 | iso_pu_bacteria | 2718217927 | 2719388522 | 478 |
| 774 | iso_pu_bacteria | 2718217997 | 2719668148 | 478 |
| 775 | iso_pu_bacteria | 2718218009 | 2719728311 | 478 |
| 776 | iso_pu_bacteria | 2718218199 | 2720494911 | 478 |
| 777 | iso_pu_bacteria | 2718218232 | 2720611231 | 478 |
| 778 | iso_pu_bacteria | 2718218233 | 2720616404 | 478 |
| 779 | iso_pu_bacteria | 2718218235 | 2720629478 | 478 |
| 780 | iso_pu_bacteria | 2718218269 | 2720772049 | 478 |
| 781 | iso_pu_bacteria | 2718218363 | 2721145172 | 478 |
| 782 | iso_pu_bacteria | 2718218365 | 2721155910 | 478 |
| 783 | iso_pu_bacteria | 2718218366 | 2721167259 | 478 |
| 784 | iso_pu_bacteria | 2718218423 | 2721403145 | 478 |
| 785 | iso_pu_bacteria | 2721755514 | 2722838237 | 478 |
| 786 | iso_pu_bacteria | 2721755556 | 2723029480 | 478 |
| 787 | iso_pu_bacteria | 2721755684 | 2723563095 | 478 |
| 788 | iso_pu_bacteria | 2721755685 | 2723571076 | 478 |
| 789 | iso_pu_bacteria | 2721755809 | 2724035502 | 478 |
| 790 | iso_pu_bacteria | 2721755810 | 2724042505 | 478 |
| 791 | iso_pu_bacteria | 2721755819 | 2724086869 | 478 |
| 792 | iso_pu_bacteria | 2721755822 | 2724107027 | 478 |
| 793 | iso_pu_bacteria | 2721755823 | 2724107837 | 478 |
| 794 | iso_pu_bacteria | 2728369352 | 2730105794 | 478 |
| 795 | iso_pu_bacteria | 2728369365 | 2730162010 | 478 |
| 796 | iso_pu_bacteria | 2728369397 | 2730301017 | 478 |
| 797 | iso_pu_bacteria | 2791355256 | 2793298982 | 478 |
| 798 | iso_pu_bacteria | 2791355260 | 2793323943 | 478 |
| 799 | iso_pu_bacteria | 2791355262 | 2793333162 | 478 |
| 800 | iso_pu_bacteria | 2791355263 | 2793340051 | 478 |
| 801 | iso_pu_bacteria | 2791355264 | 2793346344 | 478 |
| 802 | iso_pu_bacteria | 2791355265 | 2793355547 | 478 |
| 803 | iso_pu_bacteria | 2791355267 | 2793369793 | 478 |
| 804 | iso_pu_bacteria | 2862290372 | 2862293801 | 478 |
| 805 | iso_pu_bacteria | 2919059106 | 2919059437 | 478 |
| 806 | iso_pu_bacteria | 2919713450 | 2919717633 | 478 |
| 807 | iso_pu_bacteria | 2933599457 | 2933602684 | 478 |
| 808 | iso_pu_bacteria | 2936381700 | 2936386521 | 478 |
| 809 | iso_pu_bacteria | 2939647034 | 2939651204 | 478 |
| 810 | iso_pu_bacteria | 2954002825 | 2954008325 | 478 |
| 811 | iso_pu_bacteria | 8005275841 | 8005277238 | 478 |
| 812 | iso_pu_bacteria | 8005282627 | 8005287752 | 478 |
| 813 | iso_pu_bacteria | 8005289223 | 8005289321 | 478 |
| 814 | iso_pu_bacteria | 8005301065 | 8005304913 | 478 |
| 815 | iso_pu_bacteria | 8005382845 | 8005388749 | 478 |
| 816 | iso_pu_bacteria | 8005395548 | 8005397548 | 478 |
| 817 | iso_pu_bacteria | 8005430974 | 8005436909 | 478 |
| 818 | iso_pu_bacteria | 8005497431 | 8005503162 | 478 |
| 819 | iso_pu_bacteria | 8005626139 | 8005630702 | 478 |
| 820 | iso_pu_bacteria | 8005668836 | 8005675080 | 478 |
| 821 | iso_pu_bacteria | 8005695170 | 8005701848 | 478 |
| 822 | iso_pu_bacteria | 8018127388 | 8018127878 | 478 |
| 823 | iso_pu_bacteria | 8018176218 | 8018182315 | 478 |
| 824 | iso_pu_bacteria | 8023623736 | 8023631442 | 478 |
| 825 | iso_pu_bacteria | 8056375014 | 8056375084 | 478 |
| 826 | iso_pu_bacteria | 8056382006 | 8056383618 | 478 |
| 827 | 3300003323 | rootH1_10020478 | rootH1_100204785 | 479 |
| 828 | 3300005614 | Ga0068856_100011072 | Ga0068856_1000110726 | 479 |
| 829 | 3300005614 | Ga0068856_100064802 | Ga0068856_1000648023 | 479 |
| 830 | 3300009093 | Ga0105240_10000012 | Ga0105240_10000012383 | 479 |
| 831 | 3300009545 | Ga0105237_10034447 | Ga0105237_100344473 | 479 |
| 832 | 3300010375 | Ga0105239_10076423 | Ga0105239_100764232 | 479 |
| 833 | 3300011119 | Ga0105246_10077956 | Ga0105246_100779562 | 479 |
| 834 | 3300013104 | Ga0157370_10000078 | Ga0157370_100000784 | 479 |
| 835 | 3300015262 | Ga0182007_10000467 | Ga0182007_100004677 | 479 |
| 836 | 3300025228 | Ga0209672_105034 | Ga0209672_1050342 | 479 |
| 837 | 3300025253 | Ga0209677_100158 | Ga0209677_10015812 | 479 |
| 838 | 3300025261 | Ga0209233_1000161 | Ga0209233_100016183 | 479 |
| 839 | 3300025315 | Ga0207697_10002976 | Ga0207697_100029763 | 479 |
| 840 | 3300025904 | Ga0207647_10032327 | Ga0207647_100323272 | 479 |
| 841 | 3300025913 | Ga0207695_10000097 | Ga0207695_10000097175 | 479 |
| 842 | 3300025914 | Ga0207671_10000023 | Ga0207671_10000023257 | 479 |
| 843 | 3300025981 | Ga0207640_10063834 | Ga0207640_100638342 | 479 |
| 844 | 3300026078 | Ga0207702_10036199 | Ga0207702_100361992 | 479 |
| 845 | 3300026078 | Ga0207702_10150633 | Ga0207702_101506332 | 479 |
| 846 | 3300030522 | Ga0307512_10043303 | Ga0307512_100433032 | 479 |
| 847 | 3300031616 | Ga0307508_10038578 | Ga0307508_100385783 | 479 |
| 848 | 3300031649 | Ga0307514_10001738 | Ga0307514_100017389 | 479 |
| 849 | 3300037466 | Ga0395898_0048647 | Ga0395898_0048647_2028_3494 | 479 |
| 850 | 3300041404 | Ga0439436_0004122 | Ga0439436_0004122_1792_3315 | 479 |
| 851 | 3300041999 | Ga0439433_0006160 | Ga0439433_0006160_520_2043 | 479 |
| 852 | 3300042007 | Ga0439449_0013305 | Ga0439449_0013305_590_2113 | 479 |
| 853 | 3300042014 | Ga0439457_000374 | Ga0439457_000374_4375_5898 | 479 |
| 854 | 3300044658 | Ga0466972_0000697 | Ga0466972_0000697_5914_7380 | 479 |
| 855 | 3300044658 | Ga0466972_0002890 | Ga0466972_0002890_1380_2846 | 479 |
| 856 | 3300044684 | Ga0466966_0014776 | Ga0466966_0014776_2295_3755 | 479 |
| 857 | 3300044693 | Ga0466961_0020629 | Ga0466961_0020629_2463_3998 | 479 |
| 858 | 3300044693 | Ga0466961_0076304 | Ga0466961_0076304_71_1537 | 479 |
| 859 | 3300044719 | Ga0466971_0002086 | Ga0466971_0002086_3039_4499 | 479 |
| 860 | 3300044765 | Ga0466970_0001147 | Ga0466970_0001147_2516_3982 | 479 |
| 861 | 3300044765 | Ga0466970_0003166 | Ga0466970_0003166_2376_3836 | 479 |
| 862 | 3300044765 | Ga0466970_0005144 | Ga0466970_0005144_2978_4429 | 479 |
| 863 | 3300044901 | Ga0466960_0028193 | Ga0466960_0028193_616_2082 | 479 |
| 864 | 3300045049 | Ga0466959_0019321 | Ga0466959_0019321_2947_4407 | 479 |
| 865 | 3300045836 | Ga0466958_0003383 | Ga0466958_0003383_3929_5389 | 479 |
| 866 | 3300045836 | Ga0466958_0003456 | Ga0466958_0003456_2958_4409 | 479 |
| 867 | 3300045976 | Ga0466967_0016365 | Ga0466967_0016365_97_1557 | 479 |
| 868 | 3300046455 | Ga0495603_0075899 | Ga0495603_0075899_384_1850 | 479 |
| 869 | 3300046462 | Ga0495651_0089835 | Ga0495651_0089835_301_1767 | 479 |
| 870 | 3300046477 | Ga0495664_0024462 | Ga0495664_0024462_1655_3121 | 479 |
| 871 | 3300046492 | Ga0495585_0054994 | Ga0495585_0054994_426_1892 | 479 |
