F494302

General Info

Members Datasets Scaffolds Average Seq Length
1485 438 1482 159

Family's Representative Sequence

Representative Sequence 3300025290|Ga0207673_1009582|Ga0207673_10095822
Length 193
Sequence VGRPAAAKLVAPSGAPYLAHMSDPQISLTQNAAKRVAMFAIVLVHPEIPPNTGNVIRLTANTATDLHLVEPLGFRMDDRDLRRAGLDYHEYARVAVHRDFAACRAALDADAPRRWFAFTTQASRSAYDVAYRPGDVLVFGSETRGLPPTILEHFPADTHLRIPMRAGVRSLNLSNAVAVAVYEAWRQQRFSGR

Samples

Sample ID Description Type Environment
1 2643221639 Pelomonas sp. Root1217 Isolate Unclassified
2 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
3 2643221660 Methylibium sp. Root1272 Isolate Unclassified
4 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
7 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
8 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
9 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
10 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
17 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
18 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
19 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
20 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
21 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
22 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
23 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
24 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
25 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
26 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
27 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
28 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
29 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
30 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
31 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
32 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
33 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
34 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
35 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
36 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
37 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
38 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
39 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
40 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
41 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
42 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
43 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
44 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
45 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
46 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
47 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
48 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
49 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
50 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
51 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
52 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
53 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
54 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
55 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
56 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
57 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
58 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
59 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
60 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
61 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
62 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
63 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
64 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
65 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
66 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
67 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
68 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
69 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
70 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
71 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
72 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
73 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
74 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
75 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
76 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
77 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
78 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
79 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
80 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
81 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
82 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
83 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
84 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
85 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
86 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
87 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
88 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
89 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
90 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
91 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
92 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
93 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
94 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
95 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
96 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
97 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
98 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
99 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
100 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
101 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
102 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
103 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
104 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
105 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
106 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
107 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
108 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
109 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
110 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
111 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
112 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
113 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
114 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
115 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
116 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
117 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
118 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
119 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
120 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
121 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
122 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
123 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
124 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
125 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
126 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
127 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
128 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
129 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
130 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
131 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
132 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
133 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
134 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
135 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
136 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
137 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
138 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
139 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
140 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
207 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
208 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
209 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
213 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
214 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
215 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
216 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
217 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
218 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
219 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
220 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
221 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
222 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
223 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
224 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
225 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
226 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
227 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
228 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
229 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
230 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
231 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
232 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
233 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
234 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
235 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
236 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
237 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
238 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
239 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
240 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
241 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
242 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
243 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
244 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
245 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
246 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
247 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
248 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
249 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
250 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
251 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
252 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
253 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
254 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
255 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
256 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
257 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
258 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
259 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
260 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
261 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
262 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
263 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
264 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
265 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
266 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
267 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
268 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
269 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
270 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
271 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
272 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
273 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
274 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
275 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
276 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
277 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
278 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
279 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
280 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
281 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
282 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
283 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
284 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
285 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
286 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
287 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
288 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
289 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
290 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
291 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
292 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
293 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
294 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
295 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
296 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
297 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
298 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
299 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
300 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
301 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
302 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
303 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
304 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
305 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
306 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
307 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
308 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
309 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
310 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
311 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
312 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
313 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
314 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
315 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
316 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
317 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
318 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
319 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
320 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
321 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
322 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
323 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
324 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
325 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
326 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
327 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
328 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
329 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
330 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
331 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
332 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
333 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
334 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
335 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
336 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
337 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
338 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
339 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
340 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
341 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
342 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
343 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
344 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
345 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
346 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
347 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
348 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
349 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
350 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
351 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
352 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
353 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
354 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
355 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
356 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
357 3300049518 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control Metagenome Rhizosphere
358 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
359 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
360 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
361 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
362 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
363 3300049524 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H21_B_7_control Metagenome Rhizosphere
364 3300049526 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control Metagenome Rhizosphere
365 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
366 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
367 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
368 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
369 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
370 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
371 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
372 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
373 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
374 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
375 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
376 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
377 3300049659 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control Metagenome Rhizosphere
378 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
379 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
380 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
381 3300049666 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control Metagenome Rhizosphere
382 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
383 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
384 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
385 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
386 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
387 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
388 3300049676 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control Metagenome Rhizosphere
389 3300049678 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought Metagenome Rhizosphere
390 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
391 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
392 3300049684 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control Metagenome Rhizosphere
393 3300049685 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control Metagenome Rhizosphere
394 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
395 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
396 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
397 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
398 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
399 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
400 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
401 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
402 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
403 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
404 3300049757 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control Metagenome Rhizosphere
405 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
406 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
407 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
408 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
409 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
410 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
411 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
412 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
413 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
414 3300049771 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control Metagenome Rhizosphere
415 3300049773 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_B_4_control Metagenome Rhizosphere
416 3300049774 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought Metagenome Rhizosphere
417 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
418 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
419 3300049777 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control Metagenome Rhizosphere
420 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
421 3300049849 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought Metagenome Rhizosphere
422 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
423 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
424 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
425 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
426 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
427 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
428 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
429 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
430 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
431 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
432 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
433 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
434 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
435 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
436 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
437 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
438 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.6
Metatranscriptomes 0.2
Isolates 0.2

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.28
Nodule 0.13
Rhizoplane 3.57
Rhizosphere 94.07
Stem 0
Stem Tuber 0
Unclassified 0.94