| 872 | 3300046499 | Ga0495594_0028964 | Ga0495594_0028964_251_1717 | 479 |
| 873 | 3300046507 | Ga0495606_0016139 | Ga0495606_0016139_856_2322 | 479 |
| 874 | 3300046513 | Ga0495616_0006775 | Ga0495616_0006775_4465_5931 | 479 |
| 875 | 3300046514 | Ga0495618_0051403 | Ga0495618_0051403_594_2060 | 479 |
| 876 | 3300046516 | Ga0495628_0079386 | Ga0495628_0079386_282_1748 | 479 |
| 877 | 3300046517 | Ga0495630_0078275 | Ga0495630_0078275_280_1752 | 479 |
| 878 | 3300046533 | Ga0495640_0023944 | Ga0495640_0023944_2937_4403 | 479 |
| 879 | 3300046543 | Ga0495645_0079914 | Ga0495645_0079914_641_2107 | 479 |
| 880 | 3300046557 | Ga0495622_0042990 | Ga0495622_0042990_384_1850 | 479 |
| 881 | 3300046679 | Ga0495623_0001555 | Ga0495623_0001555_3054_4526 | 479 |
| 882 | 3300046679 | Ga0495623_0037430 | Ga0495623_0037430_763_2229 | 479 |
| 883 | 3300046690 | Ga0495624_0015165 | Ga0495624_0015165_1018_2484 | 479 |
| 884 | 3300046794 | Ga0495589_0015969 | Ga0495589_0015969_1402_2868 | 479 |
| 885 | 3300046809 | Ga0495600_0014267 | Ga0495600_0014267_1230_2696 | 479 |
| 886 | 3300046809 | Ga0495600_0064174 | Ga0495600_0064174_328_1800 | 479 |
| 887 | 3300046810 | Ga0495660_0052408 | Ga0495660_0052408_341_1807 | 479 |
| 888 | 3300047317 | Ga0495604_0001987 | Ga0495604_0001987_10916_12388 | 479 |
| 889 | 3300047321 | Ga0495676_0104666 | Ga0495676_0104666_499_1965 | 479 |
| 890 | 3300047322 | Ga0495680_0014506 | Ga0495680_0014506_4147_5613 | 479 |
| 891 | 3300047444 | Ga0495675_0070964 | Ga0495675_0070964_22_1488 | 479 |
| 892 | 3300047447 | Ga0495685_006104 | Ga0495685_006104_1298_2764 | 479 |
| 893 | 3300047471 | Ga0495684_0089737 | Ga0495684_0089737_527_1993 | 479 |
| 894 | 3300047673 | Ga0495593_0040956 | Ga0495593_0040956_205_1671 | 479 |
| 895 | 3300048906 | Ga0496103_0003246 | Ga0496103_0003246_4304_5755 | 479 |
| 896 | 3300048909 | Ga0496106_0042915 | Ga0496106_0042915_1729_3231 | 479 |
| 897 | 3300048920 | Ga0496117_0002025 | Ga0496117_0002025_14776_16227 | 479 |
| 898 | 3300048921 | Ga0496118_0003588 | Ga0496118_0003588_8266_9717 | 479 |
| 899 | 3300048921 | Ga0496118_0004643 | Ga0496118_0004643_10789_12348 | 479 |
| 900 | 3300048923 | Ga0496120_0021217 | Ga0496120_0021217_1929_3380 | 479 |
| 901 | 3300048926 | Ga0496123_0019254 | Ga0496123_0019254_1912_3363 | 479 |
| 902 | 3300048927 | Ga0496124_0006099 | Ga0496124_0006099_372_1823 | 479 |
| 903 | 3300048928 | Ga0496125_0007198 | Ga0496125_0007198_1579_3030 | 479 |
| 904 | 3300049569 | Ga0501032_0114679 | Ga0501032_0114679_291_1757 | 479 |
| 905 | 3300049571 | Ga0501034_0027798 | Ga0501034_0027798_3128_4594 | 479 |
| 906 | 3300049574 | Ga0501038_0014219 | Ga0501038_0014219_3437_4903 | 479 |
| 907 | 3300049574 | Ga0501038_0026353 | Ga0501038_0026353_3655_5121 | 479 |
| 908 | 3300049581 | Ga0501047_0036860 | Ga0501047_0036860_2861_4327 | 479 |
| 909 | 3300049742 | Ga0501080_0031536 | Ga0501080_0031536_2563_4029 | 479 |
| 910 | 3300049822 | Ga0501035_0060475 | Ga0501035_0060475_1816_3282 | 479 |
| 911 | 3300049823 | Ga0501044_0008984 | Ga0501044_0008984_1620_3089 | 479 |
| 912 | 3300049823 | Ga0501044_0036839 | Ga0501044_0036839_291_1757 | 479 |
| 913 | 3300060344 | Ga0587071_009129 | Ga0587071_009129_48_1562 | 479 |
| 914 | 3300061719 | Ga0466962_0013373 | Ga0466962_0013373_1692_3152 | 479 |
| 915 | iso_pu_bacteria | 2537561587 | 2537872925 | 479 |
| 916 | iso_pu_bacteria | 2547132111 | 2547412146 | 479 |
| 917 | iso_pu_bacteria | 2554235003 | 2554245161 | 479 |
| 918 | iso_pu_bacteria | 2558860242 | 2559297008 | 479 |
| 919 | iso_pu_bacteria | 2599185210 | 2599605078 | 479 |
| 920 | iso_pu_bacteria | 2600255279 | 2601611145 | 479 |
| 921 | iso_pu_bacteria | 2600255308 | 2601747918 | 479 |
| 922 | iso_pu_bacteria | 2616644814 | 2616698997 | 479 |
| 923 | iso_pu_bacteria | 2643221693 | 2644521251 | 479 |
| 924 | iso_pu_bacteria | 2808606387 | 2808989031 | 479 |
| 925 | iso_pu_bacteria | 2811994879 | 2812354439 | 479 |
| 926 | iso_pu_bacteria | 2818991439 | 2819557158 | 479 |
| 927 | iso_pu_bacteria | 2838675328 | 2838678304 | 479 |
| 928 | iso_pu_bacteria | 2838714209 | 2838716790 | 479 |
| 929 | iso_pu_bacteria | 2838719591 | 2838722600 | 479 |
| 930 | iso_pu_bacteria | 2838724970 | 2838727539 | 479 |
| 931 | iso_pu_bacteria | 2841846520 | 2841849145 | 479 |
| 932 | iso_pu_bacteria | 2841859092 | 2841861794 | 479 |
| 933 | iso_pu_bacteria | 2842124991 | 2842128106 | 479 |
| 934 | iso_pu_bacteria | 2842130223 | 2842133197 | 479 |
| 935 | iso_pu_bacteria | 2842152218 | 2842155191 | 479 |
| 936 | iso_pu_bacteria | 2842170452 | 2842173690 | 479 |
| 937 | iso_pu_bacteria | 2842175837 | 2842178812 | 479 |
| 938 | iso_pu_bacteria | 2842187318 | 2842189897 | 479 |
| 939 | iso_pu_bacteria | 2842211629 | 2842214211 | 479 |
| 940 | iso_pu_bacteria | 2842224351 | 2842226930 | 479 |
| 941 | iso_pu_bacteria | 2842515876 | 2842517940 | 479 |
| 942 | iso_pu_bacteria | 2867475112 | 2867476033 | 479 |
| 943 | iso_pu_bacteria | 2899792073 | 2899792884 | 479 |
| 944 | iso_pu_bacteria | 2899845264 | 2899845391 | 479 |
| 945 | iso_pu_bacteria | 2919114240 | 2919116981 | 479 |
| 946 | iso_pu_bacteria | 2926754445 | 2926758494 | 479 |
| 947 | iso_pu_bacteria | 2926760298 | 2926763974 | 479 |
| 948 | iso_pu_bacteria | 2933006813 | 2933009430 | 479 |
| 949 | iso_pu_bacteria | 2933011516 | 2933013569 | 479 |
| 950 | iso_pu_bacteria | 2933594066 | 2933598178 | 479 |
| 951 | iso_pu_bacteria | 2946064051 | 2946071264 | 479 |
| 952 | iso_pu_bacteria | 2954711539 | 2954713060 | 479 |
| 953 | iso_pu_bacteria | 2954721474 | 2954723020 | 479 |
| 954 | iso_pu_bacteria | 2954731030 | 2954738809 | 479 |
| 955 | iso_pu_bacteria | 2954740390 | 2954741929 | 479 |
| 956 | iso_pu_bacteria | 2954749733 | 2954757669 | 479 |
| 957 | iso_pu_bacteria | 2954759201 | 2954760906 | 479 |
| 958 | iso_pu_bacteria | 2979089926 | 2979090928 | 479 |
| 959 | iso_pu_bacteria | 2979095461 | 2979096453 | 479 |
| 960 | iso_pu_bacteria | 2979100975 | 2979102189 | 479 |
| 961 | iso_pu_bacteria | 2984509177 | 2984509862 | 479 |
| 962 | iso_pu_bacteria | 2984518228 | 2984519441 | 479 |
| 963 | iso_pu_bacteria | 2984537506 | 2984538201 | 479 |
| 964 | iso_pu_bacteria | 2984601300 | 2984604953 | 479 |
| 965 | iso_pu_bacteria | 2997451912 | 2997455168 | 479 |
| 966 | iso_pu_bacteria | 3002998708 | 3003001700 | 479 |
| 967 | iso_pu_bacteria | 650716007 | 650843434 | 479 |
| 968 | iso_pu_bacteria | 8004182704 | 8004184680 | 479 |
| 969 | iso_pu_bacteria | 8054160619 | 8054166223 | 479 |
| 970 | 3300009036 | Ga0105244_10031860 | Ga0105244_100318602 | 480 |
| 971 | 3300025728 | Ga0207655_1043696 | Ga0207655_10436961 | 480 |
| 972 | 3300046473 | Ga0495582_0060366 | Ga0495582_0060366_432_2000 | 480 |
| 973 | 3300046477 | Ga0495664_0027542 | Ga0495664_0027542_1560_3128 | 480 |
| 974 | 3300046499 | Ga0495594_0036708 | Ga0495594_0036708_691_2259 | 480 |
| 975 | 3300046531 | Ga0495665_0007776 | Ga0495665_0007776_3151_4719 | 480 |
| 976 | 3300046535 | Ga0495586_0009888 | Ga0495586_0009888_1493_3061 | 480 |
| 977 | 3300046536 | Ga0495587_0012618 | Ga0495587_0012618_1076_2644 | 480 |
| 978 | 3300046543 | Ga0495645_0006857 | Ga0495645_0006857_853_2421 | 480 |
| 979 | 3300046559 | Ga0495667_0003973 | Ga0495667_0003973_5005_6573 | 480 |
| 980 | 3300046679 | Ga0495623_0017148 | Ga0495623_0017148_1750_3318 | 480 |
| 981 | 3300046809 | Ga0495600_0028844 | Ga0495600_0028844_408_1976 | 480 |
| 982 | 3300047315 | Ga0495581_0023949 | Ga0495581_0023949_1320_2888 | 480 |
| 983 | 3300047317 | Ga0495604_0065020 | Ga0495604_0065020_20_1588 | 480 |
| 984 | 3300047444 | Ga0495675_0009185 | Ga0495675_0009185_683_2251 | 480 |
| 985 | iso_pu_bacteria | 2510917022 | 2511132629 | 480 |
| 986 | iso_pu_bacteria | 2582581307 | 2585275559 | 480 |
| 987 | iso_pu_bacteria | 2585427531 | 2585562585 | 480 |
| 988 | iso_pu_bacteria | 2585427608 | 2585899254 | 480 |
| 989 | iso_pu_bacteria | 2585427609 | 2585906247 | 480 |
| 990 | iso_pu_bacteria | 2585428125 | 2587981669 | 480 |
| 991 | iso_pu_bacteria | 2643221582 | 2643916884 | 480 |
| 992 | iso_pu_bacteria | 2784132109 | 2784471225 | 480 |
| 993 | iso_pu_bacteria | 2910809715 | 2910811841 | 480 |
| 994 | iso_pu_bacteria | 2974315732 | 2974316512 | 480 |
| 995 | iso_pu_bacteria | 2984523437 | 2984524685 | 480 |
| 996 | iso_pu_bacteria | 2984576629 | 2984578005 | 480 |
| 997 | iso_pu_bacteria | 2990256926 | 2990257519 | 480 |
| 998 | iso_pu_bacteria | 8003570095 | 8003573029 | 480 |
| 999 | 3300002773 | JGI25152J39213_1001657 | JGI25152J39213_10016576 | 481 |
| 1000 | 3300006042 | Ga0075368_10002845 | Ga0075368_100028457 | 481 |
| 1001 | 3300006048 | Ga0075363_100000269 | Ga0075363_10000026913 | 481 |
| 1002 | 3300006177 | Ga0075362_10001446 | Ga0075362_100014466 | 481 |
| 1003 | 3300006186 | Ga0075369_10010268 | Ga0075369_100102685 | 481 |
| 1004 | 3300006186 | Ga0075369_10031488 | Ga0075369_100314881 | 481 |
| 1005 | 3300006948 | Ga0099826_10000059 | Ga0099826_1000005928 | 481 |
| 1006 | 3300006948 | Ga0099826_10033794 | Ga0099826_100337942 | 481 |
| 1007 | 3300025258 | Ga0209129_1000180 | Ga0209129_10001809 | 481 |
| 1008 | 3300025294 | Ga0209025_1000255 | Ga0209025_1000255111 | 481 |
| 1009 | 3300025294 | Ga0209025_1001712 | Ga0209025_10017122 | 481 |
| 1010 | 3300027312 | Ga0209371_1000003 | Ga0209371_1000003825 | 481 |
| 1011 | 3300027312 | Ga0209371_1001534 | Ga0209371_10015345 | 481 |
| 1012 | 3300027666 | Ga0209282_1000502 | Ga0209282_100050211 | 481 |
| 1013 | 3300028379 | Ga0268266_10015356 | Ga0268266_100153565 | 481 |
| 1014 | 3300030500 | Ga0268256_1000004 | Ga0268256_1000004225 | 481 |
| 1015 | 3300030500 | Ga0268256_1014568 | Ga0268256_10145683 | 481 |
| 1016 | 3300030744 | Ga0316181_1263973 | Ga0316181_12639732 | 481 |
| 1017 | 3300037418 | Ga0395900_0056878 | Ga0395900_0056878_365_1852 | 481 |
| 1018 | 3300046535 | Ga0495586_0094107 | Ga0495586_0094107_160_1647 | 481 |
| 1019 | 3300047323 | Ga0495683_0000192 | Ga0495683_0000192_40741_42210 | 481 |
| 1020 | 3300048920 | Ga0496117_0056492 | Ga0496117_0056492_1158_2615 | 481 |
| 1021 | 3300048921 | Ga0496118_0042228 | Ga0496118_0042228_1202_2659 | 481 |
| 1022 | 3300050490 | nmdc:mga03n38_4590_c1 | nmdc:mga03n38_4590_c1_414_1880 | 481 |
| 1023 | 3300050491 | nmdc:mga00v17_61394_c1 | nmdc:mga00v17_61394_c1_180_1703 | 481 |
| 1024 | 3300059477 | Ga0587084_004059 | Ga0587084_004059_12_1463 | 481 |
| 1025 | 3300059505 | Ga0587083_0008002 | Ga0587083_0008002_156_1607 | 481 |
| 1026 | 3300059508 | Ga0587088_005574 | Ga0587088_005574_193_1644 | 481 |
| 1027 | 3300059510 | Ga0587090_000982 | Ga0587090_000982_1064_2515 | 481 |
| 1028 | 3300059511 | Ga0587091_002210 | Ga0587091_002210_630_2081 | 481 |
| 1029 | 3300059639 | Ga0587062_000796 | Ga0587062_000796_780_2231 | 481 |
| 1030 | 3300059643 | Ga0587072_002733 | Ga0587072_002733_199_1650 | 481 |
| 1031 | iso_pu_bacteria | 2509276019 | 2509376017 | 481 |
| 1032 | iso_pu_bacteria | 2558860100 | 2558862019 | 481 |
| 1033 | iso_pu_bacteria | 2744054900 | 2746087974 | 481 |
| 1034 | iso_pu_bacteria | 2744054901 | 2746097531 | 481 |
| 1035 | iso_pu_bacteria | 2758568016 | 2758639916 | 481 |
| 1036 | iso_pu_bacteria | 2775506735 | 2775657603 | 481 |
| 1037 | iso_pu_bacteria | 2808606357 | 2808829880 | 481 |
| 1038 | iso_pu_bacteria | 2808606360 | 2808851057 | 481 |
| 1039 | iso_pu_bacteria | 2808606370 | 2808894161 | 481 |
| 1040 | iso_pu_bacteria | 2808606371 | 2808897946 | 481 |
| 1041 | iso_pu_bacteria | 2811994871 | 2812318421 | 481 |
| 1042 | iso_pu_bacteria | 2850079185 | 2850083961 | 481 |
| 1043 | iso_pu_bacteria | 2945916053 | 2945916171 | 481 |
| 1044 | iso_pu_bacteria | 2945956166 | 2945959239 | 481 |
| 1045 | iso_pu_bacteria | 2946037020 | 2946040534 | 481 |
| 1046 | iso_pu_bacteria | 2946059875 | 2946059982 | 481 |
| 1047 | iso_pu_bacteria | 8056447290 | 8056451620 | 481 |
| 1048 | iso_pu_bacteria | 8056667051 | 8056673503 | 481 |
| 1049 | 3300003752 | Ga0055539_1000019 | Ga0055539_1000019201 | 482 |
| 1050 | 3300003756 | Ga0055533_1000023 | Ga0055533_1000023124 | 482 |
| 1051 | 3300003759 | Ga0055525_1000088 | Ga0055525_100008847 | 482 |
| 1052 | 3300003841 | Ga0055541_1002437 | Ga0055541_10024371 | 482 |
| 1053 | 3300025315 | Ga0207697_10010229 | Ga0207697_100102292 | 482 |
| 1054 | 3300031548 | Ga0307408_100027030 | Ga0307408_1000270302 | 482 |
| 1055 | 3300037418 | Ga0395900_0029516 | Ga0395900_0029516_1782_3296 | 482 |
| 1056 | 3300044765 | Ga0466970_0032398 | Ga0466970_0032398_993_2564 | 482 |
| 1057 | 3300045049 | Ga0466959_0043937 | Ga0466959_0043937_565_2136 | 482 |
| 1058 | iso_pu_bacteria | 2513237159 | 2513999219 | 482 |
| 1059 | iso_pu_bacteria | 2643221568 | 2643858020 | 482 |
| 1060 | iso_pu_bacteria | 2751185800 | 2753357415 | 482 |
| 1061 | iso_pu_bacteria | 2757320536 | 2758225455 | 482 |
| 1062 | iso_pu_bacteria | 2842521101 | 2842524966 | 482 |
| 1063 | iso_pu_bacteria | 2844849076 | 2844850572 | 482 |
| 1064 | iso_pu_bacteria | 2854911287 | 2854913429 | 482 |