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24751J29686_10046467 3300002459 Bacteria 897
2 rootL2_10073240 3300003322 Bacteria 4164
3 Ga0055524_1000146 3300003775 Bacteria 84190
4 Ga0055530_10009559 3300003791 Bacteria 3707
5 Ga0055531_10004965 3300003794 Bacteria 7899
6 Ga0065712_10235339 3300005290 Bacteria 995
7 Ga0065715_10274079 3300005293 Bacteria 1103
8 Ga0065715_10612704 3300005293 Bacteria 700
9 Ga0070658_10005980 3300005327 Bacteria 9863
10 Ga0070658_10103749 3300005327 Bacteria 2352
11 Ga0070658_10141199 3300005327 Bacteria 2012
12 Ga0070658_10218690 3300005327 Bacteria 1610
13 Ga0070658_10287816 3300005327 Bacteria 1400
14 Ga0070658_10324897 3300005327 Bacteria 1314
15 Ga0070658_10390331 3300005327 Bacteria 1195
16 Ga0070658_11103298 3300005327 Bacteria 690
17 Ga0070676_10000267 3300005328 Bacteria 22827
18 Ga0070676_10009436 3300005328 Bacteria 5272
19 Ga0070676_10074109 3300005328 Bacteria 2049
20 Ga0070676_10083232 3300005328 Bacteria 1946
21 Ga0070683_100006762 3300005329 Bacteria 9634
22 Ga0070683_100014268 3300005329 Bacteria 6945
23 Ga0070683_100167950 3300005329 Bacteria 2082
24 Ga0070683_100257060 3300005329 Bacteria 1661
25 Ga0070683_101497725 3300005329 Bacteria 649
26 Ga0070683_101847100 3300005329 Bacteria 581
27 Ga0070690_100003078 3300005330 Bacteria 9067
28 Ga0070690_100010609 3300005330 Bacteria 5366
29 Ga0070690_100107454 3300005330 Bacteria 1857
30 Ga0070690_100374995 3300005330 Bacteria 1039
31 Ga0070670_100011670 3300005331 Bacteria 7515
32 Ga0070670_100016497 3300005331 Bacteria 6341
33 Ga0070670_100020490 3300005331 Bacteria 5685
34 Ga0070670_100049106 3300005331 Bacteria 3629
35 Ga0070670_100110464 3300005331 Bacteria 2369
36 Ga0070670_100143121 3300005331 Bacteria 2068
37 Ga0070670_100367407 3300005331 Bacteria 1266
38 Ga0070670_100512593 3300005331 Bacteria 1067
39 Ga0070670_100958521 3300005331 Bacteria 777
40 Ga0070677_10000642 3300005333 Bacteria 11722
41 Ga0070677_10010485 3300005333 Bacteria 3171
42 Ga0068869_100008109 3300005334 Bacteria 6756
43 Ga0068869_100009367 3300005334 Bacteria 6355
44 Ga0068869_100023785 3300005334 Bacteria 4238
45 Ga0068869_100036679 3300005334 Bacteria 3482
46 Ga0068869_100130351 3300005334 Bacteria 1932
47 Ga0068869_100144121 3300005334 Bacteria 1842
48 Ga0068869_100464197 3300005334 Bacteria 1052
49 Ga0070666_10004334 3300005335 Bacteria 8636
50 Ga0070666_10004746 3300005335 Bacteria 8304
51 Ga0070666_10017791 3300005335 Bacteria 4561
52 Ga0070666_10124836 3300005335 Bacteria 1786
53 Ga0070666_10166275 3300005335 Bacteria 1543
54 Ga0070666_11018123 3300005335 Bacteria 615
55 Ga0070680_100028407 3300005336 Bacteria 4486
56 Ga0070680_100034253 3300005336 Bacteria 4094
57 Ga0070682_100100175 3300005337 Bacteria 1912
58 Ga0070682_100708485 3300005337 Bacteria 808
59 Ga0068868_100015847 3300005338 Bacteria 5585
60 Ga0068868_100033124 3300005338 Bacteria 3981
61 Ga0068868_100034949 3300005338 Bacteria 3883
62 Ga0068868_100036210 3300005338 Bacteria 3818
63 Ga0068868_100038640 3300005338 Bacteria 3705
64 Ga0068868_100182700 3300005338 Bacteria 1741
65 Ga0068868_100371236 3300005338 Bacteria 1229
66 Ga0068868_100395511 3300005338 Bacteria 1192
67 Ga0068868_100427836 3300005338 Bacteria 1147
68 Ga0070660_100022673 3300005339 Bacteria 4647
69 Ga0070660_100031136 3300005339 Bacteria 4004
70 Ga0070660_100097177 3300005339 Bacteria 2330
71 Ga0070660_100662776 3300005339 Bacteria 874
72 Ga0070660_100943809 3300005339 Bacteria 728
73 Ga0070689_100019016 3300005340 Bacteria 5074
74 Ga0070689_100019090 3300005340 Bacteria 5063
75 Ga0070689_100044593 3300005340 Bacteria 3412
76 Ga0070689_100055757 3300005340 Bacteria 3063
77 Ga0070689_100163692 3300005340 Bacteria 1800
78 Ga0070689_101076455 3300005340 Bacteria 718
79 Ga0070691_10172697 3300005341 Bacteria 1121
80 Ga0070687_100039542 3300005343 Bacteria 2371
81 Ga0070687_100082039 3300005343 Bacteria 1762
82 Ga0070661_100006131 3300005344 Bacteria 8276
83 Ga0070661_100015813 3300005344 Bacteria 5326
84 Ga0070661_100015818 3300005344 Bacteria 5325
85 Ga0070661_100046937 3300005344 Bacteria 3160
86 Ga0070661_100700056 3300005344 Bacteria 825
87 Ga0070661_100793527 3300005344 Bacteria 777
88 Ga0070692_10004689 3300005345 Bacteria 5731
89 Ga0070692_10040008 3300005345 Bacteria 2396
90 Ga0070668_100006650 3300005347 Bacteria 8571
91 Ga0070668_100019549 3300005347 Bacteria 5098
92 Ga0070668_100022057 3300005347 Bacteria 4814
93 Ga0070668_100022437 3300005347 Bacteria 4772
94 Ga0070668_100060746 3300005347 Bacteria 2928
95 Ga0070668_100184173 3300005347 Bacteria 1707
96 Ga0070668_100256206 3300005347 Bacteria 1454
97 Ga0070668_100617455 3300005347 Bacteria 950
98 Ga0070669_100011261 3300005353 Bacteria 6350
99 Ga0070669_100072484 3300005353 Bacteria 2550
100 Ga0070669_100089829 3300005353 Bacteria 2302
101 Ga0070669_100116999 3300005353 Bacteria 2029
102 Ga0070669_100129232 3300005353 Bacteria 1936
103 Ga0070669_100302554 3300005353 Bacteria 1287
104 Ga0070675_100003343 3300005354 Bacteria 12143
105 Ga0070675_100016616 3300005354 Bacteria 5842
106 Ga0070675_100032389 3300005354 Bacteria 4231
107 Ga0070675_100035125 3300005354 Bacteria 4072
108 Ga0070675_100203583 3300005354 Bacteria 1718
109 Ga0070675_100205734 3300005354 Bacteria 1709
110 Ga0070675_100416372 3300005354 Bacteria 1201
111 Ga0070675_100771843 3300005354 Bacteria 878
112 Ga0070671_100000803 3300005355 Bacteria 22698
113 Ga0070671_100001991 3300005355 Bacteria 15686
114 Ga0070671_100024095 3300005355 Bacteria 4981
115 Ga0070671_100051913 3300005355 Bacteria 3410
116 Ga0070671_100054588 3300005355 Bacteria 3322
117 Ga0070671_100059511 3300005355 Bacteria 3179
118 Ga0070671_100223880 3300005355 Bacteria 1596
119 Ga0070671_100573648 3300005355 Bacteria 974
120 Ga0070671_100612033 3300005355 Bacteria 942
121 Ga0070671_100664302 3300005355 Bacteria 903
122 Ga0070671_100794183 3300005355 Bacteria 824
123 Ga0070674_100000274 3300005356 Bacteria 25095
124 Ga0070674_100013078 3300005356 Bacteria 5118
125 Ga0070674_100021899 3300005356 Bacteria 4113
126 Ga0070674_100070026 3300005356 Bacteria 2476
127 Ga0070674_100082737 3300005356 Bacteria 2297
128 Ga0070674_100109817 3300005356 Bacteria 2023
129 Ga0070674_100139100 3300005356 Bacteria 1820
130 Ga0070673_100000502 3300005364 Bacteria 20926
131 Ga0070673_100002265 3300005364 Bacteria 11663
132 Ga0070673_100031683 3300005364 Bacteria 3971
133 Ga0070673_100038486 3300005364 Bacteria 3653
134 Ga0070673_100040894 3300005364 Bacteria 3560
135 Ga0070673_100080038 3300005364 Bacteria 2646
136 Ga0070673_100090223 3300005364 Bacteria 2503
137 Ga0070673_100506297 3300005364 Bacteria 1093
138 Ga0070688_100011938 3300005365 Bacteria 4850
139 Ga0070688_100012315 3300005365 Bacteria 4789
140 Ga0070688_100015734 3300005365 Bacteria 4311
141 Ga0070688_100196730 3300005365 Bacteria 1408
142 Ga0070659_100001726 3300005366 Bacteria 15700
143 Ga0070659_100017311 3300005366 Bacteria 5420
144 Ga0070659_100029734 3300005366 Bacteria 4223
145 Ga0070659_100048701 3300005366 Bacteria 3330
146 Ga0070659_100065437 3300005366 Bacteria 2879
147 Ga0070659_100066089 3300005366 Bacteria 2865
148 Ga0070659_100117998 3300005366 Bacteria 2146
149 Ga0070659_100132111 3300005366 Bacteria 2028
150 Ga0070659_100377555 3300005366 Bacteria 1193
151 Ga0070659_100516245 3300005366 Bacteria 1020
152 Ga0070659_101544051 3300005366 Bacteria 592
153 Ga0070667_100011152 3300005367 Bacteria 7433
154 Ga0070667_100014378 3300005367 Bacteria 6540
155 Ga0070667_100018913 3300005367 Bacteria 5712
156 Ga0070667_100044618 3300005367 Bacteria 3724
157 Ga0070667_100096867 3300005367 Bacteria 2545
158 Ga0070667_100287679 3300005367 Bacteria 1477
159 Ga0070667_100305114 3300005367 Bacteria 1434
160 Ga0070667_100395130 3300005367 Bacteria 1258
161 Ga0070667_100986338 3300005367 Bacteria 786
162 Ga0070667_101809902 3300005367 Bacteria 575
163 Ga0070667_101823240 3300005367 Bacteria 572
164 Ga0070709_10008299 3300005434 Bacteria 5702
165 Ga0070709_10012962 3300005434 Bacteria 4676
166 Ga0070709_10028106 3300005434 Bacteria 3351
167 Ga0070709_10060724 3300005434 Bacteria 2404
168 Ga0070709_10233450 3300005434 Bacteria 1317
169 Ga0070709_10553675 3300005434 Bacteria 880
170 Ga0070709_10862396 3300005434 Bacteria 714
171 Ga0070714_100017248 3300005435 Bacteria 5847
172 Ga0070714_100029515 3300005435 Bacteria 4559
173 Ga0070714_100125104 3300005435 Bacteria 2291
174 Ga0070714_100383712 3300005435 Bacteria 1325
175 Ga0070714_101151357 3300005435 Bacteria 756
176 Ga0070714_101198294 3300005435 Bacteria 741
177 Ga0070714_101336626 3300005435 Bacteria 700
178 Ga0070713_100000621 3300005436 Bacteria 22637
179 Ga0070713_100009875 3300005436 Bacteria 6867
180 Ga0070713_100173718 3300005436 Bacteria 1932
181 Ga0070713_100256006 3300005436 Bacteria 1598
182 Ga0070713_100489612 3300005436 Bacteria 1159
183 Ga0070713_100565560 3300005436 Bacteria 1078
184 Ga0070713_101505457 3300005436 Bacteria 653
185 Ga0070710_10006664 3300005437 Bacteria 5559
186 Ga0070710_10446092 3300005437 Bacteria 876
187 Ga0070710_10582498 3300005437 Bacteria 777
188 Ga0070701_10037705 3300005438 Bacteria 2442
189 Ga0070701_10110108 3300005438 Bacteria 1538
190 Ga0070701_10800546 3300005438 Bacteria 643
191 Ga0070711_100000562 3300005439 Bacteria 19387
192 Ga0070711_100015057 3300005439 Bacteria 4887
193 Ga0070711_100290769 3300005439 Bacteria 1296
194 Ga0070711_100345369 3300005439 Bacteria 1195
195 Ga0070711_100538655 3300005439 Bacteria 967
196 Ga0070705_100002681 3300005440 Bacteria 8900
197 Ga0070705_100004688 3300005440 Bacteria 6659
198 Ga0070705_100111127 3300005440 Bacteria 1751
199 Ga0070700_100282541 3300005441 Bacteria 1204
200 Ga0070700_100515347 3300005441 Bacteria 923
201 Ga0070700_100627673 3300005441 Bacteria 845
202 Ga0070700_100665984 3300005441 Bacteria 823
203 Ga0070700_100827078 3300005441 Bacteria 748
204 Ga0070694_100003055 3300005444 Bacteria 9963
205 Ga0070694_100198333 3300005444 Bacteria 1495
206 Ga0070694_100365659 3300005444 Bacteria 1121
207 Ga0070708_100000961 3300005445 Bacteria 21881
208 Ga0070708_100039815 3300005445 Bacteria 4114
209 Ga0070663_100000226 3300005455 Bacteria 28442
210 Ga0070663_100049234 3300005455 Bacteria 2991
211 Ga0070663_100126042 3300005455 Bacteria 1940
212 Ga0070663_100170808 3300005455 Bacteria 1681
213 Ga0070663_100286692 3300005455 Bacteria 1314
214 Ga0070663_100458338 3300005455 Bacteria 1052
215 Ga0070663_100467398 3300005455 Bacteria 1042
216 Ga0070663_100731111 3300005455 Bacteria 843
217 Ga0070678_100002036 3300005456 Bacteria 10931
218 Ga0070678_100003054 3300005456 Bacteria 9278
219 Ga0070678_100006079 3300005456 Bacteria 7045
220 Ga0070678_100086342 3300005456 Bacteria 2393
221 Ga0070678_100166747 3300005456 Bacteria 1790
222 Ga0070678_100628410 3300005456 Bacteria 961
223 Ga0070662_100000111 3300005457 Bacteria 45577
224 Ga0070662_100015044 3300005457 Bacteria 5176
225 Ga0070662_100099703 3300005457 Bacteria 2196
226 Ga0070662_100214297 3300005457 Bacteria 1534
227 Ga0070662_100316909 3300005457 Bacteria 1271
228 Ga0070681_10026543 3300005458 Bacteria 5821
229 Ga0070681_10053935 3300005458 Bacteria 4006
230 Ga0070681_10790647 3300005458 Bacteria 866
231 Ga0068867_100004886 3300005459 Bacteria 9434
232 Ga0068867_100009782 3300005459 Bacteria 6757
233 Ga0068867_100022311 3300005459 Bacteria 4526
234 Ga0068867_100259632 3300005459 Bacteria 1416
235 Ga0068867_100669553 3300005459 Bacteria 913
236 Ga0070685_10001706 3300005466 Bacteria 11541
237 Ga0070685_10012009 3300005466 Bacteria 4541
238 Ga0070685_10062991 3300005466 Bacteria 2176
239 Ga0070706_100584167 3300005467 Bacteria 1038
240 Ga0070707_100078238 3300005468 Bacteria 3190
241 Ga0070699_100003739 3300005518 Bacteria 13438
242 Ga0070699_100016433 3300005518 Bacteria 6356
243 Ga0070699_100027824 3300005518 Bacteria 4876
244 Ga0070679_100228271 3300005530 Bacteria 1821
245 Ga0070679_100316192 3300005530 Bacteria 1511
246 Ga0070679_100321563 3300005530 Bacteria 1496
247 Ga0070679_100843137 3300005530 Bacteria 860
248 Ga0070684_100001117 3300005535 Bacteria 19263
249 Ga0070684_100053565 3300005535 Bacteria 3513
250 Ga0070684_100054153 3300005535 Bacteria 3495
251 Ga0070684_100119191 3300005535 Bacteria 2373
252 Ga0070684_100240883 3300005535 Bacteria 1652
253 Ga0070684_100616206 3300005535 Bacteria 1009
254 Ga0070697_100011036 3300005536 Bacteria 7058
255 Ga0070697_100057369 3300005536 Bacteria 3168
256 Ga0070697_100146517 3300005536 Bacteria 1988
257 Ga0068853_100005294 3300005539 Bacteria 10101
258 Ga0068853_100012925 3300005539 Bacteria 6805
259 Ga0068853_100083415 3300005539 Bacteria 2800
260 Ga0068853_100156536 3300005539 Bacteria 2053
261 Ga0068853_100230938 3300005539 Bacteria 1693
262 Ga0068853_100281602 3300005539 Bacteria 1533
263 Ga0068853_100328122 3300005539 Bacteria 1420
264 Ga0068853_100492048 3300005539 Bacteria 1157
265 Ga0068853_100793635 3300005539 Bacteria 906
266 Ga0070672_100001773 3300005543 Bacteria 13493
267 Ga0070672_100008494 3300005543 Bacteria 7031
268 Ga0070672_100014344 3300005543 Bacteria 5615
269 Ga0070672_100026516 3300005543 Bacteria 4314
270 Ga0070672_100035407 3300005543 Bacteria 3795
271 Ga0070672_100049647 3300005543 Bacteria 3266
272 Ga0070672_100128039 3300005543 Bacteria 2084
273 Ga0070672_100202101 3300005543 Bacteria 1662
274 Ga0070672_100329371 3300005543 Bacteria 1299
275 Ga0070672_100429191 3300005543 Bacteria 1136
276 Ga0070686_100027477 3300005544 Bacteria 3444
277 Ga0070686_100053216 3300005544 Bacteria 2584
278 Ga0070686_100061297 3300005544 Bacteria 2430
279 Ga0070686_100120908 3300005544 Bacteria 1798
280 Ga0070686_100303239 3300005544 Bacteria 1185
281 Ga0070686_100346621 3300005544 Bacteria 1115
282 Ga0070695_100007268 3300005545 Bacteria 6564
283 Ga0070695_100010123 3300005545 Bacteria 5622
284 Ga0070695_100046302 3300005545 Bacteria 2775
285 Ga0070695_100199059 3300005545 Bacteria 1430
286 Ga0070695_100342034 3300005545 Bacteria 1118
287 Ga0070696_100012043 3300005546 Bacteria 5794
288 Ga0070696_100016947 3300005546 Bacteria 4914
289 Ga0070696_100047956 3300005546 Bacteria 2965
290 Ga0070696_100072589 3300005546 Bacteria 2424
291 Ga0070696_100222503 3300005546 Bacteria 1417
292 Ga0070693_100010776 3300005547 Bacteria 4586
293 Ga0070693_100065531 3300005547 Bacteria 2123
294 Ga0070693_100077819 3300005547 Bacteria 1969
295 Ga0070693_100090605 3300005547 Bacteria 1842
296 Ga0070665_100010727 3300005548 Bacteria 9272
297 Ga0070665_100014147 3300005548 Bacteria 8017
298 Ga0070665_100082703 3300005548 Bacteria 3216
299 Ga0070665_100084751 3300005548 Bacteria 3174
300 Ga0070665_100147841 3300005548 Bacteria 2352
301 Ga0070665_100237044 3300005548 Bacteria 1825
302 Ga0070665_100423992 3300005548 Bacteria 1339
303 Ga0070665_100529066 3300005548 Unclassified 1191
304 Ga0070665_100781205 3300005548 Bacteria 968
305 Ga0070704_100113532 3300005549 Bacteria 2066
306 Ga0070704_100124348 3300005549 Bacteria 1987
307 Ga0070704_100878593 3300005549 Bacteria 805
308 Ga0068855_100000450 3300005563 Bacteria 50828
309 Ga0068855_100005788 3300005563 Bacteria 15089
310 Ga0068855_100007194 3300005563 Bacteria 13506
311 Ga0068855_100025363 3300005563 Bacteria 7093
312 Ga0068855_100134541 3300005563 Bacteria 2821
313 Ga0068855_100243201 3300005563 Bacteria 2010
314 Ga0068855_100285704 3300005563 Bacteria 1830
315 Ga0068855_100399376 3300005563 Bacteria 1506
316 Ga0068855_100437942 3300005563 Bacteria 1428
317 Ga0068855_101358125 3300005563 Bacteria 734
318 Ga0070664_100000658 3300005564 Bacteria 26393
319 Ga0070664_100002704 3300005564 Bacteria 14316
320 Ga0070664_100019104 3300005564 Bacteria 5635
321 Ga0070664_100041993 3300005564 Bacteria 3861
322 Ga0070664_100083651 3300005564 Bacteria 2753
323 Ga0070664_100261851 3300005564 Bacteria 1556
324 Ga0070664_100309288 3300005564 Bacteria 1430
325 Ga0070664_100452004 3300005564 Bacteria 1180
326 Ga0070664_100492939 3300005564 Bacteria 1129
327 Ga0070664_100729429 3300005564 Bacteria 924
328 Ga0070664_101202464 3300005564 Bacteria 715
329 Ga0068857_100005799 3300005577 Bacteria 10556
330 Ga0068857_100086667 3300005577 Bacteria 2800
331 Ga0068857_100098008 3300005577 Bacteria 2629
332 Ga0068857_100128153 3300005577 Bacteria 2287
333 Ga0068857_100594720 3300005577 Bacteria 1045
334 Ga0068857_100687870 3300005577 Bacteria 971
335 Ga0068857_100815666 3300005577 Bacteria 891
336 Ga0068854_100013441 3300005578 Bacteria 5374
337 Ga0068854_100030042 3300005578 Bacteria 3766
338 Ga0068854_100041866 3300005578 Bacteria 3238
339 Ga0068854_100050573 3300005578 Bacteria 2974
340 Ga0068854_100113282 3300005578 Bacteria 2049
341 Ga0068854_100266585 3300005578 Bacteria 1373
342 Ga0068856_100000350 3300005614 Bacteria 50393
343 Ga0068856_100006095 3300005614 Bacteria 11842
344 Ga0068856_100021309 3300005614 Bacteria 6298
345 Ga0068856_100032074 3300005614 Bacteria 5142
346 Ga0068856_100074182 3300005614 Bacteria 3368
347 Ga0070702_100014764 3300005615 Bacteria 3970
348 Ga0070702_100428814 3300005615 Bacteria 954
349 Ga0070702_100610941 3300005615 Bacteria 819
350 Ga0070702_100724592 3300005615 Bacteria 761
351 Ga0070702_100774019 3300005615 Bacteria 739
352 Ga0068852_100000823 3300005616 Bacteria 20478
353 Ga0068852_100000940 3300005616 Bacteria 19237
354 Ga0068852_100006323 3300005616 Bacteria 8545
355 Ga0068852_100008545 3300005616 Bacteria 7552
356 Ga0068852_100032464 3300005616 Bacteria 4324
357 Ga0068852_100035269 3300005616 Bacteria 4171
358 Ga0068852_100101705 3300005616 Bacteria 2596
359 Ga0068852_100129902 3300005616 Bacteria 2319
360 Ga0068852_100225160 3300005616 Bacteria 1785
361 Ga0068859_100001741 3300005617 Bacteria 22164
362 Ga0068859_100006755 3300005617 Bacteria 11649
363 Ga0068859_100013682 3300005617 Bacteria 8133
364 Ga0068859_100015466 3300005617 Bacteria 7665
365 Ga0068859_100018437 3300005617 Bacteria 7015
366 Ga0068859_100146194 3300005617 Bacteria 2439
367 Ga0068859_100241082 3300005617 Bacteria 1897
368 Ga0068859_100437758 3300005617 Bacteria 1403
369 Ga0068859_100692971 3300005617 Bacteria 1110
370 Ga0068864_100004626 3300005618 Bacteria 11286
371 Ga0068864_100008845 3300005618 Bacteria 8303
372 Ga0068864_100040417 3300005618 Bacteria 3990
373 Ga0068864_100079555 3300005618 Bacteria 2870
374 Ga0068864_100182425 3300005618 Bacteria 1920
375 Ga0068864_100366211 3300005618 Bacteria 1363
376 Ga0068864_100527486 3300005618 Bacteria 1139
377 Ga0068864_100665022 3300005618 Bacteria 1015
378 Ga0068864_100713124 3300005618 Bacteria 981
379 Ga0068864_100904203 3300005618 Bacteria 872
380 Ga0068864_101182483 3300005618 Bacteria 763
381 Ga0068864_101335995 3300005618 Bacteria 718
382 Ga0068866_10001140 3300005718 Bacteria 11673
383 Ga0068866_10142945 3300005718 Bacteria 1376
384 Ga0068866_10914367 3300005718 Bacteria 618
385 Ga0068861_100020343 3300005719 Bacteria 4752
386 Ga0068861_100021902 3300005719 Bacteria 4597
387 Ga0068861_100133909 3300005719 Bacteria 2014
388 Ga0068861_100538340 3300005719 Bacteria 1062
389 Ga0068861_100830338 3300005719 Unclassified 870
390 Ga0068861_101114476 3300005719 Bacteria 759
391 Ga0068861_101217472 3300005719 Bacteria 729
392 Ga0068851_10002888 3300005834 Bacteria 7590
393 Ga0068851_10010098 3300005834 Bacteria 4398
394 Ga0068851_10015536 3300005834 Bacteria 3629
395 Ga0068851_10017493 3300005834 Bacteria 3444
396 Ga0068851_10045665 3300005834 Bacteria 2214
397 Ga0068851_10102684 3300005834 Bacteria 1519
398 Ga0068851_10462328 3300005834 Bacteria 756
399 Ga0068870_10011295 3300005840 Bacteria 4136
400 Ga0068870_10013697 3300005840 Bacteria 3818
401 Ga0068870_10024771 3300005840 Bacteria 2971
402 Ga0068870_10146490 3300005840 Bacteria 1387
403 Ga0068870_10155989 3300005840 Bacteria 1349
404 Ga0068870_10427668 3300005840 Bacteria 868
405 Ga0068870_10434541 3300005840 Bacteria 862
406 Ga0068863_100007778 3300005841 Bacteria 10479
407 Ga0068863_100010341 3300005841 Bacteria 9063
408 Ga0068863_100017079 3300005841 Bacteria 6959
409 Ga0068863_100017142 3300005841 Bacteria 6946
410 Ga0068863_100089280 3300005841 Bacteria 2922
411 Ga0068863_100089474 3300005841 Bacteria 2919
412 Ga0068863_100152609 3300005841 Bacteria 2211
413 Ga0068863_100381561 3300005841 Bacteria 1376
414 Ga0068863_100410416 3300005841 Bacteria 1326
415 Ga0068863_100462731 3300005841 Bacteria 1246
416 Ga0068863_100503377 3300005841 Bacteria 1193
417 Ga0068863_100717650 3300005841 Bacteria 994
418 Ga0068858_100005201 3300005842 Bacteria 12750
419 Ga0068858_100007116 3300005842 Bacteria 10863
420 Ga0068858_100008383 3300005842 Bacteria 9942
421 Ga0068858_100025618 3300005842 Bacteria 5488
422 Ga0068858_100031012 3300005842 Bacteria 4965
423 Ga0068858_100038624 3300005842 Bacteria 4429
424 Ga0068858_100097462 3300005842 Bacteria 2741
425 Ga0068858_100112030 3300005842 Bacteria 2548
426 Ga0068858_100248656 3300005842 Bacteria 1689
427 Ga0068858_100554054 3300005842 Bacteria 1113
428 Ga0068858_101128837 3300005842 Bacteria 770
429 Ga0068860_100003853 3300005843 Bacteria 15413
430 Ga0068860_100006923 3300005843 Bacteria 11363
431 Ga0068860_100028491 3300005843 Bacteria 5376
432 Ga0068860_100049948 3300005843 Bacteria 3983
433 Ga0068860_100058629 3300005843 Bacteria 3660
434 Ga0068860_100103036 3300005843 Bacteria 2724
435 Ga0068860_100118186 3300005843 Bacteria 2537
436 Ga0068860_100142833 3300005843 Bacteria 2302
437 Ga0068860_100272969 3300005843 Bacteria 1651
438 Ga0068860_100289383 3300005843 Bacteria 1603
439 Ga0068860_100438342 3300005843 Bacteria 1297
440 Ga0068860_100466196 3300005843 Bacteria 1257
441 Ga0068860_100640400 3300005843 Bacteria 1070
442 Ga0068862_100007988 3300005844 Bacteria 8753
443 Ga0068862_100016343 3300005844 Bacteria 6176
444 Ga0068862_100022934 3300005844 Bacteria 5226
445 Ga0068862_100045373 3300005844 Bacteria 3750
446 Ga0068862_100206038 3300005844 Bacteria 1775
447 Ga0070715_10497504 3300006163 Bacteria 697
448 Ga0070716_100016651 3300006173 Bacteria 3799
449 Ga0070716_100301596 3300006173 Bacteria 1115
450 Ga0070716_101018324 3300006173 Bacteria 656
451 Ga0070712_100003612 3300006175 Bacteria 9538
452 Ga0070712_100004881 3300006175 Bacteria 8295
453 Ga0070712_100635049 3300006175 Bacteria 906
454 Ga0070712_100911020 3300006175 Bacteria 758
455 Ga0075362_10059457 3300006177 Bacteria 1726
456 Ga0075367_10389397 3300006178 Bacteria 881
457 Ga0075366_10161046 3300006195 Bacteria 1360
458 Ga0075366_10223903 3300006195 Bacteria 1146
459 Ga0075366_10569283 3300006195 Bacteria 702
460 Ga0097621_100005070 3300006237 Bacteria 9257
461 Ga0097621_100011618 3300006237 Bacteria 6493
462 Ga0097621_100014528 3300006237 Bacteria 5896
463 Ga0097621_100059433 3300006237 Bacteria 3130
464 Ga0097621_100085160 3300006237 Bacteria 2636
465 Ga0097621_100112531 3300006237 Bacteria 2302
466 Ga0097621_100175283 3300006237 Bacteria 1851
467 Ga0097621_100206410 3300006237 Bacteria 1707
468 Ga0097621_100211255 3300006237 Bacteria 1688
469 Ga0097621_100213448 3300006237 Bacteria 1679
470 Ga0097621_100970915 3300006237 Bacteria 794
471 Ga0097621_101005143 3300006237 Bacteria 780
472 Ga0097621_101014047 3300006237 Bacteria 777
473 Ga0075370_10007832 3300006353 Bacteria 5464
474 Ga0075370_10301590 3300006353 Bacteria 953
475 Ga0068871_100004840 3300006358 Bacteria 9410
476 Ga0068871_100009792 3300006358 Bacteria 6954
477 Ga0068871_100032204 3300006358 Bacteria 4140
478 Ga0068871_100111440 3300006358 Bacteria 2302
479 Ga0068871_100223181 3300006358 Bacteria 1633
480 Ga0068871_100228649 3300006358 Bacteria 1614
481 Ga0068871_100275257 3300006358 Bacteria 1471
482 Ga0075428_100027531 3300006844 Bacteria 6290
483 Ga0075428_101296960 3300006844 Bacteria 766
484 Ga0075434_100007245 3300006871 Bacteria 10262
485 Ga0075434_100336236 3300006871 Bacteria 1531
486 Ga0075429_100001051 3300006880 Bacteria 22037
487 Ga0075429_100414980 3300006880 Bacteria 1179
488 Ga0068865_100006023 3300006881 Bacteria 7387
489 Ga0068865_100017868 3300006881 Bacteria 4568
490 Ga0068865_100144694 3300006881 Bacteria 1796
491 Ga0068865_100204565 3300006881 Bacteria 1535