| 1065 | iso_pu_bacteria | 2854916844 | 2854921109 | 482 |
| 1066 | iso_pu_bacteria | 2857740372 | 2857744851 | 482 |
| 1067 | iso_pu_bacteria | 2904497146 | 2904499116 | 482 |
| 1068 | iso_pu_bacteria | 2904776348 | 2904780606 | 482 |
| 1069 | iso_pu_bacteria | 2910809715 | 2910811436 | 482 |
| 1070 | iso_pu_bacteria | 2919034639 | 2919039088 | 482 |
| 1071 | iso_pu_bacteria | 2919166419 | 2919171016 | 482 |
| 1072 | iso_pu_bacteria | 2919538618 | 2919541319 | 482 |
| 1073 | iso_pu_bacteria | 2932426870 | 2932430170 | 482 |
| 1074 | iso_pu_bacteria | 2933418574 | 2933422143 | 482 |
| 1075 | iso_pu_bacteria | 2939674588 | 2939678951 | 482 |
| 1076 | iso_pu_bacteria | 2966924647 | 2966926360 | 482 |
| 1077 | iso_pu_bacteria | 2978969890 | 2978970447 | 482 |
| 1078 | iso_pu_bacteria | 2984587000 | 2984587478 | 482 |
| 1079 | iso_pu_bacteria | 8054460903 | 8054463608 | 482 |
| 1080 | 3300011119 | Ga0105246_10004731 | Ga0105246_100047316 | 483 |
| 1081 | 3300013100 | Ga0157373_10023542 | Ga0157373_100235422 | 483 |
| 1082 | 3300013102 | Ga0157371_10000002 | Ga0157371_1000000238 | 483 |
| 1083 | 3300013104 | Ga0157370_10001455 | Ga0157370_1000145515 | 483 |
| 1084 | 3300031548 | Ga0307408_100085182 | Ga0307408_1000851822 | 483 |
| 1085 | 3300046674 | Ga0495588_0048544 | Ga0495588_0048544_299_1840 | 483 |
| 1086 | 3300047470 | Ga0495681_0010307 | Ga0495681_0010307_383_2053 | 483 |
| 1087 | 3300048919 | Ga0496116_0015029 | Ga0496116_0015029_810_2375 | 483 |
| 1088 | 3300048920 | Ga0496117_0000052 | Ga0496117_0000052_117844_119517 | 483 |
| 1089 | 3300048921 | Ga0496118_0000432 | Ga0496118_0000432_13918_15591 | 483 |
| 1090 | 3300048922 | Ga0496119_0055959 | Ga0496119_0055959_263_1828 | 483 |
| 1091 | 3300048923 | Ga0496120_0000019 | Ga0496120_0000019_117844_119517 | 483 |
| 1092 | 3300048925 | Ga0496122_0000053 | Ga0496122_0000053_117844_119517 | 483 |
| 1093 | 3300048926 | Ga0496123_0000038 | Ga0496123_0000038_117844_119517 | 483 |
| 1094 | 3300050489 | nmdc:mga03683_132_c1 | nmdc:mga03683_132_c1_693_2258 | 483 |
| 1095 | 3300050491 | nmdc:mga00v17_11_c1 | nmdc:mga00v17_11_c1_3802_5367 | 483 |
| 1096 | 3300050492 | nmdc:mga0yw44_96_c1 | nmdc:mga0yw44_96_c1_17889_19454 | 483 |
| 1097 | 3300050494 | nmdc:mga06z11_14488_c1 | nmdc:mga06z11_14488_c1_484_2049 | 483 |
| 1098 | 3300050495 | nmdc:mga04h51_6837_c1 | nmdc:mga04h51_6837_c1_484_2049 | 483 |
| 1099 | 3300050516 | nmdc:mga0sz30_485_c1 | nmdc:mga0sz30_485_c1_5497_7062 | 483 |
| 1100 | 3300053137 | Ga0500561_0000033 | Ga0500561_0000033_15642_17207 | 483 |
| 1101 | iso_pu_bacteria | 2919051321 | 2919055147 | 483 |
| 1102 | iso_pu_bacteria | 2919059106 | 2919060900 | 483 |
| 1103 | iso_pu_bacteria | 2929138655 | 2929143285 | 483 |
| 1104 | iso_pu_bacteria | 2939647034 | 2939651245 | 483 |
| 1105 | iso_pu_bacteria | 2974294766 | 2974295645 | 483 |
| 1106 | iso_pu_bacteria | 2974324384 | 2974324552 | 483 |
| 1107 | 3300005288 | Ga0065714_10004525 | Ga0065714_100045251 | 484 |
| 1108 | 3300005328 | Ga0070676_10001857 | Ga0070676_100018573 | 484 |
| 1109 | 3300005331 | Ga0070670_100049013 | Ga0070670_1000490133 | 484 |
| 1110 | 3300005331 | Ga0070670_100056374 | Ga0070670_1000563742 | 484 |
| 1111 | 3300005353 | Ga0070669_100010732 | Ga0070669_1000107323 | 484 |
| 1112 | 3300005354 | Ga0070675_100012523 | Ga0070675_1000125234 | 484 |
| 1113 | 3300005355 | Ga0070671_100047239 | Ga0070671_1000472392 | 484 |
| 1114 | 3300006051 | Ga0075364_10000193 | Ga0075364_1000019317 | 484 |
| 1115 | 3300006058 | Ga0075432_10005837 | Ga0075432_100058373 | 484 |
| 1116 | 3300009011 | Ga0105251_10015859 | Ga0105251_100158591 | 484 |
| 1117 | 3300009036 | Ga0105244_10013325 | Ga0105244_100133254 | 484 |
| 1118 | 3300009098 | Ga0105245_10087458 | Ga0105245_100874582 | 484 |
| 1119 | 3300011119 | Ga0105246_10031207 | Ga0105246_100312072 | 484 |
| 1120 | 3300013306 | Ga0163162_10084787 | Ga0163162_100847873 | 484 |
| 1121 | 3300021327 | Ga0214543_1003948 | Ga0214543_10039488 | 484 |
| 1122 | 3300025728 | Ga0207655_1017637 | Ga0207655_10176373 | 484 |
| 1123 | 3300025735 | Ga0207713_1025983 | Ga0207713_10259832 | 484 |
| 1124 | 3300025893 | Ga0207682_10005202 | Ga0207682_100052022 | 484 |
| 1125 | 3300025907 | Ga0207645_10001051 | Ga0207645_1000105112 | 484 |
| 1126 | 3300025925 | Ga0207650_10005626 | Ga0207650_100056267 | 484 |
| 1127 | 3300025926 | Ga0207659_10007512 | Ga0207659_100075123 | 484 |
| 1128 | 3300025927 | Ga0207687_10135981 | Ga0207687_101359811 | 484 |
| 1129 | 3300025935 | Ga0207709_10084128 | Ga0207709_100841282 | 484 |
| 1130 | 3300025937 | Ga0207669_10013591 | Ga0207669_100135912 | 484 |
| 1131 | 3300025940 | Ga0207691_10012886 | Ga0207691_100128864 | 484 |
| 1132 | 3300026121 | Ga0207683_10006658 | Ga0207683_100066585 | 484 |
| 1133 | 3300031824 | Ga0307413_10017362 | Ga0307413_100173622 | 484 |
| 1134 | 3300031852 | Ga0307410_10002024 | Ga0307410_100020244 | 484 |
| 1135 | 3300031911 | Ga0307412_10003191 | Ga0307412_100031916 | 484 |
| 1136 | 3300041404 | Ga0439436_0000195 | Ga0439436_0000195_1880_3355 | 484 |
| 1137 | 3300041411 | Ga0439466_0008105 | Ga0439466_0008105_1584_3098 | 484 |
| 1138 | 3300041413 | Ga0439465_0001310 | Ga0439465_0001310_3508_4983 | 484 |
| 1139 | 3300041413 | Ga0439465_0004124 | Ga0439465_0004124_2741_4255 | 484 |
| 1140 | 3300041999 | Ga0439433_0004144 | Ga0439433_0004144_1270_2784 | 484 |
| 1141 | 3300042007 | Ga0439449_0001574 | Ga0439449_0001574_4290_5804 | 484 |
| 1142 | 3300046475 | Ga0495639_0030573 | Ga0495639_0030573_25_1539 | 484 |
| 1143 | 3300046476 | Ga0495662_0006897 | Ga0495662_0006897_97_1611 | 484 |
| 1144 | 3300046477 | Ga0495664_0008887 | Ga0495664_0008887_24_1538 | 484 |
| 1145 | 3300046536 | Ga0495587_0003374 | Ga0495587_0003374_1573_3087 | 484 |
| 1146 | 3300046543 | Ga0495645_0004124 | Ga0495645_0004124_7501_9015 | 484 |
| 1147 | 3300046559 | Ga0495667_0005045 | Ga0495667_0005045_6169_7683 | 484 |
| 1148 | 3300046675 | Ga0495657_0032047 | Ga0495657_0032047_161_1675 | 484 |
| 1149 | 3300047315 | Ga0495581_0024488 | Ga0495581_0024488_1167_2681 | 484 |
| 1150 | 3300047317 | Ga0495604_0035514 | Ga0495604_0035514_2312_3826 | 484 |
| 1151 | 3300047319 | Ga0495674_0190311 | Ga0495674_0190311_155_1669 | 484 |
| 1152 | 3300048903 | Ga0496100_0086666 | Ga0496100_0086666_134_1648 | 484 |
| 1153 | 3300048904 | Ga0496101_0013834 | Ga0496101_0013834_2658_4172 | 484 |
| 1154 | 3300048905 | Ga0496102_0116561 | Ga0496102_0116561_256_1770 | 484 |
| 1155 | 3300048906 | Ga0496103_0005572 | Ga0496103_0005572_1679_3181 | 484 |
| 1156 | 3300048906 | Ga0496103_0093038 | Ga0496103_0093038_256_1770 | 484 |
| 1157 | 3300048907 | Ga0496104_0022013 | Ga0496104_0022013_2020_3534 | 484 |
| 1158 | 3300048908 | Ga0496105_0016719 | Ga0496105_0016719_359_1873 | 484 |
| 1159 | 3300048909 | Ga0496106_0091902 | Ga0496106_0091902_67_1581 | 484 |
| 1160 | 3300048910 | Ga0496107_0023999 | Ga0496107_0023999_908_2422 | 484 |
| 1161 | 3300048911 | Ga0496108_0024226 | Ga0496108_0024226_3408_4922 | 484 |
| 1162 | 3300048911 | Ga0496108_0044250 | Ga0496108_0044250_1472_2986 | 484 |
| 1163 | 3300048911 | Ga0496108_0085898 | Ga0496108_0085898_237_1754 | 484 |
| 1164 | 3300048912 | Ga0496109_0105305 | Ga0496109_0105305_908_2422 | 484 |
| 1165 | 3300048913 | Ga0496110_0147545 | Ga0496110_0147545_256_1770 | 484 |
| 1166 | 3300048914 | Ga0496111_0073280 | Ga0496111_0073280_67_1581 | 484 |
| 1167 | 3300048916 | Ga0496113_0056348 | Ga0496113_0056348_908_2422 | 484 |
| 1168 | 3300048917 | Ga0496114_0019171 | Ga0496114_0019171_3252_4766 | 484 |
| 1169 | 3300048918 | Ga0496115_0088507 | Ga0496115_0088507_541_2055 | 484 |
| 1170 | 3300048924 | Ga0496121_0000337 | Ga0496121_0000337_52085_53560 | 484 |
| 1171 | 3300048927 | Ga0496124_0028720 | Ga0496124_0028720_626_2140 | 484 |
| 1172 | 3300050491 | nmdc:mga00v17_178_c1 | nmdc:mga00v17_178_c1_17185_18660 | 484 |
| 1173 | 3300053157 | Ga0500624_000520 | Ga0500624_000520_5571_7175 | 484 |
| 1174 | 3300053161 | Ga0500634_0003753 | Ga0500634_0003753_315_1790 | 484 |
| 1175 | 3300053177 | Ga0500636_0000039 | Ga0500636_0000039_53052_54521 | 484 |
| 1176 | 3300059514 | Ga0587095_000115 | Ga0587095_000115_1552_3078 | 484 |
| 1177 | iso_pu_bacteria | 2690315906 | 2691511824 | 484 |
| 1178 | iso_pu_bacteria | 2773857759 | 2774383207 | 484 |
| 1179 | iso_pu_bacteria | 2773857762 | 2774397213 | 484 |
| 1180 | iso_pu_bacteria | 2775506735 | 2775657246 | 484 |
| 1181 | iso_pu_bacteria | 2808606357 | 2808829010 | 484 |
| 1182 | iso_pu_bacteria | 2808606360 | 2808850235 | 484 |
| 1183 | iso_pu_bacteria | 2808606366 | 2808877212 | 484 |
| 1184 | iso_pu_bacteria | 2808606370 | 2808893254 | 484 |
| 1185 | iso_pu_bacteria | 2808606371 | 2808898671 | 484 |
| 1186 | iso_pu_bacteria | 2811994871 | 2812319253 | 484 |
| 1187 | iso_pu_bacteria | 2945916053 | 2945917006 | 484 |
| 1188 | iso_pu_bacteria | 2945920336 | 2945922746 | 484 |
| 1189 | iso_pu_bacteria | 2945920336 | 2945923720 | 484 |
| 1190 | iso_pu_bacteria | 2946024296 | 2946024944 | 484 |
| 1191 | iso_pu_bacteria | 2946037020 | 2946041569 | 484 |
| 1192 | iso_pu_bacteria | 2946059875 | 2946060836 | 484 |
| 1193 | iso_pu_bacteria | 2953998280 | 2954001794 | 484 |
| 1194 | iso_pu_bacteria | 2953998280 | 2954002770 | 484 |
| 1195 | iso_pu_bacteria | 2974302888 | 2974305010 | 484 |
| 1196 | iso_pu_bacteria | 2974302888 | 2974305418 | 484 |
| 1197 | iso_pu_bacteria | 2997451912 | 2997452375 | 484 |
| 1198 | 3300003323 | rootH1_10072379 | rootH1_100723798 | 485 |
| 1199 | 3300005327 | Ga0070658_10155017 | Ga0070658_101550172 | 485 |
| 1200 | 3300025253 | Ga0209677_102523 | Ga0209677_1025233 | 485 |
| 1201 | 3300031731 | Ga0307405_10068937 | Ga0307405_100689371 | 485 |
| 1202 | 3300031903 | Ga0307407_10063097 | Ga0307407_100630972 | 485 |
| 1203 | 3300037312 | Ga0395899_0010636 | Ga0395899_0010636_1752_3320 | 485 |
| 1204 | 3300037466 | Ga0395898_0007917 | Ga0395898_0007917_9647_11185 | 485 |
| 1205 | 3300039437 | Ga0436365_1804934 | Ga0436365_1804934_36_1592 | 485 |
| 1206 | 3300042002 | Ga0439442_000315 | Ga0439442_000315_2944_4518 | 485 |
| 1207 | 3300044765 | Ga0466970_0007014 | Ga0466970_0007014_1269_2804 | 485 |
| 1208 | 3300046615 | Ga0495656_0004570 | Ga0495656_0004570_1883_3406 | 485 |
| 1209 | 3300048925 | Ga0496122_0005506 | Ga0496122_0005506_3412_4881 | 485 |
| 1210 | 3300048928 | Ga0496125_0000358 | Ga0496125_0000358_36082_37551 | 485 |
| 1211 | 3300049569 | Ga0501032_0003609 | Ga0501032_0003609_7069_8583 | 485 |
| 1212 | 3300049573 | Ga0501037_0070992 | Ga0501037_0070992_304_1818 | 485 |
| 1213 | 3300049823 | Ga0501044_0117842 | Ga0501044_0117842_911_2425 | 485 |
| 1214 | 3300050507 | nmdc:mga05p37_174620_c1 | nmdc:mga05p37_174620_c1_376_1917 | 485 |
| 1215 | 3300059508 | Ga0587088_001153 | Ga0587088_001153_32_1546 | 485 |
| 1216 | 3300059510 | Ga0587090_000138 | Ga0587090_000138_1506_3047 | 485 |
| 1217 | 3300059604 | Ga0587098_000351 | Ga0587098_000351_1115_2635 | 485 |
| 1218 | 3300059626 | Ga0587115_000278 | Ga0587115_000278_182_1723 | 485 |
| 1219 | 3300059630 | Ga0587128_000022 | Ga0587128_000022_3311_4852 | 485 |
| 1220 | 3300059660 | Ga0587124_000008 | Ga0587124_000008_1282_2823 | 485 |
| 1221 | iso_pu_bacteria | 2690315906 | 2691512637 | 485 |
| 1222 | iso_pu_bacteria | 2773857758 | 2774379589 | 485 |
| 1223 | iso_pu_bacteria | 2904430863 | 2904434036 | 485 |
| 1224 | iso_pu_bacteria | 2904509784 | 2904512970 | 485 |
| 1225 | iso_pu_bacteria | 2908674828 | 2908676789 | 485 |
| 1226 | iso_pu_bacteria | 2908678064 | 2908679388 | 485 |
| 1227 | iso_pu_bacteria | 2909074476 | 2909077018 | 485 |
| 1228 | iso_pu_bacteria | 2919039151 | 2919039630 | 485 |
| 1229 | iso_pu_bacteria | 2919069694 | 2919070027 | 485 |
| 1230 | iso_pu_bacteria | 2928500415 | 2928503328 | 485 |
| 1231 | iso_pu_bacteria | 2945956166 | 2945956222 | 485 |
| 1232 | iso_pu_bacteria | 2977228692 | 2977229585 | 485 |
| 1233 | iso_pu_bacteria | 2977236895 | 2977238368 | 485 |
| 1234 | iso_pu_bacteria | 2984542743 | 2984543851 | 485 |
| 1235 | iso_pu_bacteria | 8054107350 | 8054108883 | 485 |
| 1236 | 3300003792 | Ga0055540_1000102 | Ga0055540_100010282 | 486 |
| 1237 | 3300005331 | Ga0070670_100145467 | Ga0070670_1001454671 | 486 |
| 1238 | 3300005333 | Ga0070677_10005553 | Ga0070677_100055533 | 486 |
| 1239 | 3300005354 | Ga0070675_100014679 | Ga0070675_1000146795 | 486 |
| 1240 | 3300005355 | Ga0070671_100050040 | Ga0070671_1000500402 | 486 |
| 1241 | 3300005367 | Ga0070667_100161053 | Ga0070667_1001610532 | 486 |
| 1242 | 3300009036 | Ga0105244_10021407 | Ga0105244_100214071 | 486 |
| 1243 | 3300009177 | Ga0105248_10163942 | Ga0105248_101639422 | 486 |
| 1244 | 3300025225 | Ga0209566_100031 | Ga0209566_100031124 | 486 |
| 1245 | 3300025226 | Ga0209674_100001 | Ga0209674_1000012028 | 486 |
| 1246 | 3300025230 | Ga0209563_100001 | Ga0209563_1000012028 | 486 |
| 1247 | 3300025230 | Ga0209563_100155 | Ga0209563_1001559 | 486 |
| 1248 | 3300025253 | Ga0209677_100001 | Ga0209677_1000012028 | 486 |