492 Ga0068865_101512517 3300006881 Bacteria 602
493 Ga0075436_100189631 3300006914 Bacteria 1454
494 Ga0075436_100299875 3300006914 Bacteria 1152
495 Ga0097620_100001741 3300006931 Bacteria 22164
496 Ga0097620_100006755 3300006931 Bacteria 11649
497 Ga0097620_100013682 3300006931 Bacteria 8133
498 Ga0097620_100015466 3300006931 Bacteria 7665
499 Ga0097620_100018437 3300006931 Bacteria 7015
500 Ga0097620_100146188 3300006931 Bacteria 2439
501 Ga0097620_100241073 3300006931 Bacteria 1897
502 Ga0097620_100437775 3300006931 Bacteria 1403
503 Ga0097620_100693026 3300006931 Bacteria 1110
504 Ga0079104_1000001 3300006946 Bacteria 521847
505 Ga0075435_100091917 3300007076 Bacteria 2505
506 Ga0099794_10014365 3300007265 Bacteria 3469
507 Ga0099794_10019347 3300007265 Bacteria 3066
508 Ga0099794_10030122 3300007265 Bacteria 2532
509 Ga0105240_10001889 3300009093 Bacteria 34824
510 Ga0105240_10008787 3300009093 Bacteria 14390
511 Ga0105240_10013727 3300009093 Bacteria 11102
512 Ga0105240_10022316 3300009093 Bacteria 8396
513 Ga0105240_11738242 3300009093 Bacteria 651
514 Ga0111539_10077714 3300009094 Bacteria 3906
515 Ga0111539_10868363 3300009094 Bacteria 1049
516 Ga0105245_10009343 3300009098 Bacteria 8553
517 Ga0105245_10009415 3300009098 Bacteria 8519
518 Ga0105245_10035818 3300009098 Bacteria 4406
519 Ga0105245_10082944 3300009098 Bacteria 2933
520 Ga0105245_10492541 3300009098 Bacteria 1241
521 Ga0105245_10932365 3300009098 Bacteria 911
522 Ga0105245_11873599 3300009098 Bacteria 653
523 Ga0105247_10018997 3300009101 Bacteria 4128
524 Ga0105247_10072757 3300009101 Bacteria 2152
525 Ga0114129_10272777 3300009147 Bacteria 2263
526 Ga0105243_11837791 3300009148 Bacteria 637
527 Ga0105241_10006963 3300009174 Bacteria 8316
528 Ga0105241_10011046 3300009174 Bacteria 6625
529 Ga0105241_10063871 3300009174 Bacteria 2842
530 Ga0105241_10692202 3300009174 Bacteria 930
531 Ga0105241_11250830 3300009174 Bacteria 705
532 Ga0105241_11337483 3300009174 Bacteria 684
533 Ga0105242_10008131 3300009176 Bacteria 8072
534 Ga0105242_10077721 3300009176 Bacteria 2769
535 Ga0105242_10258737 3300009176 Bacteria 1571
536 Ga0105248_10000878 3300009177 Bacteria 33719
537 Ga0105248_10003568 3300009177 Bacteria 17250
538 Ga0105248_10013308 3300009177 Bacteria 9056
539 Ga0105248_10057367 3300009177 Bacteria 4371
540 Ga0105248_10081931 3300009177 Bacteria 3628
541 Ga0105248_10101263 3300009177 Bacteria 3247
542 Ga0105248_10276297 3300009177 Bacteria 1891
543 Ga0105248_10759452 3300009177 Bacteria 1094
544 Ga0105248_11098406 3300009177 Bacteria 899
545 Ga0105237_10024857 3300009545 Bacteria 6128
546 Ga0105237_10053862 3300009545 Bacteria 4034
547 Ga0105237_10078968 3300009545 Bacteria 3281
548 Ga0105237_10114390 3300009545 Bacteria 2691
549 Ga0105237_10300962 3300009545 Bacteria 1607
550 Ga0105237_11011002 3300009545 Bacteria 838
551 Ga0105237_11911226 3300009545 Bacteria 602
552 Ga0105238_10009503 3300009551 Bacteria 9731
553 Ga0105238_10035807 3300009551 Bacteria 5045
554 Ga0105238_10331229 3300009551 Bacteria 1509
555 Ga0105238_11640935 3300009551 Bacteria 673
556 Ga0105238_12411654 3300009551 Bacteria 562
557 Ga0105249_10140898 3300009553 Bacteria 2312
558 Ga0105249_10157207 3300009553 Bacteria 2194
559 Ga0105249_10188866 3300009553 Bacteria 2010
560 Ga0105249_10317138 3300009553 Bacteria 1569
561 Ga0105249_10669218 3300009553 Bacteria 1097
562 Ga0105249_11075945 3300009553 Bacteria 874
563 Ga0105239_10170886 3300010375 Bacteria 2431
564 Ga0105239_10696001 3300010375 Bacteria 1162
565 Ga0105239_10932774 3300010375 Bacteria 997
566 Ga0105239_11507199 3300010375 Bacteria 777
567 Ga0105246_10023747 3300011119 Bacteria 3971
568 Ga0105246_10145440 3300011119 Bacteria 1788
569 Ga0157373_10001063 3300013100 Bacteria 21146
570 Ga0157373_10013745 3300013100 Bacteria 5935
571 Ga0157373_10170001 3300013100 Bacteria 1534
572 Ga0157371_10001162 3300013102 Bacteria 28274
573 Ga0157371_10695242 3300013102 Bacteria 761
574 Ga0157371_10703964 3300013102 Bacteria 756
575 Ga0157371_10804122 3300013102 Bacteria 709
576 Ga0157370_10018289 3300013104 Bacteria 7050
577 Ga0157370_10042167 3300013104 Bacteria 4399
578 Ga0157370_10046754 3300013104 Bacteria 4150
579 Ga0157370_10114567 3300013104 Bacteria 2518
580 Ga0157370_10361564 3300013104 Bacteria 1337
581 Ga0157370_10683768 3300013104 Bacteria 937
582 Ga0157370_10734214 3300013104 Bacteria 900
583 Ga0157369_10002639 3300013105 Bacteria 21418
584 Ga0157369_10054350 3300013105 Bacteria 4325
585 Ga0157369_10203685 3300013105 Bacteria 2076
586 Ga0157369_10229695 3300013105 Bacteria 1940
587 Ga0157369_10275373 3300013105 Bacteria 1753
588 Ga0157369_10412080 3300013105 Bacteria 1401
589 Ga0157369_10442483 3300013105 Bacteria 1346
590 Ga0157369_11160926 3300013105 Bacteria 789
591 Ga0157374_10001809 3300013296 Bacteria 18004
592 Ga0157374_10035751 3300013296 Bacteria 4546
593 Ga0157374_10035915 3300013296 Bacteria 4537
594 Ga0157374_10133566 3300013296 Bacteria 2404
595 Ga0157374_10215766 3300013296 Bacteria 1882
596 Ga0157374_10659770 3300013296 Bacteria 1058
597 Ga0157374_10700986 3300013296 Bacteria 1025
598 Ga0157374_11543223 3300013296 Bacteria 688
599 Ga0157378_10009283 3300013297 Bacteria 8568
600 Ga0157378_10009954 3300013297 Bacteria 8288
601 Ga0157378_10030000 3300013297 Bacteria 4803
602 Ga0157378_10401907 3300013297 Bacteria 1350
603 Ga0157378_10654335 3300013297 Bacteria 1067
604 Ga0163162_10001211 3300013306 Bacteria 24106
605 Ga0163162_10011811 3300013306 Bacteria 8518
606 Ga0163162_10096594 3300013306 Bacteria 3043
607 Ga0163162_10201399 3300013306 Bacteria 2119
608 Ga0163162_10328857 3300013306 Bacteria 1661
609 Ga0163162_10617676 3300013306 Bacteria 1209
610 Ga0163162_10717152 3300013306 Bacteria 1121
611 Ga0163162_10934839 3300013306 Bacteria 979
612 Ga0157372_10001523 3300013307 Bacteria 25194
613 Ga0157372_10001692 3300013307 Bacteria 23859
614 Ga0157372_10006706 3300013307 Bacteria 12248
615 Ga0157372_10021790 3300013307 Bacteria 6926
616 Ga0157372_10038529 3300013307 Bacteria 5275
617 Ga0157372_10057008 3300013307 Bacteria 4366
618 Ga0157372_10125179 3300013307 Bacteria 2955
619 Ga0157372_10127426 3300013307 Bacteria 2927
620 Ga0157372_10235050 3300013307 Bacteria 2125
621 Ga0157372_10342593 3300013307 Bacteria 1741
622 Ga0157372_10611369 3300013307 Bacteria 1270
623 Ga0157372_10653370 3300013307 Bacteria 1225
624 Ga0157372_11040013 3300013307 Bacteria 948
625 Ga0157372_11081066 3300013307 Bacteria 928
626 Ga0157372_11268004 3300013307 Bacteria 851
627 Ga0157375_10005469 3300013308 Bacteria 11045
628 Ga0157375_10008616 3300013308 Bacteria 8929
629 Ga0157375_10009546 3300013308 Bacteria 8518
630 Ga0157375_10030473 3300013308 Bacteria 5087
631 Ga0157375_10139594 3300013308 Bacteria 2549
632 Ga0157375_10160405 3300013308 Bacteria 2390
633 Ga0157375_10192365 3300013308 Bacteria 2195
634 Ga0157375_10341164 3300013308 Bacteria 1664
635 Ga0157375_11331140 3300013308 Bacteria 845
636 Ga0163163_10001352 3300014325 Bacteria 20693
637 Ga0163163_10005124 3300014325 Bacteria 11296
638 Ga0163163_10017644 3300014325 Bacteria 6662
639 Ga0163163_10116185 3300014325 Bacteria 2707
640 Ga0163163_10129546 3300014325 Bacteria 2563
641 Ga0163163_10277309 3300014325 Bacteria 1728
642 Ga0163163_10788761 3300014325 Bacteria 1013
643 Ga0163163_11206576 3300014325 Bacteria 819
644 Ga0157380_10075229 3300014326 Bacteria 2744
645 Ga0157380_10127469 3300014326 Bacteria 2166
646 Ga0157380_10183319 3300014326 Bacteria 1841
647 Ga0157380_10323229 3300014326 Bacteria 1431
648 Ga0157380_10406241 3300014326 Bacteria 1294
649 Ga0157380_11896899 3300014326 Bacteria 656
650 Ga0157377_10005762 3300014745 Bacteria 5846
651 Ga0157377_10020805 3300014745 Bacteria 3442
652 Ga0157377_10192613 3300014745 Bacteria 1289
653 Ga0157377_10354686 3300014745 Bacteria 985
654 Ga0157379_10003084 3300014968 Bacteria 14092
655 Ga0157379_10006078 3300014968 Bacteria 10396
656 Ga0157379_10014992 3300014968 Bacteria 6798
657 Ga0157379_10044107 3300014968 Bacteria 3981
658 Ga0157379_10094110 3300014968 Bacteria 2688
659 Ga0157379_10177073 3300014968 Bacteria 1926
660 Ga0157379_10290174 3300014968 Bacteria 1490
661 Ga0157379_10295756 3300014968 Bacteria 1475
662 Ga0157379_10877914 3300014968 Bacteria 850
663 Ga0157376_10005980 3300014969 Bacteria 8550
664 Ga0157376_10006034 3300014969 Bacteria 8519
665 Ga0157376_10008657 3300014969 Bacteria 7355
666 Ga0157376_10021115 3300014969 Bacteria 5053
667 Ga0157376_10056422 3300014969 Bacteria 3281
668 Ga0157376_10108541 3300014969 Bacteria 2438
669 Ga0157376_10156469 3300014969 Bacteria 2061
670 Ga0157376_10216043 3300014969 Bacteria 1773
671 Ga0157376_10268444 3300014969 Bacteria 1602
672 Ga0157376_10329577 3300014969 Bacteria 1454
673 Ga0157376_10432172 3300014969 Bacteria 1280
674 Ga0163161_10091924 3300017792 Bacteria 2246
675 Ga0163161_10292088 3300017792 Bacteria 1281
676 Ga0206356_10378156 3300020070 Bacteria 879
677 Ga0206354_10831956 3300020081 Bacteria 2348
678 Ga0206353_10348253 3300020082 Bacteria 1932
679 Ga0213872_10010960 3300021361 Bacteria 4300
680 Ga0209565_1008854 3300025263 Bacteria 2605
681 Ga0207673_1009582 3300025290 Bacteria 1239
682 Ga0209050_1000118 3300025298 Bacteria 202586
683 Ga0209256_1000015 3300025299 Bacteria 622953
684 Ga0209051_1048365 3300025303 Bacteria 1443
685 Ga0207697_10001322 3300025315 Bacteria 13639
686 Ga0207697_10006351 3300025315 Bacteria 5356
687 Ga0207697_10064319 3300025315 Bacteria 1530
688 Ga0207656_10021638 3300025321 Bacteria 2572
689 Ga0207656_10040066 3300025321 Bacteria 1985
690 Ga0207656_10110599 3300025321 Bacteria 1269
691 Ga0207656_10436309 3300025321 Bacteria 661
692 Ga0207682_10001314 3300025893 Bacteria 11425
693 Ga0207682_10066945 3300025893 Bacteria 1514
694 Ga0207692_10151398 3300025898 Bacteria 1329
695 Ga0207692_10243228 3300025898 Bacteria 1075
696 Ga0207692_10742301 3300025898 Bacteria 639
697 Ga0207642_10049883 3300025899 Bacteria 1884
698 Ga0207642_10059991 3300025899 Bacteria 1762
699 Ga0207642_10086113 3300025899 Bacteria 1539
700 Ga0207642_10228143 3300025899 Bacteria 1045
701 Ga0207710_10224370 3300025900 Bacteria 934
702 Ga0207710_10274693 3300025900 Bacteria 847
703 Ga0207688_10040755 3300025901 Bacteria 2581
704 Ga0207688_10137724 3300025901 Bacteria 1435
705 Ga0207680_10002102 3300025903 Bacteria 9324
706 Ga0207680_10002576 3300025903 Bacteria 8460
707 Ga0207680_10006510 3300025903 Bacteria 5654
708 Ga0207680_10130197 3300025903 Bacteria 1657
709 Ga0207680_10778992 3300025903 Unclassified 686
710 Ga0207685_10052916 3300025905 Bacteria 1574
711 Ga0207699_10020977 3300025906 Bacteria 3512
712 Ga0207699_10045839 3300025906 Bacteria 2554
713 Ga0207699_10156363 3300025906 Bacteria 1513
714 Ga0207699_10542025 3300025906 Bacteria 843
715 Ga0207699_10891022 3300025906 Bacteria 656
716 Ga0207645_10000214 3300025907 Bacteria 48041
717 Ga0207645_10000421 3300025907 Bacteria 35045
718 Ga0207645_10000695 3300025907 Bacteria 27978
719 Ga0207645_10051776 3300025907 Bacteria 2623
720 Ga0207645_10221952 3300025907 Bacteria 1246
721 Ga0207643_10000537 3300025908 Bacteria 24350
722 Ga0207643_10006837 3300025908 Bacteria 6123
723 Ga0207643_10031135 3300025908 Bacteria 2972
724 Ga0207643_10190696 3300025908 Bacteria 1244
725 Ga0207705_10029140 3300025909 Bacteria 3935
726 Ga0207705_10046332 3300025909 Bacteria 3125
727 Ga0207705_10125004 3300025909 Bacteria 1911
728 Ga0207705_10251199 3300025909 Bacteria 1349
729 Ga0207705_10347690 3300025909 Bacteria 1142
730 Ga0207705_10430450 3300025909 Bacteria 1022
731 Ga0207684_10062559 3300025910 Bacteria 3160
732 Ga0207654_10030084 3300025911 Bacteria 2978
733 Ga0207654_10046536 3300025911 Bacteria 2474
734 Ga0207654_10761391 3300025911 Bacteria 698
735 Ga0207707_10002896 3300025912 Bacteria 15301
736 Ga0207707_10012845 3300025912 Bacteria 7286
737 Ga0207707_10741698 3300025912 Bacteria 822
738 Ga0207695_10053255 3300025913 Bacteria 4233
739 Ga0207695_10460568 3300025913 Bacteria 1155
740 Ga0207695_11164634 3300025913 Bacteria 651
741 Ga0207671_10053265 3300025914 Bacteria 2998
742 Ga0207671_10333599 3300025914 Bacteria 1201
743 Ga0207693_10000652 3300025915 Bacteria 31091
744 Ga0207693_10257300 3300025915 Bacteria 1369
745 Ga0207693_10465167 3300025915 Bacteria 988
746 Ga0207663_10002608 3300025916 Bacteria 8679
747 Ga0207663_10080045 3300025916 Bacteria 2135
748 Ga0207660_10040475 3300025917 Bacteria 3263
749 Ga0207660_10239956 3300025917 Bacteria 1428
750 Ga0207662_10045518 3300025918 Bacteria 2594
751 Ga0207662_10260182 3300025918 Bacteria 1142
752 Ga0207657_10000750 3300025919 Bacteria 34395
753 Ga0207657_10002560 3300025919 Bacteria 19672
754 Ga0207657_10007901 3300025919 Bacteria 10850
755 Ga0207657_10024835 3300025919 Bacteria 5539
756 Ga0207657_10032956 3300025919 Bacteria 4674
757 Ga0207649_10004987 3300025920 Bacteria 7171
758 Ga0207649_10011486 3300025920 Bacteria 4884
759 Ga0207649_10053399 3300025920 Bacteria 2511
760 Ga0207649_10162744 3300025920 Bacteria 1547
761 Ga0207649_10732780 3300025920 Bacteria 768
762 Ga0207649_10918792 3300025920 Bacteria 687
763 Ga0207652_10114356 3300025921 Bacteria 2396
764 Ga0207652_10235188 3300025921 Bacteria 1651
765 Ga0207652_10523802 3300025921 Bacteria 1066
766 Ga0207646_10014581 3300025922 Bacteria 7454
767 Ga0207646_11206169 3300025922 Bacteria 663
768 Ga0207681_10029078 3300025923 Bacteria 3584
769 Ga0207681_10062396 3300025923 Bacteria 2566
770 Ga0207681_10200987 3300025923 Bacteria 1530
771 Ga0207681_10301407 3300025923 Bacteria 1268
772 Ga0207681_10318132 3300025923 Bacteria 1237
773 Ga0207694_10005853 3300025924 Bacteria 9423
774 Ga0207694_10016726 3300025924 Bacteria 5544
775 Ga0207694_10041190 3300025924 Bacteria 3558
776 Ga0207694_10323906 3300025924 Bacteria 1272
777 Ga0207694_10498964 3300025924 Bacteria 1019
778 Ga0207694_11520836 3300025924 Bacteria 565
779 Ga0207650_10008724 3300025925 Bacteria 6923
780 Ga0207650_10017230 3300025925 Bacteria 5056
781 Ga0207650_10020685 3300025925 Bacteria 4644
782 Ga0207650_10032090 3300025925 Bacteria 3799
783 Ga0207650_10044419 3300025925 Bacteria 3265
784 Ga0207650_10094251 3300025925 Bacteria 2293
785 Ga0207650_10116313 3300025925 Bacteria 2076
786 Ga0207650_10177971 3300025925 Bacteria 1694
787 Ga0207650_10895675 3300025925 Bacteria 753
788 Ga0207650_11345727 3300025925 Bacteria 608
789 Ga0207659_10002136 3300025926 Bacteria 11725
790 Ga0207659_10012703 3300025926 Bacteria 5372
791 Ga0207659_10017200 3300025926 Bacteria 4719
792 Ga0207659_10041351 3300025926 Bacteria 3228
793 Ga0207659_10074554 3300025926 Bacteria 2487
794 Ga0207659_10377670 3300025926 Bacteria 1181
795 Ga0207687_10002403 3300025927 Bacteria 12697
796 Ga0207687_10009624 3300025927 Bacteria 6317
797 Ga0207687_10089592 3300025927 Bacteria 2240
798 Ga0207687_11428951 3300025927 Bacteria 594
799 Ga0207700_10006059 3300025928 Bacteria 7282
800 Ga0207700_10006798 3300025928 Bacteria 6950
801 Ga0207700_10061260 3300025928 Bacteria 2853
802 Ga0207700_10302396 3300025928 Bacteria 1382
803 Ga0207700_10386787 3300025928 Bacteria 1224
804 Ga0207700_10742649 3300025928 Bacteria 877
805 Ga0207700_11277872 3300025928 Bacteria 654
806 Ga0207664_10000912 3300025929 Bacteria 19958
807 Ga0207664_10055495 3300025929 Bacteria 3144
808 Ga0207664_10462445 3300025929 Bacteria 1133
809 Ga0207664_10534050 3300025929 Bacteria 1052
810 Ga0207664_11133358 3300025929 Bacteria 699
811 Ga0207644_10001317 3300025931 Bacteria 15943
812 Ga0207644_10001544 3300025931 Bacteria 14840
813 Ga0207644_10007546 3300025931 Bacteria 7092
814 Ga0207644_10010859 3300025931 Bacteria 6012
815 Ga0207644_10039904 3300025931 Bacteria 3316
816 Ga0207644_10044769 3300025931 Bacteria 3146
817 Ga0207644_10111826 3300025931 Bacteria 2066
818 Ga0207644_10151743 3300025931 Bacteria 1793
819 Ga0207644_10263945 3300025931 Bacteria 1378
820 Ga0207644_10392191 3300025931 Bacteria 1133
821 Ga0207644_10504612 3300025931 Bacteria 998
822 Ga0207690_10000826 3300025932 Bacteria 19864
823 Ga0207690_10018363 3300025932 Bacteria 4289
824 Ga0207690_10024622 3300025932 Bacteria 3771
825 Ga0207690_10028312 3300025932 Bacteria 3551
826 Ga0207690_10265877 3300025932 Bacteria 1330
827 Ga0207690_10273017 3300025932 Bacteria 1314
828 Ga0207706_10000465 3300025933 Bacteria 43279
829 Ga0207706_10004984 3300025933 Bacteria 12403
830 Ga0207706_10008050 3300025933 Bacteria 9728
831 Ga0207706_10013535 3300025933 Bacteria 7414
832 Ga0207706_10141051 3300025933 Bacteria 2120
833 Ga0207706_10219105 3300025933 Bacteria 1667
834 Ga0207706_10228234 3300025933 Bacteria 1629
835 Ga0207686_10016224 3300025934 Bacteria 4176
836 Ga0207686_10081829 3300025934 Bacteria 2109
837 Ga0207709_10193197 3300025935 Bacteria 1448
838 Ga0207709_10226720 3300025935 Bacteria 1351
839 Ga0207670_10008447 3300025936 Bacteria 5817
840 Ga0207670_10028643 3300025936 Bacteria 3540
841 Ga0207670_10041928 3300025936 Bacteria 3013
842 Ga0207670_10122272 3300025936 Bacteria 1894
843 Ga0207670_10226472 3300025936 Bacteria 1434
844 Ga0207670_10644180 3300025936 Bacteria 873
845 Ga0207670_10912645 3300025936 Bacteria 736
846 Ga0207669_10016731 3300025937 Bacteria 3737
847 Ga0207669_10049351 3300025937 Bacteria 2508
848 Ga0207669_10062316 3300025937 Bacteria 2296
849 Ga0207669_10168199 3300025937 Bacteria 1557
850 Ga0207669_10219510 3300025937 Bacteria 1394
851 Ga0207669_10349222 3300025937 Bacteria 1142
852 Ga0207704_10003217 3300025938 Bacteria 7394
853 Ga0207704_10051971 3300025938 Bacteria 2482
854 Ga0207704_10089364 3300025938 Bacteria 2018
855 Ga0207704_10159849 3300025938 Bacteria 1602
856 Ga0207704_10514262 3300025938 Bacteria 967
857 Ga0207704_10934686 3300025938 Bacteria 731
858 Ga0207665_10006908 3300025939 Bacteria 7511
859 Ga0207665_10439099 3300025939 Bacteria 1000
860 Ga0207691_10000084 3300025940 Bacteria 80075
861 Ga0207691_10000577 3300025940 Bacteria 36651
862 Ga0207691_10001328 3300025940 Bacteria 24681
863 Ga0207691_10007830 3300025940 Bacteria 10292
864 Ga0207691_10009589 3300025940 Bacteria 9292
865 Ga0207691_10024667 3300025940 Bacteria 5655
866 Ga0207691_10050830 3300025940 Bacteria 3793
867 Ga0207691_10133319 3300025940 Bacteria 2193
868 Ga0207691_10168116 3300025940 Bacteria 1921
869 Ga0207691_10277792 3300025940 Bacteria 1441
870 Ga0207691_10304882 3300025940 Bacteria 1367
871 Ga0207711_10000087 3300025941 Bacteria 98302
872 Ga0207711_10068506 3300025941 Bacteria 3074
873 Ga0207711_10079464 3300025941 Bacteria 2863
874 Ga0207711_10554326 3300025941 Bacteria 1072
875 Ga0207711_11864467 3300025941 Bacteria 544
876 Ga0207689_10000069 3300025942 Bacteria 83053
877 Ga0207689_10001822 3300025942 Bacteria 20138
878 Ga0207689_10004226 3300025942 Bacteria 13059
879 Ga0207689_10014272 3300025942 Bacteria 6760
880 Ga0207689_10020777 3300025942 Bacteria 5522
881 Ga0207689_10127315 3300025942 Bacteria 2095
882 Ga0207689_10392687 3300025942 Bacteria 1156
883 Ga0207661_10009752 3300025944 Bacteria 6897
884 Ga0207661_10068005 3300025944 Bacteria 2899
885 Ga0207661_10081925 3300025944 Bacteria 2667
886 Ga0207661_10139313 3300025944 Bacteria 2086
887 Ga0207661_10307273 3300025944 Bacteria 1423
888 Ga0207661_10495668 3300025944 Bacteria 1116
889 Ga0207661_11402725 3300025944 Bacteria 641
890 Ga0207679_10002617 3300025945 Bacteria 11097
891 Ga0207679_10003953 3300025945 Bacteria 9205
892 Ga0207679_10009503 3300025945 Bacteria 6234
893 Ga0207679_10018509 3300025945 Bacteria 4668
894 Ga0207679_10024164 3300025945 Bacteria 4164
895 Ga0207679_10033839 3300025945 Bacteria 3600
896 Ga0207679_10224474 3300025945 Bacteria 1582
897 Ga0207679_10328735 3300025945 Bacteria 1326
898 Ga0207679_10353045 3300025945 Bacteria 1282
899 Ga0207679_10655101 3300025945 Bacteria 950
900 Ga0207667_10000490 3300025949 Bacteria 52292
901 Ga0207667_10001200 3300025949 Bacteria 32473
902 Ga0207667_10020237 3300025949 Bacteria 7405
903 Ga0207667_10034332 3300025949 Bacteria 5448
904 Ga0207667_10049680 3300025949 Bacteria 4429
905 Ga0207667_10230511 3300025949 Bacteria 1896
906 Ga0207667_10754105 3300025949 Bacteria 972
907 Ga0207651_10034097 3300025960 Bacteria 3292
908 Ga0207651_10058537 3300025960 Bacteria 2663
909 Ga0207651_10076025 3300025960 Bacteria 2399
910 Ga0207651_10098714 3300025960 Bacteria 2160
911 Ga0207651_10412067 3300025960 Bacteria 1152
912 Ga0207651_10896648 3300025960 Bacteria 790
913 Ga0207712_10169501 3300025961 Bacteria 1705
914 Ga0207712_10588000 3300025961 Bacteria 961
915 Ga0207712_10598117 3300025961 Bacteria 954
916 Ga0207668_10002833 3300025972 Bacteria 10154
917 Ga0207668_10020812 3300025972 Bacteria 4175
918 Ga0207668_10072731 3300025972 Bacteria 2461
919 Ga0207668_10082765 3300025972 Bacteria 2333
920 Ga0207668_10096561 3300025972 Bacteria 2185
921 Ga0207668_10139413 3300025972 Bacteria 1862
922 Ga0207668_10184349 3300025972 Bacteria 1649
923 Ga0207668_10264603 3300025972 Bacteria 1403
924 Ga0207640_10004420 3300025981 Bacteria 7627
925 Ga0207640_10196228 3300025981 Bacteria 1526
926 Ga0207640_10322519 3300025981 Bacteria 1230
927 Ga0207640_10381345 3300025981 Bacteria 1142
928 Ga0207640_10836124 3300025981 Bacteria 800
929 Ga0207640_10877677 3300025981 Bacteria 782
930 Ga0207658_10004792 3300025986 Bacteria 9360
931 Ga0207658_10015419 3300025986 Bacteria 5242
932 Ga0207658_10030693 3300025986 Bacteria 3808
933 Ga0207658_10034077 3300025986 Bacteria 3636
934 Ga0207658_10040854 3300025986 Bacteria 3356
935 Ga0207658_10131100 3300025986 Bacteria 2014
936 Ga0207658_10385542 3300025986 Bacteria 1228
937 Ga0207658_10836479 3300025986 Bacteria 837
938 Ga0207677_10002351 3300026023 Bacteria 9910
939 Ga0207677_10003281 3300026023 Bacteria 8554
940 Ga0207677_10013587 3300026023 Bacteria 4725
941 Ga0207677_10096955 3300026023 Bacteria 2159
942 Ga0207677_10205834 3300026023 Bacteria 1567
943 Ga0207677_10258002 3300026023 Bacteria 1419
944 Ga0207677_10315814 3300026023 Bacteria 1296
945 Ga0207677_10387167 3300026023 Bacteria 1182
946 Ga0207677_11023988 3300026023 Bacteria 750
947 Ga0207703_10003435 3300026035 Bacteria 13293
948 Ga0207703_10020784 3300026035 Bacteria 5136
949 Ga0207703_10047877 3300026035 Bacteria 3448
950 Ga0207703_10097054 3300026035 Bacteria 2489
951 Ga0207703_10099385 3300026035 Bacteria 2463
952 Ga0207703_10234858 3300026035 Bacteria 1645
953 Ga0207703_10535412 3300026035 Bacteria 1103
954 Ga0207703_10927693 3300026035 Bacteria 834
955 Ga0207703_11135969 3300026035 Bacteria 751
956 Ga0207703_11166214 3300026035 Bacteria 740
957 Ga0207639_10002729 3300026041 Bacteria 11845
958 Ga0207639_10085045 3300026041 Bacteria 2515
959 Ga0207639_10115683 3300026041 Bacteria 2194
960 Ga0207639_10206423 3300026041 Bacteria 1688
961 Ga0207639_10225232 3300026041 Bacteria 1622
962 Ga0207639_10590504 3300026041 Bacteria 1023
963 Ga0207639_10845258 3300026041 Bacteria 854
964 Ga0207678_10000429 3300026067 Bacteria 38134
965 Ga0207678_10024896 3300026067 Bacteria 5226
966 Ga0207678_10063616 3300026067 Bacteria 3170
967 Ga0207678_10257659 3300026067 Bacteria 1495
968 Ga0207678_10433641 3300026067 Bacteria 1141
969 Ga0207678_10483840 3300026067 Bacteria 1078
970 Ga0207678_10955631 3300026067 Bacteria 758
971 Ga0207708_10000710 3300026075 Bacteria 25096
972 Ga0207708_10070723 3300026075 Bacteria 2672
973 Ga0207708_10609583 3300026075 Bacteria 926
974 Ga0207708_10728229 3300026075 Bacteria 850
975 Ga0207702_10000635 3300026078 Bacteria 38453
976 Ga0207702_10007712 3300026078 Bacteria 9141
977 Ga0207702_10555710 3300026078 Bacteria 1123
978 Ga0207702_10741525 3300026078 Bacteria 969
979 Ga0207641_10000832 3300026088 Bacteria 32828
980 Ga0207641_10008086 3300026088 Bacteria 8714
981 Ga0207641_10028936 3300026088 Bacteria 4581
982 Ga0207641_10046362 3300026088 Bacteria 3663
983 Ga0207641_10074523 3300026088 Bacteria 2928
984 Ga0207641_10091874 3300026088 Bacteria 2657
985 Ga0207641_10252563 3300026088 Bacteria 1647
986 Ga0207641_10430200 3300026088 Bacteria 1272
987 Ga0207641_10484223 3300026088 Bacteria 1199
988 Ga0207641_10623493 3300026088 Bacteria 1057
989 Ga0207641_10848422 3300026088 Bacteria 905
990 Ga0207648_10001494 3300026089 Bacteria 25761
991 Ga0207648_10002166 3300026089 Bacteria 21346
992 Ga0207648_10005304 3300026089 Bacteria 13008
993 Ga0207648_10007639 3300026089 Bacteria 10594
994 Ga0207648_10010002 3300026089 Bacteria 9024
995 Ga0207648_10258076 3300026089 Bacteria 1555
996 Ga0207648_10314828 3300026089 Bacteria 1405
997 Ga0207648_10823879 3300026089 Bacteria 865
998 Ga0207676_10000294 3300026095 Bacteria 43081
999 Ga0207676_10010977 3300026095 Bacteria 6467
1000 Ga0207676_10031242 3300026095 Bacteria 4004
1001 Ga0207676_10034632 3300026095 Bacteria 3824
1002 Ga0207676_10087407 3300026095 Bacteria 2549
1003 Ga0207676_10117327 3300026095 Bacteria 2238
1004 Ga0207676_10157544 3300026095 Bacteria 1963
1005 Ga0207676_10636366 3300026095 Bacteria 1028
1006 Ga0207676_11009222 3300026095 Bacteria 820
1007 Ga0207676_11097917 3300026095 Bacteria 786
1008 Ga0207676_11373440 3300026095 Bacteria 702
1009 Ga0207674_10000140 3300026116 Bacteria 84173
1010 Ga0207674_10001268 3300026116 Bacteria 32991
1011 Ga0207674_10002122 3300026116 Bacteria 25063
1012 Ga0207674_10008483 3300026116 Bacteria 11866
1013 Ga0207674_10066352 3300026116 Bacteria 3635
1014 Ga0207674_10126579 3300026116 Bacteria 2520
1015 Ga0207675_100003688 3300026118 Bacteria 14923
1016 Ga0207675_100024173 3300026118 Bacteria 5650
1017 Ga0207675_100133130 3300026118 Bacteria 2357
1018 Ga0207675_100258972 3300026118 Bacteria 1685
1019 Ga0207675_100621877 3300026118 Bacteria 1084
1020 Ga0207675_100754562 3300026118 Bacteria 984
1021 Ga0207683_10000003 3300026121 Bacteria 191866
1022 Ga0207683_10000355 3300026121 Bacteria 42024
1023 Ga0207683_10004640 3300026121 Bacteria 11848
1024 Ga0207683_10013734 3300026121 Bacteria 6904
1025 Ga0207683_10038235 3300026121 Bacteria 4181
1026 Ga0207683_10041228 3300026121 Bacteria 4030
1027 Ga0207683_10244960 3300026121 Bacteria 1635
1028 Ga0207683_11224833 3300026121 Bacteria 695
1029 Ga0207683_11269342 3300026121 Bacteria 682
1030 Ga0207698_10001629 3300026142 Bacteria 13078
1031 Ga0207698_10016336 3300026142 Bacteria 5000
1032 Ga0207698_10026907 3300026142 Bacteria 4075
1033 Ga0207698_10098460 3300026142 Bacteria 2417
1034 Ga0207698_10140919 3300026142 Bacteria 2077
1035 Ga0207698_10331444 3300026142 Bacteria 1430
1036 Ga0207698_10500209 3300026142 Bacteria 1183
1037 Ga0207698_10694092 3300026142 Bacteria 1012
1038 Ga0207698_12038168 3300026142 Bacteria 588
1039 Ga0209281_1000151 3300027111 Bacteria 167268
1040 Ga0209998_10063347 3300027717 Bacteria 874
1041 Ga0207428_10459083 3300027907 Bacteria 928
1042 Ga0268266_10098208 3300028379 Bacteria 2576
1043 Ga0268266_10398746 3300028379 Bacteria 1300
1044 Ga0268266_10448216 3300028379 Bacteria 1226
1045 Ga0268266_10469980 3300028379 Bacteria 1197
1046 Ga0268266_10507024 3300028379 Bacteria 1153
1047 Ga0268266_11906427 3300028379 Bacteria 568
1048 Ga0268265_10055502 3300028380 Bacteria 3010
1049 Ga0268265_10151504 3300028380 Bacteria 1956
1050 Ga0268265_10171615 3300028380 Bacteria 1854
1051 Ga0268265_10326190 3300028380 Bacteria 1393
1052 Ga0268264_10007174 3300028381 Bacteria 9334
1053 Ga0268264_10007222 3300028381 Bacteria 9303
1054 Ga0268264_10014173 3300028381 Bacteria 6556
1055 Ga0268264_10027411 3300028381 Bacteria 4654
1056 Ga0268264_10072575 3300028381 Bacteria 2919
1057 Ga0268264_10172961 3300028381 Bacteria 1955
1058 Ga0268264_10317376 3300028381 Bacteria 1472
1059 Ga0268264_10469749 3300028381 Bacteria 1222
1060 Ga0268264_10522120 3300028381 Bacteria 1161
1061 Ga0307515_10104002 3300028794 Bacteria 3398
1062 Ga0265328_10010415 3300031239 Bacteria 3745
1063 Ga0265325_10005542 3300031241 Bacteria 7791
1064 Ga0265329_10001188 3300031242 Bacteria 12768
1065 Ga0265331_10000588 3300031250 Bacteria 32461
1066 Ga0265327_10001246 3300031251 Bacteria 33969
1067 Ga0265316_10003969 3300031344 Bacteria 14815
1068 Ga0307513_10039326 3300031456 Bacteria 5244
1069 Ga0307408_100056526 3300031548 Bacteria 2846
1070 Ga0307508_10291073 3300031616 Bacteria 1226
1071 Ga0307508_10303334 3300031616 Bacteria 1189
1072 Ga0265342_10035908 3300031712 Bacteria 3030
1073 Ga0307405_10006897 3300031731 Bacteria 5635
1074 Ga0307405_10150781 3300031731 Bacteria 1634
1075 Ga0307405_10441964 3300031731 Bacteria 1029
1076 Ga0307413_10258834 3300031824 Bacteria 1296
1077 Ga0307413_10272077 3300031824 Bacteria 1269
1078 Ga0307410_10001643 3300031852 Bacteria 10280
1079 Ga0307410_10347028 3300031852 Bacteria 1185
1080 Ga0307406_10002738 3300031901 Bacteria 9617
1081 Ga0307406_10011363 3300031901 Bacteria 5051
1082 Ga0307406_11119924 3300031901 Bacteria 680
1083 Ga0307407_10006893 3300031903 Bacteria 5100
1084 Ga0307407_10082475 3300031903 Bacteria 1949
1085 Ga0307407_10194948 3300031903 Bacteria 1353
1086 Ga0307407_10504138 3300031903 Bacteria 888
1087 Ga0307412_10022675 3300031911 Bacteria 3853
1088 Ga0307412_10072937 3300031911 Unclassified 2347
1089 Ga0307412_10252357 3300031911 Bacteria 1370
1090 Ga0307412_10742330 3300031911 Bacteria 847
1091 Ga0307409_100072777 3300031995 Unclassified 2738
1092 Ga0307409_100343701 3300031995 Bacteria 1405
1093 Ga0307409_100618660 3300031995 Bacteria 1073
1094 Ga0307416_100287861 3300032002 Bacteria 1624
1095 Ga0307416_100581064 3300032002 Bacteria 1198
1096 Ga0307416_100881466 3300032002 Bacteria 994
1097 Ga0307414_10008851 3300032004 Bacteria 5745
1098 Ga0307414_10031387 3300032004 Bacteria 3485
1099 Ga0307414_10407716 3300032004 Bacteria 1182
1100 Ga0307411_10008275 3300032005 Bacteria 5373
1101 Ga0307415_100003530 3300032126 Bacteria 7971
1102 Ga0307415_100013901 3300032126 Bacteria 4714
1103 Ga0307415_100300861 3300032126 Bacteria 1329
1104 Ga0307510_10145803 3300033180 Bacteria 1999
1105 Ga0373950_0025484 3300034818 Bacteria 1068
1106 Ga0373926_0023656 3300035083 Bacteria 2135
1107 Ga0373926_0063682 3300035083 Bacteria 1347
1108 Ga0373926_0187788 3300035083 Bacteria 793
1109 Ga0373934_0001028 3300035086 Bacteria 10066
1110 Ga0373934_0028705 3300035086 Bacteria 2170
1111 Ga0373940_0006679 3300035088 Bacteria 2572
1112 Ga0373944_0095052 3300035089 Bacteria 1001
1113 Ga0373944_0220730 3300035089 Bacteria 692
1114 Ga0373949_0033605 3300035090 Bacteria 1233
1115 Ga0373951_0005905 3300035091 Bacteria 2828
1116 Ga0373951_0197114 3300035091 Bacteria 585
1117 Ga0373952_0020617 3300035092 Bacteria 1383
1118 Ga0373923_0000349 3300035111 Bacteria 10443
1119 Ga0373923_0234089 3300035111 Bacteria 856
1120 Ga0373932_0127581 3300035112 Bacteria 854
1121 Ga0373936_0085339 3300035113 Bacteria 1318
1122 Ga0373939_0000181 3300035114 Bacteria 17462
1123 Ga0373945_0022054 3300035116 Bacteria 2191
1124 Ga0373945_0055004 3300035116 Bacteria 1472
1125 Ga0373945_0116426 3300035116 Bacteria 1059
1126 Ga0373953_0011995 3300035117 Bacteria 3057
1127 Ga0373954_0000014 3300035118 Bacteria 71012
1128 Ga0373954_0001030 3300035118 Bacteria 11058
1129 Ga0373954_0088249 3300035118 Bacteria 1487
1130 Ga0373954_0350248 3300035118 Bacteria 729
1131 Ga0373954_0370139 3300035118 Bacteria 708
1132 Ga0373956_0002915 3300035119 Bacteria 6921
1133 Ga0373957_0000571 3300035120 Bacteria 9332
1134 Ga0373957_0020193 3300035120 Bacteria 2352
1135 Ga0373957_0066703 3300035120 Bacteria 1402
1136 Ga0373957_0409280 3300035120 Bacteria 584
1137 Ga0373960_0001830 3300035121 Bacteria 4758
1138 Ga0373960_0021540 3300035121 Bacteria 1715
1139 Ga0373943_0006181 3300035170 Bacteria 5374
1140 Ga0373943_0020255 3300035170 Bacteria 3065
1141 Ga0373943_0093965 3300035170 Bacteria 1557
1142 Ga0373943_0319466 3300035170 Bacteria 885
1143 Ga0373946_0019765 3300035171 Bacteria 2598
1144 Ga0373946_0134764 3300035171 Bacteria 1140
1145 Ga0373955_0007208 3300035172 Bacteria 5099
1146 Ga0373955_0009860 3300035172 Bacteria 4493
1147 Ga0373955_0021182 3300035172 Bacteria 3278
1148 Ga0373955_0040880 3300035172 Bacteria 2483
1149 Ga0373955_0086287 3300035172 Bacteria 1783
1150 Ga0373955_0433414 3300035172 Bacteria 800
1151 Ga0373961_0201507 3300035241 Bacteria 702
1152 Ga0373962_0025391 3300035242 Bacteria 1591
1153 Ga0373924_0052026 3300035410 Bacteria 1699
1154 Ga0373924_0220160 3300035410 Bacteria 839
1155 Ga0373931_0000400 3300035691 Bacteria 17756
1156 Ga0373931_0006244 3300035691 Bacteria 5558
1157 Ga0373931_0324949 3300035691 Bacteria 957
1158 Ga0373931_0499369 3300035691 Bacteria 784
1159 Ga0373931_0618554 3300035691 Bacteria 709
1160 Ga0373935_0001974 3300035692 Bacteria 11546
1161 Ga0373935_0008949 3300035692 Bacteria 5993
1162 Ga0373935_0060731 3300035692 Bacteria 2418
1163 Ga0373935_0146577 3300035692 Bacteria 1598
1164 Ga0373935_0884709 3300035692 Bacteria 661
1165 Ga0373927_0012584 3300035695 Bacteria 5631
1166 Ga0373927_0027951 3300035695 Bacteria 3681
1167 Ga0373927_0052206 3300035695 Bacteria 2645
1168 Ga0373927_0176704 3300035695 Bacteria 1400
1169 Ga0373927_0419486 3300035695 Bacteria 883
1170 Ga0373933_0020603 3300035724 Bacteria 3739
1171 Ga0373933_0206472 3300035724 Bacteria 1258
1172 Ga0373933_0381085 3300035724 Bacteria 918
1173 Ga0373947_0037034 3300035725 Bacteria 2894
1174 Ga0373947_0072873 3300035725 Bacteria 2110
1175 Ga0373947_0078718 3300035725 Bacteria 2035
1176 Ga0373937_0001093 3300036401 Bacteria 22840
1177 Ga0373937_0006625 3300036401 Bacteria 10000
1178 Ga0373937_0014281 3300036401 Bacteria 7008
1179 Ga0373937_0016376 3300036401 Bacteria 6582
1180 Ga0373937_0029114 3300036401 Bacteria 5001
1181 Ga0373937_0039190 3300036401 Bacteria 4319
1182 Ga0373937_0223074 3300036401 Bacteria 1774
1183 Ga0373937_0297402 3300036401 Bacteria 1525
1184 Ga0373937_0370279 3300036401 Bacteria 1358
1185 Ga0373937_0398840 3300036401 Bacteria 1305
1186 Ga0373937_1076454 3300036401 Bacteria 753
1187 Ga0373925_0013167 3300037068 Bacteria 5987
1188 Ga0373925_0031283 3300037068 Bacteria 3910
1189 Ga0373925_0033878 3300037068 Bacteria 3763
1190 Ga0373925_0161591 3300037068 Bacteria 1764
1191 Ga0373925_0218196 3300037068 Bacteria 1521
1192 Ga0373925_0409949 3300037068 Bacteria 1106
1193 Ga0373925_0513838 3300037068 Bacteria 984
1194 Ga0373925_0714276 3300037068 Bacteria 826
1195 Ga0395899_0298613 3300037312 Bacteria 1091
1196 Ga0395900_0000058 3300037418 Bacteria 206785
1197 Ga0395905_0020330 3300037471 Bacteria 6289
1198 Ga0395905_0057608 3300037471 Bacteria 3634
1199 Ga0395905_0674301 3300037471 Bacteria 936
1200 Ga0395905_0685052 3300037471 Bacteria 927
1201 Ga0436365_0267431 3300039437 Bacteria 547
1202 Ga0436365_0612874 3300039437 Bacteria 2493
1203 Ga0436361_0550950 3300039447 Bacteria 3681
1204 Ga0436361_0610301 3300039447 Bacteria 1158
1205 Ga0436361_1181538 3300039447 Bacteria 5470
1206 Ga0451787_067562 3300041441 Bacteria 684
1207 Ga0451791_1059383 3300041451 Bacteria 719
1208 Ga0451793_0982348 3300041452 Bacteria 814
1209 Ga0451793_1844437 3300041452 Bacteria 528
1210 Ga0451802_0395932 3300041460 Bacteria 908
1211 Ga0451807_1126674 3300041486 Bacteria 819
1212 Ga0451807_1466985 3300041486 Bacteria 1832
1213 Ga0451853_2209825 3300041512 Bacteria 697
1214 Ga0451853_3563638 3300041512 Bacteria 665
1215 Ga0450888_017070 3300042126 Bacteria 899
1216 Ga0450898_094800 3300042134 Bacteria 619
1217 Ga0439444_0069724 3300042437 Bacteria 750
1218 Ga0439460_0132680 3300042461 Bacteria 822
1219 Ga0451577_0000166 3300042876 Bacteria 145166
1220 Ga0451577_0011347 3300042876 Bacteria 8436
1221 Ga0451577_0041533 3300042876 Bacteria 4128
1222 Ga0451577_0089006 3300042876 Bacteria 2755
1223 Ga0451577_0196562 3300042876 Bacteria 1820
1224 Ga0451577_0319536 3300042876 Bacteria 1408
1225 Ga0451577_0478437 3300042876 Bacteria 1131
1226 Ga0451577_0819077 3300042876 Bacteria 840
1227 Ga0453684_0000187 3300044712 Bacteria 272378
1228 Ga0453684_0326016 3300044712 Bacteria 1738
1229 Ga0453684_0459968 3300044712 Bacteria 1415
1230 Ga0453684_0595395 3300044712 Bacteria 1212
1231 Ga0453684_0747795 3300044712 Bacteria 1059
1232 Ga0453684_1674208 3300044712 Bacteria 651
1233 Ga0451576_0004563 3300045051 Bacteria 17903
1234 Ga0451576_0066511 3300045051 Bacteria 3752
1235 Ga0451576_0078737 3300045051 Bacteria 3430
1236 Ga0451576_0088289 3300045051 Bacteria 3225
1237 Ga0451576_0109010 3300045051 Bacteria 2881
1238 Ga0451576_0144474 3300045051 Bacteria 2481
1239 Ga0451576_0378520 3300045051 Bacteria 1484
1240 Ga0451576_0771342 3300045051 Bacteria 1010
1241 Ga0451576_1283296 3300045051 Bacteria 763
1242 Ga0451576_1868636 3300045051 Bacteria 620
1243 Ga0495592_0000306 3300046454 Bacteria 41265
1244 Ga0495592_0033331 3300046454 Bacteria 3885
1245 Ga0495603_0055973 3300046455 Bacteria 2336
1246 Ga0495603_0233658 3300046455 Bacteria 1060
1247 Ga0495590_0006658 3300046457 Bacteria 4503
1248 Ga0495629_0122985 3300046459 Bacteria 1807
1249 Ga0495629_0377754 3300046459 Bacteria 964
1250 Ga0495629_0451808 3300046459 Bacteria 870
1251 Ga0495651_0120855 3300046462 Bacteria 1925
1252 Ga0495653_0061608 3300046463 Bacteria 2838
1253 Ga0495653_0435556 3300046463 Bacteria 827
1254 Ga0495580_0035274 3300046472 Bacteria 3597
1255 Ga0495580_0155868 3300046472 Bacteria 1581
1256 Ga0495580_0837688 3300046472 Bacteria 594
1257 Ga0495639_0477521 3300046475 Bacteria 635
1258 Ga0495662_0014882 3300046476 Bacteria 3780
1259 Ga0495662_0097628 3300046476 Bacteria 1436
1260 Ga0495664_0136347 3300046477 Bacteria 1487
1261 Ga0495594_0033790 3300046499 Bacteria 2782
1262 Ga0495606_0323201 3300046507 Bacteria 828
1263 Ga0495608_0000439 3300046511 Bacteria 29042
1264 Ga0495608_0005328 3300046511 Bacteria 9189
1265 Ga0495628_0001253 3300046516 Bacteria 23229
1266 Ga0495628_0073905 3300046516 Bacteria 2656
1267 Ga0495628_0172955 3300046516 Bacteria 1637
1268 Ga0495628_0199969 3300046516 Bacteria 1506
1269 Ga0495630_0003035 3300046517 Bacteria 11651
1270 Ga0495630_0105486 3300046517 Bacteria 2134
1271 Ga0495630_0222128 3300046517 Bacteria 1442
1272 Ga0495630_0618217 3300046517 Bacteria 830
1273 Ga0495630_1439012 3300046517 Bacteria 518
1274 Ga0495644_0157003 3300046523 Bacteria 872
1275 Ga0495666_0012180 3300046526 Bacteria 4293
1276 Ga0495652_0031405 3300046529 Bacteria 4652
1277 Ga0495652_0065732 3300046529 Bacteria 3046
1278 Ga0495640_0000418 3300046533 Bacteria 30693
1279 Ga0495640_0076952 3300046533 Bacteria 2225
1280 Ga0495640_0531035 3300046533 Bacteria 714
1281 Ga0495586_0001587 3300046535 Bacteria 12505
1282 Ga0495586_0264459 3300046535 Bacteria 982
1283 Ga0495587_0004909 3300046536 Bacteria 8772
1284 Ga0495587_0010361 3300046536 Bacteria 5938
1285 Ga0495598_0087349 3300046537 Bacteria 1011
1286 Ga0495621_0032710 3300046539 Bacteria 1790
1287 Ga0495645_0000490 3300046543 Bacteria 27455
1288 Ga0495645_0026388 3300046543 Bacteria 4217
1289 Ga0495645_0078524 3300046543 Bacteria 2372
1290 Ga0495645_0458000 3300046543 Bacteria 803
1291 Ga0495622_0139844 3300046557 Bacteria 1100
1292 Ga0495667_0003624 3300046559 Bacteria 10384
1293 Ga0495667_0010719 3300046559 Bacteria 6198
1294 Ga0495634_0003074 3300046642 Bacteria 13580
1295 Ga0495635_0012559 3300046663 Bacteria 5935
1296 Ga0495635_0028372 3300046663 Bacteria 3890
1297 Ga0495635_0061638 3300046663 Bacteria 2576
1298 Ga0495635_0569354 3300046663 Bacteria 741
1299 Ga0495659_0220722 3300046664 Bacteria 783
1300 Ga0495657_0053644 3300046675 Bacteria 2697
1301 Ga0495657_0252240 3300046675 Bacteria 1062
1302 Ga0495599_0030882 3300046678 Bacteria 3363
1303 Ga0495623_0016103 3300046679 Bacteria 4831
1304 Ga0495623_0016408 3300046679 Bacteria 4785
1305 Ga0495646_0161500 3300046680 Bacteria 1240
1306 Ga0495646_0267894 3300046680 Bacteria 911
1307 Ga0495647_0006266 3300046681 Bacteria 3932
1308 Ga0495647_0410149 3300046681 Bacteria 623
1309 Ga0495658_0001390 3300046683 Bacteria 12703
1310 Ga0495658_0051443 3300046683 Bacteria 2334
1311 Ga0495658_0405231 3300046683 Bacteria 869
1312 Ga0495658_0425095 3300046683 Bacteria 848
1313 Ga0495669_0154193 3300046684 Bacteria 1088
1314 Ga0495613_0003181 3300046689 Bacteria 12293
1315 Ga0495624_0086555 3300046690 Bacteria 1935
1316 Ga0495600_0010182 3300046809 Bacteria 5827
1317 Ga0495660_0175115 3300046810 Bacteria 1042
1318 Ga0495581_0007795 3300047315 Bacteria 6200
1319 Ga0495581_0236104 3300047315 Bacteria 1069
1320 Ga0495581_0360171 3300047315 Bacteria 849
1321 Ga0495604_0001668 3300047317 Bacteria 18261
1322 Ga0495604_0036725 3300047317 Bacteria 3862
1323 Ga0495604_0091377 3300047317 Bacteria 2258
1324 Ga0495636_0008982 3300047318 Bacteria 3932
1325 Ga0495674_0157845 3300047319 Bacteria 1899
1326 Ga0495676_0118717 3300047321 Bacteria 1928
1327 Ga0495680_0003157 3300047322 Bacteria 16416
1328 Ga0495680_0221855 3300047322 Bacteria 1349
1329 Ga0495680_1073305 3300047322 Bacteria 510
1330 Ga0495675_0032340 3300047444 Bacteria 3338
1331 Ga0495684_0033460 3300047471 Bacteria 3942
1332 Ga0495684_0108494 3300047471 Bacteria 2096
1333 Ga0495684_0229618 3300047471 Bacteria 1358
1334 Ga0495684_0254489 3300047471 Bacteria 1276
1335 Ga0495686_0007201 3300047472 Bacteria 8376
1336 Ga0495593_0062059 3300047673 Bacteria 1954
1337 Ga0495593_0254632 3300047673 Bacteria 879
1338 Ga0495593_0547638 3300047673 Bacteria 580
1339 Ga0495602_0088274 3300048088 Bacteria 2582
1340 Ga0495602_0267579 3300048088 Bacteria 1265
1341 Ga0495602_0592727 3300048088 Bacteria 763
1342 Ga0495614_0189555 3300048089 Bacteria 927
1343 Ga0496100_0148853 3300048903 Bacteria 1667
1344 Ga0496100_0275800 3300048903 Bacteria 1252
1345 Ga0496101_0111777 3300048904 Bacteria 2057
1346 Ga0496101_0373198 3300048904 Bacteria 1122
1347 Ga0496102_0011222 3300048905 Bacteria 7719
1348 Ga0496102_0028779 3300048905 Bacteria 4967
1349 Ga0496102_0068326 3300048905 Bacteria 3260
1350 Ga0496102_0181835 3300048905 Bacteria 1981
1351 Ga0496102_0637073 3300048905 Bacteria 989
1352 Ga0496102_1112387 3300048905 Bacteria 710
1353 Ga0496103_0082550 3300048906 Bacteria 2023
1354 Ga0496104_0015746 3300048907 Bacteria 6859
1355 Ga0496104_0047473 3300048907 Bacteria 4047
1356 Ga0496104_0190240 3300048907 Bacteria 1964
1357 Ga0496104_1132789 3300048907 Bacteria 686
1358 Ga0496105_0004395 3300048908 Bacteria 10614
1359 Ga0496105_1323374 3300048908 Bacteria 525
1360 Ga0496106_0002520 3300048909 Bacteria 13644
1361 Ga0496106_0412147 3300048909 Bacteria 1086
1362 Ga0496106_1084368 3300048909 Bacteria 628
1363 Ga0496107_0025820 3300048910 Bacteria 4162
1364 Ga0496107_0041380 3300048910 Bacteria 3308
1365 Ga0496107_0203866 3300048910 Bacteria 1470
1366 Ga0496108_0044550 3300048911 Bacteria 3703
1367 Ga0496108_0159103 3300048911 Bacteria 1951
1368 Ga0496108_0215054 3300048911 Bacteria 1669
1369 Ga0496108_0516898 3300048911 Bacteria 1042
1370 Ga0496109_0004450 3300048912 Bacteria 11702
1371 Ga0496109_0105832 3300048912 Bacteria 2613
1372 Ga0496109_0212835 3300048912 Bacteria 1818
1373 Ga0496110_0091381 3300048913 Bacteria 2723
1374 Ga0496110_0149406 3300048913 Bacteria 2115
1375 Ga0496110_0286969 3300048913 Bacteria 1499
1376 Ga0496110_1090073 3300048913 Bacteria 707
1377 Ga0496111_0176743 3300048914 Bacteria 1587
1378 Ga0496111_0613467 3300048914 Bacteria 796
1379 Ga0496112_0000349 3300048915 Bacteria 30137
1380 Ga0496112_0003789 3300048915 Bacteria 12634
1381 Ga0496112_0073785 3300048915 Bacteria 3373
1382 Ga0496113_0071646 3300048916 Bacteria 2636
1383 Ga0496113_0245005 3300048916 Bacteria 1430
1384 Ga0496113_0320863 3300048916 Bacteria 1242
1385 Ga0496113_0562266 3300048916 Bacteria 914
1386 Ga0496114_0021666 3300048917 Bacteria 5229
1387 Ga0496114_0620088 3300048917 Bacteria 953
1388 Ga0496115_0892985 3300048918 Bacteria 686
1389 Ga0496124_0001001 3300048927 Bacteria 44775
1390 Ga0501290_000024 3300049513 Bacteria 20106
1391 Ga0501291_000039 3300049514 Bacteria 16775
1392 Ga0501292_000069 3300049515 Bacteria 20733
1393 Ga0501294_000192 3300049517 Bacteria 7491
1394 Ga0501295_000183 3300049518 Bacteria 6307
1395 Ga0501296_000176 3300049519 Bacteria 6824
1396 Ga0501297_000004 3300049520 Bacteria 22617
1397 Ga0501298_000124 3300049521 Bacteria 9227
1398 Ga0501299_000282 3300049522 Bacteria 5815
1399 Ga0501300_000132 3300049523 Bacteria 11104
1400 Ga0501301_000026 3300049524 Bacteria 6740
1401 Ga0501303_000147 3300049526 Bacteria 6111
1402 Ga0501070_1203259 3300049586 Bacteria 581
1403 Ga0501072_0343786 3300049588 Bacteria 1185
1404 Ga0501073_0283398 3300049589 Bacteria 1143
1405 Ga0501076_0116726 3300049592 Bacteria 2160
1406 Ga0501198_000280 3300049649 Bacteria 6481
1407 Ga0501199_005334 3300049650 Bacteria 1289
1408 Ga0501201_000014 3300049651 Bacteria 10935
1409 Ga0501202_000015 3300049652 Bacteria 19511
1410 Ga0501206_000010 3300049653 Bacteria 18339
1411 Ga0501207_000613 3300049654 Unclassified 4117
1412 Ga0501208_004334 3300049655 Unclassified 1664
1413 Ga0501211_000610 3300049658 Unclassified 3578
1414 Ga0501214_005204 3300049659 Unclassified 1241
1415 Ga0501216_000112 3300049660 Bacteria 7859
1416 Ga0501223_010883 3300049663 Unclassified 1826
1417 Ga0501227_001636 3300049665 Unclassified 4994
1418 Ga0501228_003108 3300049666 Unclassified 1346
1419 Ga0501230_000274 3300049667 Unclassified 4756
1420 Ga0501233_000058 3300049668 Bacteria 14525
1421 Ga0501235_000042 3300049669 Bacteria 20584
1422 Ga0501236_000929 3300049670 Unclassified 3295
1423 Ga0501239_004284 3300049672 Unclassified 1393
1424 Ga0501243_000440 3300049675 Bacteria 5523
1425 Ga0501246_000059 3300049676 Bacteria 6119
1426 Ga0501248_000300 3300049678 Unclassified 2557
1427 Ga0501249_000123 3300049679 Bacteria 23882
1428 Ga0501251_000033 3300049681 Bacteria 10069
1429 Ga0501255_000822 3300049684 Unclassified 2282
1430 Ga0501256_000952 3300049685 Unclassified 2022
1431 Ga0501257_016794 3300049686 Unclassified 1699
1432 Ga0501259_001098 3300049688 Unclassified 4527
1433 Ga0501260_000011 3300049689 Bacteria 13212
1434 Ga0501261_000100 3300049690 Bacteria 12946
1435 Ga0501219_001625 3300049703 Unclassified 2022
1436 Ga0501221_000074 3300049704 Bacteria 11102
1437 Ga0501225_0000250 3300049705 Bacteria 16815
1438 Ga0501229_000218 3300049706 Bacteria 6344
1439 Ga0501234_000065 3300049707 Bacteria 12750
1440 Ga0501080_0861603 3300049742 Bacteria 791
1441 Ga0501232_007375 3300049757 Bacteria 1158
1442 Ga0501263_039330 3300049760 Bacteria 691
1443 Ga0501264_000438 3300049761 Bacteria 6431
1444 Ga0501265_000143 3300049762 Bacteria 6663
1445 Ga0501266_008958 3300049763 Bacteria 1262
1446 Ga0501268_002618 3300049765 Unclassified 2385
1447 Ga0501269_008319 3300049766 Bacteria 1253
1448 Ga0501270_000408 3300049767 Unclassified 3680
1449 Ga0501271_001648 3300049768 Unclassified 1930
1450 Ga0501272_000128 3300049769 Bacteria 5931
1451 Ga0501274_000535 3300049771 Unclassified 2732
1452 Ga0501276_002219 3300049773 Bacteria 1363
1453 Ga0501278_001279 3300049774 Unclassified 1808
1454 Ga0501279_000130 3300049775 Bacteria 10801
1455 Ga0501280_004263 3300049776 Unclassified 2113
1456 Ga0501281_00749 3300049777 Unclassified 2802
1457 Ga0501283_000044 3300049779 Bacteria 15150
1458 Ga0501200_00096 3300049849 Unclassified 2117
1459 Ga0501226_002204 3300049853 Unclassified 2404
1460 nmdc:mga03683_46821_c1 3300050489 Bacteria 1793
1461 nmdc:mga0k408_239696_c1 3300050493 Bacteria 1083
1462 nmdc:mga07m45_1390_c1 3300050496 Bacteria 11048
1463 nmdc:mga05p37_41232_c1 3300050507 Bacteria 5668
1464 nmdc:mga09592_544091_c1 3300050508 Bacteria 997
1465 nmdc:mga09592_8709_c1 3300050508 Bacteria 8255
1466 nmdc:mga0qj67_17879_c1 3300050509 Bacteria 5396
1467 nmdc:mga08y16_368861_c1 3300050511 Bacteria 1473
1468 nmdc:mga08y16_79846_c1 3300050511 Bacteria 3410
1469 nmdc:mga0n895_3063_c1 3300050512 Bacteria 13289
1470 nmdc:mga0n895_593505_c1 3300050512 Bacteria 1110
1471 nmdc:mga0rr50_154529_c1 3300050513 Bacteria 1857
1472 Ga0495601_0003644 3300053077 Bacteria 8857
1473 Ga0495612_0163011 3300053078 Bacteria 974
1474 Ga0495612_0288231 3300053078 Bacteria 735
1475 Ga0495595_0130017 3300053084 Bacteria 1230
1476 Ga0495595_0134453 3300053084 Bacteria 1211
1477 Ga0495619_0005553 3300053085 Bacteria 8000
1478 Ga0495619_0024756 3300053085 Bacteria 3851
1479 Ga0495619_0844092 3300053085 Bacteria 618
1480 Ga0500651_0457437 3300053093 Bacteria 709
1481 Ga0500593_008110 3300053117 Bacteria 4305
1482 Ga0530510_0107075 3300061734 Bacteria 2046