| 1249 | 3300025728 | Ga0207655_1005663 | Ga0207655_10056636 | 486 |
| 1250 | 3300025893 | Ga0207682_10000870 | Ga0207682_100008705 | 486 |
| 1251 | 3300025901 | Ga0207688_10018592 | Ga0207688_100185922 | 486 |
| 1252 | 3300025907 | Ga0207645_10005766 | Ga0207645_100057662 | 486 |
| 1253 | 3300025925 | Ga0207650_10037411 | Ga0207650_100374112 | 486 |
| 1254 | 3300025926 | Ga0207659_10050333 | Ga0207659_100503331 | 486 |
| 1255 | 3300025940 | Ga0207691_10014615 | Ga0207691_100146156 | 486 |
| 1256 | 3300026121 | Ga0207683_10017060 | Ga0207683_100170602 | 486 |
| 1257 | 3300031995 | Ga0307409_100256776 | Ga0307409_1002567761 | 486 |
| 1258 | 3300032002 | Ga0307416_100050099 | Ga0307416_1000500992 | 486 |
| 1259 | 3300037418 | Ga0395900_0142728 | Ga0395900_0142728_642_2180 | 486 |
| 1260 | 3300038443 | Ga0395901_0049549 | Ga0395901_0049549_1548_3086 | 486 |
| 1261 | 3300039437 | Ga0436365_1486359 | Ga0436365_1486359_4032_5522 | 486 |
| 1262 | 3300044693 | Ga0466961_0080319 | Ga0466961_0080319_152_1720 | 486 |
| 1263 | 3300044765 | Ga0466970_0012299 | Ga0466970_0012299_601_2148 | 486 |
| 1264 | 3300044842 | Ga0466957_0074184 | Ga0466957_0074184_444_2012 | 486 |
| 1265 | 3300048090 | Ga0495615_0010729 | Ga0495615_0010729_44_1618 | 486 |
| 1266 | 3300048909 | Ga0496106_0129451 | Ga0496106_0129451_308_1891 | 486 |
| 1267 | 3300048911 | Ga0496108_0175398 | Ga0496108_0175398_18_1601 | 486 |
| 1268 | 3300048913 | Ga0496110_0178049 | Ga0496110_0178049_227_1810 | 486 |
| 1269 | 3300048915 | Ga0496112_0072862 | Ga0496112_0072862_355_1938 | 486 |
| 1270 | 3300048918 | Ga0496115_0167767 | Ga0496115_0167767_62_1645 | 486 |
| 1271 | 3300048920 | Ga0496117_0003132 | Ga0496117_0003132_13140_14684 | 486 |
| 1272 | 3300048921 | Ga0496118_0000640 | Ga0496118_0000640_33057_34601 | 486 |
| 1273 | 3300048924 | Ga0496121_0000005 | Ga0496121_0000005_664224_665702 | 486 |
| 1274 | 3300048925 | Ga0496122_0004580 | Ga0496122_0004580_8201_9676 | 486 |
| 1275 | 3300048925 | Ga0496122_0066908 | Ga0496122_0066908_362_1897 | 486 |
| 1276 | 3300048927 | Ga0496124_0000070 | Ga0496124_0000070_3784_5319 | 486 |
| 1277 | 3300048927 | Ga0496124_0003218 | Ga0496124_0003218_7406_8977 | 486 |
| 1278 | 3300048927 | Ga0496124_0043699 | Ga0496124_0043699_1503_2981 | 486 |
| 1279 | 3300048928 | Ga0496125_0000163 | Ga0496125_0000163_31953_33431 | 486 |
| 1280 | 3300048928 | Ga0496125_0108077 | Ga0496125_0108077_154_1737 | 486 |
| 1281 | 3300049128 | Ga0501308_001792 | Ga0501308_001792_24_1538 | 486 |
| 1282 | 3300049586 | Ga0501070_0000065 | Ga0501070_0000065_21168_22739 | 486 |
| 1283 | iso_pu_bacteria | 2751185788 | 2753302520 | 486 |
| 1284 | iso_pu_bacteria | 2893684298 | 2893686171 | 486 |
| 1285 | iso_pu_bacteria | 2928104781 | 2928105845 | 486 |
| 1286 | iso_pu_bacteria | 2984551494 | 2984554682 | 486 |
| 1287 | 3300003758 | Ga0055532_1000750 | Ga0055532_10007507 | 487 |
| 1288 | 3300031548 | Ga0307408_100091679 | Ga0307408_1000916791 | 487 |
| 1289 | 3300041404 | Ga0439436_0011031 | Ga0439436_0011031_352_1902 | 487 |
| 1290 | 3300041999 | Ga0439433_0001637 | Ga0439433_0001637_2922_4472 | 487 |
| 1291 | 3300042007 | Ga0439449_0017073 | Ga0439449_0017073_1134_2684 | 487 |
| 1292 | 3300044901 | Ga0466960_0024589 | Ga0466960_0024589_26_1624 | 487 |
| 1293 | 3300046472 | Ga0495580_0004805 | Ga0495580_0004805_6411_7928 | 487 |
| 1294 | 3300048915 | Ga0496112_0006644 | Ga0496112_0006644_8607_10124 | 487 |
| 1295 | 3300048921 | Ga0496118_0040502 | Ga0496118_0040502_2155_3657 | 487 |
| 1296 | 3300048922 | Ga0496119_0002729 | Ga0496119_0002729_16362_17864 | 487 |
| 1297 | 3300048923 | Ga0496120_0002192 | Ga0496120_0002192_9632_11134 | 487 |
| 1298 | 3300048925 | Ga0496122_0000031 | Ga0496122_0000031_173122_174624 | 487 |
| 1299 | 3300048926 | Ga0496123_0000013 | Ga0496123_0000013_173132_174634 | 487 |
| 1300 | 3300053177 | Ga0500636_0007158 | Ga0500636_0007158_4701_6185 | 487 |
| 1301 | 3300059477 | Ga0587084_000309 | Ga0587084_000309_1881_3392 | 487 |
| 1302 | 3300059490 | Ga0587066_000629 | Ga0587066_000629_1499_3010 | 487 |
| 1303 | 3300059491 | Ga0587070_001326 | Ga0587070_001326_968_2488 | 487 |
| 1304 | 3300059510 | Ga0587090_002985 | Ga0587090_002985_373_1884 | 487 |
| 1305 | 3300059511 | Ga0587091_000092 | Ga0587091_000092_3314_4825 | 487 |
| 1306 | 3300059512 | Ga0587092_000499 | Ga0587092_000499_1550_3061 | 487 |
| 1307 | 3300059513 | Ga0587094_002376 | Ga0587094_002376_420_1931 | 487 |
| 1308 | 3300059623 | Ga0587101_000289 | Ga0587101_000289_1541_3052 | 487 |
| 1309 | 3300059630 | Ga0587128_000197 | Ga0587128_000197_17_1528 | 487 |
| 1310 | 3300059630 | Ga0587128_001628 | Ga0587128_001628_97_1614 | 487 |
| 1311 | 3300059639 | Ga0587062_001343 | Ga0587062_001343_408_1919 | 487 |
| 1312 | 3300059642 | Ga0587069_002201 | Ga0587069_002201_418_1929 | 487 |
| 1313 | 3300059647 | Ga0587079_000356 | Ga0587079_000356_236_1747 | 487 |
| 1314 | 3300059652 | Ga0587107_001234 | Ga0587107_001234_350_1861 | 487 |
| 1315 | iso_pu_bacteria | 2643221616 | 2644097966 | 487 |
| 1316 | iso_pu_bacteria | 2891968417 | 2891969856 | 487 |
| 1317 | iso_pu_bacteria | 2977264416 | 2977264850 | 487 |
| 1318 | iso_pu_bacteria | 8016254467 | 8016255872 | 487 |
| 1319 | 3300002773 | JGI25152J39213_1000585 | JGI25152J39213_100058513 | 488 |
| 1320 | 3300003760 | Ga0055527_1000025 | Ga0055527_1000025171 | 488 |
| 1321 | 3300003762 | Ga0055542_1000048 | Ga0055542_1000048171 | 488 |
| 1322 | 3300003763 | Ga0055529_1000057 | Ga0055529_100005710 | 488 |
| 1323 | 3300009148 | Ga0105243_10167044 | Ga0105243_101670441 | 488 |
| 1324 | 3300011119 | Ga0105246_10005032 | Ga0105246_100050325 | 488 |
| 1325 | 3300013308 | Ga0157375_10002937 | Ga0157375_100029374 | 488 |
| 1326 | 3300025228 | Ga0209672_100011 | Ga0209672_100011829 | 488 |
| 1327 | 3300025229 | Ga0209147_101101 | Ga0209147_1011016 | 488 |
| 1328 | 3300025242 | Ga0209258_101738 | Ga0209258_1017384 | 488 |
| 1329 | 3300025245 | Ga0207425_1005693 | Ga0207425_10056932 | 488 |
| 1330 | 3300025254 | Ga0209148_1000023 | Ga0209148_1000023667 | 488 |
| 1331 | 3300025258 | Ga0209129_1000130 | Ga0209129_100013043 | 488 |
| 1332 | 3300025272 | Ga0209455_1000023 | Ga0209455_1000023667 | 488 |
| 1333 | 3300025294 | Ga0209025_1000364 | Ga0209025_100036483 | 488 |
| 1334 | 3300031548 | Ga0307408_100005443 | Ga0307408_1000054438 | 488 |
| 1335 | 3300031731 | Ga0307405_10061240 | Ga0307405_100612402 | 488 |
| 1336 | 3300031852 | Ga0307410_10106503 | Ga0307410_101065031 | 488 |