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009174 Ga0105241_10692202 Ga0105241_106922022 125
2 3300044712 Ga0453684_1674208 Ga0453684_1674208_195_599 133
3 3300031995 Ga0307409_100343701 Ga0307409_1003437012 140
4 3300025927 Ga0207687_10089592 Ga0207687_100895922 145
5 3300014968 Ga0157379_10877914 Ga0157379_108779142 147
6 3300005338 Ga0068868_100182700 Ga0068868_1001827001 149
7 3300005340 Ga0070689_100019090 Ga0070689_1000190904 151
8 3300005441 Ga0070700_100282541 Ga0070700_1002825412 151
9 3300005444 Ga0070694_100198333 Ga0070694_1001983332 151
10 3300005536 Ga0070697_100146517 Ga0070697_1001465173 151
11 3300005544 Ga0070686_100053216 Ga0070686_1000532162 151
12 3300005544 Ga0070686_100346621 Ga0070686_1003466212 151
13 3300005545 Ga0070695_100010123 Ga0070695_1000101232 151
14 3300005545 Ga0070695_100199059 Ga0070695_1001990592 151
15 3300005546 Ga0070696_100222503 Ga0070696_1002225032 151
16 3300005549 Ga0070704_100113532 Ga0070704_1001135322 151
17 3300005617 Ga0068859_100013682 Ga0068859_1000136826 151
18 3300006195 Ga0075366_10223903 Ga0075366_102239032 151
19 3300006871 Ga0075434_100007245 Ga0075434_1000072453 151
20 3300006880 Ga0075429_100414980 Ga0075429_1004149802 151
21 3300006931 Ga0097620_100013682 Ga0097620_1000136827 151
22 3300007076 Ga0075435_100091917 Ga0075435_1000919174 151
23 3300009094 Ga0111539_10077714 Ga0111539_100777142 151
24 3300025918 Ga0207662_10260182 Ga0207662_102601822 151
25 3300025936 Ga0207670_10028643 Ga0207670_100286434 151
26 3300026075 Ga0207708_10070723 Ga0207708_100707233 151
27 3300026075 Ga0207708_10609583 Ga0207708_106095832 151
28 3300036401 Ga0373937_0006625 Ga0373937_0006625_4867_5322 151
29 3300036401 Ga0373937_0223074 Ga0373937_0223074_1070_1525 151
30 3300045051 Ga0451576_0771342 Ga0451576_0771342_36_491 151
31 3300046454 Ga0495592_0000306 Ga0495592_0000306_30739_31194 151
32 3300046459 Ga0495629_0451808 Ga0495629_0451808_134_589 151
33 3300046463 Ga0495653_0061608 Ga0495653_0061608_560_1015 151
34 3300046476 Ga0495662_0014882 Ga0495662_0014882_2617_3072 151
35 3300046511 Ga0495608_0000439 Ga0495608_0000439_10716_11171 151
36 3300046516 Ga0495628_0001253 Ga0495628_0001253_18670_19125 151
37 3300046516 Ga0495628_0172955 Ga0495628_0172955_648_1103 151
38 3300046517 Ga0495630_0003035 Ga0495630_0003035_5185_5640 151
39 3300046517 Ga0495630_0618217 Ga0495630_0618217_10_465 151
40 3300046526 Ga0495666_0012180 Ga0495666_0012180_1105_1560 151
41 3300046529 Ga0495652_0031405 Ga0495652_0031405_879_1334 151
42 3300046533 Ga0495640_0000418 Ga0495640_0000418_21374_21829 151
43 3300046533 Ga0495640_0076952 Ga0495640_0076952_753_1208 151
44 3300046535 Ga0495586_0001587 Ga0495586_0001587_2975_3430 151
45 3300046535 Ga0495586_0264459 Ga0495586_0264459_214_669 151
46 3300046536 Ga0495587_0004909 Ga0495587_0004909_778_1233 151
47 3300046537 Ga0495598_0087349 Ga0495598_0087349_68_523 151
48 3300046559 Ga0495667_0010719 Ga0495667_0010719_2771_3226 151
49 3300046642 Ga0495634_0003074 Ga0495634_0003074_2890_3345 151
50 3300046663 Ga0495635_0028372 Ga0495635_0028372_174_629 151
51 3300046681 Ga0495647_0410149 Ga0495647_0410149_79_534 151
52 3300046683 Ga0495658_0001390 Ga0495658_0001390_3973_4428 151
53 3300046689 Ga0495613_0003181 Ga0495613_0003181_9068_9523 151
54 3300046809 Ga0495600_0010182 Ga0495600_0010182_2373_2828 151
55 3300047315 Ga0495581_0236104 Ga0495581_0236104_537_992 151
56 3300047315 Ga0495581_0360171 Ga0495581_0360171_200_655 151
57 3300047317 Ga0495604_0001668 Ga0495604_0001668_4091_4546 151
58 3300047317 Ga0495604_0036725 Ga0495604_0036725_16_471 151
59 3300047318 Ga0495636_0008982 Ga0495636_0008982_96_551 151
60 3300047319 Ga0495674_0157845 Ga0495674_0157845_684_1139 151
61 3300047322 Ga0495680_0003157 Ga0495680_0003157_3001_3456 151
62 3300047673 Ga0495593_0254632 Ga0495593_0254632_141_596 151
63 3300047673 Ga0495593_0547638 Ga0495593_0547638_21_476 151
64 3300050493 nmdc:mga0k408_239696_c1 nmdc:mga0k408_239696_c1_548_1003 151
65 3300050508 nmdc:mga09592_544091_c1 nmdc:mga09592_544091_c1_468_923 151
66 3300050511 nmdc:mga08y16_79846_c1 nmdc:mga08y16_79846_c1_1568_2023 151
67 3300050512 nmdc:mga0n895_3063_c1 nmdc:mga0n895_3063_c1_7926_8381 151
68 3300053084 Ga0495595_0130017 Ga0495595_0130017_49_504 151
69 3300053085 Ga0495619_0024756 Ga0495619_0024756_252_707 151
70 3300053085 Ga0495619_0844092 Ga0495619_0844092_126_581 151
71 iso_pu_bacteria 2643221654 2644303004 151
72 iso_pu_bacteria 2643221660 2644338610 151
73 3300035086 Ga0373934_0028705 Ga0373934_0028705_729_1190 152
74 3300035111 Ga0373923_0234089 Ga0373923_0234089_364_825 152
75 3300035118 Ga0373954_0000014 Ga0373954_0000014_62359_62820 152
76 3300035120 Ga0373957_0066703 Ga0373957_0066703_639_1100 152
77 3300035172 Ga0373955_0433414 Ga0373955_0433414_40_501 152
78 3300035724 Ga0373933_0020603 Ga0373933_0020603_2919_3380 152
79 3300036401 Ga0373937_0014281 Ga0373937_0014281_4649_5110 152
80 3300046675 Ga0495657_0053644 Ga0495657_0053644_1490_1951 152
81 3300005327 Ga0070658_10005980 Ga0070658_100059804 153
82 3300005327 Ga0070658_10287816 Ga0070658_102878162 153
83 3300005327 Ga0070658_11103298 Ga0070658_111032981 153
84 3300005328 Ga0070676_10083232 Ga0070676_100832322 153
85 3300005329 Ga0070683_100167950 Ga0070683_1001679501 153
86 3300005329 Ga0070683_101497725 Ga0070683_1014977251 153
87 3300005330 Ga0070690_100003078 Ga0070690_1000030787 153
88 3300005330 Ga0070690_100107454 Ga0070690_1001074542 153
89 3300005330 Ga0070690_100374995 Ga0070690_1003749951 153
90 3300005331 Ga0070670_100020490 Ga0070670_1000204903 153
91 3300005334 Ga0068869_100009367 Ga0068869_1000093674 153
92 3300005334 Ga0068869_100023785 Ga0068869_1000237852 153
93 3300005334 Ga0068869_100036679 Ga0068869_1000366794 153
94 3300005334 Ga0068869_100464197 Ga0068869_1004641972 153
95 3300005335 Ga0070666_10004746 Ga0070666_100047467 153
96 3300005335 Ga0070666_11018123 Ga0070666_110181231 153
97 3300005336 Ga0070680_100028407 Ga0070680_1000284072 153
98 3300005337 Ga0070682_100100175 Ga0070682_1001001752 153
99 3300005338 Ga0068868_100015847 Ga0068868_1000158474 153
100 3300005338 Ga0068868_100033124 Ga0068868_1000331242 153
101 3300005338 Ga0068868_100034949 Ga0068868_1000349495 153
102 3300005338 Ga0068868_100371236 Ga0068868_1003712361 153
103 3300005338 Ga0068868_100395511 Ga0068868_1003955111 153
104 3300005339 Ga0070660_100662776 Ga0070660_1006627761 153
105 3300005340 Ga0070689_100019016 Ga0070689_1000190163 153
106 3300005340 Ga0070689_100044593 Ga0070689_1000445934 153
107 3300005340 Ga0070689_100163692 Ga0070689_1001636922 153
108 3300005340 Ga0070689_101076455 Ga0070689_1010764552 153
109 3300005343 Ga0070687_100039542 Ga0070687_1000395423 153
110 3300005343 Ga0070687_100082039 Ga0070687_1000820392 153
111 3300005344 Ga0070661_100015813 Ga0070661_1000158135 153
112 3300005344 Ga0070661_100793527 Ga0070661_1007935271 153
113 3300005345 Ga0070692_10004689 Ga0070692_100046892 153
114 3300005347 Ga0070668_100617455 Ga0070668_1006174552 153
115 3300005353 Ga0070669_100302554 Ga0070669_1003025541 153
116 3300005354 Ga0070675_100203583 Ga0070675_1002035833 153
117 3300005355 Ga0070671_100054588 Ga0070671_1000545885 153
118 3300005355 Ga0070671_100794183 Ga0070671_1007941832 153
119 3300005364 Ga0070673_100002265 Ga0070673_1000022653 153
120 3300005364 Ga0070673_100038486 Ga0070673_1000384863 153
121 3300005365 Ga0070688_100012315 Ga0070688_1000123155 153
122 3300005365 Ga0070688_100196730 Ga0070688_1001967302 153
123 3300005366 Ga0070659_100065437 Ga0070659_1000654373 153
124 3300005366 Ga0070659_100117998 Ga0070659_1001179982 153
125 3300005366 Ga0070659_100516245 Ga0070659_1005162452 153
126 3300005367 Ga0070667_100014378 Ga0070667_1000143787 153
127 3300005367 Ga0070667_100096867 Ga0070667_1000968673 153
128 3300005367 Ga0070667_100986338 Ga0070667_1009863381 153
129 3300005434 Ga0070709_10012962 Ga0070709_100129624 153
130 3300005434 Ga0070709_10028106 Ga0070709_100281063 153
131 3300005434 Ga0070709_10060724 Ga0070709_100607243 153
132 3300005435 Ga0070714_100017248 Ga0070714_1000172484 153
133 3300005435 Ga0070714_101198294 Ga0070714_1011982942 153
134 3300005435 Ga0070714_101336626 Ga0070714_1013366261 153
135 3300005436 Ga0070713_100000621 Ga0070713_1000006219 153
136 3300005436 Ga0070713_100009875 Ga0070713_1000098757 153
137 3300005436 Ga0070713_100256006 Ga0070713_1002560062 153
138 3300005436 Ga0070713_100565560 Ga0070713_1005655601 153
139 3300005436 Ga0070713_101505457 Ga0070713_1015054571 153
140 3300005437 Ga0070710_10006664 Ga0070710_100066647 153
141 3300005437 Ga0070710_10446092 Ga0070710_104460921 153
142 3300005437 Ga0070710_10582498 Ga0070710_105824981 153
143 3300005438 Ga0070701_10037705 Ga0070701_100377052 153
144 3300005438 Ga0070701_10800546 Ga0070701_108005461 153
145 3300005439 Ga0070711_100000562 Ga0070711_10000056217 153
146 3300005439 Ga0070711_100290769 Ga0070711_1002907691 153
147 3300005439 Ga0070711_100345369 Ga0070711_1003453692 153
148 3300005440 Ga0070705_100002681 Ga0070705_10000268110 153
149 3300005440 Ga0070705_100004688 Ga0070705_1000046888 153
150 3300005441 Ga0070700_100515347 Ga0070700_1005153471 153
151 3300005444 Ga0070694_100003055 Ga0070694_1000030559 153
152 3300005444 Ga0070694_100365659 Ga0070694_1003656592 153
153 3300005445 Ga0070708_100039815 Ga0070708_1000398155 153
154 3300005455 Ga0070663_100126042 Ga0070663_1001260421 153
155 3300005455 Ga0070663_100286692 Ga0070663_1002866921 153
156 3300005456 Ga0070678_100086342 Ga0070678_1000863423 153
157 3300005457 Ga0070662_100015044 Ga0070662_1000150447 153
158 3300005459 Ga0068867_100259632 Ga0068867_1002596322 153
159 3300005459 Ga0068867_100669553 Ga0068867_1006695532 153
160 3300005466 Ga0070685_10001706 Ga0070685_100017069 153
161 3300005467 Ga0070706_100584167 Ga0070706_1005841671 153
162 3300005518 Ga0070699_100016433 Ga0070699_1000164333 153
163 3300005530 Ga0070679_100228271 Ga0070679_1002282713 153
164 3300005535 Ga0070684_100054153 Ga0070684_1000541533 153
165 3300005535 Ga0070684_100240883 Ga0070684_1002408832 153
166 3300005536 Ga0070697_100011036 Ga0070697_1000110364 153
167 3300005536 Ga0070697_100057369 Ga0070697_1000573692 153
168 3300005539 Ga0068853_100230938 Ga0068853_1002309382 153
169 3300005539 Ga0068853_100793635 Ga0068853_1007936351 153
170 3300005543 Ga0070672_100128039 Ga0070672_1001280393 153
171 3300005543 Ga0070672_100329371 Ga0070672_1003293711 153
172 3300005544 Ga0070686_100061297 Ga0070686_1000612973 153
173 3300005544 Ga0070686_100120908 Ga0070686_1001209082 153
174 3300005544 Ga0070686_100303239 Ga0070686_1003032392 153
175 3300005545 Ga0070695_100007268 Ga0070695_1000072687 153
176 3300005545 Ga0070695_100046302 Ga0070695_1000463022 153
177 3300005546 Ga0070696_100016947 Ga0070696_1000169473 153
178 3300005546 Ga0070696_100047956 Ga0070696_1000479563 153
179 3300005546 Ga0070696_100072589 Ga0070696_1000725893 153
180 3300005547 Ga0070693_100010776 Ga0070693_1000107765 153
181 3300005547 Ga0070693_100090605 Ga0070693_1000906052 153
182 3300005548 Ga0070665_100014147 Ga0070665_1000141478 153
183 3300005548 Ga0070665_100423992 Ga0070665_1004239922 153
184 3300005549 Ga0070704_100124348 Ga0070704_1001243482 153
185 3300005563 Ga0068855_101358125 Ga0068855_1013581252 153
186 3300005564 Ga0070664_100261851 Ga0070664_1002618512 153
187 3300005564 Ga0070664_100492939 Ga0070664_1004929392 153
188 3300005564 Ga0070664_101202464 Ga0070664_1012024641 153
189 3300005577 Ga0068857_100098008 Ga0068857_1000980083 153
190 3300005577 Ga0068857_100594720 Ga0068857_1005947202 153
191 3300005578 Ga0068854_100050573 Ga0068854_1000505734 153
192 3300005614 Ga0068856_100032074 Ga0068856_1000320742 153
193 3300005615 Ga0070702_100014764 Ga0070702_1000147642 153
194 3300005615 Ga0070702_100428814 Ga0070702_1004288142 153
195 3300005615 Ga0070702_100610941 Ga0070702_1006109411 153
196 3300005615 Ga0070702_100724592 Ga0070702_1007245921 153
197 3300005616 Ga0068852_100000823 Ga0068852_10000082323 153
198 3300005616 Ga0068852_100101705 Ga0068852_1001017052 153
199 3300005617 Ga0068859_100001741 Ga0068859_10000174115 153
200 3300005617 Ga0068859_100006755 Ga0068859_1000067555 153
201 3300005617 Ga0068859_100241082 Ga0068859_1002410822 153
202 3300005617 Ga0068859_100692971 Ga0068859_1006929711 153
203 3300005618 Ga0068864_100004626 Ga0068864_10000462613 153
204 3300005618 Ga0068864_100366211 Ga0068864_1003662112 153
205 3300005618 Ga0068864_100665022 Ga0068864_1006650222 153
206 3300005718 Ga0068866_10001140 Ga0068866_100011408 153
207 3300005718 Ga0068866_10142945 Ga0068866_101429451 153
208 3300005718 Ga0068866_10914367 Ga0068866_109143671 153
209 3300005834 Ga0068851_10015536 Ga0068851_100155362 153
210 3300005834 Ga0068851_10462328 Ga0068851_104623282 153
211 3300005840 Ga0068870_10434541 Ga0068870_104345411 153
212 3300005841 Ga0068863_100007778 Ga0068863_10000777812 153
213 3300005841 Ga0068863_100381561 Ga0068863_1003815612 153
214 3300005842 Ga0068858_100008383 Ga0068858_10000838314 153
215 3300005842 Ga0068858_100025618 Ga0068858_1000256183 153
216 3300005842 Ga0068858_100112030 Ga0068858_1001120304 153
217 3300005842 Ga0068858_100554054 Ga0068858_1005540542 153
218 3300005843 Ga0068860_100049948 Ga0068860_1000499485 153
219 3300005843 Ga0068860_100103036 Ga0068860_1001030362 153
220 3300005843 Ga0068860_100142833 Ga0068860_1001428332 153
221 3300005843 Ga0068860_100289383 Ga0068860_1002893833 153
222 3300005844 Ga0068862_100007988 Ga0068862_1000079882 153
223 3300006163 Ga0070715_10497504 Ga0070715_104975042 153
224 3300006173 Ga0070716_100016651 Ga0070716_1000166513 153
225 3300006173 Ga0070716_100301596 Ga0070716_1003015962 153
226 3300006175 Ga0070712_100003612 Ga0070712_1000036127 153
227 3300006175 Ga0070712_100004881 Ga0070712_1000048815 153
228 3300006237 Ga0097621_100005070 Ga0097621_1000050709 153
229 3300006237 Ga0097621_100112531 Ga0097621_1001125313 153
230 3300006237 Ga0097621_100175283 Ga0097621_1001752832 153
231 3300006237 Ga0097621_100206410 Ga0097621_1002064102 153
232 3300006237 Ga0097621_101005143 Ga0097621_1010051432 153
233 3300006358 Ga0068871_100004840 Ga0068871_1000048407 153
234 3300006358 Ga0068871_100009792 Ga0068871_1000097923 153
235 3300006358 Ga0068871_100032204 Ga0068871_1000322042 153
236 3300006358 Ga0068871_100111440 Ga0068871_1001114403 153
237 3300006358 Ga0068871_100228649 Ga0068871_1002286493 153
238 3300006881 Ga0068865_100204565 Ga0068865_1002045652 153
239 3300006931 Ga0097620_100001741 Ga0097620_10000174115 153
240 3300006931 Ga0097620_100006755 Ga0097620_1000067555 153
241 3300006931 Ga0097620_100241073 Ga0097620_1002410732 153
242 3300006931 Ga0097620_100693026 Ga0097620_1006930261 153
243 3300007265 Ga0099794_10014365 Ga0099794_100143652 153
244 3300007265 Ga0099794_10019347 Ga0099794_100193472 153
245 3300007265 Ga0099794_10030122 Ga0099794_100301224 153
246 3300009093 Ga0105240_10008787 Ga0105240_1000878718 153
247 3300009098 Ga0105245_10009343 Ga0105245_100093437 153
248 3300009098 Ga0105245_10009415 Ga0105245_100094157 153
249 3300009098 Ga0105245_10035818 Ga0105245_100358185 153
250 3300009098 Ga0105245_10082944 Ga0105245_100829442 153
251 3300009098 Ga0105245_10932365 Ga0105245_109323651 153
252 3300009098 Ga0105245_11873599 Ga0105245_118735991 153
253 3300009101 Ga0105247_10018997 Ga0105247_100189975 153
254 3300009174 Ga0105241_10011046 Ga0105241_100110465 153
255 3300009174 Ga0105241_10063871 Ga0105241_100638711 153
256 3300009174 Ga0105241_11250830 Ga0105241_112508301 153
257 3300009176 Ga0105242_10008131 Ga0105242_100081317 153
258 3300009176 Ga0105242_10258737 Ga0105242_102587372 153
259 3300009177 Ga0105248_10000878 Ga0105248_1000087821 153
260 3300009177 Ga0105248_10013308 Ga0105248_100133087 153
261 3300009177 Ga0105248_10101263 Ga0105248_101012633 153
262 3300009177 Ga0105248_11098406 Ga0105248_110984061 153
263 3300009545 Ga0105237_10053862 Ga0105237_100538623 153
264 3300009545 Ga0105237_10300962 Ga0105237_103009622 153
265 3300009551 Ga0105238_10331229 Ga0105238_103312292 153
266 3300009551 Ga0105238_11640935 Ga0105238_116409351 153
267 3300009551 Ga0105238_12411654 Ga0105238_124116541 153
268 3300009553 Ga0105249_10317138 Ga0105249_103171383 153
269 3300010375 Ga0105239_10170886 Ga0105239_101708862 153
270 3300010375 Ga0105239_11507199 Ga0105239_115071991 153
271 3300011119 Ga0105246_10145440 Ga0105246_101454402 153
272 3300013102 Ga0157371_10703964 Ga0157371_107039642 153
273 3300013104 Ga0157370_10046754 Ga0157370_100467542 153
274 3300013104 Ga0157370_10734214 Ga0157370_107342142 153
275 3300013105 Ga0157369_11160926 Ga0157369_111609261 153
276 3300013296 Ga0157374_10001809 Ga0157374_1000180913 153
277 3300013296 Ga0157374_10133566 Ga0157374_101335662 153
278 3300013296 Ga0157374_10700986 Ga0157374_107009862 153
279 3300013297 Ga0157378_10009283 Ga0157378_100092837 153
280 3300013297 Ga0157378_10009954 Ga0157378_100099546 153
281 3300013297 Ga0157378_10401907 Ga0157378_104019072 153
282 3300013306 Ga0163162_10011811 Ga0163162_100118117 153
283 3300013306 Ga0163162_10096594 Ga0163162_100965943 153
284 3300013306 Ga0163162_10328857 Ga0163162_103288572 153
285 3300013307 Ga0157372_10001692 Ga0157372_100016928 153
286 3300013307 Ga0157372_11268004 Ga0157372_112680042 153
287 3300013308 Ga0157375_10008616 Ga0157375_100086167 153
288 3300013308 Ga0157375_10009546 Ga0157375_100095462 153
289 3300013308 Ga0157375_10192365 Ga0157375_101923653 153
290 3300014325 Ga0163163_10001352 Ga0163163_1000135213 153
291 3300014325 Ga0163163_10116185 Ga0163163_101161853 153
292 3300014325 Ga0163163_11206576 Ga0163163_112065762 153
293 3300014745 Ga0157377_10005762 Ga0157377_100057627 153
294 3300014745 Ga0157377_10192613 Ga0157377_101926132 153
295 3300014968 Ga0157379_10006078 Ga0157379_100060787 153
296 3300014968 Ga0157379_10290174 Ga0157379_102901742 153
297 3300014968 Ga0157379_10295756 Ga0157379_102957561 153
298 3300014969 Ga0157376_10005980 Ga0157376_100059807 153
299 3300014969 Ga0157376_10006034 Ga0157376_100060347 153
300 3300014969 Ga0157376_10008657 Ga0157376_100086576 153
301 3300014969 Ga0157376_10108541 Ga0157376_101085412 153
302 3300014969 Ga0157376_10268444 Ga0157376_102684442 153
303 3300014969 Ga0157376_10432172 Ga0157376_104321722 153
304 3300017792 Ga0163161_10292088 Ga0163161_102920882 153
305 3300025321 Ga0207656_10436309 Ga0207656_104363091 153
306 3300025898 Ga0207692_10151398 Ga0207692_101513982 153
307 3300025898 Ga0207692_10243228 Ga0207692_102432282 153
308 3300025899 Ga0207642_10228143 Ga0207642_102281432 153
309 3300025900 Ga0207710_10224370 Ga0207710_102243702 153
310 3300025903 Ga0207680_10002576 Ga0207680_100025769 153
311 3300025903 Ga0207680_10130197 Ga0207680_101301972 153
312 3300025905 Ga0207685_10052916 Ga0207685_100529163 153
313 3300025906 Ga0207699_10045839 Ga0207699_100458393 153
314 3300025906 Ga0207699_10156363 Ga0207699_101563631 153
315 3300025906 Ga0207699_10542025 Ga0207699_105420252 153
316 3300025907 Ga0207645_10221952 Ga0207645_102219522 153
317 3300025909 Ga0207705_10029140 Ga0207705_100291403 153
318 3300025909 Ga0207705_10251199 Ga0207705_102511993 153
319 3300025911 Ga0207654_10030084 Ga0207654_100300842 153
320 3300025911 Ga0207654_10046536 Ga0207654_100465362 153
321 3300025911 Ga0207654_10761391 Ga0207654_107613911 153
322 3300025915 Ga0207693_10000652 Ga0207693_1000065220 153
323 3300025915 Ga0207693_10465167 Ga0207693_104651671 153
324 3300025916 Ga0207663_10002608 Ga0207663_100026089 153
325 3300025918 Ga0207662_10045518 Ga0207662_100455182 153
326 3300025919 Ga0207657_10007901 Ga0207657_1000790110 153
327 3300025922 Ga0207646_11206169 Ga0207646_112061691 153
328 3300025923 Ga0207681_10318132 Ga0207681_103181322 153
329 3300025924 Ga0207694_10016726 Ga0207694_100167264 153
330 3300025924 Ga0207694_10323906 Ga0207694_103239062 153
331 3300025924 Ga0207694_10498964 Ga0207694_104989641 153
332 3300025924 Ga0207694_11520836 Ga0207694_115208361 153
333 3300025925 Ga0207650_10116313 Ga0207650_101163133 153
334 3300025926 Ga0207659_10377670 Ga0207659_103776701 153
335 3300025927 Ga0207687_10002403 Ga0207687_100024032 153
336 3300025927 Ga0207687_10009624 Ga0207687_100096245 153
337 3300025927 Ga0207687_11428951 Ga0207687_114289511 153
338 3300025928 Ga0207700_10006059 Ga0207700_100060594 153
339 3300025928 Ga0207700_10006798 Ga0207700_100067983 153
340 3300025928 Ga0207700_10386787 Ga0207700_103867872 153
341 3300025928 Ga0207700_10742649 Ga0207700_107426492 153
342 3300025928 Ga0207700_11277872 Ga0207700_112778721 153
343 3300025929 Ga0207664_10000912 Ga0207664_100009125 153
344 3300025929 Ga0207664_11133358 Ga0207664_111333582 153
345 3300025931 Ga0207644_10001544 Ga0207644_1000154415 153
346 3300025931 Ga0207644_10151743 Ga0207644_101517432 153
347 3300025931 Ga0207644_10263945 Ga0207644_102639452 153
348 3300025932 Ga0207690_10265877 Ga0207690_102658772 153
349 3300025933 Ga0207706_10008050 Ga0207706_1000805011 153
350 3300025934 Ga0207686_10016224 Ga0207686_100162242 153
351 3300025935 Ga0207709_10193197 Ga0207709_101931972 153
352 3300025936 Ga0207670_10008447 Ga0207670_100084473 153
353 3300025936 Ga0207670_10041928 Ga0207670_100419281 153
354 3300025936 Ga0207670_10226472 Ga0207670_102264721 153
355 3300025936 Ga0207670_10644180 Ga0207670_106441802 153
356 3300025936 Ga0207670_10912645 Ga0207670_109126452 153
357 3300025937 Ga0207669_10049351 Ga0207669_100493514 153
358 3300025938 Ga0207704_10089364 Ga0207704_100893642 153
359 3300025938 Ga0207704_10514262 Ga0207704_105142622 153
360 3300025938 Ga0207704_10934686 Ga0207704_109346862 153
361 3300025939 Ga0207665_10006908 Ga0207665_100069086 153
362 3300025940 Ga0207691_10024667 Ga0207691_100246677 153
363 3300025940 Ga0207691_10277792 Ga0207691_102777922 153
364 3300025941 Ga0207711_10000087 Ga0207711_1000008782 153
365 3300025941 Ga0207711_10068506 Ga0207711_100685063 153
366 3300025941 Ga0207711_10554326 Ga0207711_105543262 153
367 3300025942 Ga0207689_10001822 Ga0207689_1000182221 153
368 3300025942 Ga0207689_10020777 Ga0207689_100207774 153
369 3300025942 Ga0207689_10127315 Ga0207689_101273152 153
370 3300025942 Ga0207689_10392687 Ga0207689_103926872 153
371 3300025944 Ga0207661_10139313 Ga0207661_101393131 153
372 3300025944 Ga0207661_10495668 Ga0207661_104956682 153
373 3300025945 Ga0207679_10033839 Ga0207679_100338396 153
374 3300025960 Ga0207651_10058537 Ga0207651_100585374 153
375 3300025960 Ga0207651_10412067 Ga0207651_104120672 153
376 3300025961 Ga0207712_10588000 Ga0207712_105880001 153
377 3300025972 Ga0207668_10096561 Ga0207668_100965613 153
378 3300025981 Ga0207640_10004420 Ga0207640_100044208 153
379 3300025981 Ga0207640_10322519 Ga0207640_103225192 153
380 3300025986 Ga0207658_10030693 Ga0207658_100306932 153
381 3300025986 Ga0207658_10034077 Ga0207658_100340772 153
382 3300025986 Ga0207658_10836479 Ga0207658_108364792 153
383 3300026023 Ga0207677_10003281 Ga0207677_100032818 153
384 3300026023 Ga0207677_10205834 Ga0207677_102058342 153
385 3300026023 Ga0207677_10258002 Ga0207677_102580021 153
386 3300026023 Ga0207677_10387167 Ga0207677_103871672 153
387 3300026035 Ga0207703_10003435 Ga0207703_1000343511 153
388 3300026035 Ga0207703_10097054 Ga0207703_100970543 153
389 3300026035 Ga0207703_10927693 Ga0207703_109276931 153
390 3300026035 Ga0207703_11166214 Ga0207703_111662141 153
391 3300026041 Ga0207639_10115683 Ga0207639_101156832 153
392 3300026041 Ga0207639_10845258 Ga0207639_108452582 153
393 3300026067 Ga0207678_10257659 Ga0207678_102576592 153
394 3300026078 Ga0207702_10555710 Ga0207702_105557102 153
395 3300026088 Ga0207641_10008086 Ga0207641_100080869 153
396 3300026088 Ga0207641_10074523 Ga0207641_100745232 153
397 3300026089 Ga0207648_10010002 Ga0207648_100100026 153
398 3300026089 Ga0207648_10258076 Ga0207648_102580762 153
399 3300026095 Ga0207676_10000294 Ga0207676_1000029426 153
400 3300026116 Ga0207674_10002122 Ga0207674_100021229 153
401 3300026116 Ga0207674_10066352 Ga0207674_100663521 153
402 3300026121 Ga0207683_10000355 Ga0207683_1000035534 153
403 3300026121 Ga0207683_11269342 Ga0207683_112693422 153
404 3300026142 Ga0207698_10001629 Ga0207698_100016297 153
405 3300026142 Ga0207698_10016336 Ga0207698_100163362 153
406 3300026142 Ga0207698_10331444 Ga0207698_103314442 153
407 3300026142 Ga0207698_12038168 Ga0207698_120381681 153
408 3300027717 Ga0209998_10063347 Ga0209998_100633472 153
409 3300028379 Ga0268266_10098208 Ga0268266_100982081 153
410 3300028380 Ga0268265_10055502 Ga0268265_100555025 153
411 3300028381 Ga0268264_10007222 Ga0268264_100072228 153
412 3300028381 Ga0268264_10014173 Ga0268264_100141735 153
413 3300028381 Ga0268264_10469749 Ga0268264_104697492 153
414 3300028381 Ga0268264_10522120 Ga0268264_105221202 153
415 3300031731 Ga0307405_10006897 Ga0307405_100068975 153
416 3300031824 Ga0307413_10258834 Ga0307413_102588342 153
417 3300031901 Ga0307406_10011363 Ga0307406_100113632 153
418 3300031903 Ga0307407_10006893 Ga0307407_100068932 153
419 3300031903 Ga0307407_10504138 Ga0307407_105041382 153
420 3300031911 Ga0307412_10072937 Ga0307412_100729373 153
421 3300031995 Ga0307409_100072777 Ga0307409_1000727773 153
422 3300032004 Ga0307414_10008851 Ga0307414_100088512 153
423 3300032005 Ga0307411_10008275 Ga0307411_100082753 153
424 3300032126 Ga0307415_100003530 Ga0307415_1000035304 153
425 3300035083 Ga0373926_0023656 Ga0373926_0023656_380_856 153
426 3300035083 Ga0373926_0187788 Ga0373926_0187788_39_515 153
427 3300035086 Ga0373934_0001028 Ga0373934_0001028_7671_8147 153
428 3300035089 Ga0373944_0220730 Ga0373944_0220730_26_502 153
429 3300035092 Ga0373952_0020617 Ga0373952_0020617_871_1335 153
430 3300035111 Ga0373923_0000349 Ga0373923_0000349_5591_6067 153
431 3300035113 Ga0373936_0085339 Ga0373936_0085339_641_1108 153
432 3300035116 Ga0373945_0022054 Ga0373945_0022054_146_622 153
433 3300035116 Ga0373945_0055004 Ga0373945_0055004_164_640 153
434 3300035116 Ga0373945_0116426 Ga0373945_0116426_445_912 153
435 3300035117 Ga0373953_0011995 Ga0373953_0011995_281_757 153
436 3300035118 Ga0373954_0001030 Ga0373954_0001030_7663_8139 153
437 3300035118 Ga0373954_0088249 Ga0373954_0088249_835_1311 153
438 3300035119 Ga0373956_0002915 Ga0373956_0002915_4521_4997 153
439 3300035120 Ga0373957_0000571 Ga0373957_0000571_6059_6535 153
440 3300035120 Ga0373957_0409280 Ga0373957_0409280_80_556 153
441 3300035121 Ga0373960_0021540 Ga0373960_0021540_636_1100 153
442 3300035170 Ga0373943_0006181 Ga0373943_0006181_4137_4613 153
443 3300035170 Ga0373943_0020255 Ga0373943_0020255_349_816 153
444 3300035170 Ga0373943_0093965 Ga0373943_0093965_122_598 153
445 3300035171 Ga0373946_0019765 Ga0373946_0019765_974_1450 153
446 3300035171 Ga0373946_0134764 Ga0373946_0134764_23_490 153
447 3300035172 Ga0373955_0007208 Ga0373955_0007208_3324_3800 153
448 3300035172 Ga0373955_0009860 Ga0373955_0009860_3253_3759 153
449 3300035172 Ga0373955_0021182 Ga0373955_0021182_788_1264 153
450 3300035410 Ga0373924_0052026 Ga0373924_0052026_685_1161 153
451 3300035691 Ga0373931_0006244 Ga0373931_0006244_2110_2574 153
452 3300035691 Ga0373931_0499369 Ga0373931_0499369_265_741 153
453 3300035692 Ga0373935_0001974 Ga0373935_0001974_10082_10549 153
454 3300035692 Ga0373935_0008949 Ga0373935_0008949_3349_3825 153
455 3300035692 Ga0373935_0146577 Ga0373935_0146577_17_493 153
456 3300035692 Ga0373935_0884709 Ga0373935_0884709_73_540 153
457 3300035695 Ga0373927_0012584 Ga0373927_0012584_4806_5282 153
458 3300035695 Ga0373927_0027951 Ga0373927_0027951_570_1037 153
459 3300035695 Ga0373927_0052206 Ga0373927_0052206_12_488 153
460 3300035724 Ga0373933_0381085 Ga0373933_0381085_154_621 153
461 3300035725 Ga0373947_0037034 Ga0373947_0037034_1262_1729 153
462 3300035725 Ga0373947_0078718 Ga0373947_0078718_378_854 153
463 3300036401 Ga0373937_0001093 Ga0373937_0001093_7598_8074 153
464 3300036401 Ga0373937_0016376 Ga0373937_0016376_4841_5317 153
465 3300036401 Ga0373937_0029114 Ga0373937_0029114_1034_1510 153
466 3300036401 Ga0373937_0297402 Ga0373937_0297402_684_1151 153
467 3300037068 Ga0373925_0013167 Ga0373925_0013167_4809_5276 153
468 3300037068 Ga0373925_0033878 Ga0373925_0033878_915_1391 153
469 3300037068 Ga0373925_0218196 Ga0373925_0218196_352_828 153
470 3300037068 Ga0373925_0714276 Ga0373925_0714276_217_684 153
471 3300037312 Ga0395899_0298613 Ga0395899_0298613_210_713 153
472 3300037471 Ga0395905_0685052 Ga0395905_0685052_348_851 153
473 3300041441 Ga0451787_067562 Ga0451787_067562_135_617 153
474 3300041486 Ga0451807_1466985 Ga0451807_1466985_300_764 153
475 3300042437 Ga0439444_0069724 Ga0439444_0069724_160_639 153
476 3300042461 Ga0439460_0132680 Ga0439460_0132680_108_587 153
477 3300042876 Ga0451577_0011347 Ga0451577_0011347_1046_1510 153
478 3300042876 Ga0451577_0478437 Ga0451577_0478437_379_843 153
479 3300046454 Ga0495592_0033331 Ga0495592_0033331_1167_1634 153
480 3300046455 Ga0495603_0055973 Ga0495603_0055973_635_1111 153
481 3300046455 Ga0495603_0233658 Ga0495603_0233658_570_1037 153
482 3300046459 Ga0495629_0377754 Ga0495629_0377754_153_629 153
483 3300046462 Ga0495651_0120855 Ga0495651_0120855_921_1397 153
484 3300046463 Ga0495653_0435556 Ga0495653_0435556_250_726 153
485 3300046472 Ga0495580_0035274 Ga0495580_0035274_913_1389 153
486 3300046472 Ga0495580_0155868 Ga0495580_0155868_228_704 153
487 3300046472 Ga0495580_0837688 Ga0495580_0837688_90_575 153
488 3300046476 Ga0495662_0097628 Ga0495662_0097628_275_751 153
489 3300046477 Ga0495664_0136347 Ga0495664_0136347_965_1441 153
490 3300046499 Ga0495594_0033790 Ga0495594_0033790_1091_1567 153
491 3300046511 Ga0495608_0005328 Ga0495608_0005328_6744_7211 153
492 3300046516 Ga0495628_0073905 Ga0495628_0073905_1144_1611 153
493 3300046516 Ga0495628_0199969 Ga0495628_0199969_944_1420 153
494 3300046517 Ga0495630_0222128 Ga0495630_0222128_644_1120 153
495 3300046517 Ga0495630_1439012 Ga0495630_1439012_30_506 153
496 3300046523 Ga0495644_0157003 Ga0495644_0157003_253_717 153
497 3300046529 Ga0495652_0065732 Ga0495652_0065732_1798_2265 153
498 3300046533 Ga0495640_0531035 Ga0495640_0531035_179_655 153
499 3300046536 Ga0495587_0010361 Ga0495587_0010361_1445_1912 153
500 3300046539 Ga0495621_0032710 Ga0495621_0032710_816_1292 153
501 3300046543 Ga0495645_0000490 Ga0495645_0000490_19696_20163 153
502 3300046543 Ga0495645_0026388 Ga0495645_0026388_2557_3033 153
503 3300046543 Ga0495645_0078524 Ga0495645_0078524_675_1151 153
504 3300046543 Ga0495645_0458000 Ga0495645_0458000_27_503 153
505 3300046559 Ga0495667_0003624 Ga0495667_0003624_2503_3009 153
506 3300046663 Ga0495635_0012559 Ga0495635_0012559_3427_3903 153
507 3300046663 Ga0495635_0061638 Ga0495635_0061638_1281_1748 153
508 3300046663 Ga0495635_0569354 Ga0495635_0569354_32_508 153
509 3300046664 Ga0495659_0220722 Ga0495659_0220722_212_688 153
510 3300046675 Ga0495657_0252240 Ga0495657_0252240_429_905 153
511 3300046678 Ga0495599_0030882 Ga0495599_0030882_653_1120 153
512 3300046679 Ga0495623_0016103 Ga0495623_0016103_3420_3887 153
513 3300046679 Ga0495623_0016408 Ga0495623_0016408_135_611 153
514 3300046680 Ga0495646_0161500 Ga0495646_0161500_122_589 153
515 3300046680 Ga0495646_0267894 Ga0495646_0267894_261_737 153
516 3300046681 Ga0495647_0006266 Ga0495647_0006266_788_1264 153
517 3300046683 Ga0495658_0405231 Ga0495658_0405231_180_656 153
518 3300046684 Ga0495669_0154193 Ga0495669_0154193_119_595 153
519 3300047315 Ga0495581_0007795 Ga0495581_0007795_5200_5676 153
520 3300047317 Ga0495604_0091377 Ga0495604_0091377_685_1152 153
521 3300047322 Ga0495680_0221855 Ga0495680_0221855_738_1214 153
522 3300047322 Ga0495680_1073305 Ga0495680_1073305_30_497 153
523 3300047444 Ga0495675_0032340 Ga0495675_0032340_827_1303 153
524 3300047471 Ga0495684_0033460 Ga0495684_0033460_2734_3201 153
525 3300047471 Ga0495684_0108494 Ga0495684_0108494_199_675 153
526 3300047471 Ga0495684_0254489 Ga0495684_0254489_504_980 153
527 3300047673 Ga0495593_0062059 Ga0495593_0062059_151_627 153
528 3300048088 Ga0495602_0088274 Ga0495602_0088274_876_1343 153
529 3300048088 Ga0495602_0267579 Ga0495602_0267579_670_1146 153
530 3300048088 Ga0495602_0592727 Ga0495602_0592727_44_520 153
531 3300048089 Ga0495614_0189555 Ga0495614_0189555_190_666 153
532 3300048903 Ga0496100_0275800 Ga0496100_0275800_746_1222 153
533 3300048904 Ga0496101_0111777 Ga0496101_0111777_186_662 153
534 3300048905 Ga0496102_0028779 Ga0496102_0028779_1490_1963 153
535 3300048905 Ga0496102_1112387 Ga0496102_1112387_33_509 153
536 3300048906 Ga0496103_0082550 Ga0496103_0082550_618_1094 153
537 3300048907 Ga0496104_0015746 Ga0496104_0015746_3188_3664 153
538 3300048908 Ga0496105_0004395 Ga0496105_0004395_3538_4014 153
539 3300048908 Ga0496105_1323374 Ga0496105_1323374_43_507 153
540 3300048909 Ga0496106_0412147 Ga0496106_0412147_314_790 153
541 3300048909 Ga0496106_1084368 Ga0496106_1084368_121_597 153
542 3300048910 Ga0496107_0203866 Ga0496107_0203866_304_780 153
543 3300048911 Ga0496108_0044550 Ga0496108_0044550_2662_3138 153
544 3300048912 Ga0496109_0004450 Ga0496109_0004450_4001_4477 153
545 3300048913 Ga0496110_0091381 Ga0496110_0091381_861_1337 153
546 3300048915 Ga0496112_0003789 Ga0496112_0003789_2588_3064 153
547 3300048916 Ga0496113_0562266 Ga0496113_0562266_37_513 153
548 3300049513 Ga0501290_000024 Ga0501290_000024_14371_14850 153
549 3300049514 Ga0501291_000039 Ga0501291_000039_2710_3189 153
550 3300049515 Ga0501292_000069 Ga0501292_000069_12658_13137 153
551 3300049517 Ga0501294_000192 Ga0501294_000192_970_1449 153
552 3300049518 Ga0501295_000183 Ga0501295_000183_4804_5283 153
553 3300049519 Ga0501296_000176 Ga0501296_000176_220_699 153
554 3300049520 Ga0501297_000004 Ga0501297_000004_14707_15186 153
555 3300049521 Ga0501298_000124 Ga0501298_000124_8366_8845 153
556 3300049522 Ga0501299_000282 Ga0501299_000282_5103_5582 153
557 3300049523 Ga0501300_000132 Ga0501300_000132_5587_6066 153
558 3300049524 Ga0501301_000026 Ga0501301_000026_2444_2923 153
559 3300049526 Ga0501303_000147 Ga0501303_000147_1674_2153 153
560 3300049586 Ga0501070_1203259 Ga0501070_1203259_86_556 153
561 3300049589 Ga0501073_0283398 Ga0501073_0283398_101_571 153
562 3300049649 Ga0501198_000280 Ga0501198_000280_4035_4514 153
563 3300049650 Ga0501199_005334 Ga0501199_005334_702_1181 153
564 3300049651 Ga0501201_000014 Ga0501201_000014_4745_5224 153
565 3300049652 Ga0501202_000015 Ga0501202_000015_3214_3693 153
566 3300049653 Ga0501206_000010 Ga0501206_000010_10199_10678 153
567 3300049654 Ga0501207_000613 Ga0501207_000613_3215_3694 153
568 3300049655 Ga0501208_004334 Ga0501208_004334_332_811 153
569 3300049658 Ga0501211_000610 Ga0501211_000610_1690_2169 153
570 3300049659 Ga0501214_005204 Ga0501214_005204_110_589 153
571 3300049660 Ga0501216_000112 Ga0501216_000112_1381_1860 153
572 3300049663 Ga0501223_010883 Ga0501223_010883_11_490 153
573 3300049665 Ga0501227_001636 Ga0501227_001636_2618_3097 153
574 3300049666 Ga0501228_003108 Ga0501228_003108_120_599 153
575 3300049667 Ga0501230_000274 Ga0501230_000274_798_1277 153
576 3300049668 Ga0501233_000058 Ga0501233_000058_889_1368 153
577 3300049669 Ga0501235_000042 Ga0501235_000042_14431_14910 153
578 3300049670 Ga0501236_000929 Ga0501236_000929_624_1103 153
579 3300049672 Ga0501239_004284 Ga0501239_004284_98_577 153
580 3300049675 Ga0501243_000440 Ga0501243_000440_4169_4648 153
581 3300049676 Ga0501246_000059 Ga0501246_000059_1551_2030 153
582 3300049678 Ga0501248_000300 Ga0501248_000300_750_1229 153
583 3300049679 Ga0501249_000123 Ga0501249_000123_10917_11396 153
584 3300049681 Ga0501251_000033 Ga0501251_000033_9208_9687 153
585 3300049684 Ga0501255_000822 Ga0501255_000822_856_1335 153
586 3300049685 Ga0501256_000952 Ga0501256_000952_258_737 153
587 3300049686 Ga0501257_016794 Ga0501257_016794_166_645 153
588 3300049688 Ga0501259_001098 Ga0501259_001098_2575_3054 153
589 3300049689 Ga0501260_000011 Ga0501260_000011_1453_1932 153
590 3300049690 Ga0501261_000100 Ga0501261_000100_6893_7372 153
591 3300049703 Ga0501219_001625 Ga0501219_001625_682_1161 153
592 3300049704 Ga0501221_000074 Ga0501221_000074_8201_8680 153
593 3300049705 Ga0501225_0000250 Ga0501225_0000250_7560_8039 153
594 3300049706 Ga0501229_000218 Ga0501229_000218_5582_6061 153
595 3300049707 Ga0501234_000065 Ga0501234_000065_5843_6322 153
596 3300049742 Ga0501080_0861603 Ga0501080_0861603_94_564 153
597 3300049757 Ga0501232_007375 Ga0501232_007375_120_599 153
598 3300049760 Ga0501263_039330 Ga0501263_039330_23_502 153
599 3300049761 Ga0501264_000438 Ga0501264_000438_5570_6049 153
600 3300049762 Ga0501265_000143 Ga0501265_000143_4477_4956 153
601 3300049763 Ga0501266_008958 Ga0501266_008958_284_763 153
602 3300049765 Ga0501268_002618 Ga0501268_002618_873_1352 153
603 3300049766 Ga0501269_008319 Ga0501269_008319_279_758 153
604 3300049767 Ga0501270_000408 Ga0501270_000408_3167_3646 153
605 3300049768 Ga0501271_001648 Ga0501271_001648_1336_1815 153
606 3300049769 Ga0501272_000128 Ga0501272_000128_2048_2527 153
607 3300049771 Ga0501274_000535 Ga0501274_000535_695_1174 153
608 3300049773 Ga0501276_002219 Ga0501276_002219_756_1235 153
609 3300049774 Ga0501278_001279 Ga0501278_001279_562_1041 153
610 3300049775 Ga0501279_000130 Ga0501279_000130_2402_2881 153
611 3300049776 Ga0501280_004263 Ga0501280_004263_1488_1967 153
612 3300049777 Ga0501281_00749 Ga0501281_00749_711_1190 153
613 3300049779 Ga0501283_000044 Ga0501283_000044_5526_6005 153
614 3300049849 Ga0501200_00096 Ga0501200_00096_93_572 153
615 3300049853 Ga0501226_002204 Ga0501226_002204_806_1285 153
616 3300050512 nmdc:mga0n895_593505_c1 nmdc:mga0n895_593505_c1_247_780 153
617 3300053077 Ga0495601_0003644 Ga0495601_0003644_1126_1593 153
618 3300053078 Ga0495612_0163011 Ga0495612_0163011_285_752 153
619 3300053078 Ga0495612_0288231 Ga0495612_0288231_168_644 153
620 3300053085 Ga0495619_0005553 Ga0495619_0005553_5902_6378 153
621 3300005293 Ga0065715_10612704 Ga0065715_106127042 154
622 3300005327 Ga0070658_10141199 Ga0070658_101411993 154
623 3300005329 Ga0070683_100257060 Ga0070683_1002570602 154
624 3300005336 Ga0070680_100034253 Ga0070680_1000342532 154
625 3300005341 Ga0070691_10172697 Ga0070691_101726972 154
626 3300005344 Ga0070661_100006131 Ga0070661_1000061313 154
627 3300005344 Ga0070661_100046937 Ga0070661_1000469372 154
628 3300005353 Ga0070669_100072484 Ga0070669_1000724843 154
629 3300005354 Ga0070675_100032389 Ga0070675_1000323893 154
630 3300005355 Ga0070671_100001991 Ga0070671_1000019919 154
631 3300005355 Ga0070671_100612033 Ga0070671_1006120332 154
632 3300005356 Ga0070674_100070026 Ga0070674_1000700262 154
633 3300005364 Ga0070673_100090223 Ga0070673_1000902233 154
634 3300005364 Ga0070673_100506297 Ga0070673_1005062972 154
635 3300005366 Ga0070659_100017311 Ga0070659_1000173111 154
636 3300005366 Ga0070659_100048701 Ga0070659_1000487014 154
637 3300005366 Ga0070659_100377555 Ga0070659_1003775552 154
638 3300005367 Ga0070667_100305114 Ga0070667_1003051142 154
639 3300005434 Ga0070709_10233450 Ga0070709_102334502 154
640 3300005435 Ga0070714_101151357 Ga0070714_1011513572 154
641 3300005439 Ga0070711_100538655 Ga0070711_1005386552 154
642 3300005441 Ga0070700_100627673 Ga0070700_1006276732 154
643 3300005455 Ga0070663_100049234 Ga0070663_1000492343 154
644 3300005455 Ga0070663_100731111 Ga0070663_1007311111 154
645 3300005456 Ga0070678_100166747 Ga0070678_1001667473 154
646 3300005456 Ga0070678_100628410 Ga0070678_1006284101 154
647 3300005457 Ga0070662_100000111 Ga0070662_10000011132 154
648 3300005457 Ga0070662_100099703 Ga0070662_1000997031 154
649 3300005458 Ga0070681_10790647 Ga0070681_107906471 154
650 3300005535 Ga0070684_100001117 Ga0070684_10000111712 154
651 3300005539 Ga0068853_100005294 Ga0068853_1000052943 154
652 3300005539 Ga0068853_100156536 Ga0068853_1001565363 154
653 3300005539 Ga0068853_100328122 Ga0068853_1003281222 154
654 3300005543 Ga0070672_100026516 Ga0070672_1000265165 154
655 3300005543 Ga0070672_100429191 Ga0070672_1004291912 154
656 3300005547 Ga0070693_100077819 Ga0070693_1000778192 154
657 3300005563 Ga0068855_100000450 Ga0068855_10000045032 154
658 3300005563 Ga0068855_100005788 Ga0068855_1000057889 154
659 3300005564 Ga0070664_100002704 Ga0070664_1000027048 154
660 3300005577 Ga0068857_100128153 Ga0068857_1001281531 154
661 3300005578 Ga0068854_100013441 Ga0068854_1000134413 154
662 3300005578 Ga0068854_100266585 Ga0068854_1002665852 154
663 3300005614 Ga0068856_100000350 Ga0068856_10000035034 154
664 3300005614 Ga0068856_100074182 Ga0068856_1000741821 154
665 3300005615 Ga0070702_100774019 Ga0070702_1007740192 154
666 3300005616 Ga0068852_100129902 Ga0068852_1001299022 154
667 3300005618 Ga0068864_100527486 Ga0068864_1005274862 154
668 3300005719 Ga0068861_101217472 Ga0068861_1012174722 154
669 3300005834 Ga0068851_10010098 Ga0068851_100100981 154
670 3300005834 Ga0068851_10102684 Ga0068851_101026842 154
671 3300005841 Ga0068863_100462731 Ga0068863_1004627312 154
672 3300005843 Ga0068860_100640400 Ga0068860_1006404002 154
673 3300006175 Ga0070712_100635049 Ga0070712_1006350492 154
674 3300006175 Ga0070712_100911020 Ga0070712_1009110202 154
675 3300006914 Ga0075436_100189631 Ga0075436_1001896312 154
676 3300009093 Ga0105240_10022316 Ga0105240_100223167 154
677 3300009174 Ga0105241_10006963 Ga0105241_100069633 154
678 3300009176 Ga0105242_10077721 Ga0105242_100777213 154
679 3300009177 Ga0105248_10003568 Ga0105248_1000356816 154
680 3300009545 Ga0105237_10024857 Ga0105237_100248574 154
681 3300009551 Ga0105238_10035807 Ga0105238_100358074 154
682 3300009553 Ga0105249_10669218 Ga0105249_106692182 154
683 3300009553 Ga0105249_11075945 Ga0105249_110759452 154
684 3300010375 Ga0105239_10696001 Ga0105239_106960012 154
685 3300013100 Ga0157373_10001063 Ga0157373_1000106315 154
686 3300013102 Ga0157371_10001162 Ga0157371_1000116221 154
687 3300013102 Ga0157371_10695242 Ga0157371_106952422 154
688 3300013105 Ga0157369_10203685 Ga0157369_102036853 154
689 3300013297 Ga0157378_10654335 Ga0157378_106543352 154
690 3300013306 Ga0163162_10617676 Ga0163162_106176761 154
691 3300013306 Ga0163162_10717152 Ga0163162_107171522 154
692 3300013307 Ga0157372_10001523 Ga0157372_1000152319 154
693 3300013307 Ga0157372_11081066 Ga0157372_110810662 154
694 3300014326 Ga0157380_10183319 Ga0157380_101833193 154
695 3300014968 Ga0157379_10094110 Ga0157379_100941104 154
696 3300014968 Ga0157379_10177073 Ga0157379_101770731 154
697 3300020070 Ga0206356_10378156 Ga0206356_103781562 154
698 3300020081 Ga0206354_10831956 Ga0206354_108319562 154
699 3300020082 Ga0206353_10348253 Ga0206353_103482533 154
700 3300025315 Ga0207697_10064319 Ga0207697_100643192 154
701 3300025907 Ga0207645_10051776 Ga0207645_100517762 154
702 3300025912 Ga0207707_10002896 Ga0207707_100028962 154
703 3300025912 Ga0207707_10741698 Ga0207707_107416981 154
704 3300025913 Ga0207695_10460568 Ga0207695_104605682 154
705 3300025915 Ga0207693_10257300 Ga0207693_102573003 154
706 3300025917 Ga0207660_10040475 Ga0207660_100404754 154
707 3300025919 Ga0207657_10000750 Ga0207657_1000075016 154
708 3300025919 Ga0207657_10002560 Ga0207657_1000256016 154
709 3300025920 Ga0207649_10004987 Ga0207649_100049877 154
710 3300025921 Ga0207652_10235188 Ga0207652_102351882 154
711 3300025923 Ga0207681_10062396 Ga0207681_100623962 154
712 3300025924 Ga0207694_10041190 Ga0207694_100411904 154
713 3300025926 Ga0207659_10041351 Ga0207659_100413512 154
714 3300025931 Ga0207644_10001317 Ga0207644_100013179 154
715 3300025932 Ga0207690_10000826 Ga0207690_1000082622 154
716 3300025933 Ga0207706_10000465 Ga0207706_1000046533 154
717 3300025933 Ga0207706_10228234 Ga0207706_102282341 154
718 3300025940 Ga0207691_10133319 Ga0207691_101333192 154
719 3300025944 Ga0207661_10068005 Ga0207661_100680052 154
720 3300025945 Ga0207679_10002617 Ga0207679_100026175 154
721 3300025945 Ga0207679_10024164 Ga0207679_100241642 154
722 3300025949 Ga0207667_10000490 Ga0207667_1000049025 154
723 3300025949 Ga0207667_10001200 Ga0207667_1000120016 154
724 3300025949 Ga0207667_10049680 Ga0207667_100496803 154
725 3300025981 Ga0207640_10196228 Ga0207640_101962282 154
726 3300025986 Ga0207658_10385542 Ga0207658_103855422 154
727 3300026041 Ga0207639_10002729 Ga0207639_1000272911 154
728 3300026041 Ga0207639_10225232 Ga0207639_102252322 154
729 3300026067 Ga0207678_10024896 Ga0207678_100248962 154
730 3300026067 Ga0207678_10063616 Ga0207678_100636161 154
731 3300026078 Ga0207702_10000635 Ga0207702_1000063524 154
732 3300026089 Ga0207648_10823879 Ga0207648_108238791 154
733 3300026116 Ga0207674_10001268 Ga0207674_1000126820 154
734 3300026121 Ga0207683_10244960 Ga0207683_102449601 154
735 3300026142 Ga0207698_10098460 Ga0207698_100984601 154
736 3300026142 Ga0207698_10694092 Ga0207698_106940922 154
737 3300035695 Ga0373927_0419486 Ga0373927_0419486_52_564 154
738 3300042126 Ga0450888_017070 Ga0450888_017070_319_792 154
739 3300042134 Ga0450898_094800 Ga0450898_094800_71_544 154
740 3300048904 Ga0496101_0373198 Ga0496101_0373198_362_895 154
741 3300048905 Ga0496102_0181835 Ga0496102_0181835_445_978 154
742 3300048909 Ga0496106_0002520 Ga0496106_0002520_7050_7583 154
743 3300048910 Ga0496107_0041380 Ga0496107_0041380_597_1130 154
744 3300003322 rootL2_10073240 rootL2_100732404 155
745 3300003775 Ga0055524_1000146 Ga0055524_100014659 155
746 3300003791 Ga0055530_10009559 Ga0055530_100095595 155
747 3300003794 Ga0055531_10004965 Ga0055531_100049656 155
748 3300005328 Ga0070676_10009436 Ga0070676_100094362 155
749 3300005366 Ga0070659_100001726 Ga0070659_10000172615 155
750 3300005435 Ga0070714_100383712 Ga0070714_1003837122 155
751 3300005455 Ga0070663_100000226 Ga0070663_10000022626 155
752 3300005457 Ga0070662_100214297 Ga0070662_1002142972 155
753 3300005564 Ga0070664_100019104 Ga0070664_1000191047 155
754 3300005616 Ga0068852_100035269 Ga0068852_1000352692 155
755 3300005618 Ga0068864_101182483 Ga0068864_1011824832 155
756 3300005841 Ga0068863_100717650 Ga0068863_1007176502 155
757 3300006178 Ga0075367_10389397 Ga0075367_103893972 155
758 3300006195 Ga0075366_10161046 Ga0075366_101610462 155
759 3300006195 Ga0075366_10569283 Ga0075366_105692832 155
760 3300006237 Ga0097621_100970915 Ga0097621_1009709152 155
761 3300006353 Ga0075370_10301590 Ga0075370_103015902 155
762 3300006880 Ga0075429_100001051 Ga0075429_10000105118 155
763 3300006946 Ga0079104_1000001 Ga0079104_1000001358 155
764 3300009094 Ga0111539_10868363 Ga0111539_108683631 155
765 3300009147 Ga0114129_10272777 Ga0114129_102727773 155
766 3300009545 Ga0105237_11911226 Ga0105237_119112261 155
767 3300013105 Ga0157369_10412080 Ga0157369_104120802 155
768 3300014969 Ga0157376_10329577 Ga0157376_103295772 155
769 3300021361 Ga0213872_10010960 Ga0213872_100109604 155
770 3300025263 Ga0209565_1008854 Ga0209565_10088542 155
771 3300025298 Ga0209050_1000118 Ga0209050_100011820 155
772 3300025299 Ga0209256_1000015 Ga0209256_1000015446 155
773 3300025303 Ga0209051_1048365 Ga0209051_10483652 155
774 3300025932 Ga0207690_10024622 Ga0207690_100246222 155
775 3300025933 Ga0207706_10219105 Ga0207706_102191052 155
776 3300025945 Ga0207679_10018509 Ga0207679_100185097 155
777 3300026023 Ga0207677_11023988 Ga0207677_110239881 155
778 3300026078 Ga0207702_10741525 Ga0207702_107415252 155
779 3300026088 Ga0207641_10848422 Ga0207641_108484222 155
780 3300026095 Ga0207676_10636366 Ga0207676_106363662 155
781 3300027111 Ga0209281_1000151 Ga0209281_100015141 155
782 3300028794 Ga0307515_10104002 Ga0307515_101040022 155
783 3300031456 Ga0307513_10039326 Ga0307513_100393262 155
784 3300031548 Ga0307408_100056526 Ga0307408_1000565263 155
785 3300031616 Ga0307508_10291073 Ga0307508_102910732 155
786 3300031616 Ga0307508_10303334 Ga0307508_103033342 155
787 3300031731 Ga0307405_10441964 Ga0307405_104419642 155
788 3300031824 Ga0307413_10272077 Ga0307413_102720772 155
789 3300031852 Ga0307410_10347028 Ga0307410_103470282 155
790 3300031903 Ga0307407_10082475 Ga0307407_100824752 155
791 3300031903 Ga0307407_10194948 Ga0307407_101949482 155
792 3300031911 Ga0307412_10022675 Ga0307412_100226753 155
793 3300031911 Ga0307412_10742330 Ga0307412_107423301 155
794 3300031995 Ga0307409_100618660 Ga0307409_1006186602 155
795 3300032004 Ga0307414_10407716 Ga0307414_104077162 155
796 3300032126 Ga0307415_100013901 Ga0307415_1000139015 155
797 3300033180 Ga0307510_10145803 Ga0307510_101458031 155
798 3300034818 Ga0373950_0025484 Ga0373950_0025484_72_542 155
799 3300035088 Ga0373940_0006679 Ga0373940_0006679_706_1176 155
800 3300035089 Ga0373944_0095052 Ga0373944_0095052_230_700 155
801 3300035090 Ga0373949_0033605 Ga0373949_0033605_143_613 155
802 3300035091 Ga0373951_0005905 Ga0373951_0005905_800_1270 155
803 3300035112 Ga0373932_0127581 Ga0373932_0127581_349_819 155
804 3300035114 Ga0373939_0000181 Ga0373939_0000181_13628_14098 155
805 3300035121 Ga0373960_0001830 Ga0373960_0001830_603_1073 155
806 3300035241 Ga0373961_0201507 Ga0373961_0201507_195_665 155
807 3300035242 Ga0373962_0025391 Ga0373962_0025391_953_1423 155
808 3300035691 Ga0373931_0000400 Ga0373931_0000400_10282_10752 155
809 3300035691 Ga0373931_0618554 Ga0373931_0618554_202_672 155
810 3300036401 Ga0373937_0398840 Ga0373937_0398840_605_1075 155
811 3300037068 Ga0373925_0513838 Ga0373925_0513838_252_722 155
812 3300037418 Ga0395900_0000058 Ga0395900_0000058_169142_169615 155
813 3300037471 Ga0395905_0020330 Ga0395905_0020330_1560_2036 155
814 3300037471 Ga0395905_0674301 Ga0395905_0674301_47_517 155
815 3300039437 Ga0436365_0267431 Ga0436365_0267431_11_481 155
816 3300039447 Ga0436361_0550950 Ga0436361_0550950_1266_1736 155
817 3300039447 Ga0436361_0610301 Ga0436361_0610301_530_1000 155
818 3300039447 Ga0436361_1181538 Ga0436361_1181538_4107_4577 155
819 3300041451 Ga0451791_1059383 Ga0451791_1059383_164_634 155
820 3300041452 Ga0451793_1844437 Ga0451793_1844437_20_490 155
821 3300041486 Ga0451807_1126674 Ga0451807_1126674_241_711 155
822 3300041512 Ga0451853_3563638 Ga0451853_3563638_35_505 155
823 3300042876 Ga0451577_0000166 Ga0451577_0000166_42351_42845 155
824 3300042876 Ga0451577_0041533 Ga0451577_0041533_3106_3576 155
825 3300042876 Ga0451577_0196562 Ga0451577_0196562_1293_1763 155
826 3300042876 Ga0451577_0819077 Ga0451577_0819077_74_544 155
827 3300044712 Ga0453684_0000187 Ga0453684_0000187_226024_226518 155
828 3300044712 Ga0453684_0459968 Ga0453684_0459968_113_583 155
829 3300044712 Ga0453684_0595395 Ga0453684_0595395_181_651 155
830 3300045051 Ga0451576_0004563 Ga0451576_0004563_13531_14025 155
831 3300045051 Ga0451576_0066511 Ga0451576_0066511_3173_3643 155
832 3300045051 Ga0451576_0088289 Ga0451576_0088289_2620_3090 155
833 3300045051 Ga0451576_0144474 Ga0451576_0144474_907_1416 155
834 3300045051 Ga0451576_0378520 Ga0451576_0378520_203_673 155
835 3300045051 Ga0451576_1283296 Ga0451576_1283296_127_597 155
836 3300045051 Ga0451576_1868636 Ga0451576_1868636_130_600 155
837 3300046457 Ga0495590_0006658 Ga0495590_0006658_3311_3781 155
838 3300046475 Ga0495639_0477521 Ga0495639_0477521_77_547 155
839 3300046507 Ga0495606_0323201 Ga0495606_0323201_125_595 155
840 3300046517 Ga0495630_0105486 Ga0495630_0105486_889_1359 155
841 3300046557 Ga0495622_0139844 Ga0495622_0139844_607_1077 155
842 3300046683 Ga0495658_0425095 Ga0495658_0425095_92_562 155
843 3300046690 Ga0495624_0086555 Ga0495624_0086555_725_1195 155
844 3300046810 Ga0495660_0175115 Ga0495660_0175115_46_516 155
845 3300047321 Ga0495676_0118717 Ga0495676_0118717_1060_1530 155
846 3300047472 Ga0495686_0007201 Ga0495686_0007201_3925_4395 155
847 3300048905 Ga0496102_0011222 Ga0496102_0011222_3348_3818 155
848 3300048907 Ga0496104_1132789 Ga0496104_1132789_118_588 155
849 3300048911 Ga0496108_0516898 Ga0496108_0516898_287_757 155
850 3300048912 Ga0496109_0212835 Ga0496109_0212835_494_964 155
851 3300048915 Ga0496112_0000349 Ga0496112_0000349_8421_8891 155
852 3300048916 Ga0496113_0245005 Ga0496113_0245005_387_857 155
853 3300048916 Ga0496113_0320863 Ga0496113_0320863_349_819 155
854 3300048917 Ga0496114_0021666 Ga0496114_0021666_3973_4443 155
855 3300048927 Ga0496124_0001001 Ga0496124_0001001_3501_4004 155
856 3300050507 nmdc:mga05p37_41232_c1 nmdc:mga05p37_41232_c1_4008_4478 155
857 3300050508 nmdc:mga09592_8709_c1 nmdc:mga09592_8709_c1_3815_4306 155
858 3300050509 nmdc:mga0qj67_17879_c1 nmdc:mga0qj67_17879_c1_3580_4071 155
859 3300053093 Ga0500651_0457437 Ga0500651_0457437_66_536 155
860 3300053117 Ga0500593_008110 Ga0500593_008110_3168_3638 155
861 iso_pu_bacteria 2643221639 2644217166 155
862 3300002459 JGI24751J29686_10046467 JGI24751J29686_100464672 156
863 3300005290 Ga0065712_10235339 Ga0065712_102353392 156
864 3300005293 Ga0065715_10274079 Ga0065715_102740792 156
865 3300005327 Ga0070658_10103749 Ga0070658_101037493 156
866 3300005327 Ga0070658_10218690 Ga0070658_102186902 156
867 3300005327 Ga0070658_10324897 Ga0070658_103248972 156
868 3300005327 Ga0070658_10390331 Ga0070658_103903311 156
869 3300005328 Ga0070676_10000267 Ga0070676_1000026720 156
870 3300005328 Ga0070676_10074109 Ga0070676_100741092 156
871 3300005329 Ga0070683_100006762 Ga0070683_1000067622 156
872 3300005329 Ga0070683_100014268 Ga0070683_1000142683 156
873 3300005329 Ga0070683_101847100 Ga0070683_1018471001 156
874 3300005330 Ga0070690_100010609 Ga0070690_1000106093 156
875 3300005331 Ga0070670_100011670 Ga0070670_1000116703 156
876 3300005331 Ga0070670_100016497 Ga0070670_1000164972 156
877 3300005331 Ga0070670_100049106 Ga0070670_1000491063 156
878 3300005331 Ga0070670_100110464 Ga0070670_1001104642 156
879 3300005331 Ga0070670_100143121 Ga0070670_1001431212 156
880 3300005331 Ga0070670_100367407 Ga0070670_1003674072 156
881 3300005331 Ga0070670_100512593 Ga0070670_1005125932 156
882 3300005331 Ga0070670_100958521 Ga0070670_1009585212 156
883 3300005333 Ga0070677_10000642 Ga0070677_100006427 156
884 3300005333 Ga0070677_10010485 Ga0070677_100104853 156
885 3300005334 Ga0068869_100008109 Ga0068869_1000081098 156
886 3300005334 Ga0068869_100130351 Ga0068869_1001303513 156
887 3300005334 Ga0068869_100144121 Ga0068869_1001441212 156
888 3300005335 Ga0070666_10004334 Ga0070666_100043342 156
889 3300005335 Ga0070666_10017791 Ga0070666_100177912 156
890 3300005335 Ga0070666_10124836 Ga0070666_101248362 156
891 3300005335 Ga0070666_10166275 Ga0070666_101662752 156
892 3300005337 Ga0070682_100708485 Ga0070682_1007084851 156
893 3300005338 Ga0068868_100036210 Ga0068868_1000362103 156
894 3300005338 Ga0068868_100038640 Ga0068868_1000386402 156
895 3300005338 Ga0068868_100427836 Ga0068868_1004278362 156
896 3300005339 Ga0070660_100022673 Ga0070660_1000226736 156
897 3300005339 Ga0070660_100031136 Ga0070660_1000311362 156
898 3300005339 Ga0070660_100097177 Ga0070660_1000971771 156
899 3300005339 Ga0070660_100943809 Ga0070660_1009438091 156
900 3300005340 Ga0070689_100055757 Ga0070689_1000557572 156
901 3300005344 Ga0070661_100015818 Ga0070661_1000158187 156
902 3300005344 Ga0070661_100700056 Ga0070661_1007000561 156
903 3300005345 Ga0070692_10040008 Ga0070692_100400082 156
904 3300005347 Ga0070668_100006650 Ga0070668_1000066503 156
905 3300005347 Ga0070668_100019549 Ga0070668_1000195494 156
906 3300005347 Ga0070668_100022057 Ga0070668_1000220573 156
907 3300005347 Ga0070668_100022437 Ga0070668_1000224374 156
908 3300005347 Ga0070668_100060746 Ga0070668_1000607462 156
909 3300005347 Ga0070668_100184173 Ga0070668_1001841732 156
910 3300005347 Ga0070668_100256206 Ga0070668_1002562062 156
911 3300005353 Ga0070669_100011261 Ga0070669_1000112613 156
912 3300005353 Ga0070669_100089829 Ga0070669_1000898293 156
913 3300005353 Ga0070669_100116999 Ga0070669_1001169992 156
914 3300005353 Ga0070669_100129232 Ga0070669_1001292322 156
915 3300005354 Ga0070675_100003343 Ga0070675_1000033433 156
916 3300005354 Ga0070675_100016616 Ga0070675_1000166162 156
917 3300005354 Ga0070675_100035125 Ga0070675_1000351253 156
918 3300005354 Ga0070675_100205734 Ga0070675_1002057342 156
919 3300005354 Ga0070675_100416372 Ga0070675_1004163722 156
920 3300005354 Ga0070675_100771843 Ga0070675_1007718431 156
921 3300005355 Ga0070671_100000803 Ga0070671_10000080321 156
922 3300005355 Ga0070671_100024095 Ga0070671_1000240955 156
923 3300005355 Ga0070671_100051913 Ga0070671_1000519132 156
924 3300005355 Ga0070671_100059511 Ga0070671_1000595112 156
925 3300005355 Ga0070671_100223880 Ga0070671_1002238802 156
926 3300005355 Ga0070671_100573648 Ga0070671_1005736481 156
927 3300005355 Ga0070671_100664302 Ga0070671_1006643022 156
928 3300005356 Ga0070674_100000274 Ga0070674_10000027428 156
929 3300005356 Ga0070674_100013078 Ga0070674_1000130783 156
930 3300005356 Ga0070674_100021899 Ga0070674_1000218993 156
931 3300005356 Ga0070674_100082737 Ga0070674_1000827373 156
932 3300005356 Ga0070674_100109817 Ga0070674_1001098172 156
933 3300005356 Ga0070674_100139100 Ga0070674_1001391001 156
934 3300005364 Ga0070673_100000502 Ga0070673_1000005028 156
935 3300005364 Ga0070673_100031683 Ga0070673_1000316832 156
936 3300005364 Ga0070673_100040894 Ga0070673_1000408944 156
937 3300005364 Ga0070673_100080038 Ga0070673_1000800383 156
938 3300005365 Ga0070688_100011938 Ga0070688_1000119387 156
939 3300005365 Ga0070688_100015734 Ga0070688_1000157345 156
940 3300005366 Ga0070659_100029734 Ga0070659_1000297344 156
941 3300005366 Ga0070659_100066089 Ga0070659_1000660893 156
942 3300005366 Ga0070659_100132111 Ga0070659_1001321113 156
943 3300005366 Ga0070659_101544051 Ga0070659_1015440511 156
944 3300005367 Ga0070667_100011152 Ga0070667_1000111523 156
945 3300005367 Ga0070667_100018913 Ga0070667_1000189132 156
946 3300005367 Ga0070667_100044618 Ga0070667_1000446183 156
947 3300005367 Ga0070667_100287679 Ga0070667_1002876792 156
948 3300005367 Ga0070667_100395130 Ga0070667_1003951302 156
949 3300005367 Ga0070667_101809902 Ga0070667_1018099021 156
950 3300005367 Ga0070667_101823240 Ga0070667_1018232401 156
951 3300005434 Ga0070709_10008299 Ga0070709_100082994 156
952 3300005434 Ga0070709_10553675 Ga0070709_105536751 156
953 3300005434 Ga0070709_10862396 Ga0070709_108623961 156
954 3300005435 Ga0070714_100029515 Ga0070714_1000295155 156
955 3300005435 Ga0070714_100125104 Ga0070714_1001251042 156
956 3300005436 Ga0070713_100173718 Ga0070713_1001737182 156
957 3300005436 Ga0070713_100489612 Ga0070713_1004896122 156
958 3300005438 Ga0070701_10110108 Ga0070701_101101082 156
959 3300005439 Ga0070711_100015057 Ga0070711_1000150572 156
960 3300005440 Ga0070705_100111127 Ga0070705_1001111271 156
961 3300005441 Ga0070700_100665984 Ga0070700_1006659841 156
962 3300005441 Ga0070700_100827078 Ga0070700_1008270782 156
963 3300005445 Ga0070708_100000961 Ga0070708_1000009619 156
964 3300005455 Ga0070663_100170808 Ga0070663_1001708081 156
965 3300005455 Ga0070663_100458338 Ga0070663_1004583382 156
966 3300005455 Ga0070663_100467398 Ga0070663_1004673981 156
967 3300005456 Ga0070678_100002036 Ga0070678_10000203612 156
968 3300005456 Ga0070678_100003054 Ga0070678_1000030548 156
969 3300005456 Ga0070678_100006079 Ga0070678_1000060792 156
970 3300005457 Ga0070662_100316909 Ga0070662_1003169092 156
971 3300005458 Ga0070681_10026543 Ga0070681_100265438 156
972 3300005458 Ga0070681_10053935 Ga0070681_100539352 156
973 3300005459 Ga0068867_100004886 Ga0068867_1000048869 156
974 3300005459 Ga0068867_100009782 Ga0068867_1000097826 156
975 3300005459 Ga0068867_100022311 Ga0068867_1000223117 156
976 3300005466 Ga0070685_10012009 Ga0070685_100120093 156
977 3300005466 Ga0070685_10062991 Ga0070685_100629913 156
978 3300005468 Ga0070707_100078238 Ga0070707_1000782382 156
979 3300005518 Ga0070699_100003739 Ga0070699_1000037399 156
980 3300005518 Ga0070699_100027824 Ga0070699_1000278242 156
981 3300005530 Ga0070679_100316192 Ga0070679_1003161922 156
982 3300005530 Ga0070679_100321563 Ga0070679_1003215632 156
983 3300005530 Ga0070679_100843137 Ga0070679_1008431371 156
984 3300005535 Ga0070684_100053565 Ga0070684_1000535652 156
985 3300005535 Ga0070684_100119191 Ga0070684_1001191912 156
986 3300005535 Ga0070684_100616206 Ga0070684_1006162062 156
987 3300005539 Ga0068853_100012925 Ga0068853_1000129251 156
988 3300005539 Ga0068853_100083415 Ga0068853_1000834153 156
989 3300005539 Ga0068853_100281602 Ga0068853_1002816022 156
990 3300005539 Ga0068853_100492048 Ga0068853_1004920482 156
991 3300005543 Ga0070672_100001773 Ga0070672_10000177310 156
992 3300005543 Ga0070672_100008494 Ga0070672_1000084944 156
993 3300005543 Ga0070672_100014344 Ga0070672_1000143446 156
994 3300005543 Ga0070672_100035407 Ga0070672_1000354073 156
995 3300005543 Ga0070672_100049647 Ga0070672_1000496473 156
996 3300005543 Ga0070672_100202101 Ga0070672_1002021013 156
997 3300005544 Ga0070686_100027477 Ga0070686_1000274774 156
998 3300005545 Ga0070695_100342034 Ga0070695_1003420342 156
999 3300005546 Ga0070696_100012043 Ga0070696_1000120433 156
1000 3300005547 Ga0070693_100065531 Ga0070693_1000655312 156
1001 3300005548 Ga0070665_100010727 Ga0070665_1000107278 156
1002 3300005548 Ga0070665_100082703 Ga0070665_1000827032 156
1003 3300005548 Ga0070665_100084751 Ga0070665_1000847512 156
1004 3300005548 Ga0070665_100147841 Ga0070665_1001478412 156
1005 3300005548 Ga0070665_100237044 Ga0070665_1002370442 156
1006 3300005548 Ga0070665_100529066 Ga0070665_1005290662 156
1007 3300005548 Ga0070665_100781205 Ga0070665_1007812052 156
1008 3300005549 Ga0070704_100878593 Ga0070704_1008785931 156
1009 3300005563 Ga0068855_100007194 Ga0068855_10000719415 156
1010 3300005563 Ga0068855_100025363 Ga0068855_1000253632 156
1011 3300005563 Ga0068855_100134541 Ga0068855_1001345413 156
1012 3300005563 Ga0068855_100243201 Ga0068855_1002432012 156
1013 3300005563 Ga0068855_100285704 Ga0068855_1002857042 156
1014 3300005563 Ga0068855_100399376 Ga0068855_1003993762 156
1015 3300005563 Ga0068855_100437942 Ga0068855_1004379422 156
1016 3300005564 Ga0070664_100000658 Ga0070664_10000065825 156
1017 3300005564 Ga0070664_100041993 Ga0070664_1000419933 156
1018 3300005564 Ga0070664_100083651 Ga0070664_1000836513 156
1019 3300005564 Ga0070664_100309288 Ga0070664_1003092882 156
1020 3300005564 Ga0070664_100452004 Ga0070664_1004520042 156
1021 3300005564 Ga0070664_100729429 Ga0070664_1007294291 156
1022 3300005577 Ga0068857_100005799 Ga0068857_1000057999 156
1023 3300005577 Ga0068857_100086667 Ga0068857_1000866673 156
1024 3300005577 Ga0068857_100687870 Ga0068857_1006878702 156
1025 3300005577 Ga0068857_100815666 Ga0068857_1008156662 156
1026 3300005578 Ga0068854_100030042 Ga0068854_1000300422 156
1027 3300005578 Ga0068854_100041866 Ga0068854_1000418662 156
1028 3300005578 Ga0068854_100113282 Ga0068854_1001132822 156
1029 3300005614 Ga0068856_100006095 Ga0068856_1000060955 156
1030 3300005614 Ga0068856_100021309 Ga0068856_1000213092 156
1031 3300005616 Ga0068852_100000940 Ga0068852_1000009404 156
1032 3300005616 Ga0068852_100006323 Ga0068852_1000063237 156
1033 3300005616 Ga0068852_100008545 Ga0068852_1000085454 156
1034 3300005616 Ga0068852_100032464 Ga0068852_1000324643 156
1035 3300005616 Ga0068852_100225160 Ga0068852_1002251602 156
1036 3300005617 Ga0068859_100015466 Ga0068859_1000154665 156
1037 3300005617 Ga0068859_100018437 Ga0068859_1000184372 156
1038 3300005617 Ga0068859_100146194 Ga0068859_1001461942 156
1039 3300005617 Ga0068859_100437758 Ga0068859_1004377582 156
1040 3300005618 Ga0068864_100008845 Ga0068864_1000088458 156
1041 3300005618 Ga0068864_100040417 Ga0068864_1000404172 156
1042 3300005618 Ga0068864_100079555 Ga0068864_1000795552 156
1043 3300005618 Ga0068864_100182425 Ga0068864_1001824253 156
1044 3300005618 Ga0068864_100713124 Ga0068864_1007131242 156
1045 3300005618 Ga0068864_100904203 Ga0068864_1009042032 156
1046 3300005618 Ga0068864_101335995 Ga0068864_1013359952 156
1047 3300005719 Ga0068861_100020343 Ga0068861_1000203432 156
1048 3300005719 Ga0068861_100021902 Ga0068861_1000219025 156
1049 3300005719 Ga0068861_100133909 Ga0068861_1001339092 156
1050 3300005719 Ga0068861_100538340 Ga0068861_1005383402 156
1051 3300005719 Ga0068861_100830338 Ga0068861_1008303382 156
1052 3300005719 Ga0068861_101114476 Ga0068861_1011144762 156
1053 3300005834 Ga0068851_10002888 Ga0068851_100028889 156
1054 3300005834 Ga0068851_10017493 Ga0068851_100174934 156
1055 3300005834 Ga0068851_10045665 Ga0068851_100456652 156
1056 3300005840 Ga0068870_10011295 Ga0068870_100112953 156
1057 3300005840 Ga0068870_10013697 Ga0068870_100136972 156
1058 3300005840 Ga0068870_10024771 Ga0068870_100247712 156
1059 3300005840 Ga0068870_10146490 Ga0068870_101464902 156
1060 3300005840 Ga0068870_10155989 Ga0068870_101559892 156
1061 3300005840 Ga0068870_10427668 Ga0068870_104276682 156
1062 3300005841 Ga0068863_100010341 Ga0068863_1000103419 156
1063 3300005841 Ga0068863_100017079 Ga0068863_1000170794 156
1064 3300005841 Ga0068863_100017142 Ga0068863_1000171425 156
1065 3300005841 Ga0068863_100089280 Ga0068863_1000892802 156
1066 3300005841 Ga0068863_100089474 Ga0068863_1000894742 156
1067 3300005841 Ga0068863_100152609 Ga0068863_1001526093 156
1068 3300005841 Ga0068863_100410416 Ga0068863_1004104162 156
1069 3300005841 Ga0068863_100503377 Ga0068863_1005033772 156
1070 3300005842 Ga0068858_100005201 Ga0068858_10000520114 156
1071 3300005842 Ga0068858_100007116 Ga0068858_1000071162 156
1072 3300005842 Ga0068858_100031012 Ga0068858_1000310126 156
1073 3300005842 Ga0068858_100038624 Ga0068858_1000386242 156
1074 3300005842 Ga0068858_100097462 Ga0068858_1000974623 156
1075 3300005842 Ga0068858_100248656 Ga0068858_1002486562 156
1076 3300005842 Ga0068858_101128837 Ga0068858_1011288372 156
1077 3300005843 Ga0068860_100003853 Ga0068860_1000038533 156
1078 3300005843 Ga0068860_100006923 Ga0068860_10000692310 156
1079 3300005843 Ga0068860_100028491 Ga0068860_1000284912 156
1080 3300005843 Ga0068860_100058629 Ga0068860_1000586293 156
1081 3300005843 Ga0068860_100118186 Ga0068860_1001181862 156
1082 3300005843 Ga0068860_100272969 Ga0068860_1002729692 156
1083 3300005843 Ga0068860_100438342 Ga0068860_1004383422 156
1084 3300005843 Ga0068860_100466196 Ga0068860_1004661962 156
1085 3300005844 Ga0068862_100016343 Ga0068862_1000163437 156
1086 3300005844 Ga0068862_100022934 Ga0068862_1000229341 156
1087 3300005844 Ga0068862_100045373 Ga0068862_1000453734 156
1088 3300005844 Ga0068862_100206038 Ga0068862_1002060382 156
1089 3300006173 Ga0070716_101018324 Ga0070716_1010183242 156
1090 3300006177 Ga0075362_10059457 Ga0075362_100594573 156
1091 3300006237 Ga0097621_100011618 Ga0097621_1000116183 156
1092 3300006237 Ga0097621_100014528 Ga0097621_1000145285 156
1093 3300006237 Ga0097621_100059433 Ga0097621_1000594333 156
1094 3300006237 Ga0097621_100085160 Ga0097621_1000851602 156
1095 3300006237 Ga0097621_100211255 Ga0097621_1002112553 156
1096 3300006237 Ga0097621_100213448 Ga0097621_1002134482 156
1097 3300006237 Ga0097621_101014047 Ga0097621_1010140472 156
1098 3300006353 Ga0075370_10007832 Ga0075370_100078322 156
1099 3300006358 Ga0068871_100223181 Ga0068871_1002231812 156
1100 3300006358 Ga0068871_100275257 Ga0068871_1002752572 156
1101 3300006844 Ga0075428_100027531 Ga0075428_1000275317 156
1102 3300006844 Ga0075428_101296960 Ga0075428_1012969602 156
1103 3300006871 Ga0075434_100336236 Ga0075434_1003362362 156
1104 3300006881 Ga0068865_100006023 Ga0068865_1000060238 156
1105 3300006881 Ga0068865_100017868 Ga0068865_1000178683 156
1106 3300006881 Ga0068865_100144694 Ga0068865_1001446942 156
1107 3300006881 Ga0068865_101512517 Ga0068865_1015125172 156
1108 3300006914 Ga0075436_100299875 Ga0075436_1002998752 156
1109 3300006931 Ga0097620_100015466 Ga0097620_1000154667 156
1110 3300006931 Ga0097620_100018437 Ga0097620_1000184378 156
1111 3300006931 Ga0097620_100146188 Ga0097620_1001461882 156
1112 3300006931 Ga0097620_100437775 Ga0097620_1004377752 156
1113 3300009093 Ga0105240_10001889 Ga0105240_1000188934 156
1114 3300009093 Ga0105240_10013727 Ga0105240_100137274 156
1115 3300009093 Ga0105240_11738242 Ga0105240_117382421 156
1116 3300009098 Ga0105245_10492541 Ga0105245_104925411 156
1117 3300009101 Ga0105247_10072757 Ga0105247_100727571 156
1118 3300009148 Ga0105243_11837791 Ga0105243_118377911 156
1119 3300009174 Ga0105241_11337483 Ga0105241_113374832 156
1120 3300009177 Ga0105248_10057367 Ga0105248_100573673 156
1121 3300009177 Ga0105248_10081931 Ga0105248_100819311 156
1122 3300009177 Ga0105248_10276297 Ga0105248_102762973 156
1123 3300009177 Ga0105248_10759452 Ga0105248_107594522 156
1124 3300009545 Ga0105237_10078968 Ga0105237_100789682 156
1125 3300009545 Ga0105237_10114390 Ga0105237_101143903 156
1126 3300009545 Ga0105237_11011002 Ga0105237_110110022 156
1127 3300009551 Ga0105238_10009503 Ga0105238_100095038 156
1128 3300009553 Ga0105249_10140898 Ga0105249_101408982 156
1129 3300009553 Ga0105249_10157207 Ga0105249_101572073 156
1130 3300009553 Ga0105249_10188866 Ga0105249_101888662 156
1131 3300010375 Ga0105239_10932774 Ga0105239_109327742 156
1132 3300011119 Ga0105246_10023747 Ga0105246_100237473 156
1133 3300013100 Ga0157373_10013745 Ga0157373_100137453 156
1134 3300013100 Ga0157373_10170001 Ga0157373_101700012 156
1135 3300013102 Ga0157371_10804122 Ga0157371_108041222 156
1136 3300013104 Ga0157370_10018289 Ga0157370_100182897 156
1137 3300013104 Ga0157370_10042167 Ga0157370_100421673 156
1138 3300013104 Ga0157370_10114567 Ga0157370_101145672 156
1139 3300013104 Ga0157370_10361564 Ga0157370_103615641 156
1140 3300013104 Ga0157370_10683768 Ga0157370_106837681 156
1141 3300013105 Ga0157369_10002639 Ga0157369_1000263925 156
1142 3300013105 Ga0157369_10054350 Ga0157369_100543502 156
1143 3300013105 Ga0157369_10229695 Ga0157369_102296952 156
1144 3300013105 Ga0157369_10275373 Ga0157369_102753732 156
1145 3300013105 Ga0157369_10442483 Ga0157369_104424832 156
1146 3300013296 Ga0157374_10035751 Ga0157374_100357513 156
1147 3300013296 Ga0157374_10035915 Ga0157374_100359155 156
1148 3300013296 Ga0157374_10215766 Ga0157374_102157662 156
1149 3300013296 Ga0157374_10659770 Ga0157374_106597702 156
1150 3300013296 Ga0157374_11543223 Ga0157374_115432231 156
1151 3300013297 Ga0157378_10030000 Ga0157378_100300004 156
1152 3300013306 Ga0163162_10001211 Ga0163162_1000121122 156
1153 3300013306 Ga0163162_10201399 Ga0163162_102013992 156
1154 3300013306 Ga0163162_10934839 Ga0163162_109348392 156
1155 3300013307 Ga0157372_10006706 Ga0157372_100067067 156
1156 3300013307 Ga0157372_10021790 Ga0157372_100217902 156
1157 3300013307 Ga0157372_10038529 Ga0157372_100385292 156
1158 3300013307 Ga0157372_10057008 Ga0157372_100570082 156
1159 3300013307 Ga0157372_10125179 Ga0157372_101251792 156
1160 3300013307 Ga0157372_10127426 Ga0157372_101274261 156
1161 3300013307 Ga0157372_10235050 Ga0157372_102350502 156
1162 3300013307 Ga0157372_10342593 Ga0157372_103425932 156
1163 3300013307 Ga0157372_10611369 Ga0157372_106113692 156
1164 3300013307 Ga0157372_10653370 Ga0157372_106533702 156
1165 3300013307 Ga0157372_11040013 Ga0157372_110400131 156
1166 3300013308 Ga0157375_10005469 Ga0157375_100054697 156
1167 3300013308 Ga0157375_10030473 Ga0157375_100304732 156
1168 3300013308 Ga0157375_10139594 Ga0157375_101395942 156
1169 3300013308 Ga0157375_10160405 Ga0157375_101604053 156
1170 3300013308 Ga0157375_10341164 Ga0157375_103411643 156
1171 3300013308 Ga0157375_11331140 Ga0157375_113311402 156
1172 3300014325 Ga0163163_10005124 Ga0163163_100051248 156
1173 3300014325 Ga0163163_10017644 Ga0163163_100176448 156
1174 3300014325 Ga0163163_10129546 Ga0163163_101295462 156
1175 3300014325 Ga0163163_10277309 Ga0163163_102773092 156
1176 3300014325 Ga0163163_10788761 Ga0163163_107887611 156
1177 3300014326 Ga0157380_10075229 Ga0157380_100752292 156
1178 3300014326 Ga0157380_10127469 Ga0157380_101274692 156
1179 3300014326 Ga0157380_10323229 Ga0157380_103232292 156
1180 3300014326 Ga0157380_10406241 Ga0157380_104062412 156
1181 3300014326 Ga0157380_11896899 Ga0157380_118968992 156
1182 3300014745 Ga0157377_10020805 Ga0157377_100208054 156
1183 3300014745 Ga0157377_10354686 Ga0157377_103546862 156
1184 3300014968 Ga0157379_10003084 Ga0157379_1000308413 156
1185 3300014968 Ga0157379_10014992 Ga0157379_100149928 156
1186 3300014968 Ga0157379_10044107 Ga0157379_100441073 156
1187 3300014969 Ga0157376_10021115 Ga0157376_100211156 156
1188 3300014969 Ga0157376_10056422 Ga0157376_100564224 156
1189 3300014969 Ga0157376_10156469 Ga0157376_101564692 156
1190 3300014969 Ga0157376_10216043 Ga0157376_102160432 156
1191 3300017792 Ga0163161_10091924 Ga0163161_100919242 156
1192 3300025290 Ga0207673_1009582 Ga0207673_10095822 156
1193 3300025315 Ga0207697_10001322 Ga0207697_100013229 156
1194 3300025315 Ga0207697_10006351 Ga0207697_100063515 156
1195 3300025321 Ga0207656_10021638 Ga0207656_100216383 156
1196 3300025321 Ga0207656_10040066 Ga0207656_100400662 156
1197 3300025321 Ga0207656_10110599 Ga0207656_101105991 156
1198 3300025893 Ga0207682_10001314 Ga0207682_100013147 156
1199 3300025893 Ga0207682_10066945 Ga0207682_100669452 156
1200 3300025898 Ga0207692_10742301 Ga0207692_107423011 156
1201 3300025899 Ga0207642_10049883 Ga0207642_100498833 156
1202 3300025899 Ga0207642_10059991 Ga0207642_100599912 156
1203 3300025899 Ga0207642_10086113 Ga0207642_100861132 156
1204 3300025900 Ga0207710_10274693 Ga0207710_102746931 156
1205 3300025901 Ga0207688_10040755 Ga0207688_100407552 156
1206 3300025901 Ga0207688_10137724 Ga0207688_101377242 156
1207 3300025903 Ga0207680_10002102 Ga0207680_100021022 156
1208 3300025903 Ga0207680_10006510 Ga0207680_100065106 156
1209 3300025903 Ga0207680_10778992 Ga0207680_107789921 156
1210 3300025906 Ga0207699_10020977 Ga0207699_100209772 156
1211 3300025906 Ga0207699_10891022 Ga0207699_108910221 156
1212 3300025907 Ga0207645_10000214 Ga0207645_1000021424 156
1213 3300025907 Ga0207645_10000421 Ga0207645_1000042115 156
1214 3300025907 Ga0207645_10000695 Ga0207645_1000069520 156
1215 3300025908 Ga0207643_10000537 Ga0207643_1000053711 156
1216 3300025908 Ga0207643_10006837 Ga0207643_100068377 156
1217 3300025908 Ga0207643_10031135 Ga0207643_100311354 156
1218 3300025908 Ga0207643_10190696 Ga0207643_101906962 156
1219 3300025909 Ga0207705_10046332 Ga0207705_100463322 156
1220 3300025909 Ga0207705_10125004 Ga0207705_101250042 156
1221 3300025909 Ga0207705_10347690 Ga0207705_103476902 156
1222 3300025909 Ga0207705_10430450 Ga0207705_104304502 156
1223 3300025910 Ga0207684_10062559 Ga0207684_100625592 156
1224 3300025912 Ga0207707_10012845 Ga0207707_100128457 156
1225 3300025913 Ga0207695_10053255 Ga0207695_100532553 156
1226 3300025913 Ga0207695_11164634 Ga0207695_111646342 156
1227 3300025914 Ga0207671_10053265 Ga0207671_100532653 156
1228 3300025914 Ga0207671_10333599 Ga0207671_103335992 156
1229 3300025916 Ga0207663_10080045 Ga0207663_100800452 156
1230 3300025917 Ga0207660_10239956 Ga0207660_102399562 156
1231 3300025919 Ga0207657_10024835 Ga0207657_100248355 156
1232 3300025919 Ga0207657_10032956 Ga0207657_100329566 156
1233 3300025920 Ga0207649_10011486 Ga0207649_100114863 156
1234 3300025920 Ga0207649_10053399 Ga0207649_100533992 156
1235 3300025920 Ga0207649_10162744 Ga0207649_101627442 156
1236 3300025920 Ga0207649_10732780 Ga0207649_107327802 156
1237 3300025920 Ga0207649_10918792 Ga0207649_109187922 156
1238 3300025921 Ga0207652_10114356 Ga0207652_101143562 156
1239 3300025921 Ga0207652_10523802 Ga0207652_105238022 156
1240 3300025922 Ga0207646_10014581 Ga0207646_100145817 156
1241 3300025923 Ga0207681_10029078 Ga0207681_100290783 156
1242 3300025923 Ga0207681_10200987 Ga0207681_102009872 156
1243 3300025923 Ga0207681_10301407 Ga0207681_103014071 156
1244 3300025924 Ga0207694_10005853 Ga0207694_100058535 156
1245 3300025925 Ga0207650_10008724 Ga0207650_100087242 156
1246 3300025925 Ga0207650_10017230 Ga0207650_100172303 156
1247 3300025925 Ga0207650_10020685 Ga0207650_100206854 156
1248 3300025925 Ga0207650_10032090 Ga0207650_100320902 156
1249 3300025925 Ga0207650_10044419 Ga0207650_100444192 156
1250 3300025925 Ga0207650_10094251 Ga0207650_100942513 156
1251 3300025925 Ga0207650_10177971 Ga0207650_101779712 156
1252 3300025925 Ga0207650_10895675 Ga0207650_108956751 156
1253 3300025925 Ga0207650_11345727 Ga0207650_113457272 156
1254 3300025926 Ga0207659_10002136 Ga0207659_100021369 156
1255 3300025926 Ga0207659_10012703 Ga0207659_100127032 156
1256 3300025926 Ga0207659_10017200 Ga0207659_100172002 156
1257 3300025926 Ga0207659_10074554 Ga0207659_100745542 156
1258 3300025928 Ga0207700_10061260 Ga0207700_100612603 156
1259 3300025928 Ga0207700_10302396 Ga0207700_103023962 156
1260 3300025929 Ga0207664_10055495 Ga0207664_100554953 156
1261 3300025929 Ga0207664_10462445 Ga0207664_104624451 156
1262 3300025929 Ga0207664_10534050 Ga0207664_105340502 156
1263 3300025931 Ga0207644_10007546 Ga0207644_100075464 156
1264 3300025931 Ga0207644_10010859 Ga0207644_100108594 156
1265 3300025931 Ga0207644_10039904 Ga0207644_100399044 156
1266 3300025931 Ga0207644_10044769 Ga0207644_100447694 156
1267 3300025931 Ga0207644_10111826 Ga0207644_101118262 156
1268 3300025931 Ga0207644_10392191 Ga0207644_103921912 156
1269 3300025931 Ga0207644_10504612 Ga0207644_105046122 156
1270 3300025932 Ga0207690_10018363 Ga0207690_100183633 156
1271 3300025932 Ga0207690_10028312 Ga0207690_100283123 156
1272 3300025932 Ga0207690_10273017 Ga0207690_102730172 156
1273 3300025933 Ga0207706_10004984 Ga0207706_1000498410 156
1274 3300025933 Ga0207706_10013535 Ga0207706_100135353 156
1275 3300025933 Ga0207706_10141051 Ga0207706_101410512 156
1276 3300025934 Ga0207686_10081829 Ga0207686_100818292 156
1277 3300025935 Ga0207709_10226720 Ga0207709_102267202 156
1278 3300025936 Ga0207670_10122272 Ga0207670_101222722 156
1279 3300025937 Ga0207669_10016731 Ga0207669_100167313 156
1280 3300025937 Ga0207669_10062316 Ga0207669_100623163 156
1281 3300025937 Ga0207669_10168199 Ga0207669_101681992 156
1282 3300025937 Ga0207669_10219510 Ga0207669_102195102 156
1283 3300025937 Ga0207669_10349222 Ga0207669_103492222 156
1284 3300025938 Ga0207704_10003217 Ga0207704_100032177 156
1285 3300025938 Ga0207704_10051971 Ga0207704_100519712 156
1286 3300025938 Ga0207704_10159849 Ga0207704_101598492 156
1287 3300025939 Ga0207665_10439099 Ga0207665_104390992 156
1288 3300025940 Ga0207691_10000084 Ga0207691_1000008423 156
1289 3300025940 Ga0207691_10000577 Ga0207691_1000057739 156
1290 3300025940 Ga0207691_10001328 Ga0207691_1000132821 156
1291 3300025940 Ga0207691_10007830 Ga0207691_100078309 156
1292 3300025940 Ga0207691_10009589 Ga0207691_100095893 156
1293 3300025940 Ga0207691_10050830 Ga0207691_100508303 156
1294 3300025940 Ga0207691_10168116 Ga0207691_101681162 156
1295 3300025940 Ga0207691_10304882 Ga0207691_103048822 156
1296 3300025941 Ga0207711_10079464 Ga0207711_100794642 156
1297 3300025941 Ga0207711_11864467 Ga0207711_118644671 156
1298 3300025942 Ga0207689_10000069 Ga0207689_1000006968 156
1299 3300025942 Ga0207689_10004226 Ga0207689_100042268 156
1300 3300025942 Ga0207689_10014272 Ga0207689_100142728 156
1301 3300025944 Ga0207661_10009752 Ga0207661_100097523 156
1302 3300025944 Ga0207661_10081925 Ga0207661_100819253 156
1303 3300025944 Ga0207661_10307273 Ga0207661_103072732 156
1304 3300025944 Ga0207661_11402725 Ga0207661_114027252 156
1305 3300025945 Ga0207679_10003953 Ga0207679_100039535 156
1306 3300025945 Ga0207679_10009503 Ga0207679_100095038 156
1307 3300025945 Ga0207679_10224474 Ga0207679_102244742 156
1308 3300025945 Ga0207679_10328735 Ga0207679_103287351 156
1309 3300025945 Ga0207679_10353045 Ga0207679_103530452 156
1310 3300025945 Ga0207679_10655101 Ga0207679_106551012 156
1311 3300025949 Ga0207667_10020237 Ga0207667_100202378 156
1312 3300025949 Ga0207667_10034332 Ga0207667_100343326 156
1313 3300025949 Ga0207667_10230511 Ga0207667_102305111 156
1314 3300025949 Ga0207667_10754105 Ga0207667_107541052 156
1315 3300025960 Ga0207651_10034097 Ga0207651_100340973 156
1316 3300025960 Ga0207651_10076025 Ga0207651_100760254 156
1317 3300025960 Ga0207651_10098714 Ga0207651_100987143 156
1318 3300025960 Ga0207651_10896648 Ga0207651_108966481 156
1319 3300025961 Ga0207712_10169501 Ga0207712_101695012 156
1320 3300025961 Ga0207712_10598117 Ga0207712_105981172 156
1321 3300025972 Ga0207668_10002833 Ga0207668_100028338 156
1322 3300025972 Ga0207668_10020812 Ga0207668_100208123 156
1323 3300025972 Ga0207668_10072731 Ga0207668_100727312 156
1324 3300025972 Ga0207668_10082765 Ga0207668_100827652 156
1325 3300025972 Ga0207668_10139413 Ga0207668_101394132 156
1326 3300025972 Ga0207668_10184349 Ga0207668_101843492 156
1327 3300025972 Ga0207668_10264603 Ga0207668_102646032 156
1328 3300025981 Ga0207640_10381345 Ga0207640_103813451 156
1329 3300025981 Ga0207640_10836124 Ga0207640_108361241 156
1330 3300025981 Ga0207640_10877677 Ga0207640_108776772 156
1331 3300025986 Ga0207658_10004792 Ga0207658_100047922 156
1332 3300025986 Ga0207658_10015419 Ga0207658_100154194 156
1333 3300025986 Ga0207658_10040854 Ga0207658_100408542 156
1334 3300025986 Ga0207658_10131100 Ga0207658_101311002 156
1335 3300026023 Ga0207677_10002351 Ga0207677_100023519 156
1336 3300026023 Ga0207677_10013587 Ga0207677_100135873 156
1337 3300026023 Ga0207677_10096955 Ga0207677_100969551 156
1338 3300026023 Ga0207677_10315814 Ga0207677_103158142 156
1339 3300026035 Ga0207703_10020784 Ga0207703_100207846 156
1340 3300026035 Ga0207703_10047877 Ga0207703_100478773 156
1341 3300026035 Ga0207703_10099385 Ga0207703_100993852 156
1342 3300026035 Ga0207703_10234858 Ga0207703_102348582 156
1343 3300026035 Ga0207703_10535412 Ga0207703_105354122 156
1344 3300026035 Ga0207703_11135969 Ga0207703_111359692 156
1345 3300026041 Ga0207639_10085045 Ga0207639_100850451 156
1346 3300026041 Ga0207639_10206423 Ga0207639_102064232 156
1347 3300026041 Ga0207639_10590504 Ga0207639_105905042 156
1348 3300026067 Ga0207678_10000429 Ga0207678_1000042928 156
1349 3300026067 Ga0207678_10433641 Ga0207678_104336412 156
1350 3300026067 Ga0207678_10483840 Ga0207678_104838402 156
1351 3300026067 Ga0207678_10955631 Ga0207678_109556311 156
1352 3300026075 Ga0207708_10000710 Ga0207708_1000071023 156
1353 3300026075 Ga0207708_10728229 Ga0207708_107282292 156
1354 3300026078 Ga0207702_10007712 Ga0207702_100077124 156
1355 3300026088 Ga0207641_10000832 Ga0207641_1000083229 156
1356 3300026088 Ga0207641_10028936 Ga0207641_100289364 156
1357 3300026088 Ga0207641_10046362 Ga0207641_100463623 156
1358 3300026088 Ga0207641_10091874 Ga0207641_100918743 156
1359 3300026088 Ga0207641_10252563 Ga0207641_102525632 156
1360 3300026088 Ga0207641_10430200 Ga0207641_104302002 156
1361 3300026088 Ga0207641_10484223 Ga0207641_104842232 156
1362 3300026088 Ga0207641_10623493 Ga0207641_106234932 156
1363 3300026089 Ga0207648_10001494 Ga0207648_1000149418 156
1364 3300026089 Ga0207648_10002166 Ga0207648_1000216623 156
1365 3300026089 Ga0207648_10005304 Ga0207648_100053042 156
1366 3300026089 Ga0207648_10007639 Ga0207648_1000763910 156
1367 3300026089 Ga0207648_10314828 Ga0207648_103148282 156
1368 3300026095 Ga0207676_10010977 Ga0207676_100109773 156
1369 3300026095 Ga0207676_10031242 Ga0207676_100312424 156
1370 3300026095 Ga0207676_10034632 Ga0207676_100346322 156
1371 3300026095 Ga0207676_10087407 Ga0207676_100874072 156
1372 3300026095 Ga0207676_10117327 Ga0207676_101173273 156
1373 3300026095 Ga0207676_10157544 Ga0207676_101575443 156
1374 3300026095 Ga0207676_11009222 Ga0207676_110092222 156
1375 3300026095 Ga0207676_11097917 Ga0207676_110979172 156
1376 3300026095 Ga0207676_11373440 Ga0207676_113734402 156
1377 3300026116 Ga0207674_10000140 Ga0207674_1000014052 156
1378 3300026116 Ga0207674_10008483 Ga0207674_100084839 156
1379 3300026116 Ga0207674_10126579 Ga0207674_101265792 156
1380 3300026118 Ga0207675_100003688 Ga0207675_10000368810 156
1381 3300026118 Ga0207675_100024173 Ga0207675_1000241733 156
1382 3300026118 Ga0207675_100133130 Ga0207675_1001331303 156
1383 3300026118 Ga0207675_100258972 Ga0207675_1002589722 156
1384 3300026118 Ga0207675_100621877 Ga0207675_1006218772 156
1385 3300026118 Ga0207675_100754562 Ga0207675_1007545621 156
1386 3300026121 Ga0207683_10000003 Ga0207683_10000003120 156
1387 3300026121 Ga0207683_10004640 Ga0207683_100046407 156
1388 3300026121 Ga0207683_10013734 Ga0207683_100137347 156
1389 3300026121 Ga0207683_10038235 Ga0207683_100382351 156
1390 3300026121 Ga0207683_10041228 Ga0207683_100412283 156
1391 3300026121 Ga0207683_11224833 Ga0207683_112248332 156
1392 3300026142 Ga0207698_10026907 Ga0207698_100269073 156
1393 3300026142 Ga0207698_10140919 Ga0207698_101409192 156
1394 3300026142 Ga0207698_10500209 Ga0207698_105002092 156
1395 3300027907 Ga0207428_10459083 Ga0207428_104590831 156
1396 3300028379 Ga0268266_10398746 Ga0268266_103987462 156
1397 3300028379 Ga0268266_10448216 Ga0268266_104482162 156
1398 3300028379 Ga0268266_10469980 Ga0268266_104699802 156
1399 3300028379 Ga0268266_10507024 Ga0268266_105070242 156
1400 3300028379 Ga0268266_11906427 Ga0268266_119064271 156
1401 3300028380 Ga0268265_10151504 Ga0268265_101515042 156
1402 3300028380 Ga0268265_10171615 Ga0268265_101716152 156
1403 3300028380 Ga0268265_10326190 Ga0268265_103261902 156
1404 3300028381 Ga0268264_10007174 Ga0268264_100071749 156
1405 3300028381 Ga0268264_10027411 Ga0268264_100274113 156
1406 3300028381 Ga0268264_10072575 Ga0268264_100725752 156
1407 3300028381 Ga0268264_10172961 Ga0268264_101729613 156
1408 3300028381 Ga0268264_10317376 Ga0268264_103173762 156
1409 3300031239 Ga0265328_10010415 Ga0265328_100104155 156
1410 3300031241 Ga0265325_10005542 Ga0265325_100055428 156
1411 3300031242 Ga0265329_10001188 Ga0265329_100011889 156
1412 3300031250 Ga0265331_10000588 Ga0265331_100005884 156
1413 3300031251 Ga0265327_10001246 Ga0265327_1000124633 156
1414 3300031344 Ga0265316_10003969 Ga0265316_100039699 156
1415 3300031712 Ga0265342_10035908 Ga0265342_100359082 156
1416 3300031731 Ga0307405_10150781 Ga0307405_101507812 156
1417 3300031852 Ga0307410_10001643 Ga0307410_100016433 156
1418 3300031901 Ga0307406_10002738 Ga0307406_100027383 156
1419 3300031901 Ga0307406_11119924 Ga0307406_111199241 156
1420 3300031911 Ga0307412_10252357 Ga0307412_102523572 156
1421 3300032002 Ga0307416_100287861 Ga0307416_1002878612 156
1422 3300032002 Ga0307416_100581064 Ga0307416_1005810642 156
1423 3300032002 Ga0307416_100881466 Ga0307416_1008814662 156
1424 3300032004 Ga0307414_10031387 Ga0307414_100313872 156
1425 3300032126 Ga0307415_100300861 Ga0307415_1003008612 156
1426 3300035083 Ga0373926_0063682 Ga0373926_0063682_668_1141 156
1427 3300035091 Ga0373951_0197114 Ga0373951_0197114_86_559 156
1428 3300035118 Ga0373954_0350248 Ga0373954_0350248_134_604 156
1429 3300035118 Ga0373954_0370139 Ga0373954_0370139_53_559 156
1430 3300035120 Ga0373957_0020193 Ga0373957_0020193_724_1194 156
1431 3300035170 Ga0373943_0319466 Ga0373943_0319466_228_698 156
1432 3300035172 Ga0373955_0040880 Ga0373955_0040880_1293_1766 156
1433 3300035172 Ga0373955_0086287 Ga0373955_0086287_1151_1621 156
1434 3300035410 Ga0373924_0220160 Ga0373924_0220160_159_629 156
1435 3300035691 Ga0373931_0324949 Ga0373931_0324949_252_782 156
1436 3300035692 Ga0373935_0060731 Ga0373935_0060731_1255_1728 156
1437 3300035695 Ga0373927_0176704 Ga0373927_0176704_606_1082 156
1438 3300035724 Ga0373933_0206472 Ga0373933_0206472_413_913 156
1439 3300035725 Ga0373947_0072873 Ga0373947_0072873_1189_1662 156
1440 3300036401 Ga0373937_0039190 Ga0373937_0039190_499_972 156
1441 3300036401 Ga0373937_0370279 Ga0373937_0370279_780_1280 156
1442 3300036401 Ga0373937_1076454 Ga0373937_1076454_209_715 156
1443 3300037068 Ga0373925_0031283 Ga0373925_0031283_760_1233 156
1444 3300037068 Ga0373925_0161591 Ga0373925_0161591_1044_1520 156
1445 3300037068 Ga0373925_0409949 Ga0373925_0409949_494_967 156
1446 3300037471 Ga0395905_0057608 Ga0395905_0057608_610_1089 156
1447 3300039437 Ga0436365_0612874 Ga0436365_0612874_1307_1786 156
1448 3300041452 Ga0451793_0982348 Ga0451793_0982348_264_737 156
1449 3300041460 Ga0451802_0395932 Ga0451802_0395932_399_872 156
1450 3300041512 Ga0451853_2209825 Ga0451853_2209825_46_519 156
1451 3300042876 Ga0451577_0089006 Ga0451577_0089006_1620_2102 156
1452 3300042876 Ga0451577_0319536 Ga0451577_0319536_379_876 156
1453 3300044712 Ga0453684_0326016 Ga0453684_0326016_141_623 156
1454 3300044712 Ga0453684_0747795 Ga0453684_0747795_405_902 156
1455 3300045051 Ga0451576_0078737 Ga0451576_0078737_438_935 156
1456 3300045051 Ga0451576_0109010 Ga0451576_0109010_2041_2517 156
1457 3300046459 Ga0495629_0122985 Ga0495629_0122985_31_501 156
1458 3300046683 Ga0495658_0051443 Ga0495658_0051443_1773_2243 156
1459 3300047471 Ga0495684_0229618 Ga0495684_0229618_563_1069 156
1460 3300048903 Ga0496100_0148853 Ga0496100_0148853_893_1363 156
1461 3300048905 Ga0496102_0068326 Ga0496102_0068326_1449_1919 156
1462 3300048905 Ga0496102_0637073 Ga0496102_0637073_379_870 156
1463 3300048907 Ga0496104_0047473 Ga0496104_0047473_2793_3263 156
1464 3300048907 Ga0496104_0190240 Ga0496104_0190240_1452_1925 156
1465 3300048910 Ga0496107_0025820 Ga0496107_0025820_1717_2187 156
1466 3300048911 Ga0496108_0159103 Ga0496108_0159103_630_1100 156
1467 3300048911 Ga0496108_0215054 Ga0496108_0215054_903_1394 156
1468 3300048912 Ga0496109_0105832 Ga0496109_0105832_127_600 156
1469 3300048913 Ga0496110_0149406 Ga0496110_0149406_141_611 156
1470 3300048913 Ga0496110_0286969 Ga0496110_0286969_896_1369 156
1471 3300048913 Ga0496110_1090073 Ga0496110_1090073_133_615 156
1472 3300048914 Ga0496111_0176743 Ga0496111_0176743_492_962 156
1473 3300048914 Ga0496111_0613467 Ga0496111_0613467_101_601 156
1474 3300048915 Ga0496112_0073785 Ga0496112_0073785_1202_1693 156
1475 3300048916 Ga0496113_0071646 Ga0496113_0071646_1015_1494 156
1476 3300048917 Ga0496114_0620088 Ga0496114_0620088_327_800 156
1477 3300048918 Ga0496115_0892985 Ga0496115_0892985_40_513 156
1478 3300049588 Ga0501072_0343786 Ga0501072_0343786_662_1135 156
1479 3300049592 Ga0501076_0116726 Ga0501076_0116726_1144_1671 156
1480 3300050489 nmdc:mga03683_46821_c1 nmdc:mga03683_46821_c1_348_827 156
1481 3300050496 nmdc:mga07m45_1390_c1 nmdc:mga07m45_1390_c1_9874_10353 156
1482 3300050511 nmdc:mga08y16_368861_c1 nmdc:mga08y16_368861_c1_759_1229 156
1483 3300050513 nmdc:mga0rr50_154529_c1 nmdc:mga0rr50_154529_c1_67_549 156
1484 3300053084 Ga0495595_0134453 Ga0495595_0134453_689_1195 156
1485 3300061734 Ga0530510_0107075 Ga0530510_0107075_249_776 156

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00588

SpoU_methylase

SpoU rRNA Methylase family

38

182

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
6qkv-assembly1.cif.gz_B structure of yibk from p. aeruginosa 0.9446 1 156
6qh8-assembly2.cif.gz_B structure of knotted yibk from p. aeruginosa 0.944 1 156
4kdz-assembly1.cif.gz_A crystal structure of trna/rrna methyltransferase yibk from escherichia coli (target nysgrc-012599) 0.9435 1 155
6qh8-assembly1.cif.gz_C structure of knotted yibk from p. aeruginosa 0.9407 1 154
5co4-assembly1.cif.gz_A structural insights into the 2-oh methylation of c/u34 on trna 0.9333 1 156
ID Description Score Start End Superfamily
5co4A00 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.9333 1 156 3.40.1280.10
af_O50394_1_154_3.40.1280.10 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.9304 1 156 3.40.1280.10
af_C6TCU8_69_240_3.40.1280.10 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.9286 2 154 3.40.1280.10
af_O50394_1_154_3.40.1280.10 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.9189 1 156 3.40.1280.10
5co4A00 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.9097 1 156 3.40.1280.10
ID Description Score Start End GO Terms
AF-A0A5M4EN07-F1-model_v4 Putative tRNA (cytidine(34)-2'-O)-methyltransferase (EC 2.1.1.207) (tRNA (cytidine/uridine-2'-O-)-methyltransferase) 0.9607 3 156 GO:0002130
GO:0003723
GO:0005737
GO:0141098
GO:0141102
AF-A0A4P5WXF1-F1-model_v4 Putative tRNA (cytidine(34)-2'-O)-methyltransferase (EC 2.1.1.207) (tRNA (cytidine/uridine-2'-O-)-methyltransferase) 0.9542 2 151 GO:0002130
GO:0003723
GO:0005737
GO:0141098
GO:0141102
AF-N6Z7Y9-F1-model_v4 tRNA (cytidine(34)-2'-O)-methyltransferase (EC 2.1.1.207) (tRNA (cytidine/uridine-2'-O-)-methyltransferase TrmL) 0.9522 1 156 GO:0002131
GO:0002132
GO:0003723
GO:0005737
GO:0141098
GO:0141102
AF-A0A7J7B2Z1-F1-model_v4 deleted 0.9513 1 153
AF-A0A0K8P130-F1-model_v4 tRNA (cytidine(34)-2'-O)-methyltransferase (EC 2.1.1.207) (tRNA (cytidine/uridine-2'-O-)-methyltransferase TrmL) 0.9511 1 156 GO:0002131
GO:0002132
GO:0003723
GO:0005737
GO:0141098
GO:0141102

Feature Viewer

pLDDT pTM Quality
91.16 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map