| 1337 | 3300031903 | Ga0307407_10028674 | Ga0307407_100286742 | 488 |
| 1338 | 3300031911 | Ga0307412_10126774 | Ga0307412_101267741 | 488 |
| 1339 | 3300031995 | Ga0307409_100100232 | Ga0307409_1001002322 | 488 |
| 1340 | 3300032002 | Ga0307416_100016188 | Ga0307416_1000161882 | 488 |
| 1341 | 3300032126 | Ga0307415_100060700 | Ga0307415_1000607002 | 488 |
| 1342 | 3300046518 | Ga0495631_0033175 | Ga0495631_0033175_525_2105 | 488 |
| 1343 | 3300046558 | Ga0495633_0021197 | Ga0495633_0021197_830_2410 | 488 |
| 1344 | 3300046615 | Ga0495656_0004184 | Ga0495656_0004184_332_1912 | 488 |
| 1345 | 3300046691 | Ga0495670_0005066 | Ga0495670_0005066_4876_6456 | 488 |
| 1346 | 3300047318 | Ga0495636_0011881 | Ga0495636_0011881_155_1735 | 488 |
| 1347 | 3300048905 | Ga0496102_0147520 | Ga0496102_0147520_359_1870 | 488 |
| 1348 | 3300048906 | Ga0496103_0002458 | Ga0496103_0002458_2637_4148 | 488 |
| 1349 | 3300048908 | Ga0496105_0017915 | Ga0496105_0017915_4016_5527 | 488 |
| 1350 | 3300048909 | Ga0496106_0013608 | Ga0496106_0013608_130_1641 | 488 |
| 1351 | 3300048910 | Ga0496107_0012130 | Ga0496107_0012130_1864_3375 | 488 |
| 1352 | 3300048914 | Ga0496111_0000389 | Ga0496111_0000389_8177_9688 | 488 |
| 1353 | 3300048927 | Ga0496124_0053042 | Ga0496124_0053042_1401_2924 | 488 |
| 1354 | iso_pu_bacteria | 2773857763 | 2774398577 | 488 |
| 1355 | iso_pu_bacteria | 2808606439 | 2809198850 | 488 |
| 1356 | iso_pu_bacteria | 2884763398 | 2884766758 | 488 |
| 1357 | iso_pu_bacteria | 2905926851 | 2905926893 | 488 |
| 1358 | iso_pu_bacteria | 2945941187 | 2945943515 | 488 |
| 1359 | iso_pu_bacteria | 2945941187 | 2945945048 | 488 |
| 1360 | 3300003762 | Ga0055542_1002667 | Ga0055542_10026676 | 489 |
| 1361 | 3300006042 | Ga0075368_10032139 | Ga0075368_100321391 | 489 |
| 1362 | 3300009545 | Ga0105237_10006031 | Ga0105237_100060317 | 489 |
| 1363 | 3300025254 | Ga0209148_1003076 | Ga0209148_10030762 | 489 |
| 1364 | 3300049744 | Ga0501083_0000047 | Ga0501083_0000047_39127_40746 | 489 |
| 1365 | iso_pu_bacteria | 2739367653 | 2739603847 | 489 |
| 1366 | iso_pu_bacteria | 2844849076 | 2844850129 | 489 |
| 1367 | iso_pu_bacteria | 2857727296 | 2857729424 | 489 |
| 1368 | iso_pu_bacteria | 2945941187 | 2945945473 | 489 |
| 1369 | 3300044765 | Ga0466970_0069383 | Ga0466970_0069383_79_1710 | 490 |
| 1370 | 3300048903 | Ga0496100_0070600 | Ga0496100_0070600_322_1917 | 490 |
| 1371 | 3300048909 | Ga0496106_0014747 | Ga0496106_0014747_158_1753 | 490 |
| 1372 | 3300048910 | Ga0496107_0001472 | Ga0496107_0001472_5348_6943 | 490 |
| 1373 | 3300048914 | Ga0496111_0056392 | Ga0496111_0056392_387_1982 | 490 |
| 1374 | 3300048914 | Ga0496111_0155067 | Ga0496111_0155067_30_1625 | 490 |
| 1375 | 3300049570 | Ga0501033_0026256 | Ga0501033_0026256_273_1874 | 490 |
| 1376 | 3300049578 | Ga0501042_0000193 | Ga0501042_0000193_12109_13716 | 490 |
| 1377 | 3300049823 | Ga0501044_0130605 | Ga0501044_0130605_474_2075 | 490 |
| 1378 | 3300049823 | Ga0501044_0156074 | Ga0501044_0156074_68_1657 | 490 |
| 1379 | iso_pu_bacteria | 2811994878 | 2812352547 | 490 |
| 1380 | iso_pu_bacteria | 2893684298 | 2893686172 | 490 |
| 1381 | iso_pu_bacteria | 2920879853 | 2920883836 | 490 |
| 1382 | iso_pu_bacteria | 2966921586 | 2966923287 | 490 |
| 1383 | 3300002773 | JGI25152J39213_1000175 | JGI25152J39213_10001756 | 491 |
| 1384 | 3300009148 | Ga0105243_10001837 | Ga0105243_100018375 | 491 |
| 1385 | 3300011119 | Ga0105246_10000078 | Ga0105246_1000007822 | 491 |
| 1386 | 3300025258 | Ga0209129_1000220 | Ga0209129_100022040 | 491 |
| 1387 | 3300025294 | Ga0209025_1000586 | Ga0209025_100058617 | 491 |
| 1388 | 3300025302 | Ga0207426_1000393 | Ga0207426_100039310 | 491 |
| 1389 | 3300025935 | Ga0207709_10008572 | Ga0207709_100085722 | 491 |
| 1390 | 3300048917 | Ga0496114_0005471 | Ga0496114_0005471_3549_5102 | 491 |
| 1391 | 3300002772 | JGI25164J39214_1000743 | JGI25164J39214_10007437 | 492 |
| 1392 | 3300013104 | Ga0157370_10002083 | Ga0157370_100020836 | 492 |
| 1393 | 3300025231 | Ga0207427_100028 | Ga0207427_100028306 | 492 |
| 1394 | 3300025233 | Ga0209437_101468 | Ga0209437_1014683 | 492 |
| 1395 | 3300025261 | Ga0209233_1000001 | Ga0209233_1000001804 | 492 |
| 1396 | 3300027907 | Ga0207428_10010431 | Ga0207428_100104314 | 492 |
| 1397 | 3300046691 | Ga0495670_0003593 | Ga0495670_0003593_3624_5147 | 492 |
| 1398 | 3300047318 | Ga0495636_0004898 | Ga0495636_0004898_1207_2730 | 492 |
| 1399 | 3300047445 | Ga0495677_0004977 | Ga0495677_0004977_2380_3903 | 492 |
| 1400 | 3300049744 | Ga0501083_0002277 | Ga0501083_0002277_2329_3915 | 492 |
| 1401 | iso_pu_bacteria | 2643221619 | 2644112537 | 492 |
| 1402 | iso_pu_bacteria | 2816332305 | 2817510033 | 492 |
| 1403 | 3300006186 | Ga0075369_10020933 | Ga0075369_100209332 | 493 |
| 1404 | iso_pu_bacteria | 2773857763 | 2774398866 | 493 |
| 1405 | iso_pu_bacteria | 2852663356 | 2852664371 | 493 |
| 1406 | iso_pu_bacteria | 2862993130 | 2862996795 | 493 |
| 1407 | iso_pu_bacteria | 2919395869 | 2919396210 | 493 |
| 1408 | 3300046524 | Ga0495648_0002385 | Ga0495648_0002385_7998_9518 | 494 |
| 1409 | 3300053098 | Ga0500650_0011205 | Ga0500650_0011205_109_1764 | 494 |
| 1410 | 3300001979 | JGI24740J21852_10003572 | JGI24740J21852_100035722 | 495 |
| 1411 | 3300009148 | Ga0105243_10027938 | Ga0105243_100279383 | 495 |
| 1412 | 3300011119 | Ga0105246_10048375 | Ga0105246_100483751 | 495 |
| 1413 | 3300025728 | Ga0207655_1030668 | Ga0207655_10306682 | 495 |
| 1414 | 3300025935 | Ga0207709_10011422 | Ga0207709_100114222 | 495 |
| 1415 | 3300044765 | Ga0466970_0002680 | Ga0466970_0002680_3218_4852 | 495 |
| 1416 | 3300047323 | Ga0495683_0001028 | Ga0495683_0001028_12726_14294 | 495 |
| 1417 | 3300053140 | Ga0500573_0042062 | Ga0500573_0042062_553_2133 | 495 |
| 1418 | iso_pu_bacteria | 2547132424 | 2548694785 | 495 |
| 1419 | iso_pu_bacteria | 8004021418 | 8004023584 | 495 |
| 1420 | 3300046472 | Ga0495580_0019312 | Ga0495580_0019312_2202_3800 | 496 |
| 1421 | 3300046535 | Ga0495586_0061666 | Ga0495586_0061666_96_1694 | 496 |
| 1422 | 3300048917 | Ga0496114_0001123 | Ga0496114_0001123_17046_18629 | 496 |
| 1423 | iso_pu_bacteria | 2995726249 | 2995728997 | 496 |
| 1424 | 3300020076 | Ga0206355_1600119 | Ga0206355_16001191 | 497 |
| 1425 | 3300037418 | Ga0395900_0216316 | Ga0395900_0216316_220_1800 | 497 |
| 1426 | 3300037466 | Ga0395898_0000100 | Ga0395898_0000100_99304_100884 | 497 |
| 1427 | iso_pu_bacteria | 2857729791 | 2857733107 | 497 |
| 1428 | iso_pu_bacteria | 2867475112 | 2867476488 | 497 |
| 1429 | iso_pu_bacteria | 2928121344 | 2928121812 | 497 |
| 1430 | iso_pu_bacteria | 8004021418 | 8004025287 | 497 |
| 1431 | 3300013306 | Ga0163162_10037249 | Ga0163162_100372493 | 498 |
| 1432 | 3300013307 | Ga0157372_10024667 | Ga0157372_100246675 | 498 |
| 1433 | 3300048903 | Ga0496100_0027780 | Ga0496100_0027780_1429_3012 | 498 |
| 1434 | 3300048904 | Ga0496101_0004230 | Ga0496101_0004230_5150_6733 | 498 |
| 1435 | 3300048905 | Ga0496102_0034937 | Ga0496102_0034937_2881_4464 | 498 |
| 1436 | 3300048906 | Ga0496103_0002535 | Ga0496103_0002535_6248_7831 | 498 |
| 1437 | 3300048910 | Ga0496107_0010664 | Ga0496107_0010664_1083_2666 | 498 |
| 1438 | 3300048913 | Ga0496110_0028337 | Ga0496110_0028337_829_2412 | 498 |
| 1439 | 3300048915 | Ga0496112_0090052 | Ga0496112_0090052_32_1615 | 498 |
| 1440 | 3300048916 | Ga0496113_0026795 | Ga0496113_0026795_2454_4037 | 498 |
| 1441 | 3300048923 | Ga0496120_0087619 | Ga0496120_0087619_55_1638 | 498 |
| 1442 | iso_pu_bacteria | 8004025490 | 8004026852 | 498 |
| 1443 | 3300006051 | Ga0075364_10045544 | Ga0075364_100455442 | 499 |
| 1444 | 3300013105 | Ga0157369_10088708 | Ga0157369_100887082 | 499 |
| 1445 | 3300048925 | Ga0496122_0091768 | Ga0496122_0091768_323_1915 | 499 |
| 1446 | 3300049586 | Ga0501070_0067482 | Ga0501070_0067482_129_1739 | 501 |
| 1447 | 3300049823 | Ga0501044_0244116 | Ga0501044_0244116_90_1643 | 501 |
| 1448 | 3300042137 | Ga0450902_007818 | Ga0450902_007818_11_1519 | 502 |
| 1449 | 3300041452 | Ga0451793_0946035 | Ga0451793_0946035_197_1792 | 503 |
| 1450 | 3300041509 | Ga0451843_1271766 | Ga0451843_1271766_161_1765 | 504 |
| 1451 | 3300046459 | Ga0495629_0084971 | Ga0495629_0084971_599_2197 | 504 |
| 1452 | 3300048907 | Ga0496104_0045963 | Ga0496104_0045963_346_1944 | 504 |
| 1453 | 3300048908 | Ga0496105_0012197 | Ga0496105_0012197_2875_4473 | 504 |
| 1454 | 3300048911 | Ga0496108_0014016 | Ga0496108_0014016_4849_6447 | 504 |
| 1455 | 3300048912 | Ga0496109_0001044 | Ga0496109_0001044_377_1975 | 504 |
| 1456 | 3300048913 | Ga0496110_0000574 | Ga0496110_0000574_2876_4474 | 504 |
| 1457 | 3300048914 | Ga0496111_0001626 | Ga0496111_0001626_377_1975 | 504 |
| 1458 | 3300048917 | Ga0496114_0137337 | Ga0496114_0137337_489_2087 | 504 |
| 1459 | iso_pu_bacteria | 8054929484 | 8054930360 | 506 |
| 1460 | iso_pu_bacteria | 2738543004 | 2739199348 | 508 |
| 1461 | 3300046474 | Ga0495605_0000828 | Ga0495605_0000828_163_1695 | 509 |
| 1462 | 3300046492 | Ga0495585_0000087 | Ga0495585_0000087_22321_23871 | 509 |
| 1463 | 3300025292 | Ga0209676_1000292 | Ga0209676_100029274 | 510 |
| 1464 | 3300046492 | Ga0495585_0001786 | Ga0495585_0001786_11385_12917 | 510 |
| 1465 | 3300046528 | Ga0495642_0000004 | Ga0495642_0000004_19587_21119 | 510 |
| 1466 | 3300048928 | Ga0496125_0000068 | Ga0496125_0000068_104746_106299 | 510 |
| 1467 | 3300046512 | Ga0495610_0000069 | Ga0495610_0000069_95045_96580 | 511 |
| 1468 | 3300005288 | Ga0065714_10019635 | Ga0065714_100196352 | 512 |
| 1469 | 3300006051 | Ga0075364_10042550 | Ga0075364_100425502 | 512 |
| 1470 | 3300017792 | Ga0163161_10002528 | Ga0163161_100025282 | 512 |
| 1471 | 3300025728 | Ga0207655_1005093 | Ga0207655_10050935 | 512 |
| 1472 | 3300041407 | Ga0439447_002146 | Ga0439447_002146_2748_4316 | 512 |
| 1473 | 3300041411 | Ga0439466_0008217 | Ga0439466_0008217_685_2223 | 512 |
| 1474 | 3300042010 | Ga0439452_000053 | Ga0439452_000053_60518_62056 | 512 |
| 1475 | 3300046458 | Ga0495591_000069 | Ga0495591_000069_50053_51591 | 512 |
| 1476 | 3300046463 | Ga0495653_0000466 | Ga0495653_0000466_23118_24686 | 512 |
| 1477 | 3300046471 | Ga0495650_0000228 | Ga0495650_0000228_15214_16752 | 512 |
| 1478 | 3300046520 | Ga0495637_0000904 | Ga0495637_0000904_13539_15077 | 512 |
| 1479 | 3300046530 | Ga0495654_0000256 | Ga0495654_0000256_14928_16496 | 512 |
| 1480 | 3300046809 | Ga0495600_0000176 | Ga0495600_0000176_5361_6929 | 512 |
| 1481 | 3300047322 | Ga0495680_0000066 | Ga0495680_0000066_33548_35116 | 512 |
| 1482 | 3300047444 | Ga0495675_0000026 | Ga0495675_0000026_34760_36328 | 512 |
| 1483 | 3300048924 | Ga0496121_0002230 | Ga0496121_0002230_16085_17653 | 512 |
| 1484 | 3300048925 | Ga0496122_0002107 | Ga0496122_0002107_15986_17554 | 512 |
| 1485 | 2162886007 | SwRhRL2b_contig_1535382 | SwRhRL2b_0462.00001210 | 522 |
| 1486 | 3300005289 | Ga0065704_10070742 | Ga0065704_100707429 | 522 |
| 1487 | 3300048927 | Ga0496124_0003597 | Ga0496124_0003597_3710_5320 | 522 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3l1l-assembly1.cif.gz_A-2 | structure of arg-bound escherichia coli adic | 0.851 | 34 | 473 |
| 5j4i-assembly1.cif.gz_A | crystal structure of the l-arginine/agmatine antiporter from e. coli at 2.2 angstroem resolution | 0.8479 | 34 | 475 |
| 6f2g-assembly1.cif.gz_A | bacterial asc transporter crystal structure in open to in conformation | 0.8437 | 38 | 479 |
| 5oqt-assembly1.cif.gz_A | crystal structure of a bacterial cationic amino acid transporter (cat) homologue | 0.8417 | 23 | 478 |
| 6f34-assembly1.cif.gz_A | crystal structure of a bacterial cationic amino acid transporter (cat) homologue bound to arginine. | 0.8397 | 1 | 475 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WQM9_17_470_1.20.1740.10 | Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I | 0.9868 | 29 | 485 | 1.20.1740.10 |
| af_P9WQM9_17_470_1.20.1740.10 | Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I | 0.9825 | 29 | 485 | 1.20.1740.10 |
| af_Q2FVI1_4_463_1.20.1740.10 | Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I | 0.9456 | 30 | 485 | 1.20.1740.10 |
| af_P24207_19_458_1.20.1740.10 | Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I | 0.9441 | 29 | 476 | 1.20.1740.10 |
| af_P27837_7_458_1.20.1740.10 | Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I | 0.9435 | 30 | 480 | 1.20.1740.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A0H3NSD2-F1-model_v4 | L-asparagine permease | 0.9788 | 12 | 485 |
GO:0005886
GO:0006865 GO:0055085 |
| AF-A0A034T0E9-F1-model_v4 | deleted | 0.9782 | 12 | 485 |
|
| AF-M1TUI6-F1-model_v4 | Amino acid permease/ SLC12A domain-containing protein | 0.9778 | 23 | 484 |
GO:0005886
GO:0006865 GO:0055085 |
| AF-M2XUX3-F1-model_v4 | L-asparagine permease | 0.9728 | 22 | 485 |
GO:0005886
GO:0006865 GO:0055085 |
| AF-A0A5Q0H7E5-F1-model_v4 | Amino acid permease | 0.9707 | 29 | 478 |
GO:0005886
GO:0006865 GO:0055085 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar