F494266

General Info

Members Datasets Scaffolds Average Seq Length
1480 694 1280 173

Family's Representative Sequence

Representative Sequence 3300005614|Ga0068856_100261863|Ga0068856_1002618632
Length 193
Sequence MERNDPDGRHCAPEIKSMMRRLLQPFWVLLAIVFLIEAWLWDHLEPIVARIVALIPLRAFKQWLADRVDALSPAMTLIVFAVPVIPLFPLKLVGLWLLANEYWVSAAIVIVLGKFVGLGVTAFIFDVTRSKLMQMAWFKKVYEFIMAMRAKAAELVQPIKQRIKEVLHGGGDGWSSRTLRLIQRFRKSVHEAR

Samples

Sample ID Description Type Environment
1 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
2 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
3 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
4 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
5 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
6 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
7 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
8 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
9 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
10 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
11 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
12 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
13 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
14 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
15 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
16 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
17 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
18 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
19 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
20 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
21 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
22 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
23 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
24 2791355199
25 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
26 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
27 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
28 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
29 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
30 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
31 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
32 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
33 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
34 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
35 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
36 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
37 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
38 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
39 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
40 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
41 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
42 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
43 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
44 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
45 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
46 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
47 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
48 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
49 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
50 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
51 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
52 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
53 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
54 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
55 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
56 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
57 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
58 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
59 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
60 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
61 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
62 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
63 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
64 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
65 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
66 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
67 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
68 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
69 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
70 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
71 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
72 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
73 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
74 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
75 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
76 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
77 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
78 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
79 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
80 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
81 2904699407
82 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
83 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
84 2906610324
85 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
86 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
87 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
88 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
89 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
90 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
91 2922368715
92 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
93 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
94 2922425934
95 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
96 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
97 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
98 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
99 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
100 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
101 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
102 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
103 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
104 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
105 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
106 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
107 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
108 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
109 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
110 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
111 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
112 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
113 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
114 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
115 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
116 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
117 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
118 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
119 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
120 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
121 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
122 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
123 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
124 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
125 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
126 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
127 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
128 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
129 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
130 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
131 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
132 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
133 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
134 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
135 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
136 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
137 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
138 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
139 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
140 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
141 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
142 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
143 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
144 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
145 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
146 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
147 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
148 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
149 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
150 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
151 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
152 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
153 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
154 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
155 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
156 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
157 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
158 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
159 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
160 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
161 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
162 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
163 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
164 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
165 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
166 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
167 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
168 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
169 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
170 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
171 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
172 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
173 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
174 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
175 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
176 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
177 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
178 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
179 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
180 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
181 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
182 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
183 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
184 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
185 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
186 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
187 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
188 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
189 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
190 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
191 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
192 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
193 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
194 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
195 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
196 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
197 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
198 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
199 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
200 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
201 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
202 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
203 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
204 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
205 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
206 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
207 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
208 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
209 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
210 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
211 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
212 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
213 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
214 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
215 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
216 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
217 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
218 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
219 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
220 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
221 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
222 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
223 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
224 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
225 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
226 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
227 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
228 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
229 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
230 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
231 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
232 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
233 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
234 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
235 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
236 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
237 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
238 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
239 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
240 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
241 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
242 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
243 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
244 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
245 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
246 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
247 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
248 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
249 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
250 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
251 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
252 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
253 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
254 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
255 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
256 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
257 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
258 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
259 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
260 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
261 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
262 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
263 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
264 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
265 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
266 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
267 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
268 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
269 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
270 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
271 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
272 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
273 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
274 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
275 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
276 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
277 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
278 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
279 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
280 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
281 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
282 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
283 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
284 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
285 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
286 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
287 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
288 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
289 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
290 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
291 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
292 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
293 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
294 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
295 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
296 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
297 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
298 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
299 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
300 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
301 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
302 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
303 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
304 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
305 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
306 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
307 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
308 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
309 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
310 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
311 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
312 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
313 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
314 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
315 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
316 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
317 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
318 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
319 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
320 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
321 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
322 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
323 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
324 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
325 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
326 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
327 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
328 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
329 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
330 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
331 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
332 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
333 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
334 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
335 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
336 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
337 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
338 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
339 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
340 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
341 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
342 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
343 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
344 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
345 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
346 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
347 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
348 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
349 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
350 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
351 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
352 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
353 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
354 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
355 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
356 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
357 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
358 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
359 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
360 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
361 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
362 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
363 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
364 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
365 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
366 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
367 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
368 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
369 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
370 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
371 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
372 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
373 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
374 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
375 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
376 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
377 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
378 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
379 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
380 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
381 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
382 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
383 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
384 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
385 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
386 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
387 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
388 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
389 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
390 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
391 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
392 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
393 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
394 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
395 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
396 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
397 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
398 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
399 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
400 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
401 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
402 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
403 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
404 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
405 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
406 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
407 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
408 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
409 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
410 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
411 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
412 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
413 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
414 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
415 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
416 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
417 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
418 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
419 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
420 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
421 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
422 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
423 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
424 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
425 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
426 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
427 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
428 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
429 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
430 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
431 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
432 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
433 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
434 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
435 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
436 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
437 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
438 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
439 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
440 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
441 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
442 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
443 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
444 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
445 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
446 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
447 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
448 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
449 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
450 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
451 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
452 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
453 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
454 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
455 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
456 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
457 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
458 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
459 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
460 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
461 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
462 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
463 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
464 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
465 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
466 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
467 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
468 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
469 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
470 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
471 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
472 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
473 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
474 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
475 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
476 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
477 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
478 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
479 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
480 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
481 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
482 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
483 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
484 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
485 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
486 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
487 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
488 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
489 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
490 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
491 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
492 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
493 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
494 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
495 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
496 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
497 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
498 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
499 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
500 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
501 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
502 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
503 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
504 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
505 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
506 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
507 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
508 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
509 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
510 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
511 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
512 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
513 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
514 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
515 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
516 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
517 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
518 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
519 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
520 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
521 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
522 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
523 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
524 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
525 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
526 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
527 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
528 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
529 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
530 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
531 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
532 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
533 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
534 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
535 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
536 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
537 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
538 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
539 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
540 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
541 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
542 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
543 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
544 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
545 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
546 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
547 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
548 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
549 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
550 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
551 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
552 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
553 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
554 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
555 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
556 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
557 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
558 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
559 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
560 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
561 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
562 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
563 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
564 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
565 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
566 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
567 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
568 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
569 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
570 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
571 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
572 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
573 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
574 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
575 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
576 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
577 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
578 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
579 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
580 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
581 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
582 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
583 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
584 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
585 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
586 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
587 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
588 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
589 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
590 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
591 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
592 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
593 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
594 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
595 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
596 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
597 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
598 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
599 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
600 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
601 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
602 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
603 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
604 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
605 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
606 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
607 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
608 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
609 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
610 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
611 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
612 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
613 3300053106 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 endosphere Metagenome Endosphere
614 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
615 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
616 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
617 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
618 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
619 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
620 3300053124 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere Metagenome Endosphere
621 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
622 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
623 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
624 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
625 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
626 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
627 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
628 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
629 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
630 3300053144 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 endosphere Metagenome Endosphere
631 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
632 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
633 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
634 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
635 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
636 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
637 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
638 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
639 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
640 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
641 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
642 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
643 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
644 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
645 3300053722 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 endosphere Metagenome Endosphere
646 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
647 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
648 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
649 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
650 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
651 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
652 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
653 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
654 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
655 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
656 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
657 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
658 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
659 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
660 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
661 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
662 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
663 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
664 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
665 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
666 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
667 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
668 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
669 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
670 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
671 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
672 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
673 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
674 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
675 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
676 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
677 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
678 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
679 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
680 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
681 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
682 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
683 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
684 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
685 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
686 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
687 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
688 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
689 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
690 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
691 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
692 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
693 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
694 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 86.64
Metatranscriptomes 0.14
Isolates 13.22

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15
Nodule 10.54
Rhizoplane 5.27
Rhizosphere 58.51
Stem 0
Stem Tuber 0
Unclassified 10.68

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1009058 3300001904 Bacteria 1648
2 JGI24737J22298_10067448 3300001990 Bacteria 1071
3 JGI24744J21845_10006651 3300002077 Bacteria 2393
4 JGI25406J46586_10009349 3300003203 Bacteria 4391
5 JGI25406J46586_10154205 3300003203 Bacteria 670
6 JGI25165J46597_1005291 3300003214 Bacteria 2526
7 JGI25153J46596_10005387 3300003215 Bacteria 6720
8 JGI25153J46596_10006271 3300003215 Bacteria 6074
9 JGI25153J46596_10006385 3300003215 Bacteria 5976
10 JGI25153J46596_10014578 3300003215 Bacteria 3256
11 JGI25153J46596_10042166 3300003215 Bacteria 1395
12 rootL2_10223649 3300003322 Bacteria 2054
13 JGI25160J50197_1002041 3300003354 Bacteria 9623
14 JGI25160J50197_1004384 3300003354 Bacteria 6116
15 JGI25160J50197_1005378 3300003354 Bacteria 5340
16 JGI25161J50226_1018010 3300003374 Bacteria 736
17 JGI25404J52841_10000873 3300003659 Bacteria 4879
18 JGI25404J52841_10013024 3300003659 Bacteria 1804
19 JGI25404J52841_10067389 3300003659 Bacteria 749
20 JGI25404J52841_10106369 3300003659 Bacteria 589
21 Ga0055531_10004632 3300003794 Bacteria 8262
22 Ga0055531_10027490 3300003794 Bacteria 1995
23 Ga0055543_1007172 3300004625 Bacteria 2604
24 Ga0055543_1026148 3300004625 Bacteria 1039
25 Ga0065165_1003775 3300005262 Bacteria 10150
26 Ga0065165_1003886 3300005262 Bacteria 9897
27 Ga0065165_1019062 3300005262 Bacteria 2463
28 Ga0070658_10291913 3300005327 Bacteria 1389
29 Ga0070676_10547942 3300005328 Bacteria 827
30 Ga0070690_100099015 3300005330 Bacteria 1930
31 Ga0070670_100525653 3300005331 Bacteria 1054
32 Ga0068869_100031930 3300005334 Bacteria 3708
33 Ga0068869_100401449 3300005334 Bacteria 1127
34 Ga0068869_100433628 3300005334 Bacteria 1086
35 Ga0070666_10322709 3300005335 Bacteria 1102
36 Ga0070666_10664934 3300005335 Bacteria 762
37 Ga0070680_100277401 3300005336 Bacteria 1420
38 Ga0070682_100240415 3300005337 Bacteria 1299
39 Ga0068868_100162758 3300005338 Bacteria 1844
40 Ga0068868_100435601 3300005338 Bacteria 1137
41 Ga0068868_100614006 3300005338 Bacteria 965
42 Ga0068868_100981123 3300005338 Bacteria 772
43 Ga0068868_101352447 3300005338 Bacteria 663
44 Ga0070660_100505443 3300005339 Bacteria 1006
45 Ga0070689_100143600 3300005340 Bacteria 1921
46 Ga0070687_100653555 3300005343 Bacteria 729
47 Ga0070661_100268021 3300005344 Bacteria 1322
48 Ga0070668_100052173 3300005347 Bacteria 3152
49 Ga0070668_100080823 3300005347 Bacteria 2547
50 Ga0070668_100092406 3300005347 Bacteria 2386
51 Ga0070668_100093376 3300005347 Bacteria 2374
52 Ga0070668_100146930 3300005347 Bacteria 1903
53 Ga0070668_100226037 3300005347 Bacteria 1546
54 Ga0070668_100461726 3300005347 Bacteria 1093
55 Ga0070669_100196111 3300005353 Bacteria 1586
56 Ga0070675_100174031 3300005354 Bacteria 1858
57 Ga0070675_101051968 3300005354 Bacteria 748
58 Ga0070671_100457252 3300005355 Bacteria 1096
59 Ga0070671_100577311 3300005355 Bacteria 971
60 Ga0070674_100286693 3300005356 Bacteria 1307
61 Ga0070674_100476657 3300005356 Bacteria 1035
62 Ga0070674_101173489 3300005356 Bacteria 681
63 Ga0070673_100288838 3300005364 Bacteria 1441
64 Ga0070673_100459906 3300005364 Bacteria 1146
65 Ga0070673_101509513 3300005364 Bacteria 634
66 Ga0070688_100937311 3300005365 Bacteria 685
67 Ga0070659_100129249 3300005366 Bacteria 2050
68 Ga0070659_101040940 3300005366 Bacteria 720
69 Ga0070667_100184393 3300005367 Bacteria 1847
70 Ga0070709_10000164 3300005434 Bacteria 42124
71 Ga0070709_10184937 3300005434 Bacteria 1466
72 Ga0070714_100047913 3300005435 Bacteria 3633
73 Ga0070714_100116517 3300005435 Bacteria 2372
74 Ga0070713_100004014 3300005436 Bacteria 9799
75 Ga0070713_100094561 3300005436 Bacteria 2577
76 Ga0070713_100196055 3300005436 Bacteria 1822
77 Ga0070713_100906911 3300005436 Bacteria 848
78 Ga0070710_10000283 3300005437 Bacteria 24031
79 Ga0070710_10153524 3300005437 Bacteria 1422
80 Ga0070701_10438818 3300005438 Bacteria 835
81 Ga0070711_100005189 3300005439 Bacteria 7768
82 Ga0070711_100015539 3300005439 Bacteria 4818
83 Ga0070663_100040755 3300005455 Bacteria 3253
84 Ga0070663_100048472 3300005455 Bacteria 3012
85 Ga0070663_100124021 3300005455 Bacteria 1954
86 Ga0070663_100124757 3300005455 Bacteria 1949
87 Ga0070663_100126633 3300005455 Bacteria 1935
88 Ga0070663_100206905 3300005455 Bacteria 1534
89 Ga0070663_100455756 3300005455 Bacteria 1055
90 Ga0070663_100586840 3300005455 Bacteria 936
91 Ga0070663_100617546 3300005455 Bacteria 913
92 Ga0070663_100845157 3300005455 Bacteria 787
93 Ga0070678_100031271 3300005456 Bacteria 3669
94 Ga0070678_100298265 3300005456 Bacteria 1369
95 Ga0070678_100376863 3300005456 Bacteria 1227
96 Ga0070678_100435374 3300005456 Bacteria 1146
97 Ga0070662_100249738 3300005457 Bacteria 1426
98 Ga0070662_100412757 3300005457 Bacteria 1116
99 Ga0070681_10099168 3300005458 Bacteria 2859
100 Ga0070706_100375313 3300005467 Bacteria 1325
101 Ga0070707_100137959 3300005468 Bacteria 2373
102 Ga0070679_100177508 3300005530 Bacteria 2103
103 Ga0070697_100073538 3300005536 Bacteria 2807
104 Ga0068853_100272640 3300005539 Bacteria 1558
105 Ga0068853_100330786 3300005539 Bacteria 1414
106 Ga0068853_100366307 3300005539 Bacteria 1344
107 Ga0068853_100504203 3300005539 Bacteria 1143
108 Ga0068853_100588946 3300005539 Bacteria 1056
109 Ga0070672_100133626 3300005543 Bacteria 2041
110 Ga0070672_100209828 3300005543 Bacteria 1631
111 Ga0070686_100300815 3300005544 Bacteria 1190
112 Ga0070693_100054359 3300005547 Bacteria 2302
113 Ga0070693_100334448 3300005547 Bacteria 1032
114 Ga0070665_100024388 3300005548 Bacteria 6091
115 Ga0070665_100113273 3300005548 Bacteria 2715
116 Ga0070665_100232557 3300005548 Bacteria 1843
117 Ga0070665_100263835 3300005548 Bacteria 1723
118 Ga0070665_100423701 3300005548 Bacteria 1340
119 Ga0070665_100666282 3300005548 Bacteria 1054
120 Ga0070665_101829538 3300005548 Bacteria 614
121 Ga0068855_100205366 3300005563 Bacteria 2217
122 Ga0070664_100114656 3300005564 Bacteria 2355
123 Ga0068857_100276126 3300005577 Bacteria 1545
124 Ga0068857_100480307 3300005577 Bacteria 1164
125 Ga0068857_100538843 3300005577 Bacteria 1099
126 Ga0068857_100574455 3300005577 Bacteria 1064
127 Ga0068854_100037985 3300005578 Bacteria 3384
128 Ga0068854_100350862 3300005578 Bacteria 1207
129 Ga0068856_100101992 3300005614 Bacteria 2863
130 Ga0068856_100151979 3300005614 Bacteria 2324
131 Ga0068856_100261863 3300005614 Bacteria 1745
132 Ga0068856_100762197 3300005614 Bacteria 988
133 Ga0068856_100892822 3300005614 Bacteria 908
134 Ga0070702_100034991 3300005615 Bacteria 2773
135 Ga0070702_100176664 3300005615 Bacteria 1394
136 Ga0068852_100164356 3300005616 Bacteria 2075
137 Ga0068852_100340850 3300005616 Bacteria 1461
138 Ga0068852_100695221 3300005616 Bacteria 1027
139 Ga0068852_100819838 3300005616 Bacteria 945
140 Ga0068859_100320351 3300005617 Bacteria 1644
141 Ga0068859_100404153 3300005617 Bacteria 1462
142 Ga0068859_100673693 3300005617 Bacteria 1126
143 Ga0068859_100930930 3300005617 Bacteria 953
144 Ga0068864_100076165 3300005618 Bacteria 2930
145 Ga0068866_10064783 3300005718 Bacteria 1909
146 Ga0068866_10154652 3300005718 Bacteria 1332
147 Ga0068861_100362861 3300005719 Bacteria 1274
148 Ga0068861_100401389 3300005719 Bacteria 1216
149 Ga0068861_100672704 3300005719 Bacteria 959
150 Ga0068870_10362037 3300005840 Bacteria 934
151 Ga0068863_100572227 3300005841 Bacteria 1117
152 Ga0068863_100585417 3300005841 Bacteria 1104
153 Ga0068863_100687203 3300005841 Bacteria 1017
154 Ga0068863_100792837 3300005841 Bacteria 945
155 Ga0068863_101031747 3300005841 Bacteria 826
156 Ga0068858_100241443 3300005842 Bacteria 1714
157 Ga0068858_100292276 3300005842 Bacteria 1553
158 Ga0068858_100326385 3300005842 Bacteria 1467
159 Ga0068858_100414739 3300005842 Bacteria 1295
160 Ga0068858_100504965 3300005842 Bacteria 1168
161 Ga0068858_100514563 3300005842 Bacteria 1157
162 Ga0068860_100017741 3300005843 Bacteria 6934
163 Ga0068860_100253173 3300005843 Bacteria 1715
164 Ga0068860_100443083 3300005843 Bacteria 1290
165 Ga0068862_100086095 3300005844 Bacteria 2731
166 Ga0081455_10016293 3300005937 Bacteria 7181
167 Ga0081455_10027264 3300005937 Bacteria 5236
168 Ga0081455_10169663 3300005937 Bacteria 1664
169 Ga0081455_10196830 3300005937 Bacteria 1513
170 Ga0081455_10205630 3300005937 Bacteria 1471
171 Ga0081455_10209159 3300005937 Bacteria 1455
172 Ga0081455_10400114 3300005937 Bacteria 953
173 Ga0081540_1002717 3300005983 Bacteria 14394
174 Ga0081540_1004243 3300005983 Bacteria 11008
175 Ga0081540_1004583 3300005983 Bacteria 10468
176 Ga0081540_1006735 3300005983 Bacteria 8310
177 Ga0081540_1014469 3300005983 Bacteria 5053
178 Ga0081540_1018204 3300005983 Bacteria 4319
179 Ga0081540_1036177 3300005983 Bacteria 2637
180 Ga0081540_1049325 3300005983 Bacteria 2101
181 Ga0081540_1080078 3300005983 Bacteria 1474
182 Ga0081539_10000371 3300005985 Bacteria 98455
183 Ga0081539_10018231 3300005985 Bacteria 4882
184 Ga0081539_10078005 3300005985 Bacteria 1750
185 Ga0081539_10143754 3300005985 Bacteria 1156
186 Ga0070717_10038762 3300006028 Bacteria 3874
187 Ga0070717_10616045 3300006028 Bacteria 985
188 Ga0070717_11219148 3300006028 Bacteria 685
189 Ga0075365_10007177 3300006038 Bacteria 6219
190 Ga0075365_10007995 3300006038 Bacteria 5968
191 Ga0075365_10044897 3300006038 Bacteria 2897
192 Ga0075365_10117749 3300006038 Bacteria 1830
193 Ga0075365_10171744 3300006038 Bacteria 1513
194 Ga0075365_10196786 3300006038 Bacteria 1411
195 Ga0075365_10264509 3300006038 Bacteria 1209
196 Ga0075365_10337125 3300006038 Bacteria 1062
197 Ga0075368_10014493 3300006042 Bacteria 2913
198 Ga0075363_100000382 3300006048 Bacteria 13428
199 Ga0075363_100009480 3300006048 Bacteria 4577
200 Ga0075363_100171579 3300006048 Bacteria 1231
201 Ga0075364_10072888 3300006051 Bacteria 2263
202 Ga0075364_10096242 3300006051 Bacteria 1968
203 Ga0075364_10114904 3300006051 Bacteria 1799
204 Ga0075364_10170040 3300006051 Bacteria 1473
205 Ga0075364_10415813 3300006051 Bacteria 918
206 Ga0070715_10086905 3300006163 Bacteria 1431
207 Ga0070715_10161682 3300006163 Bacteria 1107
208 Ga0070715_10304498 3300006163 Bacteria 854
209 Ga0070716_100168012 3300006173 Bacteria 1429
210 Ga0070716_100307856 3300006173 Bacteria 1105
211 Ga0070712_100014272 3300006175 Bacteria 5101
212 Ga0070712_100026701 3300006175 Bacteria 3850
213 Ga0070712_100248984 3300006175 Bacteria 1419
214 Ga0075362_10001063 3300006177 Bacteria 8485
215 Ga0075362_10093881 3300006177 Bacteria 1395
216 Ga0075367_10026606 3300006178 Bacteria 3283
217 Ga0075367_10066229 3300006178 Bacteria 2164
218 Ga0075367_10084792 3300006178 Bacteria 1922
219 Ga0075367_10122497 3300006178 Bacteria 1603
220 Ga0075367_10128287 3300006178 Bacteria 1566
221 Ga0075367_10259502 3300006178 Bacteria 1091
222 Ga0075367_10376682 3300006178 Bacteria 897
223 Ga0075369_10184077 3300006186 Bacteria 961
224 Ga0075369_10205841 3300006186 Bacteria 909
225 Ga0075369_10424051 3300006186 Bacteria 628
226 Ga0075366_10043941 3300006195 Bacteria 2647
227 Ga0075366_10065380 3300006195 Bacteria 2163
228 Ga0075366_10086496 3300006195 Bacteria 1875
229 Ga0075366_10106390 3300006195 Bacteria 1686
230 Ga0075366_10186447 3300006195 Bacteria 1260
231 Ga0075366_10231164 3300006195 Bacteria 1127
232 Ga0075366_10383996 3300006195 Bacteria 864
233 Ga0075366_10455285 3300006195 Bacteria 790
234 Ga0075366_10495048 3300006195 Bacteria 755
235 Ga0097621_100892052 3300006237 Bacteria 828
236 Ga0097621_100951034 3300006237 Bacteria 802
237 Ga0075370_10029240 3300006353 Bacteria 3068
238 Ga0075370_10112638 3300006353 Bacteria 1581
239 Ga0075370_10144561 3300006353 Bacteria 1391
240 Ga0075370_10202053 3300006353 Bacteria 1172
241 Ga0068871_100360992 3300006358 Bacteria 1287
242 Ga0068871_101296814 3300006358 Bacteria 685
243 Ga0075428_100221744 3300006844 Bacteria 2042
244 Ga0068865_100128766 3300006881 Bacteria 1893
245 Ga0068865_100323303 3300006881 Bacteria 1242
246 Ga0075436_100497088 3300006914 Bacteria 892
247 Ga0097620_100320365 3300006931 Bacteria 1644
248 Ga0097620_100404141 3300006931 Bacteria 1462
249 Ga0097620_100673723 3300006931 Bacteria 1126
250 Ga0097620_100930904 3300006931 Bacteria 953
251 Ga0099824_1015237 3300006942 Bacteria 7359
252 Ga0099822_1035053 3300006943 Bacteria 3285
253 Ga0075435_100168984 3300007076 Bacteria 1844
254 Ga0099794_10421978 3300007265 Bacteria 698
255 Ga0099795_10029851 3300007788 Bacteria 1866
256 Ga0099795_10119526 3300007788 Bacteria 1052
257 Ga0105251_10189061 3300009011 Bacteria 927
258 Ga0105250_10186222 3300009092 Bacteria 872
259 Ga0105250_10401323 3300009092 Bacteria 608
260 Ga0105240_10178027 3300009093 Bacteria 2512
261 Ga0105240_10226073 3300009093 Bacteria 2177
262 Ga0105240_10642954 3300009093 Bacteria 1163
263 Ga0105240_10758931 3300009093 Bacteria 1054
264 Ga0111539_10417181 3300009094 Bacteria 1563
265 Ga0105245_10306632 3300009098 Bacteria 1560
266 Ga0105245_10504544 3300009098 Bacteria 1226
267 Ga0105245_11323201 3300009098 Bacteria 770
268 Ga0105247_10023886 3300009101 Bacteria 3683
269 Ga0105247_10131208 3300009101 Bacteria 1633
270 Ga0105247_10142907 3300009101 Bacteria 1570
271 Ga0105247_10167541 3300009101 Bacteria 1459
272 Ga0105247_10275874 3300009101 Bacteria 1158
273 Ga0105247_10413079 3300009101 Bacteria 964
274 Ga0114129_11026378 3300009147 Bacteria 1037
275 Ga0105243_10121232 3300009148 Bacteria 2205
276 Ga0105243_11260329 3300009148 Bacteria 755
277 Ga0105241_10127058 3300009174 Bacteria 2060
278 Ga0105241_11041033 3300009174 Bacteria 768
279 Ga0105241_11076802 3300009174 Bacteria 756
280 Ga0105242_10129766 3300009176 Bacteria 2174
281 Ga0105242_10215683 3300009176 Bacteria 1712
282 Ga0105242_11013291 3300009176 Bacteria 839
283 Ga0105242_11025958 3300009176 Bacteria 834
284 Ga0105248_10041030 3300009177 Bacteria 5189
285 Ga0105248_10220918 3300009177 Bacteria 2133
286 Ga0105248_10342081 3300009177 Bacteria 1684
287 Ga0105248_10392667 3300009177 Bacteria 1562
288 Ga0105248_11057603 3300009177 Bacteria 917
289 Ga0105237_10069275 3300009545 Bacteria 3523
290 Ga0105237_10142859 3300009545 Bacteria 2388
291 Ga0105237_10400005 3300009545 Bacteria 1378
292 Ga0105237_10443980 3300009545 Bacteria 1303
293 Ga0105237_10531032 3300009545 Bacteria 1183
294 Ga0105237_10907925 3300009545 Bacteria 888
295 Ga0105237_10970004 3300009545 Bacteria 857
296 Ga0105237_11191088 3300009545 Bacteria 768
297 Ga0105238_10194243 3300009551 Bacteria 2005
298 Ga0105238_10215852 3300009551 Bacteria 1894
299 Ga0105238_10538750 3300009551 Bacteria 1171
300 Ga0105238_10563306 3300009551 Bacteria 1145
301 Ga0105238_10583601 3300009551 Bacteria 1124
302 Ga0105238_11456335 3300009551 Bacteria 713
303 Ga0105249_10059548 3300009553 Bacteria 3502
304 Ga0105249_10149581 3300009553 Bacteria 2247
305 Ga0105249_10432199 3300009553 Bacteria 1352
306 Ga0105249_11609445 3300009553 Bacteria 722
307 Ga0099796_10006414 3300010159 Bacteria 3008
308 Ga0099796_10015670 3300010159 Bacteria 2220
309 Ga0099796_10141877 3300010159 Bacteria 939
310 Ga0105239_10066302 3300010375 Bacteria 3966
311 Ga0105239_10246790 3300010375 Bacteria 2005
312 Ga0105239_10280959 3300010375 Bacteria 1874
313 Ga0105239_10343708 3300010375 Bacteria 1684
314 Ga0105239_10495695 3300010375 Bacteria 1389
315 Ga0105239_10509286 3300010375 Bacteria 1369
316 Ga0105239_10572339 3300010375 Bacteria 1287
317 Ga0105239_10996996 3300010375 Bacteria 963
318 Ga0105246_10040758 3300011119 Bacteria 3136
319 Ga0105246_10239352 3300011119 Bacteria 1434
320 Ga0105246_10374335 3300011119 Bacteria 1175
321 Ga0157370_10074997 3300013104 Bacteria 3190
322 Ga0157370_10222534 3300013104 Bacteria 1748
323 Ga0157369_10030438 3300013105 Bacteria 5952
324 Ga0157374_10255525 3300013296 Bacteria 1725
325 Ga0157374_10270162 3300013296 Bacteria 1676
326 Ga0157374_10838057 3300013296 Bacteria 936
327 Ga0157378_10020915 3300013297 Bacteria 5757
328 Ga0157378_10070174 3300013297 Bacteria 3145
329 Ga0157378_10233186 3300013297 Bacteria 1755
330 Ga0157378_10444310 3300013297 Bacteria 1286
331 Ga0157378_10466163 3300013297 Bacteria 1256
332 Ga0157378_10714024 3300013297 Bacteria 1023
333 Ga0163162_10211259 3300013306 Bacteria 2070
334 Ga0163162_10413485 3300013306 Bacteria 1481
335 Ga0163162_10413874 3300013306 Bacteria 1480
336 Ga0163162_10743862 3300013306 Bacteria 1100
337 Ga0163162_10824995 3300013306 Bacteria 1044
338 Ga0157372_10718860 3300013307 Bacteria 1162
339 Ga0157375_10217414 3300013308 Bacteria 2069
340 Ga0157375_10783766 3300013308 Bacteria 1103
341 Ga0157375_11007278 3300013308 Bacteria 973
342 Ga0157375_11227028 3300013308 Bacteria 880
343 Ga0163163_10028423 3300014325 Bacteria 5369
344 Ga0163163_10133712 3300014325 Bacteria 2521
345 Ga0163163_10690854 3300014325 Bacteria 1084
346 Ga0163163_10899950 3300014325 Bacteria 948
347 Ga0163163_11046276 3300014325 Bacteria 879
348 Ga0157380_10114201 3300014326 Bacteria 2275
349 Ga0157380_10239624 3300014326 Bacteria 1634
350 Ga0157380_10873498 3300014326 Bacteria 923
351 Ga0157380_11253403 3300014326 Bacteria 787
352 Ga0157377_10207455 3300014745 Bacteria 1248
353 Ga0157377_10295538 3300014745 Bacteria 1067
354 Ga0157379_10289247 3300014968 Bacteria 1492
355 Ga0157379_10381779 3300014968 Bacteria 1293
356 Ga0157379_10707919 3300014968 Bacteria 946
357 Ga0157376_10163532 3300014969 Bacteria 2020
358 Ga0157376_10166023 3300014969 Bacteria 2006
359 Ga0157376_11292722 3300014969 Bacteria 759
360 Ga0163161_10072163 3300017792 Bacteria 2528
361 Ga0163161_10265581 3300017792 Bacteria 1342
362 Ga0206353_11400766 3300020082 Bacteria 1120
363 Ga0213876_10249333 3300021384 Bacteria 943
364 Ga0213875_10243397 3300021388 Bacteria 848
365 Ga0213875_10395076 3300021388 Bacteria 659
366 Ga0209563_105793 3300025230 Bacteria 2196
367 Ga0209677_105710 3300025253 Bacteria 3168
368 Ga0209148_1000295 3300025254 Bacteria 73660
369 Ga0209233_1003058 3300025261 Bacteria 5951
370 Ga0209233_1055178 3300025261 Bacteria 790
371 Ga0209233_1060958 3300025261 Bacteria 728
372 Ga0209455_1008110 3300025272 Bacteria 2887
373 Ga0209455_1021718 3300025272 Bacteria 1239
374 Ga0209673_1032099 3300025273 Bacteria 1622
375 Ga0209564_1007238 3300025295 Bacteria 5772
376 Ga0209564_1015758 3300025295 Bacteria 3055
377 Ga0209758_1000069 3300025297 Bacteria 286161
378 Ga0209758_1001816 3300025297 Bacteria 23562
379 Ga0209758_1002809 3300025297 Bacteria 16970
380 Ga0209758_1003717 3300025297 Bacteria 13525
381 Ga0209758_1006696 3300025297 Bacteria 8127
382 Ga0209758_1007298 3300025297 Bacteria 7579
383 Ga0209758_1039944 3300025297 Bacteria 1776
384 Ga0209758_1041471 3300025297 Bacteria 1720
385 Ga0209758_1053011 3300025297 Bacteria 1397
386 Ga0209758_1057118 3300025297 Bacteria 1314
387 Ga0209758_1102552 3300025297 Bacteria 810
388 Ga0209758_1119004 3300025297 Bacteria 716
389 Ga0209050_1074670 3300025298 Bacteria 743
390 Ga0209256_1005844 3300025299 Bacteria 6836
391 Ga0209256_1016629 3300025299 Bacteria 2494
392 Ga0209256_1034701 3300025299 Bacteria 1339
393 Ga0209256_1056171 3300025299 Bacteria 932
394 Ga0207426_1001802 3300025302 Bacteria 15949
395 Ga0207426_1004864 3300025302 Bacteria 6361
396 Ga0207426_1027673 3300025302 Bacteria 1886
397 Ga0209257_1004375 3300025304 Bacteria 10990
398 Ga0209257_1020602 3300025304 Bacteria 2429
399 Ga0207697_10087462 3300025315 Bacteria 1318
400 Ga0207697_10474344 3300025315 Bacteria 554
401 Ga0207656_10081557 3300025321 Bacteria 1455
402 Ga0207692_10000528 3300025898 Bacteria 13562
403 Ga0207692_10142642 3300025898 Bacteria 1364
404 Ga0207642_10336808 3300025899 Bacteria 886
405 Ga0207710_10062593 3300025900 Bacteria 1691
406 Ga0207710_10077845 3300025900 Bacteria 1533
407 Ga0207688_10148840 3300025901 Bacteria 1382
408 Ga0207688_10205271 3300025901 Bacteria 1183
409 Ga0207647_10009168 3300025904 Bacteria 7040
410 Ga0207647_10138451 3300025904 Bacteria 1427
411 Ga0207685_10017070 3300025905 Bacteria 2337
412 Ga0207685_10116154 3300025905 Bacteria 1167
413 Ga0207699_10000514 3300025906 Bacteria 19239
414 Ga0207645_10082783 3300025907 Bacteria 2057
415 Ga0207645_10214197 3300025907 Bacteria 1269
416 Ga0207643_10047401 3300025908 Bacteria 2431
417 Ga0207643_10214645 3300025908 Bacteria 1176
418 Ga0207643_10274946 3300025908 Bacteria 1043
419 Ga0207705_10164146 3300025909 Bacteria 1670
420 Ga0207705_10175451 3300025909 Bacteria 1615
421 Ga0207705_10698945 3300025909 Bacteria 788
422 Ga0207684_10642969 3300025910 Bacteria 904
423 Ga0207654_10024270 3300025911 Bacteria 3258
424 Ga0207654_10411346 3300025911 Bacteria 942
425 Ga0207654_10795968 3300025911 Bacteria 683
426 Ga0207695_10320248 3300025913 Bacteria 1440
427 Ga0207695_10341970 3300025913 Bacteria 1384
428 Ga0207695_10370168 3300025913 Bacteria 1319
429 Ga0207671_10038928 3300025914 Bacteria 3523
430 Ga0207671_10327691 3300025914 Bacteria 1212
431 Ga0207671_10480717 3300025914 Bacteria 990
432 Ga0207671_10532225 3300025914 Bacteria 937
433 Ga0207671_10573074 3300025914 Bacteria 900
434 Ga0207693_10008295 3300025915 Bacteria 8507
435 Ga0207693_10011107 3300025915 Bacteria 7295
436 Ga0207693_10077119 3300025915 Bacteria 2610
437 Ga0207693_10337439 3300025915 Bacteria 1180
438 Ga0207693_10788662 3300025915 Bacteria 733
439 Ga0207663_10171760 3300025916 Bacteria 1540
440 Ga0207657_10209041 3300025919 Bacteria 1567
441 Ga0207657_10464155 3300025919 Bacteria 993
442 Ga0207657_10493126 3300025919 Bacteria 960
443 Ga0207649_10267205 3300025920 Bacteria 1238
444 Ga0207649_10617338 3300025920 Bacteria 835
445 Ga0207646_10105273 3300025922 Bacteria 2530
446 Ga0207681_10070638 3300025923 Bacteria 2432
447 Ga0207681_10827855 3300025923 Bacteria 774
448 Ga0207694_10199050 3300025924 Bacteria 1629
449 Ga0207694_10410858 3300025924 Bacteria 1126
450 Ga0207694_10777121 3300025924 Bacteria 809
451 Ga0207694_10946197 3300025924 Bacteria 729
452 Ga0207650_10651439 3300025925 Bacteria 888
453 Ga0207650_11376228 3300025925 Bacteria 600
454 Ga0207659_10281115 3300025926 Bacteria 1361
455 Ga0207659_10407214 3300025926 Bacteria 1139
456 Ga0207687_10022504 3300025927 Bacteria 4195
457 Ga0207687_10710600 3300025927 Bacteria 853
458 Ga0207700_10004601 3300025928 Bacteria 8166
459 Ga0207700_10046786 3300025928 Bacteria 3202
460 Ga0207700_10157523 3300025928 Bacteria 1883
461 Ga0207700_10253220 3300025928 Bacteria 1505
462 Ga0207664_10040008 3300025929 Bacteria 3642
463 Ga0207664_10172365 3300025929 Bacteria 1853
464 Ga0207644_10224481 3300025931 Bacteria 1490
465 Ga0207644_10396134 3300025931 Bacteria 1128
466 Ga0207644_10579870 3300025931 Bacteria 930
467 Ga0207690_10146061 3300025932 Bacteria 1749
468 Ga0207690_10504883 3300025932 Bacteria 978
469 Ga0207690_10716679 3300025932 Bacteria 823
470 Ga0207706_10291959 3300025933 Bacteria 1421
471 Ga0207706_10298695 3300025933 Bacteria 1403
472 Ga0207706_10510052 3300025933 Bacteria 1038
473 Ga0207706_10798769 3300025933 Bacteria 802
474 Ga0207686_10215785 3300025934 Bacteria 1382
475 Ga0207686_10338281 3300025934 Bacteria 1130
476 Ga0207686_10468151 3300025934 Bacteria 972
477 Ga0207686_10668772 3300025934 Bacteria 823
478 Ga0207709_10085394 3300025935 Bacteria 2046
479 Ga0207709_10396460 3300025935 Bacteria 1054
480 Ga0207670_10411581 3300025936 Bacteria 1083
481 Ga0207669_10060896 3300025937 Bacteria 2316
482 Ga0207669_10149698 3300025937 Bacteria 1633
483 Ga0207669_10352590 3300025937 Bacteria 1137
484 Ga0207669_10577417 3300025937 Bacteria 911
485 Ga0207704_10293428 3300025938 Bacteria 1242
486 Ga0207704_10421295 3300025938 Bacteria 1059
487 Ga0207665_10406552 3300025939 Bacteria 1038
488 Ga0207691_10045505 3300025940 Bacteria 4033
489 Ga0207691_10094759 3300025940 Bacteria 2671
490 Ga0207691_10375552 3300025940 Bacteria 1214
491 Ga0207711_10068416 3300025941 Bacteria 3075
492 Ga0207711_10236862 3300025941 Bacteria 1673
493 Ga0207711_10589281 3300025941 Bacteria 1037
494 Ga0207689_10012963 3300025942 Bacteria 7118
495 Ga0207689_10143353 3300025942 Bacteria 1968
496 Ga0207689_10213806 3300025942 Bacteria 1593
497 Ga0207679_10386125 3300025945 Bacteria 1229
498 Ga0207679_10962248 3300025945 Bacteria 782
499 Ga0207667_10289550 3300025949 Bacteria 1673
500 Ga0207667_11148259 3300025949 Bacteria 758
501 Ga0207712_10040689 3300025961 Bacteria 3192
502 Ga0207712_10624128 3300025961 Bacteria 935
503 Ga0207668_10048924 3300025972 Bacteria 2903
504 Ga0207668_10160677 3300025972 Bacteria 1750
505 Ga0207668_10225530 3300025972 Bacteria 1507
506 Ga0207668_10301972 3300025972 Bacteria 1321
507 Ga0207668_10510058 3300025972 Bacteria 1036
508 Ga0207668_10756753 3300025972 Bacteria 857
509 Ga0207640_10284234 3300025981 Bacteria 1301
510 Ga0207640_10525771 3300025981 Bacteria 989
511 Ga0207658_10066181 3300025986 Bacteria 2717
512 Ga0207658_10138311 3300025986 Bacteria 1967
513 Ga0207658_10229032 3300025986 Bacteria 1568
514 Ga0207677_10232224 3300026023 Bacteria 1487
515 Ga0207677_10247489 3300026023 Bacteria 1446
516 Ga0207677_11152790 3300026023 Bacteria 708
517 Ga0207703_10333753 3300026035 Bacteria 1392
518 Ga0207703_11350834 3300026035 Bacteria 685
519 Ga0207639_10181545 3300026041 Bacteria 1790
520 Ga0207639_10284713 3300026041 Bacteria 1455
521 Ga0207639_10516100 3300026041 Bacteria 1094
522 Ga0207678_10016938 3300026067 Bacteria 6400
523 Ga0207678_10097135 3300026067 Bacteria 2517
524 Ga0207678_10105038 3300026067 Bacteria 2410
525 Ga0207678_10110740 3300026067 Bacteria 2342
526 Ga0207678_10121192 3300026067 Bacteria 2232
527 Ga0207678_10543179 3300026067 Bacteria 1016
528 Ga0207678_10873472 3300026067 Bacteria 795
529 Ga0207678_10893466 3300026067 Bacteria 786
530 Ga0207678_10975680 3300026067 Bacteria 750
531 Ga0207708_10216595 3300026075 Bacteria 1532
532 Ga0207702_10306634 3300026078 Bacteria 1508
533 Ga0207702_10314000 3300026078 Bacteria 1491
534 Ga0207702_11714122 3300026078 Bacteria 621
535 Ga0207641_10518813 3300026088 Bacteria 1159
536 Ga0207641_10586085 3300026088 Bacteria 1090
537 Ga0207641_11322477 3300026088 Bacteria 721
538 Ga0207648_10171204 3300026089 Bacteria 1919
539 Ga0207648_11101054 3300026089 Bacteria 745
540 Ga0207676_10261998 3300026095 Bacteria 1561
541 Ga0207676_10289778 3300026095 Bacteria 1490
542 Ga0207676_10657127 3300026095 Bacteria 1012
543 Ga0207674_10307071 3300026116 Bacteria 1535
544 Ga0207675_100124474 3300026118 Bacteria 2441
545 Ga0207675_100326301 3300026118 Bacteria 1499
546 Ga0207675_100332410 3300026118 Bacteria 1486
547 Ga0207675_100600992 3300026118 Bacteria 1103
548 Ga0207675_100928190 3300026118 Bacteria 887
549 Ga0207683_10115817 3300026121 Bacteria 2402
550 Ga0207683_10167729 3300026121 Bacteria 1987
551 Ga0207683_10173569 3300026121 Bacteria 1953
552 Ga0207683_10466989 3300026121 Bacteria 1164
553 Ga0207698_10302685 3300026142 Bacteria 1489
554 Ga0207698_10724072 3300026142 Bacteria 992
555 Ga0209389_1000102 3300027296 Bacteria 78475
556 Ga0209389_1000142 3300027296 Bacteria 62072
557 Ga0209589_1000331 3300027357 Bacteria 62072
558 Ga0209489_100404 3300027361 Bacteria 78473
559 Ga0209489_100818 3300027361 Bacteria 62070
560 Ga0209700_100408 3300027363 Bacteria 78496
561 Ga0209179_1111495 3300027512 Bacteria 610
562 Ga0209588_1051525 3300027671 Bacteria 1331
563 Ga0209588_1176845 3300027671 Bacteria 670
564 Ga0209813_10008392 3300027866 Bacteria 2609
565 Ga0209813_10010724 3300027866 Bacteria 2378
566 Ga0207428_10223601 3300027907 Bacteria 1410
567 Ga0268266_10008616 3300028379 Bacteria 9058
568 Ga0268266_10028293 3300028379 Bacteria 4764
569 Ga0268266_10048797 3300028379 Bacteria 3629
570 Ga0268266_10399636 3300028379 Bacteria 1299
571 Ga0268266_11523558 3300028379 Bacteria 644
572 Ga0268265_10014031 3300028380 Bacteria 5457
573 Ga0268265_10102999 3300028380 Bacteria 2310
574 Ga0268265_10183395 3300028380 Bacteria 1800
575 Ga0268265_10474181 3300028380 Bacteria 1174
576 Ga0268265_10480658 3300028380 Bacteria 1166
577 Ga0268265_10569855 3300028380 Bacteria 1077
578 Ga0268264_10000062 3300028381 Bacteria 302110
579 Ga0268264_10050935 3300028381 Bacteria 3449
580 Ga0268264_11297118 3300028381 Bacteria 738
581 Ga0268264_11324678 3300028381 Bacteria 730
582 Ga0265319_1030726 3300028563 Bacteria 1875
583 Ga0265334_10005800 3300028573 Bacteria 5380
584 Ga0265318_10012602 3300028577 Bacteria 3592
585 Ga0265323_10002871 3300028653 Bacteria 7739
586 Ga0265322_10049751 3300028654 Bacteria 1190
587 Ga0265336_10002816 3300028666 Bacteria 7027
588 Ga0307517_10000232 3300028786 Bacteria 94332
589 Ga0307517_10328450 3300028786 Bacteria 842
590 Ga0307515_10050080 3300028794 Bacteria 6264
591 Ga0265338_10000422 3300028800 Bacteria 75820
592 Ga0307511_10137689 3300030521 Bacteria 1447
593 Ga0265760_10026912 3300031090 Bacteria 1684
594 Ga0307513_10189662 3300031456 Bacteria 1909
595 Ga0307513_10358722 3300031456 Bacteria 1203
596 Ga0307509_10844940 3300031507 Bacteria 580
597 Ga0307408_100107648 3300031548 Bacteria 2135
598 Ga0307408_100520348 3300031548 Bacteria 1045
599 Ga0307408_101142355 3300031548 Bacteria 724
600 Ga0307508_10039596 3300031616 Bacteria 4233
601 Ga0307508_10117670 3300031616 Bacteria 2258
602 Ga0307508_10553899 3300031616 Bacteria 748
603 Ga0307516_10078366 3300031730 Bacteria 3151
604 Ga0307516_10078911 3300031730 Bacteria 3137
605 Ga0307516_10107836 3300031730 Bacteria 2593
606 Ga0307516_10186022 3300031730 Bacteria 1807
607 Ga0307516_10238958 3300031730 Bacteria 1516
608 Ga0307516_10445321 3300031730 Bacteria 952
609 Ga0307413_10046715 3300031824 Bacteria 2577
610 Ga0307413_10189102 3300031824 Bacteria 1476
611 Ga0307410_10467545 3300031852 Bacteria 1032
612 Ga0307406_10138092 3300031901 Bacteria 1721
613 Ga0307406_10225754 3300031901 Bacteria 1395
614 Ga0307406_10268796 3300031901 Bacteria 1294
615 Ga0307407_10396216 3300031903 Bacteria 989
616 Ga0307412_10209929 3300031911 Bacteria 1485
617 Ga0307409_100739361 3300031995 Bacteria 986
618 Ga0307416_100123117 3300032002 Bacteria 2317
619 Ga0307416_100248362 3300032002 Bacteria 1730
620 Ga0307416_100349319 3300032002 Bacteria 1496
621 Ga0307411_10110047 3300032005 Bacteria 1969
622 Ga0307415_100050805 3300032126 Bacteria 2811
623 Ga0307415_100233049 3300032126 Bacteria 1484
624 Ga0307507_10063749 3300033179 Bacteria 3408
625 Ga0307510_10005192 3300033180 Bacteria 15482
626 Ga0307510_10036976 3300033180 Bacteria 5426
627 Ga0373926_0011112 3300035083 Bacteria 3026
628 Ga0373926_0024481 3300035083 Bacteria 2103
629 Ga0373934_0059329 3300035086 Bacteria 1523
630 Ga0373951_0017931 3300035091 Bacteria 1605
631 Ga0373923_0122663 3300035111 Bacteria 1162
632 Ga0373923_0180281 3300035111 Bacteria 970
633 Ga0373932_0318529 3300035112 Bacteria 584
634 Ga0373936_0007829 3300035113 Bacteria 4014
635 Ga0373936_0168922 3300035113 Bacteria 956
636 Ga0373945_0033750 3300035116 Bacteria 1821
637 Ga0373953_0007669 3300035117 Bacteria 3625
638 Ga0373954_0011714 3300035118 Bacteria 3890
639 Ga0373954_0044076 3300035118 Bacteria 2081
640 Ga0373956_0019947 3300035119 Bacteria 2847
641 Ga0373957_0005744 3300035120 Bacteria 3866
642 Ga0373960_0280982 3300035121 Bacteria 613
643 Ga0373943_0003229 3300035170 Bacteria 7401
644 Ga0373943_0111820 3300035170 Bacteria 1442
645 Ga0373946_0007257 3300035171 Bacteria 4047
646 Ga0373946_0102886 3300035171 Bacteria 1283
647 Ga0373955_0011290 3300035172 Bacteria 4250
648 Ga0373955_0070950 3300035172 Bacteria 1947
649 Ga0373942_0256780 3300035207 Bacteria 596
650 Ga0373924_0002441 3300035410 Bacteria 6254
651 Ga0373924_0427177 3300035410 Bacteria 593
652 Ga0373931_0090396 3300035691 Bacteria 1705
653 Ga0373931_0368580 3300035691 Bacteria 903
654 Ga0373935_0004301 3300035692 Bacteria 8357
655 Ga0373935_0139374 3300035692 Bacteria 1637
656 Ga0373927_0000766 3300035695 Bacteria 24573
657 Ga0373927_0002321 3300035695 Bacteria 13895
658 Ga0373927_0016726 3300035695 Bacteria 4838
659 Ga0373933_0052367 3300035724 Bacteria 2442
660 Ga0373933_0095429 3300035724 Bacteria 1840
661 Ga0373947_0000310 3300035725 Bacteria 27577
662 Ga0373947_0021132 3300035725 Bacteria 3766
663 Ga0373947_0026772 3300035725 Bacteria 3372
664 Ga0373937_1289280 3300036401 Bacteria 678
665 Ga0373925_0008418 3300037068 Bacteria 7511
666 Ga0373925_0016057 3300037068 Bacteria 5421
667 Ga0373925_0044131 3300037068 Bacteria 3310
668 Ga0373925_1330677 3300037068 Bacteria 589
669 Ga0395900_0000423 3300037418 Bacteria 60773
670 Ga0395898_0010460 3300037466 Bacteria 9699
671 Ga0395905_0092357 3300037471 Bacteria 2838
672 Ga0395905_0268368 3300037471 Bacteria 1592
673 Ga0395905_0277344 3300037471 Bacteria 1562
674 Ga0395905_1009238 3300037471 Bacteria 735
675 Ga0395905_1089476 3300037471 Bacteria 702
676 Ga0395905_1184253 3300037471 Bacteria 668
677 Ga0436364_0628911 3300037853 Bacteria 4501
678 Ga0436364_0760368 3300037853 Bacteria 1055
679 Ga0436364_0953579 3300037853 Bacteria 865
680 Ga0436364_1117557 3300037853 Bacteria 1638
681 Ga0436364_1523184 3300037853 Bacteria 1178
682 Ga0395901_0101076 3300038443 Bacteria 3026
683 Ga0436365_0285466 3300039437 Bacteria 1462
684 Ga0436365_1227774 3300039437 Bacteria 2955
685 Ga0436365_1254305 3300039437 Bacteria 4008
686 Ga0436365_1567631 3300039437 Bacteria 595
687 Ga0436363_1561683 3300039450 Bacteria 713
688 Ga0451791_0396477 3300041451 Bacteria 758
689 Ga0451791_0424813 3300041451 Bacteria 853
690 Ga0451793_1501710 3300041452 Bacteria 759
691 Ga0451797_0957375 3300041453 Bacteria 1132
692 Ga0451802_1930506 3300041460 Bacteria 1286
693 Ga0451804_0020778 3300041463 Bacteria 698
694 Ga0451835_0562890 3300041492 Bacteria 804
695 Ga0451841_1340266 3300041498 Bacteria 1494
696 Ga0451849_0890308 3300041505 Bacteria 918
697 Ga0451851_1013094 3300041507 Bacteria 662
698 Ga0451855_0310176 3300041511 Bacteria 700
699 Ga0451853_0527059 3300041512 Bacteria 1060
700 Ga0439448_0193791 3300042005 Bacteria 712
701 Ga0439458_0185223 3300042157 Bacteria 566
702 Ga0439459_0006680 3300042438 Bacteria 1930
703 Ga0439459_0034763 3300042438 Bacteria 1044
704 Ga0466972_0047042 3300044658 Bacteria 2087
705 Ga0466972_0125356 3300044658 Bacteria 1210
706 Ga0466965_0208416 3300044683 Bacteria 1039
707 Ga0466966_0000628 3300044684 Bacteria 22447
708 Ga0466961_0002516 3300044693 Bacteria 11373
709 Ga0466968_0139422 3300044735 Bacteria 1108
710 Ga0466968_0298774 3300044735 Bacteria 774
711 Ga0466970_0047275 3300044765 Bacteria 2293
712 Ga0466960_0073114 3300044901 Bacteria 1710
713 Ga0466960_0485017 3300044901 Bacteria 722
714 Ga0466959_0033457 3300045049 Bacteria 3801
715 Ga0466967_0241336 3300045976 Bacteria 1724
716 Ga0495617_035848 3300046452 Bacteria 1665
717 Ga0495617_040028 3300046452 Bacteria 1568
718 Ga0495617_208192 3300046452 Bacteria 610
719 Ga0495592_0021717 3300046454 Bacteria 4883
720 Ga0495592_0029657 3300046454 Bacteria 4142
721 Ga0495592_0084325 3300046454 Bacteria 2293
722 Ga0495592_0143017 3300046454 Bacteria 1662
723 Ga0495592_0182910 3300046454 Bacteria 1426
724 Ga0495603_0000936 3300046455 Bacteria 16788
725 Ga0495603_0014727 3300046455 Bacteria 4729
726 Ga0495603_0024867 3300046455 Bacteria 3623
727 Ga0495603_0025116 3300046455 Bacteria 3603
728 Ga0495603_0113161 3300046455 Bacteria 1582
729 Ga0495603_0121441 3300046455 Bacteria 1522
730 Ga0495590_0027483 3300046457 Bacteria 1996
731 Ga0495629_0001416 3300046459 Bacteria 18913
732 Ga0495629_0003103 3300046459 Bacteria 12597
733 Ga0495629_0049337 3300046459 Bacteria 2950
734 Ga0495629_0182713 3300046459 Bacteria 1453
735 Ga0495629_0335352 3300046459 Bacteria 1033
736 Ga0495629_0441399 3300046459 Bacteria 882
737 Ga0495638_0068794 3300046460 Bacteria 2170
738 Ga0495638_0215046 3300046460 Bacteria 1077
739 Ga0495641_0005002 3300046461 Bacteria 9142
740 Ga0495641_0033486 3300046461 Bacteria 2438
741 Ga0495651_0008730 3300046462 Bacteria 7772
742 Ga0495651_0041654 3300046462 Bacteria 3566
743 Ga0495651_0110186 3300046462 Bacteria 2037
744 Ga0495651_0328589 3300046462 Bacteria 1017
745 Ga0495653_0028280 3300046463 Bacteria 4483
746 Ga0495653_0050804 3300046463 Bacteria 3187
747 Ga0495653_0058545 3300046463 Bacteria 2928
748 Ga0495650_0090423 3300046471 Bacteria 1165
749 Ga0495580_0002805 3300046472 Bacteria 14983
750 Ga0495580_0062616 3300046472 Bacteria 2610
751 Ga0495580_0236049 3300046472 Bacteria 1254
752 Ga0495582_0000302 3300046473 Bacteria 27218
753 Ga0495605_0050188 3300046474 Bacteria 2036
754 Ga0495605_0103601 3300046474 Bacteria 1305
755 Ga0495639_0000072 3300046475 Bacteria 46904
756 Ga0495662_0001578 3300046476 Bacteria 11325
757 Ga0495662_0095461 3300046476 Bacteria 1453
758 Ga0495664_0015202 3300046477 Bacteria 4374
759 Ga0495664_0044387 3300046477 Bacteria 2634
760 Ga0495664_0045491 3300046477 Bacteria 2603
761 Ga0495664_0137848 3300046477 Bacteria 1479
762 Ga0495584_0129680 3300046491 Bacteria 1279
763 Ga0495584_0131185 3300046491 Bacteria 1271
764 Ga0495584_0307972 3300046491 Bacteria 804
765 Ga0495584_0402809 3300046491 Bacteria 695
766 Ga0495585_0036674 3300046492 Bacteria 2763
767 Ga0495585_0112731 3300046492 Bacteria 1445
768 Ga0495594_0000046 3300046499 Bacteria 53822
769 Ga0495594_0117110 3300046499 Bacteria 1505
770 Ga0495594_0466224 3300046499 Bacteria 718
771 Ga0495596_0035053 3300046500 Bacteria 1991
772 Ga0495596_0077695 3300046500 Bacteria 1289
773 Ga0495607_0106803 3300046501 Bacteria 1490
774 Ga0495583_0060950 3300046506 Bacteria 1685
775 Ga0495583_0322073 3300046506 Bacteria 612
776 Ga0495606_0034214 3300046507 Bacteria 3490
777 Ga0495606_0102033 3300046507 Bacteria 1745
778 Ga0495606_0264218 3300046507 Bacteria 948
779 Ga0495606_0312184 3300046507 Bacteria 848
780 Ga0495606_0403479 3300046507 Bacteria 711
781 Ga0495606_0452802 3300046507 Bacteria 657
782 Ga0495608_0019870 3300046511 Bacteria 4619
783 Ga0495608_0080255 3300046511 Bacteria 2121
784 Ga0495610_0107052 3300046512 Bacteria 1244
785 Ga0495610_0124279 3300046512 Bacteria 1127
786 Ga0495616_0026546 3300046513 Bacteria 3081
787 Ga0495618_0028578 3300046514 Bacteria 3476
788 Ga0495620_0055847 3300046515 Bacteria 1663
789 Ga0495620_0175927 3300046515 Bacteria 828
790 Ga0495620_0239742 3300046515 Bacteria 692
791 Ga0495620_0284325 3300046515 Bacteria 629
792 Ga0495628_0015500 3300046516 Bacteria 6365
793 Ga0495628_0079992 3300046516 Bacteria 2541
794 Ga0495628_0162717 3300046516 Bacteria 1695
795 Ga0495630_0005610 3300046517 Bacteria 8864
796 Ga0495630_0147147 3300046517 Bacteria 1792
797 Ga0495631_0096176 3300046518 Bacteria 1275
798 Ga0495631_0118301 3300046518 Bacteria 1139
799 Ga0495631_0162016 3300046518 Bacteria 960
800 Ga0495631_0222239 3300046518 Bacteria 806
801 Ga0495632_0096886 3300046519 Bacteria 1393
802 Ga0495632_0203258 3300046519 Bacteria 901
803 Ga0495632_0278902 3300046519 Bacteria 744
804 Ga0495637_0074429 3300046520 Bacteria 1364
805 Ga0495643_0118009 3300046522 Bacteria 1343
806 Ga0495643_0124891 3300046522 Bacteria 1296
807 Ga0495643_0198153 3300046522 Bacteria 965
808 Ga0495644_0026767 3300046523 Bacteria 2187
809 Ga0495644_0068917 3300046523 Bacteria 1329
810 Ga0495644_0104544 3300046523 Bacteria 1072
811 Ga0495648_0001071 3300046524 Bacteria 27799
812 Ga0495648_0055289 3300046524 Bacteria 2393
813 Ga0495648_0128362 3300046524 Bacteria 1352
814 Ga0495648_0144527 3300046524 Bacteria 1248
815 Ga0495648_0167446 3300046524 Bacteria 1130
816 Ga0495648_0176996 3300046524 Bacteria 1088
817 Ga0495648_0385547 3300046524 Bacteria 630
818 Ga0495666_0020390 3300046526 Bacteria 3285
819 Ga0495666_0067929 3300046526 Bacteria 1698
820 Ga0495642_0139880 3300046528 Bacteria 1045
821 Ga0495652_0014684 3300046529 Bacteria 7023
822 Ga0495652_0019166 3300046529 Bacteria 6095
823 Ga0495652_0020755 3300046529 Bacteria 5838
824 Ga0495652_0191690 3300046529 Bacteria 1559
825 Ga0495652_0538472 3300046529 Bacteria 804
826 Ga0495665_0000335 3300046531 Bacteria 23811
827 Ga0495665_0223245 3300046531 Bacteria 974
828 Ga0495640_0002138 3300046533 Bacteria 15789
829 Ga0495640_0016721 3300046533 Bacteria 5485
830 Ga0495640_0095555 3300046533 Bacteria 1956
831 Ga0495640_0255127 3300046533 Bacteria 1097
832 Ga0495586_0098735 3300046535 Bacteria 1619
833 Ga0495586_0271468 3300046535 Bacteria 970
834 Ga0495587_0011102 3300046536 Bacteria 5713
835 Ga0495587_0063598 3300046536 Bacteria 2158
836 Ga0495587_0267144 3300046536 Bacteria 960
837 Ga0495598_0016310 3300046537 Bacteria 1893
838 Ga0495598_0098282 3300046537 Bacteria 965
839 Ga0495609_0043359 3300046538 Bacteria 2020
840 Ga0495609_0067067 3300046538 Bacteria 1581
841 Ga0495609_0207978 3300046538 Bacteria 816
842 Ga0495609_0217489 3300046538 Bacteria 794
843 Ga0495621_0150103 3300046539 Bacteria 916
844 Ga0495597_0018060 3300046542 Bacteria 3314
845 Ga0495597_0125685 3300046542 Bacteria 1066
846 Ga0495645_0008238 3300046543 Bacteria 7269
847 Ga0495622_0001664 3300046557 Bacteria 11001
848 Ga0495622_0031861 3300046557 Bacteria 2462
849 Ga0495622_0032621 3300046557 Bacteria 2432
850 Ga0495622_0101650 3300046557 Bacteria 1317
851 Ga0495622_0107212 3300046557 Bacteria 1280
852 Ga0495633_0090609 3300046558 Bacteria 1421
853 Ga0495667_0003584 3300046559 Bacteria 10443
854 Ga0495667_0008501 3300046559 Bacteria 6968
855 Ga0495667_0017003 3300046559 Bacteria 4910
856 Ga0495667_0697603 3300046559 Bacteria 629
857 Ga0495656_0007208 3300046615 Bacteria 3924
858 Ga0495656_0019568 3300046615 Bacteria 2614
859 Ga0495656_0057557 3300046615 Bacteria 1683
860 Ga0495656_0086279 3300046615 Bacteria 1427
861 Ga0495656_0341476 3300046615 Bacteria 774
862 Ga0495668_0013886 3300046616 Bacteria 4736
863 Ga0495668_0106847 3300046616 Bacteria 1531
864 Ga0495668_0185513 3300046616 Bacteria 1139
865 Ga0495668_0225484 3300046616 Bacteria 1026
866 Ga0495668_0251215 3300046616 Bacteria 968
867 Ga0495668_0513438 3300046616 Bacteria 661
868 Ga0495634_0004622 3300046642 Bacteria 10742
869 Ga0495634_0020900 3300046642 Bacteria 4636
870 Ga0495634_0360494 3300046642 Bacteria 869
871 Ga0495611_0069655 3300046648 Bacteria 1607
872 Ga0495611_0109377 3300046648 Bacteria 1286
873 Ga0495611_0154025 3300046648 Bacteria 1073
874 Ga0495625_0109767 3300046660 Bacteria 1887
875 Ga0495625_0159799 3300046660 Bacteria 1510
876 Ga0495625_0389022 3300046660 Bacteria 873
877 Ga0495625_0677335 3300046660 Bacteria 611
878 Ga0495635_0006671 3300046663 Bacteria 8062
879 Ga0495635_0014178 3300046663 Bacteria 5577
880 Ga0495635_0048596 3300046663 Bacteria 2924
881 Ga0495635_0073979 3300046663 Bacteria 2334
882 Ga0495635_0510332 3300046663 Bacteria 791
883 Ga0495659_0002107 3300046664 Bacteria 6497
884 Ga0495659_0029020 3300046664 Bacteria 1918
885 Ga0495659_0125976 3300046664 Bacteria 1012
886 Ga0495661_0041610 3300046665 Bacteria 2841
887 Ga0495661_0128554 3300046665 Bacteria 1391
888 Ga0495661_0200602 3300046665 Bacteria 1045
889 Ga0495588_0008571 3300046674 Bacteria 4696
890 Ga0495588_0128553 3300046674 Bacteria 1336
891 Ga0495588_0234405 3300046674 Bacteria 968
892 Ga0495657_0005477 3300046675 Bacteria 10046
893 Ga0495657_0031180 3300046675 Bacteria 3728
894 Ga0495657_0032801 3300046675 Bacteria 3621
895 Ga0495599_0071655 3300046678 Bacteria 2163
896 Ga0495599_0085847 3300046678 Bacteria 1966
897 Ga0495623_0010119 3300046679 Bacteria 6105
898 Ga0495623_0016092 3300046679 Bacteria 4833
899 Ga0495646_0026987 3300046680 Bacteria 3605
900 Ga0495646_0063333 3300046680 Bacteria 2196
901 Ga0495646_0172205 3300046680 Bacteria 1192
902 Ga0495647_0022488 3300046681 Bacteria 2278
903 Ga0495658_0014486 3300046683 Bacteria 4031
904 Ga0495658_0163835 3300046683 Bacteria 1373
905 Ga0495669_0054908 3300046684 Bacteria 1793
906 Ga0495669_0088458 3300046684 Bacteria 1428
907 Ga0495669_0185413 3300046684 Bacteria 992
908 Ga0495669_0229042 3300046684 Bacteria 891
909 Ga0495669_0318477 3300046684 Bacteria 750
910 Ga0495613_0004485 3300046689 Bacteria 10464
911 Ga0495613_0181544 3300046689 Bacteria 1490
912 Ga0495613_0234957 3300046689 Bacteria 1283
913 Ga0495613_0674964 3300046689 Bacteria 682
914 Ga0495624_0000795 3300046690 Bacteria 24919
915 Ga0495624_0096546 3300046690 Bacteria 1821
916 Ga0495624_0226423 3300046690 Bacteria 1133
917 Ga0495624_0290436 3300046690 Bacteria 987
918 Ga0495670_0063562 3300046691 Bacteria 1858
919 Ga0495670_0078060 3300046691 Bacteria 1684
920 Ga0495671_0274728 3300046692 Bacteria 812
921 Ga0495671_0402317 3300046692 Bacteria 655
922 Ga0495649_0047616 3300046694 Bacteria 2331
923 Ga0495649_0199931 3300046694 Bacteria 1038
924 Ga0495649_0289086 3300046694 Bacteria 836
925 Ga0495589_0099620 3300046794 Bacteria 1407
926 Ga0495589_0143196 3300046794 Bacteria 1144
927 Ga0495589_0173165 3300046794 Bacteria 1026
928 Ga0495589_0241200 3300046794 Bacteria 846
929 Ga0495600_0041236 3300046809 Bacteria 3008
930 Ga0495600_0059007 3300046809 Bacteria 2506
931 Ga0495600_0396510 3300046809 Bacteria 859
932 Ga0495660_0050740 3300046810 Bacteria 2259
933 Ga0495660_0186809 3300046810 Bacteria 999
934 Ga0495581_0000030 3300047315 Bacteria 53487
935 Ga0495581_0028132 3300047315 Bacteria 3259
936 Ga0495581_0074821 3300047315 Bacteria 1960
937 Ga0495581_0159180 3300047315 Bacteria 1320
938 Ga0495604_0005369 3300047317 Bacteria 10163
939 Ga0495604_0030536 3300047317 Bacteria 4279
940 Ga0495636_0043015 3300047318 Bacteria 1878
941 Ga0495636_0310154 3300047318 Bacteria 739
942 Ga0495674_0004821 3300047319 Bacteria 12972
943 Ga0495674_0029055 3300047319 Bacteria 5036
944 Ga0495674_0046737 3300047319 Bacteria 3842
945 Ga0495672_0037365 3300047320 Bacteria 2972
946 Ga0495672_0314720 3300047320 Bacteria 737
947 Ga0495676_0039329 3300047321 Bacteria 3918
948 Ga0495676_0047874 3300047321 Bacteria 3452
949 Ga0495676_0055320 3300047321 Bacteria 3147
950 Ga0495676_0581215 3300047321 Bacteria 730
951 Ga0495680_0008881 3300047322 Bacteria 9087
952 Ga0495680_0045020 3300047322 Bacteria 3486
953 Ga0495680_0094553 3300047322 Bacteria 2236
954 Ga0495683_0091526 3300047323 Bacteria 1473
955 Ga0495683_0163907 3300047323 Bacteria 1026
956 Ga0495683_0208964 3300047323 Bacteria 876
957 Ga0495687_126162 3300047443 Bacteria 914
958 Ga0495687_142791 3300047443 Bacteria 830
959 Ga0495675_0020892 3300047444 Bacteria 4167
960 Ga0495675_0028927 3300047444 Bacteria 3532
961 Ga0495677_0118428 3300047445 Bacteria 1009
962 Ga0495677_0220164 3300047445 Bacteria 739
963 Ga0495685_101503 3300047447 Bacteria 950
964 Ga0495673_0027495 3300047469 Bacteria 2706
965 Ga0495673_0083345 3300047469 Bacteria 1320
966 Ga0495673_0103545 3300047469 Bacteria 1147
967 Ga0495673_0108010 3300047469 Bacteria 1116
968 Ga0495673_0152098 3300047469 Bacteria 894
969 Ga0495673_0168073 3300047469 Bacteria 837
970 Ga0495673_0223046 3300047469 Bacteria 697
971 Ga0495681_0097731 3300047470 Bacteria 1288
972 Ga0495681_0236490 3300047470 Bacteria 727
973 Ga0495684_0117000 3300047471 Bacteria 2009
974 Ga0495684_0127826 3300047471 Bacteria 1910
975 Ga0495684_0351610 3300047471 Bacteria 1046
976 Ga0495686_0150331 3300047472 Bacteria 1367
977 Ga0495686_0354173 3300047472 Bacteria 797
978 Ga0495686_0426761 3300047472 Bacteria 708
979 Ga0495593_0000398 3300047673 Bacteria 24218
980 Ga0495593_0037445 3300047673 Bacteria 2624
981 Ga0495593_0118506 3300047673 Bacteria 1348
982 Ga0495602_0023058 3300048088 Bacteria 6075
983 Ga0495602_0050036 3300048088 Bacteria 3737
984 Ga0495614_0027576 3300048089 Bacteria 2448
985 Ga0495614_0357666 3300048089 Bacteria 681
986 Ga0495615_0090478 3300048090 Bacteria 852
987 Ga0495615_0138603 3300048090 Bacteria 716
988 Ga0495626_0175237 3300048091 Bacteria 892
989 Ga0496100_0046419 3300048903 Bacteria 2793
990 Ga0496100_0188849 3300048903 Bacteria 1495
991 Ga0496100_0246888 3300048903 Bacteria 1319
992 Ga0496101_0289568 3300048904 Bacteria 1281
993 Ga0496101_0430373 3300048904 Bacteria 1040
994 Ga0496101_0433593 3300048904 Bacteria 1036
995 Ga0496102_0071540 3300048905 Bacteria 3184
996 Ga0496102_0074603 3300048905 Bacteria 3118
997 Ga0496102_0074762 3300048905 Bacteria 3115
998 Ga0496102_0282570 3300048905 Bacteria 1564
999 Ga0496102_0610220 3300048905 Bacteria 1014
1000 Ga0496102_0640126 3300048905 Bacteria 986
1001 Ga0496103_0021472 3300048906 Bacteria 3885
1002 Ga0496104_0023224 3300048907 Bacteria 5702
1003 Ga0496104_0137738 3300048907 Bacteria 2345
1004 Ga0496104_0223045 3300048907 Bacteria 1797
1005 Ga0496104_0447321 3300048907 Bacteria 1204
1006 Ga0496104_0486997 3300048907 Bacteria 1145
1007 Ga0496105_0002119 3300048908 Bacteria 14370
1008 Ga0496105_0053620 3300048908 Bacteria 3330
1009 Ga0496105_0078315 3300048908 Bacteria 2729
1010 Ga0496105_0298503 3300048908 Bacteria 1295
1011 Ga0496106_0005807 3300048909 Bacteria 9124
1012 Ga0496106_0131388 3300048909 Bacteria 1964
1013 Ga0496106_0190826 3300048909 Bacteria 1629
1014 Ga0496106_0461761 3300048909 Bacteria 1020
1015 Ga0496106_0464355 3300048909 Bacteria 1017
1016 Ga0496106_0520498 3300048909 Bacteria 955
1017 Ga0496106_1063317 3300048909 Bacteria 635
1018 Ga0496107_0084269 3300048910 Bacteria 2319
1019 Ga0496107_0315893 3300048910 Bacteria 1163
1020 Ga0496107_0765599 3300048910 Bacteria 708
1021 Ga0496108_0267633 3300048911 Bacteria 1487
1022 Ga0496108_0276122 3300048911 Bacteria 1463
1023 Ga0496108_0459592 3300048911 Bacteria 1112
1024 Ga0496108_0675677 3300048911 Bacteria 897
1025 Ga0496108_1182871 3300048911 Bacteria 647
1026 Ga0496108_1201958 3300048911 Bacteria 641
1027 Ga0496109_0021697 3300048912 Bacteria 5683
1028 Ga0496109_0071834 3300048912 Bacteria 3178
1029 Ga0496109_0162309 3300048912 Bacteria 2094
1030 Ga0496109_0196394 3300048912 Bacteria 1896
1031 Ga0496109_1219651 3300048912 Bacteria 689
1032 Ga0496109_1502556 3300048912 Bacteria 608
1033 Ga0496110_0088471 3300048913 Bacteria 2766
1034 Ga0496110_0125988 3300048913 Bacteria 2311
1035 Ga0496110_0174824 3300048913 Bacteria 1949
1036 Ga0496110_0281445 3300048913 Bacteria 1514
1037 Ga0496110_0731836 3300048913 Bacteria 892
1038 Ga0496110_1069359 3300048913 Bacteria 715
1039 Ga0496111_0047295 3300048914 Bacteria 3098
1040 Ga0496111_0131513 3300048914 Bacteria 1852
1041 Ga0496111_0142191 3300048914 Bacteria 1778
1042 Ga0496111_0244844 3300048914 Bacteria 1331
1043 Ga0496112_0000018 3300048915 Bacteria 188820
1044 Ga0496112_0070075 3300048915 Bacteria 3464
1045 Ga0496112_0093432 3300048915 Bacteria 2978
1046 Ga0496112_0123986 3300048915 Bacteria 2554
1047 Ga0496112_0520433 3300048915 Bacteria 1124
1048 Ga0496112_0798307 3300048915 Bacteria 869
1049 Ga0496113_0053535 3300048916 Bacteria 3018
1050 Ga0496113_0084992 3300048916 Bacteria 2430
1051 Ga0496113_0105250 3300048916 Bacteria 2190
1052 Ga0496113_0325241 3300048916 Bacteria 1233
1053 Ga0496113_0632027 3300048916 Bacteria 856
1054 Ga0496113_0710822 3300048916 Bacteria 801
1055 Ga0496114_0305804 3300048917 Bacteria 1404
1056 Ga0496114_0436833 3300048917 Bacteria 1159
1057 Ga0496114_0700432 3300048917 Bacteria 888
1058 Ga0496115_0084663 3300048918 Bacteria 2585
1059 Ga0496115_0157355 3300048918 Bacteria 1877
1060 Ga0496115_0237536 3300048918 Bacteria 1502
1061 Ga0496116_0165046 3300048919 Bacteria 1209
1062 Ga0496116_0174683 3300048919 Bacteria 1159
1063 Ga0496116_0193715 3300048919 Bacteria 1072
1064 Ga0496116_0294710 3300048919 Bacteria 776
1065 Ga0496117_0032990 3300048920 Bacteria 3922
1066 Ga0496117_0046740 3300048920 Bacteria 3111
1067 Ga0496117_0133093 3300048920 Bacteria 1503
1068 Ga0496117_0226790 3300048920 Bacteria 1035
1069 Ga0496117_0410600 3300048920 Bacteria 680
1070 Ga0496118_0005692 3300048921 Bacteria 14039
1071 Ga0496118_0037135 3300048921 Bacteria 3926
1072 Ga0496118_0113965 3300048921 Bacteria 1784
1073 Ga0496118_0166548 3300048921 Bacteria 1354
1074 Ga0496118_0211512 3300048921 Bacteria 1137
1075 Ga0496118_0484516 3300048921 Bacteria 619
1076 Ga0496119_0026589 3300048922 Bacteria 4008
1077 Ga0496119_0054547 3300048922 Bacteria 2433
1078 Ga0496119_0059029 3300048922 Bacteria 2307
1079 Ga0496119_0062447 3300048922 Bacteria 2220
1080 Ga0496119_0102491 3300048922 Bacteria 1604
1081 Ga0496119_0162252 3300048922 Bacteria 1187
1082 Ga0496119_0437327 3300048922 Bacteria 618
1083 Ga0496120_0040266 3300048923 Bacteria 2747
1084 Ga0496121_0000278 3300048924 Bacteria 106838
1085 Ga0496121_0000870 3300048924 Bacteria 54546
1086 Ga0496121_0010173 3300048924 Bacteria 10650
1087 Ga0496121_0096171 3300048924 Bacteria 2299
1088 Ga0496121_0126343 3300048924 Bacteria 1921
1089 Ga0496121_0138497 3300048924 Bacteria 1809
1090 Ga0496121_0192329 3300048924 Bacteria 1462
1091 Ga0496121_0237709 3300048924 Bacteria 1272
1092 Ga0496121_0264483 3300048924 Bacteria 1186
1093 Ga0496121_0288805 3300048924 Bacteria 1118
1094 Ga0496121_0296409 3300048924 Bacteria 1099
1095 Ga0496121_0519332 3300048924 Bacteria 752
1096 Ga0496121_0534225 3300048924 Bacteria 737
1097 Ga0496121_0580805 3300048924 Bacteria 695
1098 Ga0496121_0704692 3300048924 Bacteria 607
1099 Ga0496122_0017924 3300048925 Bacteria 6575
1100 Ga0496122_0267463 3300048925 Bacteria 944
1101 Ga0496124_0001369 3300048927 Bacteria 36505
1102 Ga0496124_0164318 3300048927 Bacteria 1727
1103 Ga0496124_0288202 3300048927 Bacteria 1193
1104 Ga0496124_0398661 3300048927 Bacteria 956
1105 Ga0496124_0489142 3300048927 Bacteria 828
1106 Ga0496124_0601934 3300048927 Bacteria 715
1107 Ga0496125_0012916 3300048928 Bacteria 8246
1108 Ga0496125_0078047 3300048928 Bacteria 2548
1109 Ga0496125_0133097 3300048928 Bacteria 1746
1110 Ga0496125_0166528 3300048928 Bacteria 1488
1111 Ga0496125_0182460 3300048928 Bacteria 1396
1112 Ga0496125_0392879 3300048928 Bacteria 813
1113 Ga0496126_0008213 3300048929 Bacteria 11288
1114 Ga0496126_0016831 3300048929 Bacteria 7298
1115 Ga0496126_0053878 3300048929 Bacteria 3647
1116 Ga0496126_0068252 3300048929 Bacteria 3175
1117 Ga0496126_0080618 3300048929 Bacteria 2880
1118 Ga0496126_0153361 3300048929 Bacteria 1973
1119 Ga0496126_0219098 3300048929 Bacteria 1599
1120 Ga0496126_0239605 3300048929 Bacteria 1516
1121 Ga0496126_0377072 3300048929 Bacteria 1155
1122 Ga0496126_0383439 3300048929 Bacteria 1143
1123 Ga0496126_0437004 3300048929 Bacteria 1055
1124 Ga0496126_0514831 3300048929 Bacteria 954
1125 Ga0496126_0608735 3300048929 Bacteria 860
1126 Ga0496126_0618714 3300048929 Bacteria 851
1127 Ga0496126_0647077 3300048929 Bacteria 827
1128 Ga0496126_0666168 3300048929 Bacteria 812
1129 Ga0495678_166440 3300049459 Bacteria 701
1130 Ga0495682_0024271 3300049460 Bacteria 2261
1131 Ga0501048_0306506 3300049582 Bacteria 1130
1132 Ga0501067_0144909 3300049583 Bacteria 1323
1133 Ga0501080_0696706 3300049742 Bacteria 896
1134 nmdc:mga03683_100167_c1 3300050489 Bacteria 1273
1135 nmdc:mga03683_195531_c1 3300050489 Bacteria 927
1136 nmdc:mga03683_63870_c1 3300050489 Bacteria 1561
1137 nmdc:mga03683_78981_c1 3300050489 Bacteria 1418
1138 nmdc:mga03n38_25280_c1 3300050490 Bacteria 2437
1139 nmdc:mga03n38_51750_c1 3300050490 Bacteria 1835
1140 nmdc:mga00v17_104028_c1 3300050491 Bacteria 1795
1141 nmdc:mga00v17_134887_c1 3300050491 Bacteria 1580
1142 nmdc:mga00v17_399883_c1 3300050491 Bacteria 893
1143 nmdc:mga0yw44_136693_c1 3300050492 Bacteria 1591
1144 nmdc:mga0yw44_197542_c1 3300050492 Bacteria 1328
1145 nmdc:mga0yw44_234584_c1 3300050492 Bacteria 1218
1146 nmdc:mga0yw44_4136_c1 3300050492 Bacteria 6589
1147 nmdc:mga0yw44_61384_c1 3300050492 Bacteria 2306
1148 nmdc:mga0yw44_702768_c1 3300050492 Bacteria 687
1149 nmdc:mga0yw44_94133_c1 3300050492 Bacteria 1898
1150 nmdc:mga0k408_114095_c1 3300050493 Bacteria 1598
1151 nmdc:mga0k408_245765_c1 3300050493 Bacteria 1069
1152 nmdc:mga0k408_311530_c1 3300050493 Bacteria 939
1153 nmdc:mga0k408_49688_c1 3300050493 Bacteria 2428
1154 nmdc:mga0k408_620462_c1 3300050493 Bacteria 637
1155 nmdc:mga0k408_632294_c1 3300050493 Bacteria 630
1156 nmdc:mga0k408_68006_c1 3300050493 Bacteria 2077
1157 nmdc:mga06z11_164199_c1 3300050494 Bacteria 1271
1158 nmdc:mga06z11_247797_c1 3300050494 Bacteria 1048
1159 nmdc:mga06z11_98186_c1 3300050494 Bacteria 1602
1160 nmdc:mga04h51_39790_c1 3300050495 Bacteria 1529
1161 nmdc:mga04h51_4594_c1 3300050495 Bacteria 3452
1162 nmdc:mga07m45_49037_c1 3300050496 Bacteria 2376
1163 nmdc:mga07m45_72272_c1 3300050496 Bacteria 1963
1164 nmdc:mga07m45_85238_c1 3300050496 Bacteria 1807
1165 nmdc:mga05p37_715928_c1 3300050507 Bacteria 1109
1166 nmdc:mga05p37_766833_c1 3300050507 Bacteria 1061
1167 nmdc:mga08y16_1079285_c1 3300050511 Bacteria 779
1168 nmdc:mga0n895_1169042_c1 3300050512 Bacteria 744
1169 nmdc:mga0n895_55593_c1 3300050512 Bacteria 3895
1170 nmdc:mga0rr50_401671_c1 3300050513 Bacteria 1157
1171 nmdc:mga0rr50_812014_c1 3300050513 Bacteria 798
1172 nmdc:mga0sz30_201948_c1 3300050516 Bacteria 883
1173 nmdc:mga0sz30_240549_c1 3300050516 Bacteria 806
1174 nmdc:mga0sz30_24637_c2 3300050516 Bacteria 2130
1175 nmdc:mga0sz30_276370_c1 3300050516 Bacteria 748
1176 nmdc:mga0sz30_52513_c1 3300050516 Bacteria 1731
1177 nmdc:mga0sz30_6719_c1 3300050516 Bacteria 2580
1178 Ga0495601_0072078 3300053077 Bacteria 2206
1179 Ga0495601_0189917 3300053077 Bacteria 1343
1180 Ga0495612_0003340 3300053078 Bacteria 6648
1181 Ga0500635_0001019 3300053080 Bacteria 6708
1182 Ga0500635_0083337 3300053080 Bacteria 1153
1183 Ga0495655_0017739 3300053083 Bacteria 1555
1184 Ga0495655_0028351 3300053083 Bacteria 1336
1185 Ga0495655_0054284 3300053083 Bacteria 1072
1186 Ga0495655_0130147 3300053083 Bacteria 774
1187 Ga0495595_0006434 3300053084 Bacteria 4791
1188 Ga0495619_0097925 3300053085 Bacteria 1993
1189 Ga0495619_0232345 3300053085 Bacteria 1278
1190 Ga0495619_0256677 3300053085 Bacteria 1211
1191 Ga0500643_000112 3300053087 Bacteria 84793
1192 Ga0500647_0087402 3300053091 Bacteria 1494
1193 Ga0500583_0109258 3300053092 Bacteria 1360
1194 Ga0500583_0389437 3300053092 Bacteria 670
1195 Ga0500651_0013790 3300053093 Bacteria 4932
1196 Ga0500651_0204118 3300053093 Bacteria 1165
1197 Ga0500651_0426263 3300053093 Bacteria 741
1198 Ga0500651_0613454 3300053093 Bacteria 589
1199 Ga0500566_0028718 3300053094 Bacteria 3250
1200 Ga0500566_0060656 3300053094 Bacteria 2141
1201 Ga0500640_031812 3300053095 Bacteria 2314
1202 Ga0500641_0005732 3300053096 Bacteria 4401
1203 Ga0500641_0034832 3300053096 Bacteria 2006
1204 Ga0500641_0125390 3300053096 Bacteria 1107
1205 Ga0500650_0182444 3300053098 Bacteria 961
1206 Ga0500554_084081 3300053102 Bacteria 1051
1207 Ga0500555_029367 3300053103 Bacteria 1564
1208 Ga0500556_0116736 3300053104 Bacteria 1039
1209 Ga0500557_000021 3300053105 Bacteria 89662
1210 Ga0500558_226386 3300053106 Bacteria 632
1211 Ga0500562_005565 3300053108 Bacteria 3166
1212 Ga0500562_077165 3300053108 Bacteria 900
1213 Ga0500569_005793 3300053109 Bacteria 2674
1214 Ga0500569_145089 3300053109 Bacteria 799
1215 Ga0500569_184397 3300053109 Bacteria 709
1216 Ga0500594_0014142 3300053118 Bacteria 1907
1217 Ga0500595_002722 3300053119 Bacteria 8560
1218 Ga0500595_004714 3300053119 Bacteria 6055
1219 Ga0500595_017174 3300053119 Bacteria 2677
1220 Ga0500595_020317 3300053119 Bacteria 2393
1221 Ga0500595_030265 3300053119 Bacteria 1826
1222 Ga0500597_140240 3300053120 Bacteria 1042
1223 Ga0500607_037964 3300053121 Bacteria 2622
1224 Ga0500617_129887 3300053124 Bacteria 1027
1225 Ga0500621_219643 3300053126 Bacteria 659
1226 Ga0500626_120643 3300053128 Bacteria 1122
1227 Ga0500642_0000362 3300053130 Bacteria 15284
1228 Ga0500642_0083225 3300053130 Bacteria 1472
1229 Ga0500642_0161139 3300053130 Bacteria 1051
1230 Ga0500642_0208301 3300053130 Bacteria 908
1231 Ga0500655_058384 3300053133 Bacteria 775
1232 Ga0500658_0061598 3300053134 Bacteria 1561
1233 Ga0500658_0103613 3300053134 Bacteria 1244
1234 Ga0500658_0335099 3300053134 Bacteria 695
1235 Ga0500559_0034845 3300053136 Bacteria 2171
1236 Ga0500561_0027024 3300053137 Bacteria 1411
1237 Ga0500568_0011399 3300053139 Bacteria 4130
1238 Ga0500568_0013697 3300053139 Bacteria 3687
1239 Ga0500568_0132269 3300053139 Bacteria 927
1240 Ga0500573_0007614 3300053140 Bacteria 5917
1241 Ga0500585_051506 3300053144 Bacteria 1471
1242 Ga0500588_0109718 3300053146 Bacteria 961
1243 Ga0500588_0251092 3300053146 Bacteria 664
1244 Ga0500588_0311862 3300053146 Bacteria 596
1245 Ga0500589_139840 3300053147 Bacteria 999
1246 Ga0500590_012459 3300053148 Bacteria 4334
1247 Ga0500590_152328 3300053148 Bacteria 1041
1248 Ga0500603_008315 3300053150 Bacteria 2299
1249 Ga0500604_0283040 3300053151 Bacteria 575
1250 Ga0500616_0125886 3300053153 Bacteria 1217
1251 Ga0500619_164871 3300053154 Bacteria 751
1252 Ga0500620_051888 3300053155 Bacteria 1377
1253 Ga0500622_0005248 3300053156 Bacteria 7825
1254 Ga0500627_0091031 3300053158 Bacteria 1365
1255 Ga0500627_0149510 3300053158 Bacteria 1055
1256 Ga0500627_0173120 3300053158 Bacteria 972
1257 Ga0500627_0310906 3300053158 Bacteria 686
1258 Ga0500633_0074370 3300053160 Bacteria 1219
1259 Ga0500639_267963 3300053163 Bacteria 669
1260 Ga0500636_0000834 3300053177 Bacteria 16602
1261 Ga0500636_0114438 3300053177 Bacteria 1520
1262 Ga0500636_0156896 3300053177 Bacteria 1244
1263 Ga0500636_0262295 3300053177 Bacteria 874
1264 Ga0500637_0107654 3300053178 Bacteria 1616
1265 Ga0500637_0544021 3300053178 Bacteria 564
1266 Ga0500649_206274 3300053722 Bacteria 628
1267 Ga0500649_208297 3300053722 Bacteria 622
1268 Ga0500625_054654 3300053729 Bacteria 1832
1269 Ga0500645_028937 3300053730 Bacteria 1674
1270 Ga0500645_092338 3300053730 Bacteria 858
1271 Ga0500609_012382 3300053731 Bacteria 1153
1272 Ga0500656_006149 3300053732 Bacteria 1209
1273 Ga0500552_069122 3300053733 Bacteria 631
1274 Ga0500596_024173 3300053735 Bacteria 923
1275 Ga0500599_002952 3300053736 Bacteria 2063
1276 Ga0500601_000419 3300053737 Bacteria 7101
1277 Ga0500601_018425 3300053737 Bacteria 802
1278 Ga0500661_010749 3300055283 Bacteria 1664
1279 Ga0500661_061784 3300055283 Bacteria 677
1280 Ga0501082_0323771 3300060353 Bacteria 1343

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053737 Ga0500601_018425 Ga0500601_018425_352_792 133
2 3300039450 Ga0436363_1561683 Ga0436363_1561683_186_665 144
3 3300053177 Ga0500636_0156896 Ga0500636_0156896_724_1221 151
4 3300026067 Ga0207678_10873472 Ga0207678_108734722 152
5 3300048924 Ga0496121_0192329 Ga0496121_0192329_152_682 156
6 3300048929 Ga0496126_0377072 Ga0496126_0377072_26_556 156
7 3300045976 Ga0466967_0241336 Ga0466967_0241336_534_1064 157
8 3300041451 Ga0451791_0424813 Ga0451791_0424813_308_784 158
9 3300048924 Ga0496121_0704692 Ga0496121_0704692_55_582 159
10 3300005467 Ga0070706_100375313 Ga0070706_1003753132 160
11 3300005468 Ga0070707_100137959 Ga0070707_1001379592 160
12 3300005536 Ga0070697_100073538 Ga0070697_1000735383 160
13 3300007265 Ga0099794_10421978 Ga0099794_104219781 160
14 3300010159 Ga0099796_10006414 Ga0099796_100064142 160
15 3300025905 Ga0207685_10116154 Ga0207685_101161541 160
16 3300025910 Ga0207684_10642969 Ga0207684_106429692 160
17 3300025922 Ga0207646_10105273 Ga0207646_101052732 160
18 3300027671 Ga0209588_1176845 Ga0209588_11768451 160
19 3300048929 Ga0496126_0068252 Ga0496126_0068252_1242_1772 160
20 3300053083 Ga0495655_0054284 Ga0495655_0054284_16_540 160
21 3300005983 Ga0081540_1080078 Ga0081540_10800781 161
22 3300010375 Ga0105239_10280959 Ga0105239_102809593 161
23 3300025297 Ga0209758_1002809 Ga0209758_100280910 161
24 3300035091 Ga0373951_0017931 Ga0373951_0017931_1043_1573 161
25 3300041507 Ga0451851_1013094 Ga0451851_1013094_61_591 161
26 3300048907 Ga0496104_0486997 Ga0496104_0486997_114_641 161
27 3300048908 Ga0496105_0053620 Ga0496105_0053620_985_1515 161
28 3300048912 Ga0496109_0071834 Ga0496109_0071834_288_818 161
29 3300048913 Ga0496110_0281445 Ga0496110_0281445_941_1471 161
30 3300048914 Ga0496111_0047295 Ga0496111_0047295_2281_2811 161
31 3300048915 Ga0496112_0093432 Ga0496112_0093432_2000_2530 161
32 3300048924 Ga0496121_0237709 Ga0496121_0237709_561_1088 161
33 3300048929 Ga0496126_0437004 Ga0496126_0437004_430_957 161
34 3300005434 Ga0070709_10000164 Ga0070709_100001645 162
35 3300005435 Ga0070714_100047913 Ga0070714_1000479132 162
36 3300005436 Ga0070713_100196055 Ga0070713_1001960552 162
37 3300005437 Ga0070710_10000283 Ga0070710_1000028319 162
38 3300005439 Ga0070711_100005189 Ga0070711_1000051895 162
39 3300005843 Ga0068860_100017741 Ga0068860_1000177414 162
40 3300006163 Ga0070715_10161682 Ga0070715_101616822 162
41 3300006173 Ga0070716_100168012 Ga0070716_1001680122 162
42 3300006175 Ga0070712_100014272 Ga0070712_1000142721 162
43 3300006237 Ga0097621_100951034 Ga0097621_1009510341 162
44 3300009101 Ga0105247_10413079 Ga0105247_104130792 162
45 3300009545 Ga0105237_11191088 Ga0105237_111910881 162
46 3300025261 Ga0209233_1060958 Ga0209233_10609581 162
47 3300025898 Ga0207692_10000528 Ga0207692_100005289 162
48 3300025905 Ga0207685_10017070 Ga0207685_100170701 162
49 3300025906 Ga0207699_10000514 Ga0207699_100005144 162
50 3300025915 Ga0207693_10008295 Ga0207693_100082953 162
51 3300025928 Ga0207700_10157523 Ga0207700_101575232 162
52 3300025929 Ga0207664_10040008 Ga0207664_100400082 162
53 3300028381 Ga0268264_10000062 Ga0268264_10000062270 162
54 3300031616 Ga0307508_10117670 Ga0307508_101176702 162
55 3300031730 Ga0307516_10107836 Ga0307516_101078363 162
56 3300033179 Ga0307507_10063749 Ga0307507_100637492 162
57 3300035083 Ga0373926_0024481 Ga0373926_0024481_1497_2027 162
58 3300035170 Ga0373943_0111820 Ga0373943_0111820_202_732 162
59 3300035171 Ga0373946_0102886 Ga0373946_0102886_352_882 162
60 3300035695 Ga0373927_0002321 Ga0373927_0002321_9534_10064 162
61 3300035695 Ga0373927_0016726 Ga0373927_0016726_89_619 162
62 3300035725 Ga0373947_0021132 Ga0373947_0021132_2999_3529 162
63 3300037068 Ga0373925_0044131 Ga0373925_0044131_2750_3280 162
64 3300037471 Ga0395905_0268368 Ga0395905_0268368_990_1559 162
65 3300039437 Ga0436365_1227774 Ga0436365_1227774_651_1178 162
66 3300046454 Ga0495592_0182910 Ga0495592_0182910_134_664 162
67 3300046459 Ga0495629_0441399 Ga0495629_0441399_258_788 162
68 3300046472 Ga0495580_0062616 Ga0495580_0062616_1810_2340 162
69 3300046499 Ga0495594_0466224 Ga0495594_0466224_14_544 162
70 3300046536 Ga0495587_0267144 Ga0495587_0267144_321_851 162
71 3300046663 Ga0495635_0510332 Ga0495635_0510332_178_708 162
72 3300046678 Ga0495599_0071655 Ga0495599_0071655_403_933 162
73 3300048909 Ga0496106_0005807 Ga0496106_0005807_6187_6717 162
74 3300048915 Ga0496112_0000018 Ga0496112_0000018_112687_113217 162
75 3300048919 Ga0496116_0193715 Ga0496116_0193715_221_751 162
76 3300048920 Ga0496117_0032990 Ga0496117_0032990_1146_1676 162
77 3300048921 Ga0496118_0005692 Ga0496118_0005692_9522_10052 162
78 3300048922 Ga0496119_0026589 Ga0496119_0026589_2850_3380 162
79 3300048924 Ga0496121_0000870 Ga0496121_0000870_33799_34329 162
80 3300048925 Ga0496122_0017924 Ga0496122_0017924_1622_2152 162
81 3300048927 Ga0496124_0001369 Ga0496124_0001369_1664_2194 162
82 3300048927 Ga0496124_0601934 Ga0496124_0601934_46_576 162
83 3300048928 Ga0496125_0078047 Ga0496125_0078047_1296_1826 162
84 3300048929 Ga0496126_0016831 Ga0496126_0016831_6028_6558 162
85 3300053077 Ga0495601_0189917 Ga0495601_0189917_122_652 162
86 3300053080 Ga0500635_0001019 Ga0500635_0001019_3518_4048 162
87 3300053094 Ga0500566_0028718 Ga0500566_0028718_1900_2430 162
88 3300053106 Ga0500558_226386 Ga0500558_226386_52_582 162
89 3300053119 Ga0500595_017174 Ga0500595_017174_101_628 162
90 3300053119 Ga0500595_020317 Ga0500595_020317_1484_2014 162
91 3300053120 Ga0500597_140240 Ga0500597_140240_99_629 162
92 3300053136 Ga0500559_0034845 Ga0500559_0034845_38_568 162
93 3300053140 Ga0500573_0007614 Ga0500573_0007614_2931_3461 162
94 3300053148 Ga0500590_152328 Ga0500590_152328_164_694 162
95 3300053150 Ga0500603_008315 Ga0500603_008315_732_1262 162
96 3300053178 Ga0500637_0107654 Ga0500637_0107654_929_1459 162
97 3300053733 Ga0500552_069122 Ga0500552_069122_52_582 162
98 3300053735 Ga0500596_024173 Ga0500596_024173_129_659 162
99 3300005434 Ga0070709_10184937 Ga0070709_101849372 163
100 3300005436 Ga0070713_100094561 Ga0070713_1000945612 163
101 3300005539 Ga0068853_100504203 Ga0068853_1005042032 163
102 3300005577 Ga0068857_100276126 Ga0068857_1002761261 163
103 3300005578 Ga0068854_100037985 Ga0068854_1000379852 163
104 3300005614 Ga0068856_100762197 Ga0068856_1007621971 163
105 3300005614 Ga0068856_100892822 Ga0068856_1008928222 163
106 3300005617 Ga0068859_100404153 Ga0068859_1004041532 163
107 3300005841 Ga0068863_101031747 Ga0068863_1010317472 163
108 3300006028 Ga0070717_10616045 Ga0070717_106160452 163
109 3300006163 Ga0070715_10304498 Ga0070715_103044982 163
110 3300006931 Ga0097620_100404141 Ga0097620_1004041412 163
111 3300007788 Ga0099795_10029851 Ga0099795_100298511 163
112 3300009093 Ga0105240_10178027 Ga0105240_101780272 163
113 3300009098 Ga0105245_11323201 Ga0105245_113232012 163
114 3300009101 Ga0105247_10023886 Ga0105247_100238862 163
115 3300009174 Ga0105241_11076802 Ga0105241_110768022 163
116 3300009545 Ga0105237_10970004 Ga0105237_109700041 163
117 3300013104 Ga0157370_10222534 Ga0157370_102225343 163
118 3300013105 Ga0157369_10030438 Ga0157369_100304384 163
119 3300013307 Ga0157372_10718860 Ga0157372_107188601 163
120 3300020082 Ga0206353_11400766 Ga0206353_114007662 163
121 3300021388 Ga0213875_10243397 Ga0213875_102433972 163
122 3300025254 Ga0209148_1000295 Ga0209148_100029570 163
123 3300025261 Ga0209233_1003058 Ga0209233_10030582 163
124 3300025272 Ga0209455_1021718 Ga0209455_10217182 163
125 3300025909 Ga0207705_10164146 Ga0207705_101641461 163
126 3300025911 Ga0207654_10795968 Ga0207654_107959681 163
127 3300025913 Ga0207695_10341970 Ga0207695_103419702 163
128 3300025914 Ga0207671_10327691 Ga0207671_103276912 163
129 3300025914 Ga0207671_10573074 Ga0207671_105730741 163
130 3300025915 Ga0207693_10337439 Ga0207693_103374392 163
131 3300025928 Ga0207700_10046786 Ga0207700_100467863 163
132 3300026041 Ga0207639_10284713 Ga0207639_102847132 163
133 3300027671 Ga0209588_1051525 Ga0209588_10515252 163
134 3300030521 Ga0307511_10137689 Ga0307511_101376892 163
135 3300035086 Ga0373934_0059329 Ga0373934_0059329_743_1273 163
136 3300035111 Ga0373923_0122663 Ga0373923_0122663_233_763 163
137 3300035117 Ga0373953_0007669 Ga0373953_0007669_374_904 163
138 3300035118 Ga0373954_0011714 Ga0373954_0011714_2986_3516 163
139 3300035119 Ga0373956_0019947 Ga0373956_0019947_1734_2264 163
140 3300035120 Ga0373957_0005744 Ga0373957_0005744_302_832 163
141 3300035172 Ga0373955_0011290 Ga0373955_0011290_2246_2776 163
142 3300035410 Ga0373924_0002441 Ga0373924_0002441_1599_2129 163
143 3300035692 Ga0373935_0139374 Ga0373935_0139374_906_1436 163
144 3300035724 Ga0373933_0052367 Ga0373933_0052367_1220_1750 163
145 3300036401 Ga0373937_1289280 Ga0373937_1289280_136_666 163
146 3300037068 Ga0373925_1330677 Ga0373925_1330677_13_543 163
147 3300037471 Ga0395905_1184253 Ga0395905_1184253_118_648 163
148 3300037853 Ga0436364_0760368 Ga0436364_0760368_107_637 163
149 3300037853 Ga0436364_0953579 Ga0436364_0953579_215_745 163
150 3300037853 Ga0436364_1117557 Ga0436364_1117557_786_1316 163
151 3300038443 Ga0395901_0101076 Ga0395901_0101076_740_1270 163
152 3300044683 Ga0466965_0208416 Ga0466965_0208416_286_816 163
153 3300044735 Ga0466968_0298774 Ga0466968_0298774_193_723 163
154 3300046454 Ga0495592_0021717 Ga0495592_0021717_3878_4408 163
155 3300046459 Ga0495629_0049337 Ga0495629_0049337_1220_1750 163
156 3300046462 Ga0495651_0041654 Ga0495651_0041654_1531_2061 163
157 3300046463 Ga0495653_0028280 Ga0495653_0028280_2376_2906 163
158 3300046476 Ga0495662_0095461 Ga0495662_0095461_693_1223 163
159 3300046477 Ga0495664_0044387 Ga0495664_0044387_1731_2261 163
160 3300046511 Ga0495608_0019870 Ga0495608_0019870_3954_4484 163
161 3300046514 Ga0495618_0028578 Ga0495618_0028578_415_945 163
162 3300046516 Ga0495628_0015500 Ga0495628_0015500_3232_3762 163
163 3300046524 Ga0495648_0001071 Ga0495648_0001071_19095_19622 163
164 3300046529 Ga0495652_0019166 Ga0495652_0019166_3990_4520 163
165 3300046533 Ga0495640_0016721 Ga0495640_0016721_3821_4351 163
166 3300046535 Ga0495586_0271468 Ga0495586_0271468_10_540 163
167 3300046536 Ga0495587_0011102 Ga0495587_0011102_3784_4314 163
168 3300046543 Ga0495645_0008238 Ga0495645_0008238_6225_6755 163
169 3300046559 Ga0495667_0017003 Ga0495667_0017003_2846_3376 163
170 3300046642 Ga0495634_0020900 Ga0495634_0020900_1529_2059 163
171 3300046663 Ga0495635_0014178 Ga0495635_0014178_4158_4688 163
172 3300046675 Ga0495657_0031180 Ga0495657_0031180_431_961 163
173 3300046678 Ga0495599_0085847 Ga0495599_0085847_555_1085 163
174 3300046679 Ga0495623_0016092 Ga0495623_0016092_370_900 163
175 3300046680 Ga0495646_0172205 Ga0495646_0172205_60_590 163
176 3300046683 Ga0495658_0163835 Ga0495658_0163835_165_695 163
177 3300046689 Ga0495613_0181544 Ga0495613_0181544_749_1279 163
178 3300046809 Ga0495600_0059007 Ga0495600_0059007_1603_2133 163
179 3300047315 Ga0495581_0159180 Ga0495581_0159180_424_954 163
180 3300047317 Ga0495604_0030536 Ga0495604_0030536_2657_3187 163
181 3300047319 Ga0495674_0029055 Ga0495674_0029055_4244_4774 163
182 3300047320 Ga0495672_0037365 Ga0495672_0037365_2094_2624 163
183 3300047322 Ga0495680_0045020 Ga0495680_0045020_2498_3028 163
184 3300047444 Ga0495675_0028927 Ga0495675_0028927_1201_1731 163
185 3300047469 Ga0495673_0027495 Ga0495673_0027495_1542_2114 163
186 3300047471 Ga0495684_0117000 Ga0495684_0117000_1229_1759 163
187 3300047673 Ga0495593_0037445 Ga0495593_0037445_710_1240 163
188 3300048088 Ga0495602_0050036 Ga0495602_0050036_136_666 163
189 3300048922 Ga0496119_0437327 Ga0496119_0437327_21_551 163
190 3300048924 Ga0496121_0000278 Ga0496121_0000278_56806_57336 163
191 3300048924 Ga0496121_0534225 Ga0496121_0534225_161_691 163
192 3300048929 Ga0496126_0053878 Ga0496126_0053878_2969_3499 163
193 3300048929 Ga0496126_0080618 Ga0496126_0080618_958_1497 163
194 3300053077 Ga0495601_0072078 Ga0495601_0072078_694_1224 163
195 3300053078 Ga0495612_0003340 Ga0495612_0003340_136_666 163
196 3300053084 Ga0495595_0006434 Ga0495595_0006434_2800_3330 163
197 3300053085 Ga0495619_0097925 Ga0495619_0097925_1092_1622 163
198 3300053104 Ga0500556_0116736 Ga0500556_0116736_419_949 163
199 3300053119 Ga0500595_002722 Ga0500595_002722_7138_7668 163
200 3300053139 Ga0500568_0013697 Ga0500568_0013697_160_690 163
201 3300053139 Ga0500568_0132269 Ga0500568_0132269_73_603 163
202 3300006178 Ga0075367_10122497 Ga0075367_101224972 164
203 3300025915 Ga0207693_10788662 Ga0207693_107886621 164
204 3300035083 Ga0373926_0011112 Ga0373926_0011112_761_1291 164
205 3300035111 Ga0373923_0180281 Ga0373923_0180281_129_659 164
206 3300035113 Ga0373936_0007829 Ga0373936_0007829_2463_2993 164
207 3300035116 Ga0373945_0033750 Ga0373945_0033750_722_1252 164
208 3300035118 Ga0373954_0044076 Ga0373954_0044076_1181_1711 164
209 3300035170 Ga0373943_0003229 Ga0373943_0003229_5116_5646 164
210 3300035171 Ga0373946_0007257 Ga0373946_0007257_2681_3211 164
211 3300035172 Ga0373955_0070950 Ga0373955_0070950_676_1206 164
212 3300035692 Ga0373935_0004301 Ga0373935_0004301_4235_4765 164
213 3300035695 Ga0373927_0000766 Ga0373927_0000766_4515_5045 164
214 3300035724 Ga0373933_0095429 Ga0373933_0095429_1291_1821 164
215 3300035725 Ga0373947_0000310 Ga0373947_0000310_6075_6605 164
216 3300037068 Ga0373925_0016057 Ga0373925_0016057_4493_5023 164
217 3300039437 Ga0436365_0285466 Ga0436365_0285466_697_1227 164
218 3300046454 Ga0495592_0084325 Ga0495592_0084325_538_1068 164
219 3300046455 Ga0495603_0000936 Ga0495603_0000936_11186_11716 164
220 3300046455 Ga0495603_0121441 Ga0495603_0121441_208_702 164
221 3300046459 Ga0495629_0001416 Ga0495629_0001416_5499_6029 164
222 3300046461 Ga0495641_0005002 Ga0495641_0005002_4718_5248 164
223 3300046463 Ga0495653_0058545 Ga0495653_0058545_1072_1602 164
224 3300046472 Ga0495580_0002805 Ga0495580_0002805_5011_5541 164
225 3300046473 Ga0495582_0000302 Ga0495582_0000302_6692_7222 164
226 3300046475 Ga0495639_0000072 Ga0495639_0000072_11540_12070 164
227 3300046476 Ga0495662_0001578 Ga0495662_0001578_5603_6133 164
228 3300046477 Ga0495664_0045491 Ga0495664_0045491_899_1429 164
229 3300046499 Ga0495594_0000046 Ga0495594_0000046_22350_22880 164
230 3300046516 Ga0495628_0162717 Ga0495628_0162717_730_1260 164
231 3300046517 Ga0495630_0005610 Ga0495630_0005610_6650_7180 164
232 3300046524 Ga0495648_0176996 Ga0495648_0176996_416_946 164
233 3300046526 Ga0495666_0020390 Ga0495666_0020390_844_1374 164
234 3300046529 Ga0495652_0014684 Ga0495652_0014684_1960_2490 164
235 3300046531 Ga0495665_0000335 Ga0495665_0000335_9496_10026 164
236 3300046533 Ga0495640_0002138 Ga0495640_0002138_4022_4552 164
237 3300046535 Ga0495586_0098735 Ga0495586_0098735_46_576 164
238 3300046557 Ga0495622_0001664 Ga0495622_0001664_5200_5730 164
239 3300046559 Ga0495667_0003584 Ga0495667_0003584_5654_6184 164
240 3300046642 Ga0495634_0004622 Ga0495634_0004622_5698_6228 164
241 3300046663 Ga0495635_0048596 Ga0495635_0048596_183_713 164
242 3300046680 Ga0495646_0063333 Ga0495646_0063333_580_1110 164
243 3300046681 Ga0495647_0022488 Ga0495647_0022488_810_1340 164
244 3300046683 Ga0495658_0014486 Ga0495658_0014486_2624_3154 164
245 3300046689 Ga0495613_0004485 Ga0495613_0004485_7378_7908 164
246 3300046690 Ga0495624_0000795 Ga0495624_0000795_22442_22972 164
247 3300046809 Ga0495600_0396510 Ga0495600_0396510_232_762 164
248 3300047315 Ga0495581_0000030 Ga0495581_0000030_13893_14423 164
249 3300047319 Ga0495674_0004821 Ga0495674_0004821_9983_10513 164
250 3300047321 Ga0495676_0055320 Ga0495676_0055320_1073_1603 164
251 3300047322 Ga0495680_0094553 Ga0495680_0094553_528_1058 164
252 3300047471 Ga0495684_0127826 Ga0495684_0127826_332_862 164
253 3300047673 Ga0495593_0000398 Ga0495593_0000398_11667_12197 164
254 3300048089 Ga0495614_0027576 Ga0495614_0027576_1303_1833 164
255 3300048920 Ga0496117_0046740 Ga0496117_0046740_1020_1550 164
256 3300048921 Ga0496118_0113965 Ga0496118_0113965_38_568 164
257 3300048922 Ga0496119_0062447 Ga0496119_0062447_558_1088 164
258 3300048924 Ga0496121_0010173 Ga0496121_0010173_4679_5209 164
259 3300048928 Ga0496125_0133097 Ga0496125_0133097_274_804 164
260 3300048929 Ga0496126_0618714 Ga0496126_0618714_58_588 164
261 3300050494 nmdc:mga06z11_98186_c1 nmdc:mga06z11_98186_c1_635_1165 164
262 3300053085 Ga0495619_0256677 Ga0495619_0256677_109_639 164
263 3300053093 Ga0500651_0013790 Ga0500651_0013790_1621_2151 164
264 3300053118 Ga0500594_0014142 Ga0500594_0014142_773_1303 164
265 3300053130 Ga0500642_0208301 Ga0500642_0208301_166_696 164
266 3300053146 Ga0500588_0109718 Ga0500588_0109718_155_685 164
267 3300010159 Ga0099796_10015670 Ga0099796_100156702 165
268 3300035112 Ga0373932_0318529 Ga0373932_0318529_11_508 165
269 3300042157 Ga0439458_0185223 Ga0439458_0185223_32_529 165
270 3300046519 Ga0495632_0203258 Ga0495632_0203258_375_872 165
271 3300048924 Ga0496121_0580805 Ga0496121_0580805_138_668 166
272 3300050493 nmdc:mga0k408_620462_c1 nmdc:mga0k408_620462_c1_53_583 166
273 3300005336 Ga0070680_100277401 Ga0070680_1002774012 167
274 3300005458 Ga0070681_10099168 Ga0070681_100991682 167
275 3300005530 Ga0070679_100177508 Ga0070679_1001775082 167
276 3300005539 Ga0068853_100588946 Ga0068853_1005889461 167
277 3300009093 Ga0105240_10226073 Ga0105240_102260732 167
278 3300009545 Ga0105237_10531032 Ga0105237_105310322 167
279 3300013104 Ga0157370_10074997 Ga0157370_100749971 167
280 3300025909 Ga0207705_10698945 Ga0207705_106989451 167
281 3300025913 Ga0207695_10370168 Ga0207695_103701682 167
282 3300025914 Ga0207671_10532225 Ga0207671_105322252 167
283 3300025949 Ga0207667_11148259 Ga0207667_111482591 167
284 3300005436 Ga0070713_100906911 Ga0070713_1009069112 168
285 3300005437 Ga0070710_10153524 Ga0070710_101535242 168
286 3300005937 Ga0081455_10205630 Ga0081455_102056302 168
287 3300006175 Ga0070712_100026701 Ga0070712_1000267012 168
288 3300006186 Ga0075369_10205841 Ga0075369_102058411 168
289 3300025898 Ga0207692_10142642 Ga0207692_101426422 168
290 3300025915 Ga0207693_10011107 Ga0207693_100111072 168
291 3300025928 Ga0207700_10253220 Ga0207700_102532202 168
292 3300026041 Ga0207639_10181545 Ga0207639_101815452 168
293 3300048917 Ga0496114_0700432 Ga0496114_0700432_280_810 168
294 3300013308 Ga0157375_11007278 Ga0157375_110072782 169
295 3300044658 Ga0466972_0125356 Ga0466972_0125356_61_591 169
296 3300044735 Ga0466968_0139422 Ga0466968_0139422_523_1053 169
297 3300046524 Ga0495648_0128362 Ga0495648_0128362_779_1309 169
298 3300003203 JGI25406J46586_10009349 JGI25406J46586_100093492 170
299 3300005455 Ga0070663_100048472 Ga0070663_1000484721 170
300 3300005985 Ga0081539_10000371 Ga0081539_1000037113 170
301 3300009177 Ga0105248_10342081 Ga0105248_103420812 170
302 3300013297 Ga0157378_10020915 Ga0157378_100209155 170
303 3300032005 Ga0307411_10110047 Ga0307411_101100472 170
304 3300048924 Ga0496121_0519332 Ga0496121_0519332_159_689 170
305 3300003659 JGI25404J52841_10013024 JGI25404J52841_100130241 171
306 3300005983 Ga0081540_1002717 Ga0081540_10027176 171
307 3300041492 Ga0451835_0562890 Ga0451835_0562890_149_718 171
308 3300053732 Ga0500656_006149 Ga0500656_006149_62_643 171
309 iso_pu_bacteria 2922361189 2922363213 171
310 iso_pu_bacteria 2922386360 2922388482 171
311 3300009545 Ga0105237_10907925 Ga0105237_109079251 172
312 3300010375 Ga0105239_10246790 Ga0105239_102467901 172
313 iso_pu_bacteria 2507262055 2507505456 172
314 iso_pu_bacteria 2508501009 2508539341 172
315 iso_pu_bacteria 2508501042 2508695670 172
316 iso_pu_bacteria 2511231028 2511395682 172
317 iso_pu_bacteria 2513237094 2513642198 172
318 iso_pu_bacteria 2513237095 2513651328 172
319 iso_pu_bacteria 2513237098 2513676321 172
320 iso_pu_bacteria 2513237101 2513695293 172
321 iso_pu_bacteria 2513237104 2513718246 172
322 iso_pu_bacteria 2513237137 2513859378 172
323 iso_pu_bacteria 2513237139 2513873341 172
324 iso_pu_bacteria 2513237145 2513921552 172
325 iso_pu_bacteria 2513237161 2514014671 172
326 iso_pu_bacteria 2515154112 2515627651 172
327 iso_pu_bacteria 2517093001 2517106274 172
328 iso_pu_bacteria 2524023205 2524441447 172
329 iso_pu_bacteria 2524023210 2524467221 172
330 iso_pu_bacteria 2528768022 2528853312 172
331 iso_pu_bacteria 2617270735 2617352054 172
332 iso_pu_bacteria 2721755755 2723841827 172
333 iso_pu_bacteria 2728368998 2728748426 172
334 iso_pu_bacteria 2744054633 2745077581 172
335 iso_pu_bacteria 2791355196 2793062243 172
336 iso_pu_bacteria 2791355199 2793078299 172
337 iso_pu_bacteria 2802429603 2805920689 172
338 iso_pu_bacteria 2816332527 2818237862 172
339 iso_pu_bacteria 2824600985 2824604417 172
340 iso_pu_bacteria 2824609381 2824614853 172
341 iso_pu_bacteria 2824653114 2824656299 172
342 iso_pu_bacteria 2824661429 2824669885 172
343 iso_pu_bacteria 2824671348 2824671755 172
344 iso_pu_bacteria 2824679649 2824684806 172
345 iso_pu_bacteria 2824687955 2824695784 172
346 iso_pu_bacteria 2824696289 2824701665 172
347 iso_pu_bacteria 2824704595 2824710873 172
348 iso_pu_bacteria 2824753945 2824760656 172
349 iso_pu_bacteria 2824763712 2824768460 172
350 iso_pu_bacteria 2824773399 2824781375 172
351 iso_pu_bacteria 2838122688 2838124705 172
352 iso_pu_bacteria 2841941048 2841945396 172
353 iso_pu_bacteria 2841949485 2841952182 172
354 iso_pu_bacteria 2841957949 2841965340 172
355 iso_pu_bacteria 2841966195 2841970431 172
356 iso_pu_bacteria 2841974524 2841981679 172
357 iso_pu_bacteria 2841983080 2841984959 172
358 iso_pu_bacteria 2842038055 2842043314 172
359 iso_pu_bacteria 2842045827 2842052696 172
360 iso_pu_bacteria 2844315083 2844315551 172
361 iso_pu_bacteria 2847930680 2847931254 172
362 iso_pu_bacteria 2847939898 2847942347 172
363 iso_pu_bacteria 2849076700 2849083219 172
364 iso_pu_bacteria 2857509624 2857516348 172
365 iso_pu_bacteria 2874590934 2874592543 172
366 iso_pu_bacteria 2874604998 2874607880 172
367 iso_pu_bacteria 2874612657 2874617974 172
368 iso_pu_bacteria 2874620515 2874621197 172
369 iso_pu_bacteria 2874628541 2874628596 172
370 iso_pu_bacteria 2874645413 2874647162 172
371 iso_pu_bacteria 2876761206 2876769647 172
372 iso_pu_bacteria 2876771140 2876772546 172
373 iso_pu_bacteria 2876808645 2876816464 172
374 iso_pu_bacteria 2876818435 2876819807 172
375 iso_pu_bacteria 2879074833 2879076313 172
376 iso_pu_bacteria 2879083081 2879083776 172
377 iso_pu_bacteria 2879099564 2879100445 172
378 iso_pu_bacteria 2879110137 2879113307 172
379 iso_pu_bacteria 2879127579 2879128797 172
380 iso_pu_bacteria 2879142872 2879143618 172
381 iso_pu_bacteria 2881665667 2881673215 172
382 iso_pu_bacteria 2885366525 2885369329 172
383 iso_pu_bacteria 2885374607 2885377560 172
384 iso_pu_bacteria 2885383462 2885386726 172
385 iso_pu_bacteria 2885409591 2885415196 172
386 iso_pu_bacteria 2888378607 2888379395 172
387 iso_pu_bacteria 2888388044 2888390495 172
388 iso_pu_bacteria 2888419890 2888420116 172
389 iso_pu_bacteria 2889033259 2889035296 172
390 iso_pu_bacteria 2903727486 2903733540 172
391 iso_pu_bacteria 2903768456 2903777917 172
392 iso_pu_bacteria 2904666416 2904667742 172
393 iso_pu_bacteria 2904699407 2904708396 172
394 iso_pu_bacteria 2904711408 2904716324 172
395 iso_pu_bacteria 2906602504 2906608894 172
396 iso_pu_bacteria 2906610324 2906613568 172
397 iso_pu_bacteria 2906626472 2906631674 172
398 iso_pu_bacteria 2906635258 2906636576 172
399 iso_pu_bacteria 2906643746 2906648340 172
400 iso_pu_bacteria 2906660503 2906668102 172
401 iso_pu_bacteria 2908739725 2908747659 172
402 iso_pu_bacteria 2922368715 2922369382 172
403 iso_pu_bacteria 2922393267 2922396578 172
404 iso_pu_bacteria 2922425934 2922434005 172
405 iso_pu_bacteria 2929615660 2929618789 172
406 iso_pu_bacteria 2929624759 2929628526 172
407 iso_pu_bacteria 2932784394 2932790971 172
408 iso_pu_bacteria 2932794094 2932794136 172
409 iso_pu_bacteria 2932801729 2932809212 172
410 iso_pu_bacteria 2932809354 2932811975 172
411 iso_pu_bacteria 2932818245 2932825574 172
412 iso_pu_bacteria 2932828146 2932833687 172
413 iso_pu_bacteria 2933577622 2933580501 172
414 iso_pu_bacteria 2935608549 2935615514 172
415 iso_pu_bacteria 2935616580 2935623213 172
416 iso_pu_bacteria 2935638405 2935644288 172
417 iso_pu_bacteria 2935648319 2935654443 172
418 iso_pu_bacteria 2935656913 2935663323 172
419 iso_pu_bacteria 2935665750 2935672130 172
420 iso_pu_bacteria 2935675223 2935679350 172
421 iso_pu_bacteria 2935684952 2935686592 172
422 iso_pu_bacteria 2935694250 2935700373 172
423 iso_pu_bacteria 2935703347 2935710321 172
424 iso_pu_bacteria 2935713505 2935716280 172
425 iso_pu_bacteria 2935722832 2935723596 172
426 iso_pu_bacteria 2935732158 2935735151 172
427 iso_pu_bacteria 2935741537 2935744058 172
428 iso_pu_bacteria 2935750917 2935752558 172
429 iso_pu_bacteria 2935760218 2935763309 172
430 iso_pu_bacteria 2935769743 2935774282 172
431 iso_pu_bacteria 2935777560 2935783352 172
432 iso_pu_bacteria 2935785616 2935789003 172
433 iso_pu_bacteria 2935793552 2935796753 172
434 iso_pu_bacteria 2935801545 2935808312 172
435 iso_pu_bacteria 2935810662 2935816074 172
436 iso_pu_bacteria 2935819856 2935825685 172
437 iso_pu_bacteria 2935827899 2935833468 172
438 iso_pu_bacteria 2935837841 2935845974 172
439 iso_pu_bacteria 2935847175 2935853449 172
440 iso_pu_bacteria 2935855204 2935861461 172
441 iso_pu_bacteria 2935864058 2935869580 172
442 iso_pu_bacteria 2935873716 2935879909 172
443 iso_pu_bacteria 2935883170 2935889163 172
444 iso_pu_bacteria 2935908558 2935915051 172
445 iso_pu_bacteria 2935916978 2935918899 172
446 iso_pu_bacteria 2935926038 2935931384 172
447 iso_pu_bacteria 2935934488 2935939981 172
448 iso_pu_bacteria 2935942939 2935947672 172
449 iso_pu_bacteria 2935951376 2935956443 172
450 iso_pu_bacteria 2935959822 2935966711 172
451 iso_pu_bacteria 2935967501 2935973237 172
452 iso_pu_bacteria 2935975950 2935980520 172
453 iso_pu_bacteria 2935984226 2935990130 172
454 iso_pu_bacteria 2935992306 2935997868 172
455 iso_pu_bacteria 2936002035 2936008867 172
456 iso_pu_bacteria 2936011229 2936017518 172
457 iso_pu_bacteria 2936019824 2936025981 172
458 iso_pu_bacteria 2936028420 2936034823 172
459 iso_pu_bacteria 2936037263 2936041079 172
460 iso_pu_bacteria 2936046547 2936052919 172
461 iso_pu_bacteria 2936055302 2936060222 172
462 iso_pu_bacteria 2940556831 2940558471 172
463 iso_pu_bacteria 2941531003 2941535337 172
464 iso_pu_bacteria 2941538514 2941547143 172
465 iso_pu_bacteria 3005474847 3005475280 172
466 iso_pu_bacteria 3005483717 3005486668 172
467 iso_pu_bacteria 3005506211 3005508974 172
468 iso_pu_bacteria 3005587118 3005594143 172
469 iso_pu_bacteria 3005594810 3005595241 172
470 iso_pu_bacteria 3005710791 3005711184 172
471 iso_pu_bacteria 3005718088 3005718479 172
472 iso_pu_bacteria 8006926726 8006927254 172
473 iso_pu_bacteria 8006933436 8006935997 172
474 iso_pu_bacteria 8006964411 8006967642 172
475 iso_pu_bacteria 8006973647 8006975879 172
476 iso_pu_bacteria 8006984368 8006991112 172
477 iso_pu_bacteria 8006994254 8007000441 172
478 iso_pu_bacteria 8016511872 8016517985 172
479 iso_pu_bacteria 8016522445 8016526334 172
480 iso_pu_bacteria 8016530956 8016531398 172
481 iso_pu_bacteria 8016539877 8016544610 172
482 iso_pu_bacteria 8016548790 8016557464 172
483 iso_pu_bacteria 8016557553 8016565822 172
484 iso_pu_bacteria 8016566248 8016569665 172
485 iso_pu_bacteria 8016575299 8016582273 172
486 iso_pu_bacteria 8016583857 8016586143 172
487 iso_pu_bacteria 8016595262 8016603422 172
488 iso_pu_bacteria 8016603502 8016606357 172
489 iso_pu_bacteria 8016613128 8016618264 172
490 iso_pu_bacteria 8016622563 8016622913 172
491 iso_pu_bacteria 8016630954 8016635419 172
492 iso_pu_bacteria 8017057580 8017058655 172
493 iso_pu_bacteria 8019530166 8019531231 172
494 iso_pu_bacteria 8019538911 8019540321 172
495 iso_pu_bacteria 8019547302 8019549912 172
496 iso_pu_bacteria 8019555841 8019562660 172
497 iso_pu_bacteria 8019565922 8019572737 172
498 iso_pu_bacteria 8019576017 8019577002 172
499 iso_pu_bacteria 8019597564 8019606675 172
500 iso_pu_bacteria 8019619141 8019623169 172
501 iso_pu_bacteria 8019629233 8019629929 172
502 iso_pu_bacteria 8019648815 8019652276 172
503 iso_pu_bacteria 8019659431 8019666765 172
504 iso_pu_bacteria 8019668869 8019676526 172
505 iso_pu_bacteria 8019678201 8019679463 172
506 iso_pu_bacteria 8019687851 8019696041 172
507 iso_pu_bacteria 8055742211 8055742638 172
508 iso_pu_bacteria 8056673599 8056676147 172
509 iso_pu_bacteria 8056681323 8056682946 172
510 iso_pu_bacteria 8056967851 8056971499 172
511 3300005985 Ga0081539_10078005 Ga0081539_100780052 173
512 3300047445 Ga0495677_0220164 Ga0495677_0220164_109_633 174
513 3300005616 Ga0068852_100340850 Ga0068852_1003408502 175
514 3300005719 Ga0068861_100672704 Ga0068861_1006727042 175
515 3300005841 Ga0068863_100792837 Ga0068863_1007928372 175
516 3300006038 Ga0075365_10007177 Ga0075365_100071773 175
517 3300006048 Ga0075363_100000382 Ga0075363_1000003827 175
518 3300006237 Ga0097621_100892052 Ga0097621_1008920521 175
519 3300006353 Ga0075370_10112638 Ga0075370_101126382 175
520 3300025981 Ga0207640_10525771 Ga0207640_105257711 175
521 3300026067 Ga0207678_10016938 Ga0207678_100169385 175
522 3300026095 Ga0207676_10289778 Ga0207676_102897781 175
523 3300026142 Ga0207698_10302685 Ga0207698_103026852 175
524 3300027866 Ga0209813_10010724 Ga0209813_100107242 175
525 3300028379 Ga0268266_10008616 Ga0268266_100086167 175
526 3300028563 Ga0265319_1030726 Ga0265319_10307261 175
527 3300028573 Ga0265334_10005800 Ga0265334_100058003 175
528 3300028577 Ga0265318_10012602 Ga0265318_100126021 175
529 3300028653 Ga0265323_10002871 Ga0265323_100028712 175
530 3300028654 Ga0265322_10049751 Ga0265322_100497512 175
531 3300028666 Ga0265336_10002816 Ga0265336_100028165 175
532 3300028800 Ga0265338_10000422 Ga0265338_1000042220 175
533 3300037471 Ga0395905_1009238 Ga0395905_1009238_180_707 175
534 3300037853 Ga0436364_0628911 Ga0436364_0628911_2381_2908 175
535 3300039437 Ga0436365_1567631 Ga0436365_1567631_12_560 175
536 3300046452 Ga0495617_208192 Ga0495617_208192_64_591 175
537 3300046455 Ga0495603_0025116 Ga0495603_0025116_483_1010 175
538 3300046460 Ga0495638_0068794 Ga0495638_0068794_64_591 175
539 3300046499 Ga0495594_0117110 Ga0495594_0117110_566_1093 175
540 3300046501 Ga0495607_0106803 Ga0495607_0106803_953_1480 175
541 3300046557 Ga0495622_0101650 Ga0495622_0101650_11_538 175
542 3300046663 Ga0495635_0073979 Ga0495635_0073979_103_630 175
543 3300046684 Ga0495669_0229042 Ga0495669_0229042_308_835 175
544 3300046690 Ga0495624_0096546 Ga0495624_0096546_31_558 175
545 3300047315 Ga0495581_0074821 Ga0495581_0074821_1379_1906 175
546 3300048910 Ga0496107_0315893 Ga0496107_0315893_623_1150 175
547 3300048922 Ga0496119_0162252 Ga0496119_0162252_635_1162 175
548 3300048924 Ga0496121_0296409 Ga0496121_0296409_496_1023 175
549 3300048928 Ga0496125_0392879 Ga0496125_0392879_33_560 175
550 3300048929 Ga0496126_0383439 Ga0496126_0383439_64_591 175
551 3300053096 Ga0500641_0125390 Ga0500641_0125390_568_1095 175
552 3300053730 Ga0500645_028937 Ga0500645_028937_454_981 175
553 3300001904 JGI24736J21556_1009058 JGI24736J21556_10090582 176
554 3300001990 JGI24737J22298_10067448 JGI24737J22298_100674481 176
555 3300002077 JGI24744J21845_10006651 JGI24744J21845_100066513 176
556 3300003203 JGI25406J46586_10154205 JGI25406J46586_101542051 176
557 3300003214 JGI25165J46597_1005291 JGI25165J46597_10052912 176
558 3300003215 JGI25153J46596_10005387 JGI25153J46596_100053874 176
559 3300003215 JGI25153J46596_10006271 JGI25153J46596_100062714 176
560 3300003215 JGI25153J46596_10006385 JGI25153J46596_100063854 176
561 3300003215 JGI25153J46596_10014578 JGI25153J46596_100145784 176
562 3300003215 JGI25153J46596_10042166 JGI25153J46596_100421662 176
563 3300003322 rootL2_10223649 rootL2_102236493 176
564 3300003354 JGI25160J50197_1002041 JGI25160J50197_10020412 176
565 3300003354 JGI25160J50197_1004384 JGI25160J50197_10043845 176
566 3300003354 JGI25160J50197_1005378 JGI25160J50197_10053785 176
567 3300003374 JGI25161J50226_1018010 JGI25161J50226_10180101 176
568 3300003659 JGI25404J52841_10000873 JGI25404J52841_100008733 176
569 3300003659 JGI25404J52841_10067389 JGI25404J52841_100673891 176
570 3300003659 JGI25404J52841_10106369 JGI25404J52841_101063691 176
571 3300003794 Ga0055531_10004632 Ga0055531_100046324 176
572 3300003794 Ga0055531_10027490 Ga0055531_100274902 176
573 3300004625 Ga0055543_1007172 Ga0055543_10071722 176
574 3300004625 Ga0055543_1026148 Ga0055543_10261482 176
575 3300005262 Ga0065165_1003775 Ga0065165_10037755 176
576 3300005262 Ga0065165_1003886 Ga0065165_10038867 176
577 3300005262 Ga0065165_1019062 Ga0065165_10190622 176
578 3300005327 Ga0070658_10291913 Ga0070658_102919132 176
579 3300005328 Ga0070676_10547942 Ga0070676_105479421 176
580 3300005330 Ga0070690_100099015 Ga0070690_1000990152 176
581 3300005331 Ga0070670_100525653 Ga0070670_1005256532 176
582 3300005334 Ga0068869_100031930 Ga0068869_1000319302 176
583 3300005334 Ga0068869_100401449 Ga0068869_1004014491 176
584 3300005334 Ga0068869_100433628 Ga0068869_1004336282 176
585 3300005335 Ga0070666_10322709 Ga0070666_103227092 176
586 3300005335 Ga0070666_10664934 Ga0070666_106649341 176
587 3300005337 Ga0070682_100240415 Ga0070682_1002404152 176
588 3300005338 Ga0068868_100162758 Ga0068868_1001627582 176
589 3300005338 Ga0068868_100435601 Ga0068868_1004356011 176
590 3300005338 Ga0068868_100614006 Ga0068868_1006140061 176
591 3300005338 Ga0068868_100981123 Ga0068868_1009811231 176
592 3300005338 Ga0068868_101352447 Ga0068868_1013524471 176
593 3300005339 Ga0070660_100505443 Ga0070660_1005054432 176
594 3300005340 Ga0070689_100143600 Ga0070689_1001436002 176
595 3300005343 Ga0070687_100653555 Ga0070687_1006535551 176
596 3300005344 Ga0070661_100268021 Ga0070661_1002680212 176
597 3300005347 Ga0070668_100052173 Ga0070668_1000521731 176
598 3300005347 Ga0070668_100080823 Ga0070668_1000808233 176
599 3300005347 Ga0070668_100092406 Ga0070668_1000924062 176
600 3300005347 Ga0070668_100093376 Ga0070668_1000933763 176
601 3300005347 Ga0070668_100146930 Ga0070668_1001469302 176
602 3300005347 Ga0070668_100226037 Ga0070668_1002260372 176
603 3300005347 Ga0070668_100461726 Ga0070668_1004617261 176
604 3300005353 Ga0070669_100196111 Ga0070669_1001961112 176
605 3300005354 Ga0070675_100174031 Ga0070675_1001740312 176
606 3300005354 Ga0070675_101051968 Ga0070675_1010519681 176
607 3300005355 Ga0070671_100457252 Ga0070671_1004572522 176
608 3300005355 Ga0070671_100577311 Ga0070671_1005773111 176
609 3300005356 Ga0070674_100286693 Ga0070674_1002866931 176
610 3300005356 Ga0070674_100476657 Ga0070674_1004766571 176
611 3300005356 Ga0070674_101173489 Ga0070674_1011734891 176
612 3300005364 Ga0070673_100288838 Ga0070673_1002888381 176
613 3300005364 Ga0070673_100459906 Ga0070673_1004599061 176
614 3300005364 Ga0070673_101509513 Ga0070673_1015095131 176
615 3300005365 Ga0070688_100937311 Ga0070688_1009373111 176
616 3300005366 Ga0070659_100129249 Ga0070659_1001292491 176
617 3300005366 Ga0070659_101040940 Ga0070659_1010409401 176
618 3300005367 Ga0070667_100184393 Ga0070667_1001843932 176
619 3300005435 Ga0070714_100116517 Ga0070714_1001165173 176
620 3300005436 Ga0070713_100004014 Ga0070713_1000040146 176
621 3300005438 Ga0070701_10438818 Ga0070701_104388181 176
622 3300005439 Ga0070711_100015539 Ga0070711_1000155394 176
623 3300005455 Ga0070663_100040755 Ga0070663_1000407552 176
624 3300005455 Ga0070663_100124021 Ga0070663_1001240212 176
625 3300005455 Ga0070663_100124757 Ga0070663_1001247572 176
626 3300005455 Ga0070663_100126633 Ga0070663_1001266332 176
627 3300005455 Ga0070663_100206905 Ga0070663_1002069052 176
628 3300005455 Ga0070663_100455756 Ga0070663_1004557561 176
629 3300005455 Ga0070663_100586840 Ga0070663_1005868402 176
630 3300005455 Ga0070663_100617546 Ga0070663_1006175462 176
631 3300005455 Ga0070663_100845157 Ga0070663_1008451571 176
632 3300005456 Ga0070678_100031271 Ga0070678_1000312713 176
633 3300005456 Ga0070678_100298265 Ga0070678_1002982652 176
634 3300005456 Ga0070678_100376863 Ga0070678_1003768632 176
635 3300005456 Ga0070678_100435374 Ga0070678_1004353742 176
636 3300005457 Ga0070662_100249738 Ga0070662_1002497382 176
637 3300005457 Ga0070662_100412757 Ga0070662_1004127572 176
638 3300005539 Ga0068853_100272640 Ga0068853_1002726402 176
639 3300005539 Ga0068853_100330786 Ga0068853_1003307862 176
640 3300005539 Ga0068853_100366307 Ga0068853_1003663072 176
641 3300005543 Ga0070672_100133626 Ga0070672_1001336261 176
642 3300005543 Ga0070672_100209828 Ga0070672_1002098282 176
643 3300005544 Ga0070686_100300815 Ga0070686_1003008152 176
644 3300005547 Ga0070693_100054359 Ga0070693_1000543592 176
645 3300005547 Ga0070693_100334448 Ga0070693_1003344481 176
646 3300005548 Ga0070665_100024388 Ga0070665_1000243885 176
647 3300005548 Ga0070665_100113273 Ga0070665_1001132732 176
648 3300005548 Ga0070665_100232557 Ga0070665_1002325572 176
649 3300005548 Ga0070665_100263835 Ga0070665_1002638352 176
650 3300005548 Ga0070665_100423701 Ga0070665_1004237012 176
651 3300005548 Ga0070665_100666282 Ga0070665_1006662821 176
652 3300005548 Ga0070665_101829538 Ga0070665_1018295381 176
653 3300005563 Ga0068855_100205366 Ga0068855_1002053662 176
654 3300005564 Ga0070664_100114656 Ga0070664_1001146563 176
655 3300005577 Ga0068857_100480307 Ga0068857_1004803071 176
656 3300005577 Ga0068857_100538843 Ga0068857_1005388431 176
657 3300005577 Ga0068857_100574455 Ga0068857_1005744552 176
658 3300005578 Ga0068854_100350862 Ga0068854_1003508623 176
659 3300005614 Ga0068856_100101992 Ga0068856_1001019925 176
660 3300005614 Ga0068856_100151979 Ga0068856_1001519792 176
661 3300005614 Ga0068856_100261863 Ga0068856_1002618632 176
662 3300005615 Ga0070702_100034991 Ga0070702_1000349912 176
663 3300005615 Ga0070702_100176664 Ga0070702_1001766641 176
664 3300005616 Ga0068852_100164356 Ga0068852_1001643561 176
665 3300005616 Ga0068852_100695221 Ga0068852_1006952212 176
666 3300005616 Ga0068852_100819838 Ga0068852_1008198382 176
667 3300005617 Ga0068859_100320351 Ga0068859_1003203512 176
668 3300005617 Ga0068859_100673693 Ga0068859_1006736931 176
669 3300005617 Ga0068859_100930930 Ga0068859_1009309302 176
670 3300005618 Ga0068864_100076165 Ga0068864_1000761652 176
671 3300005718 Ga0068866_10064783 Ga0068866_100647831 176
672 3300005718 Ga0068866_10154652 Ga0068866_101546522 176
673 3300005719 Ga0068861_100362861 Ga0068861_1003628611 176
674 3300005719 Ga0068861_100401389 Ga0068861_1004013892 176
675 3300005840 Ga0068870_10362037 Ga0068870_103620372 176
676 3300005841 Ga0068863_100572227 Ga0068863_1005722271 176
677 3300005841 Ga0068863_100585417 Ga0068863_1005854172 176
678 3300005841 Ga0068863_100687203 Ga0068863_1006872032 176
679 3300005842 Ga0068858_100241443 Ga0068858_1002414432 176
680 3300005842 Ga0068858_100292276 Ga0068858_1002922762 176
681 3300005842 Ga0068858_100326385 Ga0068858_1003263852 176
682 3300005842 Ga0068858_100414739 Ga0068858_1004147392 176
683 3300005842 Ga0068858_100504965 Ga0068858_1005049652 176
684 3300005842 Ga0068858_100514563 Ga0068858_1005145632 176
685 3300005843 Ga0068860_100253173 Ga0068860_1002531732 176
686 3300005843 Ga0068860_100443083 Ga0068860_1004430832 176
687 3300005844 Ga0068862_100086095 Ga0068862_1000860952 176
688 3300005937 Ga0081455_10016293 Ga0081455_100162934 176
689 3300005937 Ga0081455_10027264 Ga0081455_100272642 176
690 3300005937 Ga0081455_10169663 Ga0081455_101696632 176
691 3300005937 Ga0081455_10196830 Ga0081455_101968302 176
692 3300005937 Ga0081455_10209159 Ga0081455_102091592 176
693 3300005937 Ga0081455_10400114 Ga0081455_104001141 176
694 3300005983 Ga0081540_1004243 Ga0081540_10042435 176
695 3300005983 Ga0081540_1004583 Ga0081540_10045835 176
696 3300005983 Ga0081540_1006735 Ga0081540_10067352 176
697 3300005983 Ga0081540_1014469 Ga0081540_10144694 176
698 3300005983 Ga0081540_1018204 Ga0081540_10182044 176
699 3300005983 Ga0081540_1036177 Ga0081540_10361772 176
700 3300005983 Ga0081540_1049325 Ga0081540_10493252 176
701 3300005985 Ga0081539_10018231 Ga0081539_100182314 176
702 3300005985 Ga0081539_10143754 Ga0081539_101437541 176
703 3300006028 Ga0070717_10038762 Ga0070717_100387621 176
704 3300006028 Ga0070717_11219148 Ga0070717_112191481 176
705 3300006038 Ga0075365_10007995 Ga0075365_100079958 176
706 3300006038 Ga0075365_10044897 Ga0075365_100448972 176
707 3300006038 Ga0075365_10117749 Ga0075365_101177492 176
708 3300006038 Ga0075365_10171744 Ga0075365_101717442 176
709 3300006038 Ga0075365_10196786 Ga0075365_101967862 176
710 3300006038 Ga0075365_10264509 Ga0075365_102645092 176
711 3300006038 Ga0075365_10337125 Ga0075365_103371252 176
712 3300006042 Ga0075368_10014493 Ga0075368_100144932 176
713 3300006048 Ga0075363_100009480 Ga0075363_1000094804 176
714 3300006048 Ga0075363_100171579 Ga0075363_1001715791 176
715 3300006051 Ga0075364_10072888 Ga0075364_100728882 176
716 3300006051 Ga0075364_10096242 Ga0075364_100962422 176
717 3300006051 Ga0075364_10114904 Ga0075364_101149042 176
718 3300006051 Ga0075364_10170040 Ga0075364_101700402 176
719 3300006051 Ga0075364_10415813 Ga0075364_104158131 176
720 3300006163 Ga0070715_10086905 Ga0070715_100869052 176
721 3300006173 Ga0070716_100307856 Ga0070716_1003078562 176
722 3300006175 Ga0070712_100248984 Ga0070712_1002489842 176
723 3300006177 Ga0075362_10001063 Ga0075362_100010632 176
724 3300006177 Ga0075362_10093881 Ga0075362_100938812 176
725 3300006178 Ga0075367_10026606 Ga0075367_100266064 176
726 3300006178 Ga0075367_10066229 Ga0075367_100662291 176
727 3300006178 Ga0075367_10084792 Ga0075367_100847921 176
728 3300006178 Ga0075367_10128287 Ga0075367_101282872 176
729 3300006178 Ga0075367_10259502 Ga0075367_102595022 176
730 3300006178 Ga0075367_10376682 Ga0075367_103766821 176
731 3300006186 Ga0075369_10184077 Ga0075369_101840772 176
732 3300006186 Ga0075369_10424051 Ga0075369_104240511 176
733 3300006195 Ga0075366_10043941 Ga0075366_100439411 176
734 3300006195 Ga0075366_10065380 Ga0075366_100653802 176
735 3300006195 Ga0075366_10086496 Ga0075366_100864962 176
736 3300006195 Ga0075366_10106390 Ga0075366_101063902 176
737 3300006195 Ga0075366_10186447 Ga0075366_101864472 176
738 3300006195 Ga0075366_10231164 Ga0075366_102311641 176
739 3300006195 Ga0075366_10383996 Ga0075366_103839961 176
740 3300006195 Ga0075366_10455285 Ga0075366_104552851 176
741 3300006195 Ga0075366_10495048 Ga0075366_104950482 176
742 3300006353 Ga0075370_10029240 Ga0075370_100292403 176
743 3300006353 Ga0075370_10144561 Ga0075370_101445612 176
744 3300006353 Ga0075370_10202053 Ga0075370_102020531 176
745 3300006358 Ga0068871_100360992 Ga0068871_1003609922 176
746 3300006358 Ga0068871_101296814 Ga0068871_1012968141 176
747 3300006844 Ga0075428_100221744 Ga0075428_1002217442 176
748 3300006881 Ga0068865_100128766 Ga0068865_1001287662 176
749 3300006881 Ga0068865_100323303 Ga0068865_1003233032 176
750 3300006914 Ga0075436_100497088 Ga0075436_1004970881 176
751 3300006931 Ga0097620_100320365 Ga0097620_1003203652 176
752 3300006931 Ga0097620_100673723 Ga0097620_1006737232 176
753 3300006931 Ga0097620_100930904 Ga0097620_1009309042 176
754 3300006942 Ga0099824_1015237 Ga0099824_10152372 176
755 3300006943 Ga0099822_1035053 Ga0099822_10350533 176
756 3300007076 Ga0075435_100168984 Ga0075435_1001689842 176
757 3300007788 Ga0099795_10119526 Ga0099795_101195262 176
758 3300009011 Ga0105251_10189061 Ga0105251_101890611 176
759 3300009092 Ga0105250_10186222 Ga0105250_101862222 176
760 3300009092 Ga0105250_10401323 Ga0105250_104013231 176
761 3300009093 Ga0105240_10642954 Ga0105240_106429541 176
762 3300009093 Ga0105240_10758931 Ga0105240_107589312 176
763 3300009094 Ga0111539_10417181 Ga0111539_104171812 176
764 3300009098 Ga0105245_10306632 Ga0105245_103066322 176
765 3300009098 Ga0105245_10504544 Ga0105245_105045442 176
766 3300009101 Ga0105247_10131208 Ga0105247_101312082 176
767 3300009101 Ga0105247_10142907 Ga0105247_101429072 176
768 3300009101 Ga0105247_10167541 Ga0105247_101675412 176
769 3300009101 Ga0105247_10275874 Ga0105247_102758742 176
770 3300009147 Ga0114129_11026378 Ga0114129_110263782 176
771 3300009148 Ga0105243_10121232 Ga0105243_101212322 176
772 3300009148 Ga0105243_11260329 Ga0105243_112603291 176
773 3300009174 Ga0105241_10127058 Ga0105241_101270583 176
774 3300009174 Ga0105241_11041033 Ga0105241_110410331 176
775 3300009176 Ga0105242_10129766 Ga0105242_101297663 176
776 3300009176 Ga0105242_10215683 Ga0105242_102156832 176
777 3300009176 Ga0105242_11013291 Ga0105242_110132911 176
778 3300009176 Ga0105242_11025958 Ga0105242_110259581 176
779 3300009177 Ga0105248_10041030 Ga0105248_100410305 176
780 3300009177 Ga0105248_10220918 Ga0105248_102209182 176
781 3300009177 Ga0105248_10392667 Ga0105248_103926672 176
782 3300009177 Ga0105248_11057603 Ga0105248_110576031 176
783 3300009545 Ga0105237_10069275 Ga0105237_100692754 176
784 3300009545 Ga0105237_10142859 Ga0105237_101428593 176
785 3300009545 Ga0105237_10400005 Ga0105237_104000052 176
786 3300009545 Ga0105237_10443980 Ga0105237_104439802 176
787 3300009551 Ga0105238_10194243 Ga0105238_101942433 176
788 3300009551 Ga0105238_10215852 Ga0105238_102158523 176
789 3300009551 Ga0105238_10538750 Ga0105238_105387501 176
790 3300009551 Ga0105238_10563306 Ga0105238_105633062 176
791 3300009551 Ga0105238_10583601 Ga0105238_105836012 176
792 3300009551 Ga0105238_11456335 Ga0105238_114563351 176
793 3300009553 Ga0105249_10059548 Ga0105249_100595482 176
794 3300009553 Ga0105249_10149581 Ga0105249_101495812 176
795 3300009553 Ga0105249_10432199 Ga0105249_104321991 176
796 3300009553 Ga0105249_11609445 Ga0105249_116094452 176
797 3300010159 Ga0099796_10141877 Ga0099796_101418771 176
798 3300010375 Ga0105239_10066302 Ga0105239_100663022 176
799 3300010375 Ga0105239_10343708 Ga0105239_103437082 176
800 3300010375 Ga0105239_10495695 Ga0105239_104956951 176
801 3300010375 Ga0105239_10509286 Ga0105239_105092862 176
802 3300010375 Ga0105239_10572339 Ga0105239_105723392 176
803 3300010375 Ga0105239_10996996 Ga0105239_109969961 176
804 3300011119 Ga0105246_10040758 Ga0105246_100407582 176
805 3300011119 Ga0105246_10239352 Ga0105246_102393521 176
806 3300011119 Ga0105246_10374335 Ga0105246_103743352 176
807 3300013296 Ga0157374_10255525 Ga0157374_102555252 176
808 3300013296 Ga0157374_10270162 Ga0157374_102701622 176
809 3300013296 Ga0157374_10838057 Ga0157374_108380572 176
810 3300013297 Ga0157378_10070174 Ga0157378_100701744 176
811 3300013297 Ga0157378_10233186 Ga0157378_102331863 176
812 3300013297 Ga0157378_10444310 Ga0157378_104443102 176
813 3300013297 Ga0157378_10466163 Ga0157378_104661631 176
814 3300013297 Ga0157378_10714024 Ga0157378_107140241 176
815 3300013306 Ga0163162_10211259 Ga0163162_102112591 176
816 3300013306 Ga0163162_10413485 Ga0163162_104134852 176
817 3300013306 Ga0163162_10413874 Ga0163162_104138742 176
818 3300013306 Ga0163162_10743862 Ga0163162_107438621 176
819 3300013306 Ga0163162_10824995 Ga0163162_108249951 176
820 3300013308 Ga0157375_10217414 Ga0157375_102174142 176
821 3300013308 Ga0157375_10783766 Ga0157375_107837662 176
822 3300013308 Ga0157375_11227028 Ga0157375_112270281 176
823 3300014325 Ga0163163_10028423 Ga0163163_100284233 176
824 3300014325 Ga0163163_10133712 Ga0163163_101337123 176
825 3300014325 Ga0163163_10690854 Ga0163163_106908542 176
826 3300014325 Ga0163163_10899950 Ga0163163_108999501 176
827 3300014325 Ga0163163_11046276 Ga0163163_110462761 176
828 3300014326 Ga0157380_10114201 Ga0157380_101142011 176
829 3300014326 Ga0157380_10239624 Ga0157380_102396242 176
830 3300014326 Ga0157380_10873498 Ga0157380_108734982 176
831 3300014326 Ga0157380_11253403 Ga0157380_112534031 176
832 3300014745 Ga0157377_10207455 Ga0157377_102074552 176
833 3300014745 Ga0157377_10295538 Ga0157377_102955382 176
834 3300014968 Ga0157379_10289247 Ga0157379_102892472 176
835 3300014968 Ga0157379_10381779 Ga0157379_103817791 176
836 3300014968 Ga0157379_10707919 Ga0157379_107079191 176
837 3300014969 Ga0157376_10163532 Ga0157376_101635322 176
838 3300014969 Ga0157376_10166023 Ga0157376_101660232 176
839 3300014969 Ga0157376_11292722 Ga0157376_112927221 176
840 3300017792 Ga0163161_10072163 Ga0163161_100721633 176
841 3300017792 Ga0163161_10265581 Ga0163161_102655812 176
842 3300021384 Ga0213876_10249333 Ga0213876_102493332 176
843 3300021388 Ga0213875_10395076 Ga0213875_103950761 176
844 3300025230 Ga0209563_105793 Ga0209563_1057933 176
845 3300025253 Ga0209677_105710 Ga0209677_1057102 176
846 3300025261 Ga0209233_1055178 Ga0209233_10551781 176
847 3300025272 Ga0209455_1008110 Ga0209455_10081102 176
848 3300025273 Ga0209673_1032099 Ga0209673_10320992 176
849 3300025295 Ga0209564_1007238 Ga0209564_10072385 176
850 3300025295 Ga0209564_1015758 Ga0209564_10157582 176
851 3300025297 Ga0209758_1000069 Ga0209758_1000069250 176
852 3300025297 Ga0209758_1001816 Ga0209758_10018166 176
853 3300025297 Ga0209758_1003717 Ga0209758_10037175 176
854 3300025297 Ga0209758_1006696 Ga0209758_10066966 176
855 3300025297 Ga0209758_1007298 Ga0209758_10072985 176
856 3300025297 Ga0209758_1039944 Ga0209758_10399442 176
857 3300025297 Ga0209758_1041471 Ga0209758_10414712 176
858 3300025297 Ga0209758_1053011 Ga0209758_10530112 176
859 3300025297 Ga0209758_1057118 Ga0209758_10571182 176
860 3300025297 Ga0209758_1102552 Ga0209758_11025522 176
861 3300025297 Ga0209758_1119004 Ga0209758_11190041 176
862 3300025298 Ga0209050_1074670 Ga0209050_10746701 176
863 3300025299 Ga0209256_1005844 Ga0209256_10058444 176
864 3300025299 Ga0209256_1016629 Ga0209256_10166292 176
865 3300025299 Ga0209256_1034701 Ga0209256_10347012 176
866 3300025299 Ga0209256_1056171 Ga0209256_10561712 176
867 3300025302 Ga0207426_1001802 Ga0207426_10018027 176
868 3300025302 Ga0207426_1004864 Ga0207426_10048644 176
869 3300025302 Ga0207426_1027673 Ga0207426_10276732 176
870 3300025304 Ga0209257_1004375 Ga0209257_10043755 176
871 3300025304 Ga0209257_1020602 Ga0209257_10206022 176
872 3300025315 Ga0207697_10087462 Ga0207697_100874622 176
873 3300025315 Ga0207697_10474344 Ga0207697_104743441 176
874 3300025321 Ga0207656_10081557 Ga0207656_100815572 176
875 3300025899 Ga0207642_10336808 Ga0207642_103368082 176
876 3300025900 Ga0207710_10062593 Ga0207710_100625932 176
877 3300025900 Ga0207710_10077845 Ga0207710_100778452 176
878 3300025901 Ga0207688_10148840 Ga0207688_101488402 176
879 3300025901 Ga0207688_10205271 Ga0207688_102052712 176
880 3300025904 Ga0207647_10009168 Ga0207647_100091682 176
881 3300025904 Ga0207647_10138451 Ga0207647_101384511 176
882 3300025907 Ga0207645_10082783 Ga0207645_100827832 176
883 3300025907 Ga0207645_10214197 Ga0207645_102141972 176
884 3300025908 Ga0207643_10047401 Ga0207643_100474012 176
885 3300025908 Ga0207643_10214645 Ga0207643_102146451 176
886 3300025908 Ga0207643_10274946 Ga0207643_102749461 176
887 3300025909 Ga0207705_10175451 Ga0207705_101754512 176
888 3300025911 Ga0207654_10024270 Ga0207654_100242704 176
889 3300025911 Ga0207654_10411346 Ga0207654_104113461 176
890 3300025913 Ga0207695_10320248 Ga0207695_103202482 176
891 3300025914 Ga0207671_10038928 Ga0207671_100389282 176
892 3300025914 Ga0207671_10480717 Ga0207671_104807172 176
893 3300025915 Ga0207693_10077119 Ga0207693_100771192 176
894 3300025916 Ga0207663_10171760 Ga0207663_101717602 176
895 3300025919 Ga0207657_10209041 Ga0207657_102090411 176
896 3300025919 Ga0207657_10464155 Ga0207657_104641552 176
897 3300025919 Ga0207657_10493126 Ga0207657_104931262 176
898 3300025920 Ga0207649_10267205 Ga0207649_102672052 176
899 3300025920 Ga0207649_10617338 Ga0207649_106173382 176
900 3300025923 Ga0207681_10070638 Ga0207681_100706381 176
901 3300025923 Ga0207681_10827855 Ga0207681_108278551 176
902 3300025924 Ga0207694_10199050 Ga0207694_101990502 176
903 3300025924 Ga0207694_10410858 Ga0207694_104108582 176
904 3300025924 Ga0207694_10777121 Ga0207694_107771211 176
905 3300025924 Ga0207694_10946197 Ga0207694_109461971 176
906 3300025925 Ga0207650_10651439 Ga0207650_106514392 176
907 3300025925 Ga0207650_11376228 Ga0207650_113762281 176
908 3300025926 Ga0207659_10281115 Ga0207659_102811152 176
909 3300025926 Ga0207659_10407214 Ga0207659_104072142 176
910 3300025927 Ga0207687_10022504 Ga0207687_100225044 176
911 3300025927 Ga0207687_10710600 Ga0207687_107106001 176
912 3300025928 Ga0207700_10004601 Ga0207700_100046016 176
913 3300025929 Ga0207664_10172365 Ga0207664_101723652 176
914 3300025931 Ga0207644_10224481 Ga0207644_102244812 176
915 3300025931 Ga0207644_10396134 Ga0207644_103961342 176
916 3300025931 Ga0207644_10579870 Ga0207644_105798701 176
917 3300025932 Ga0207690_10146061 Ga0207690_101460612 176
918 3300025932 Ga0207690_10504883 Ga0207690_105048832 176
919 3300025932 Ga0207690_10716679 Ga0207690_107166791 176
920 3300025933 Ga0207706_10291959 Ga0207706_102919592 176
921 3300025933 Ga0207706_10298695 Ga0207706_102986952 176
922 3300025933 Ga0207706_10510052 Ga0207706_105100522 176
923 3300025933 Ga0207706_10798769 Ga0207706_107987691 176
924 3300025934 Ga0207686_10215785 Ga0207686_102157852 176
925 3300025934 Ga0207686_10338281 Ga0207686_103382812 176
926 3300025934 Ga0207686_10468151 Ga0207686_104681511 176
927 3300025934 Ga0207686_10668772 Ga0207686_106687721 176
928 3300025935 Ga0207709_10085394 Ga0207709_100853942 176
929 3300025935 Ga0207709_10396460 Ga0207709_103964602 176
930 3300025936 Ga0207670_10411581 Ga0207670_104115812 176
931 3300025937 Ga0207669_10060896 Ga0207669_100608961 176
932 3300025937 Ga0207669_10149698 Ga0207669_101496981 176
933 3300025937 Ga0207669_10352590 Ga0207669_103525902 176
934 3300025937 Ga0207669_10577417 Ga0207669_105774171 176
935 3300025938 Ga0207704_10293428 Ga0207704_102934281 176
936 3300025938 Ga0207704_10421295 Ga0207704_104212952 176
937 3300025939 Ga0207665_10406552 Ga0207665_104065522 176
938 3300025940 Ga0207691_10045505 Ga0207691_100455052 176
939 3300025940 Ga0207691_10094759 Ga0207691_100947593 176
940 3300025940 Ga0207691_10375552 Ga0207691_103755522 176
941 3300025941 Ga0207711_10068416 Ga0207711_100684162 176
942 3300025941 Ga0207711_10236862 Ga0207711_102368622 176
943 3300025941 Ga0207711_10589281 Ga0207711_105892812 176
944 3300025942 Ga0207689_10012963 Ga0207689_100129635 176
945 3300025942 Ga0207689_10143353 Ga0207689_101433532 176
946 3300025942 Ga0207689_10213806 Ga0207689_102138062 176
947 3300025945 Ga0207679_10386125 Ga0207679_103861251 176
948 3300025945 Ga0207679_10962248 Ga0207679_109622482 176
949 3300025949 Ga0207667_10289550 Ga0207667_102895502 176
950 3300025961 Ga0207712_10040689 Ga0207712_100406894 176
951 3300025961 Ga0207712_10624128 Ga0207712_106241281 176
952 3300025972 Ga0207668_10048924 Ga0207668_100489242 176
953 3300025972 Ga0207668_10160677 Ga0207668_101606772 176
954 3300025972 Ga0207668_10225530 Ga0207668_102255302 176
955 3300025972 Ga0207668_10301972 Ga0207668_103019722 176
956 3300025972 Ga0207668_10510058 Ga0207668_105100582 176
957 3300025972 Ga0207668_10756753 Ga0207668_107567531 176
958 3300025981 Ga0207640_10284234 Ga0207640_102842341 176
959 3300025986 Ga0207658_10066181 Ga0207658_100661812 176
960 3300025986 Ga0207658_10138311 Ga0207658_101383112 176
961 3300025986 Ga0207658_10229032 Ga0207658_102290322 176
962 3300026023 Ga0207677_10232224 Ga0207677_102322241 176
963 3300026023 Ga0207677_10247489 Ga0207677_102474892 176
964 3300026023 Ga0207677_11152790 Ga0207677_111527901 176
965 3300026035 Ga0207703_10333753 Ga0207703_103337532 176
966 3300026035 Ga0207703_11350834 Ga0207703_113508341 176
967 3300026041 Ga0207639_10516100 Ga0207639_105161001 176
968 3300026067 Ga0207678_10097135 Ga0207678_100971352 176
969 3300026067 Ga0207678_10105038 Ga0207678_101050382 176
970 3300026067 Ga0207678_10110740 Ga0207678_101107402 176
971 3300026067 Ga0207678_10121192 Ga0207678_101211923 176
972 3300026067 Ga0207678_10543179 Ga0207678_105431792 176
973 3300026067 Ga0207678_10893466 Ga0207678_108934662 176
974 3300026067 Ga0207678_10975680 Ga0207678_109756801 176
975 3300026075 Ga0207708_10216595 Ga0207708_102165951 176
976 3300026078 Ga0207702_10306634 Ga0207702_103066342 176
977 3300026078 Ga0207702_10314000 Ga0207702_103140001 176
978 3300026078 Ga0207702_11714122 Ga0207702_117141221 176
979 3300026088 Ga0207641_10518813 Ga0207641_105188132 176
980 3300026088 Ga0207641_10586085 Ga0207641_105860852 176
981 3300026088 Ga0207641_11322477 Ga0207641_113224771 176
982 3300026089 Ga0207648_10171204 Ga0207648_101712041 176
983 3300026089 Ga0207648_11101054 Ga0207648_111010541 176
984 3300026095 Ga0207676_10261998 Ga0207676_102619982 176
985 3300026095 Ga0207676_10657127 Ga0207676_106571272 176
986 3300026116 Ga0207674_10307071 Ga0207674_103070711 176
987 3300026118 Ga0207675_100124474 Ga0207675_1001244742 176
988 3300026118 Ga0207675_100326301 Ga0207675_1003263011 176
989 3300026118 Ga0207675_100332410 Ga0207675_1003324102 176
990 3300026118 Ga0207675_100600992 Ga0207675_1006009922 176
991 3300026118 Ga0207675_100928190 Ga0207675_1009281901 176
992 3300026121 Ga0207683_10115817 Ga0207683_101158173 176
993 3300026121 Ga0207683_10167729 Ga0207683_101677293 176
994 3300026121 Ga0207683_10173569 Ga0207683_101735692 176
995 3300026121 Ga0207683_10466989 Ga0207683_104669892 176
996 3300026142 Ga0207698_10724072 Ga0207698_107240722 176
997 3300027296 Ga0209389_1000102 Ga0209389_100010251 176
998 3300027296 Ga0209389_1000142 Ga0209389_100014244 176
999 3300027357 Ga0209589_1000331 Ga0209589_100033144 176
1000 3300027361 Ga0209489_100404 Ga0209489_10040451 176
1001 3300027361 Ga0209489_100818 Ga0209489_10081844 176
1002 3300027363 Ga0209700_100408 Ga0209700_10040851 176
1003 3300027512 Ga0209179_1111495 Ga0209179_11114951 176
1004 3300027866 Ga0209813_10008392 Ga0209813_100083922 176
1005 3300027907 Ga0207428_10223601 Ga0207428_102236011 176
1006 3300028379 Ga0268266_10028293 Ga0268266_100282934 176
1007 3300028379 Ga0268266_10048797 Ga0268266_100487974 176
1008 3300028379 Ga0268266_10399636 Ga0268266_103996361 176
1009 3300028379 Ga0268266_11523558 Ga0268266_115235581 176
1010 3300028380 Ga0268265_10014031 Ga0268265_100140312 176
1011 3300028380 Ga0268265_10102999 Ga0268265_101029991 176
1012 3300028380 Ga0268265_10183395 Ga0268265_101833952 176
1013 3300028380 Ga0268265_10474181 Ga0268265_104741811 176
1014 3300028380 Ga0268265_10480658 Ga0268265_104806582 176
1015 3300028380 Ga0268265_10569855 Ga0268265_105698551 176
1016 3300028381 Ga0268264_10050935 Ga0268264_100509353 176
1017 3300028381 Ga0268264_11297118 Ga0268264_112971181 176
1018 3300028381 Ga0268264_11324678 Ga0268264_113246781 176
1019 3300028786 Ga0307517_10000232 Ga0307517_1000023228 176
1020 3300028786 Ga0307517_10328450 Ga0307517_103284501 176
1021 3300028794 Ga0307515_10050080 Ga0307515_100500802 176
1022 3300031090 Ga0265760_10026912 Ga0265760_100269122 176
1023 3300031456 Ga0307513_10189662 Ga0307513_101896622 176
1024 3300031456 Ga0307513_10358722 Ga0307513_103587222 176
1025 3300031507 Ga0307509_10844940 Ga0307509_108449401 176
1026 3300031548 Ga0307408_100107648 Ga0307408_1001076482 176
1027 3300031548 Ga0307408_100520348 Ga0307408_1005203481 176
1028 3300031548 Ga0307408_101142355 Ga0307408_1011423551 176
1029 3300031616 Ga0307508_10039596 Ga0307508_100395964 176
1030 3300031616 Ga0307508_10553899 Ga0307508_105538991 176
1031 3300031730 Ga0307516_10078366 Ga0307516_100783662 176
1032 3300031730 Ga0307516_10078911 Ga0307516_100789114 176
1033 3300031730 Ga0307516_10186022 Ga0307516_101860223 176
1034 3300031730 Ga0307516_10238958 Ga0307516_102389582 176
1035 3300031730 Ga0307516_10445321 Ga0307516_104453212 176
1036 3300031824 Ga0307413_10046715 Ga0307413_100467152 176
1037 3300031824 Ga0307413_10189102 Ga0307413_101891022 176
1038 3300031852 Ga0307410_10467545 Ga0307410_104675452 176
1039 3300031901 Ga0307406_10138092 Ga0307406_101380922 176
1040 3300031901 Ga0307406_10225754 Ga0307406_102257542 176
1041 3300031901 Ga0307406_10268796 Ga0307406_102687962 176
1042 3300031903 Ga0307407_10396216 Ga0307407_103962162 176
1043 3300031911 Ga0307412_10209929 Ga0307412_102099292 176
1044 3300031995 Ga0307409_100739361 Ga0307409_1007393612 176
1045 3300032002 Ga0307416_100123117 Ga0307416_1001231173 176
1046 3300032002 Ga0307416_100248362 Ga0307416_1002483622 176
1047 3300032002 Ga0307416_100349319 Ga0307416_1003493192 176
1048 3300032126 Ga0307415_100050805 Ga0307415_1000508053 176
1049 3300032126 Ga0307415_100233049 Ga0307415_1002330492 176
1050 3300033180 Ga0307510_10005192 Ga0307510_1000519212 176
1051 3300033180 Ga0307510_10036976 Ga0307510_100369764 176
1052 3300035113 Ga0373936_0168922 Ga0373936_0168922_151_681 176
1053 3300035121 Ga0373960_0280982 Ga0373960_0280982_44_574 176
1054 3300035207 Ga0373942_0256780 Ga0373942_0256780_43_573 176
1055 3300035410 Ga0373924_0427177 Ga0373924_0427177_39_569 176
1056 3300035691 Ga0373931_0090396 Ga0373931_0090396_1053_1583 176
1057 3300035691 Ga0373931_0368580 Ga0373931_0368580_245_775 176
1058 3300035725 Ga0373947_0026772 Ga0373947_0026772_1759_2289 176
1059 3300037068 Ga0373925_0008418 Ga0373925_0008418_2002_2532 176
1060 3300037418 Ga0395900_0000423 Ga0395900_0000423_43205_43735 176
1061 3300037466 Ga0395898_0010460 Ga0395898_0010460_4262_4792 176
1062 3300037471 Ga0395905_0092357 Ga0395905_0092357_2107_2637 176
1063 3300037471 Ga0395905_0277344 Ga0395905_0277344_162_692 176
1064 3300037471 Ga0395905_1089476 Ga0395905_1089476_121_651 176
1065 3300037853 Ga0436364_1523184 Ga0436364_1523184_527_1057 176
1066 3300039437 Ga0436365_1254305 Ga0436365_1254305_2202_2732 176
1067 3300041451 Ga0451791_0396477 Ga0451791_0396477_190_720 176
1068 3300041452 Ga0451793_1501710 Ga0451793_1501710_190_747 176
1069 3300041453 Ga0451797_0957375 Ga0451797_0957375_407_952 176
1070 3300041460 Ga0451802_1930506 Ga0451802_1930506_572_1102 176
1071 3300041463 Ga0451804_0020778 Ga0451804_0020778_83_613 176
1072 3300041498 Ga0451841_1340266 Ga0451841_1340266_255_785 176
1073 3300041505 Ga0451849_0890308 Ga0451849_0890308_112_642 176
1074 3300041511 Ga0451855_0310176 Ga0451855_0310176_46_576 176
1075 3300041512 Ga0451853_0527059 Ga0451853_0527059_11_541 176
1076 3300042005 Ga0439448_0193791 Ga0439448_0193791_76_606 176
1077 3300042438 Ga0439459_0006680 Ga0439459_0006680_1031_1561 176
1078 3300042438 Ga0439459_0034763 Ga0439459_0034763_89_619 176
1079 3300044658 Ga0466972_0047042 Ga0466972_0047042_1234_1764 176
1080 3300044684 Ga0466966_0000628 Ga0466966_0000628_4790_5320 176
1081 3300044693 Ga0466961_0002516 Ga0466961_0002516_6451_6981 176
1082 3300044765 Ga0466970_0047275 Ga0466970_0047275_303_833 176
1083 3300044901 Ga0466960_0073114 Ga0466960_0073114_76_606 176
1084 3300044901 Ga0466960_0485017 Ga0466960_0485017_153_683 176
1085 3300045049 Ga0466959_0033457 Ga0466959_0033457_1080_1610 176
1086 3300046452 Ga0495617_035848 Ga0495617_035848_324_854 176
1087 3300046452 Ga0495617_040028 Ga0495617_040028_809_1339 176
1088 3300046454 Ga0495592_0029657 Ga0495592_0029657_2519_3049 176
1089 3300046454 Ga0495592_0143017 Ga0495592_0143017_801_1331 176
1090 3300046455 Ga0495603_0014727 Ga0495603_0014727_2795_3325 176
1091 3300046455 Ga0495603_0024867 Ga0495603_0024867_2887_3450 176
1092 3300046455 Ga0495603_0113161 Ga0495603_0113161_562_1092 176
1093 3300046457 Ga0495590_0027483 Ga0495590_0027483_210_740 176
1094 3300046459 Ga0495629_0003103 Ga0495629_0003103_7930_8460 176
1095 3300046459 Ga0495629_0182713 Ga0495629_0182713_42_572 176
1096 3300046459 Ga0495629_0335352 Ga0495629_0335352_421_951 176
1097 3300046460 Ga0495638_0215046 Ga0495638_0215046_66_596 176
1098 3300046461 Ga0495641_0033486 Ga0495641_0033486_849_1379 176
1099 3300046462 Ga0495651_0008730 Ga0495651_0008730_2276_2806 176
1100 3300046462 Ga0495651_0110186 Ga0495651_0110186_1243_1773 176
1101 3300046462 Ga0495651_0328589 Ga0495651_0328589_280_810 176
1102 3300046463 Ga0495653_0050804 Ga0495653_0050804_2573_3103 176
1103 3300046471 Ga0495650_0090423 Ga0495650_0090423_93_623 176
1104 3300046472 Ga0495580_0236049 Ga0495580_0236049_208_738 176
1105 3300046474 Ga0495605_0050188 Ga0495605_0050188_1430_1960 176
1106 3300046474 Ga0495605_0103601 Ga0495605_0103601_597_1127 176
1107 3300046477 Ga0495664_0015202 Ga0495664_0015202_892_1422 176
1108 3300046477 Ga0495664_0137848 Ga0495664_0137848_338_868 176
1109 3300046491 Ga0495584_0129680 Ga0495584_0129680_599_1129 176
1110 3300046491 Ga0495584_0131185 Ga0495584_0131185_141_671 176
1111 3300046491 Ga0495584_0307972 Ga0495584_0307972_247_777 176
1112 3300046491 Ga0495584_0402809 Ga0495584_0402809_116_646 176
1113 3300046492 Ga0495585_0036674 Ga0495585_0036674_420_950 176
1114 3300046492 Ga0495585_0112731 Ga0495585_0112731_164_694 176
1115 3300046500 Ga0495596_0035053 Ga0495596_0035053_895_1425 176
1116 3300046500 Ga0495596_0077695 Ga0495596_0077695_114_644 176
1117 3300046506 Ga0495583_0060950 Ga0495583_0060950_531_1061 176
1118 3300046506 Ga0495583_0322073 Ga0495583_0322073_44_574 176
1119 3300046507 Ga0495606_0034214 Ga0495606_0034214_2101_2631 176
1120 3300046507 Ga0495606_0102033 Ga0495606_0102033_270_800 176
1121 3300046507 Ga0495606_0264218 Ga0495606_0264218_257_787 176
1122 3300046507 Ga0495606_0312184 Ga0495606_0312184_302_832 176
1123 3300046507 Ga0495606_0403479 Ga0495606_0403479_30_560 176
1124 3300046507 Ga0495606_0452802 Ga0495606_0452802_87_617 176
1125 3300046511 Ga0495608_0080255 Ga0495608_0080255_1164_1694 176
1126 3300046512 Ga0495610_0107052 Ga0495610_0107052_686_1216 176
1127 3300046512 Ga0495610_0124279 Ga0495610_0124279_70_600 176
1128 3300046513 Ga0495616_0026546 Ga0495616_0026546_505_1035 176
1129 3300046515 Ga0495620_0055847 Ga0495620_0055847_171_701 176
1130 3300046515 Ga0495620_0175927 Ga0495620_0175927_274_804 176
1131 3300046515 Ga0495620_0239742 Ga0495620_0239742_116_646 176
1132 3300046515 Ga0495620_0284325 Ga0495620_0284325_59_589 176
1133 3300046516 Ga0495628_0079992 Ga0495628_0079992_215_745 176
1134 3300046517 Ga0495630_0147147 Ga0495630_0147147_994_1524 176
1135 3300046518 Ga0495631_0096176 Ga0495631_0096176_550_1080 176
1136 3300046518 Ga0495631_0118301 Ga0495631_0118301_106_669 176
1137 3300046518 Ga0495631_0162016 Ga0495631_0162016_102_632 176
1138 3300046518 Ga0495631_0222239 Ga0495631_0222239_149_688 176
1139 3300046519 Ga0495632_0096886 Ga0495632_0096886_750_1280 176
1140 3300046519 Ga0495632_0278902 Ga0495632_0278902_77_607 176
1141 3300046520 Ga0495637_0074429 Ga0495637_0074429_387_917 176
1142 3300046522 Ga0495643_0118009 Ga0495643_0118009_53_583 176
1143 3300046522 Ga0495643_0124891 Ga0495643_0124891_743_1273 176
1144 3300046522 Ga0495643_0198153 Ga0495643_0198153_297_827 176
1145 3300046523 Ga0495644_0026767 Ga0495644_0026767_1362_1892 176
1146 3300046523 Ga0495644_0068917 Ga0495644_0068917_562_1092 176
1147 3300046523 Ga0495644_0104544 Ga0495644_0104544_99_662 176
1148 3300046524 Ga0495648_0055289 Ga0495648_0055289_398_928 176
1149 3300046524 Ga0495648_0144527 Ga0495648_0144527_177_707 176
1150 3300046524 Ga0495648_0167446 Ga0495648_0167446_148_678 176
1151 3300046524 Ga0495648_0385547 Ga0495648_0385547_66_596 176
1152 3300046526 Ga0495666_0067929 Ga0495666_0067929_1028_1558 176
1153 3300046528 Ga0495642_0139880 Ga0495642_0139880_180_743 176
1154 3300046529 Ga0495652_0020755 Ga0495652_0020755_4714_5244 176
1155 3300046529 Ga0495652_0191690 Ga0495652_0191690_635_1165 176
1156 3300046529 Ga0495652_0538472 Ga0495652_0538472_207_737 176
1157 3300046531 Ga0495665_0223245 Ga0495665_0223245_135_698 176
1158 3300046533 Ga0495640_0095555 Ga0495640_0095555_262_792 176
1159 3300046533 Ga0495640_0255127 Ga0495640_0255127_435_965 176
1160 3300046536 Ga0495587_0063598 Ga0495587_0063598_386_916 176
1161 3300046537 Ga0495598_0016310 Ga0495598_0016310_1002_1565 176
1162 3300046537 Ga0495598_0098282 Ga0495598_0098282_363_893 176
1163 3300046538 Ga0495609_0043359 Ga0495609_0043359_383_952 176
1164 3300046538 Ga0495609_0067067 Ga0495609_0067067_892_1437 176
1165 3300046538 Ga0495609_0207978 Ga0495609_0207978_206_736 176
1166 3300046538 Ga0495609_0217489 Ga0495609_0217489_84_614 176
1167 3300046539 Ga0495621_0150103 Ga0495621_0150103_372_902 176
1168 3300046542 Ga0495597_0018060 Ga0495597_0018060_1847_2377 176
1169 3300046542 Ga0495597_0125685 Ga0495597_0125685_259_789 176
1170 3300046557 Ga0495622_0031861 Ga0495622_0031861_991_1521 176
1171 3300046557 Ga0495622_0032621 Ga0495622_0032621_610_1173 176
1172 3300046557 Ga0495622_0107212 Ga0495622_0107212_494_1063 176
1173 3300046558 Ga0495633_0090609 Ga0495633_0090609_828_1391 176
1174 3300046559 Ga0495667_0008501 Ga0495667_0008501_1821_2351 176
1175 3300046559 Ga0495667_0697603 Ga0495667_0697603_40_570 176
1176 3300046615 Ga0495656_0007208 Ga0495656_0007208_2796_3326 176
1177 3300046615 Ga0495656_0019568 Ga0495656_0019568_104_634 176
1178 3300046615 Ga0495656_0057557 Ga0495656_0057557_487_1050 176
1179 3300046615 Ga0495656_0086279 Ga0495656_0086279_370_900 176
1180 3300046615 Ga0495656_0341476 Ga0495656_0341476_142_711 176
1181 3300046616 Ga0495668_0013886 Ga0495668_0013886_1331_1861 176
1182 3300046616 Ga0495668_0106847 Ga0495668_0106847_586_1116 176
1183 3300046616 Ga0495668_0185513 Ga0495668_0185513_537_1067 176
1184 3300046616 Ga0495668_0225484 Ga0495668_0225484_297_827 176
1185 3300046616 Ga0495668_0251215 Ga0495668_0251215_330_860 176
1186 3300046616 Ga0495668_0513438 Ga0495668_0513438_24_554 176
1187 3300046642 Ga0495634_0360494 Ga0495634_0360494_257_787 176
1188 3300046648 Ga0495611_0069655 Ga0495611_0069655_740_1270 176
1189 3300046648 Ga0495611_0109377 Ga0495611_0109377_190_720 176
1190 3300046648 Ga0495611_0154025 Ga0495611_0154025_82_612 176
1191 3300046660 Ga0495625_0109767 Ga0495625_0109767_740_1270 176
1192 3300046660 Ga0495625_0159799 Ga0495625_0159799_919_1449 176
1193 3300046660 Ga0495625_0389022 Ga0495625_0389022_28_558 176
1194 3300046660 Ga0495625_0677335 Ga0495625_0677335_54_584 176
1195 3300046663 Ga0495635_0006671 Ga0495635_0006671_3786_4316 176
1196 3300046664 Ga0495659_0002107 Ga0495659_0002107_2185_2715 176
1197 3300046664 Ga0495659_0029020 Ga0495659_0029020_117_647 176
1198 3300046664 Ga0495659_0125976 Ga0495659_0125976_435_998 176
1199 3300046665 Ga0495661_0041610 Ga0495661_0041610_1778_2308 176
1200 3300046665 Ga0495661_0128554 Ga0495661_0128554_13_576 176
1201 3300046665 Ga0495661_0200602 Ga0495661_0200602_424_954 176
1202 3300046674 Ga0495588_0008571 Ga0495588_0008571_25_555 176
1203 3300046674 Ga0495588_0128553 Ga0495588_0128553_659_1189 176
1204 3300046674 Ga0495588_0234405 Ga0495588_0234405_338_868 176
1205 3300046675 Ga0495657_0005477 Ga0495657_0005477_3025_3555 176
1206 3300046675 Ga0495657_0032801 Ga0495657_0032801_61_591 176
1207 3300046679 Ga0495623_0010119 Ga0495623_0010119_2426_2956 176
1208 3300046680 Ga0495646_0026987 Ga0495646_0026987_2537_3067 176
1209 3300046684 Ga0495669_0054908 Ga0495669_0054908_984_1514 176
1210 3300046684 Ga0495669_0088458 Ga0495669_0088458_418_948 176
1211 3300046684 Ga0495669_0185413 Ga0495669_0185413_340_870 176
1212 3300046684 Ga0495669_0318477 Ga0495669_0318477_179_709 176
1213 3300046689 Ga0495613_0234957 Ga0495613_0234957_453_983 176
1214 3300046689 Ga0495613_0674964 Ga0495613_0674964_113_643 176
1215 3300046690 Ga0495624_0226423 Ga0495624_0226423_213_743 176
1216 3300046690 Ga0495624_0290436 Ga0495624_0290436_319_849 176
1217 3300046691 Ga0495670_0063562 Ga0495670_0063562_1277_1840 176
1218 3300046691 Ga0495670_0078060 Ga0495670_0078060_118_648 176
1219 3300046692 Ga0495671_0274728 Ga0495671_0274728_26_556 176
1220 3300046692 Ga0495671_0402317 Ga0495671_0402317_55_618 176
1221 3300046694 Ga0495649_0047616 Ga0495649_0047616_962_1492 176
1222 3300046694 Ga0495649_0199931 Ga0495649_0199931_209_739 176
1223 3300046694 Ga0495649_0289086 Ga0495649_0289086_97_627 176
1224 3300046794 Ga0495589_0099620 Ga0495589_0099620_33_563 176
1225 3300046794 Ga0495589_0143196 Ga0495589_0143196_267_797 176
1226 3300046794 Ga0495589_0173165 Ga0495589_0173165_401_931 176
1227 3300046794 Ga0495589_0241200 Ga0495589_0241200_245_826 176
1228 3300046809 Ga0495600_0041236 Ga0495600_0041236_2023_2553 176
1229 3300046810 Ga0495660_0050740 Ga0495660_0050740_1467_1997 176
1230 3300046810 Ga0495660_0186809 Ga0495660_0186809_192_722 176
1231 3300047315 Ga0495581_0028132 Ga0495581_0028132_2705_3235 176
1232 3300047317 Ga0495604_0005369 Ga0495604_0005369_3952_4482 176
1233 3300047318 Ga0495636_0043015 Ga0495636_0043015_1019_1549 176
1234 3300047318 Ga0495636_0310154 Ga0495636_0310154_137_667 176
1235 3300047319 Ga0495674_0046737 Ga0495674_0046737_1375_1905 176
1236 3300047320 Ga0495672_0314720 Ga0495672_0314720_27_608 176
1237 3300047321 Ga0495676_0039329 Ga0495676_0039329_2490_3053 176
1238 3300047321 Ga0495676_0047874 Ga0495676_0047874_1617_2147 176
1239 3300047321 Ga0495676_0581215 Ga0495676_0581215_42_572 176
1240 3300047322 Ga0495680_0008881 Ga0495680_0008881_5959_6489 176
1241 3300047323 Ga0495683_0091526 Ga0495683_0091526_323_853 176
1242 3300047323 Ga0495683_0163907 Ga0495683_0163907_329_859 176
1243 3300047323 Ga0495683_0208964 Ga0495683_0208964_58_588 176
1244 3300047443 Ga0495687_126162 Ga0495687_126162_119_649 176
1245 3300047443 Ga0495687_142791 Ga0495687_142791_106_636 176
1246 3300047444 Ga0495675_0020892 Ga0495675_0020892_1202_1732 176
1247 3300047445 Ga0495677_0118428 Ga0495677_0118428_335_865 176
1248 3300047447 Ga0495685_101503 Ga0495685_101503_28_591 176
1249 3300047469 Ga0495673_0083345 Ga0495673_0083345_772_1302 176
1250 3300047469 Ga0495673_0103545 Ga0495673_0103545_125_655 176
1251 3300047469 Ga0495673_0108010 Ga0495673_0108010_143_673 176
1252 3300047469 Ga0495673_0152098 Ga0495673_0152098_351_881 176
1253 3300047469 Ga0495673_0168073 Ga0495673_0168073_211_741 176
1254 3300047469 Ga0495673_0223046 Ga0495673_0223046_139_669 176
1255 3300047470 Ga0495681_0097731 Ga0495681_0097731_565_1128 176
1256 3300047470 Ga0495681_0236490 Ga0495681_0236490_140_703 176
1257 3300047471 Ga0495684_0351610 Ga0495684_0351610_460_990 176
1258 3300047472 Ga0495686_0150331 Ga0495686_0150331_422_952 176
1259 3300047472 Ga0495686_0354173 Ga0495686_0354173_215_745 176
1260 3300047472 Ga0495686_0426761 Ga0495686_0426761_132_662 176
1261 3300047673 Ga0495593_0118506 Ga0495593_0118506_57_587 176
1262 3300048088 Ga0495602_0023058 Ga0495602_0023058_2443_2973 176
1263 3300048089 Ga0495614_0357666 Ga0495614_0357666_106_636 176
1264 3300048090 Ga0495615_0090478 Ga0495615_0090478_232_762 176
1265 3300048090 Ga0495615_0138603 Ga0495615_0138603_169_699 176
1266 3300048091 Ga0495626_0175237 Ga0495626_0175237_346_876 176
1267 3300048903 Ga0496100_0046419 Ga0496100_0046419_2210_2740 176
1268 3300048903 Ga0496100_0188849 Ga0496100_0188849_384_914 176
1269 3300048903 Ga0496100_0246888 Ga0496100_0246888_695_1276 176
1270 3300048904 Ga0496101_0289568 Ga0496101_0289568_127_657 176
1271 3300048904 Ga0496101_0430373 Ga0496101_0430373_173_703 176
1272 3300048904 Ga0496101_0433593 Ga0496101_0433593_493_1023 176
1273 3300048905 Ga0496102_0071540 Ga0496102_0071540_275_805 176
1274 3300048905 Ga0496102_0074603 Ga0496102_0074603_40_621 176
1275 3300048905 Ga0496102_0074762 Ga0496102_0074762_1004_1534 176
1276 3300048905 Ga0496102_0282570 Ga0496102_0282570_708_1238 176
1277 3300048905 Ga0496102_0610220 Ga0496102_0610220_280_810 176
1278 3300048905 Ga0496102_0640126 Ga0496102_0640126_37_567 176
1279 3300048906 Ga0496103_0021472 Ga0496103_0021472_116_646 176
1280 3300048907 Ga0496104_0023224 Ga0496104_0023224_2501_3031 176
1281 3300048907 Ga0496104_0137738 Ga0496104_0137738_302_832 176
1282 3300048907 Ga0496104_0223045 Ga0496104_0223045_1131_1661 176
1283 3300048907 Ga0496104_0447321 Ga0496104_0447321_130_660 176
1284 3300048908 Ga0496105_0002119 Ga0496105_0002119_4263_4793 176
1285 3300048908 Ga0496105_0078315 Ga0496105_0078315_1102_1632 176
1286 3300048908 Ga0496105_0298503 Ga0496105_0298503_748_1278 176
1287 3300048909 Ga0496106_0131388 Ga0496106_0131388_1298_1828 176
1288 3300048909 Ga0496106_0190826 Ga0496106_0190826_703_1233 176
1289 3300048909 Ga0496106_0461761 Ga0496106_0461761_256_837 176
1290 3300048909 Ga0496106_0464355 Ga0496106_0464355_158_688 176
1291 3300048909 Ga0496106_0520498 Ga0496106_0520498_101_631 176
1292 3300048909 Ga0496106_1063317 Ga0496106_1063317_40_570 176
1293 3300048910 Ga0496107_0084269 Ga0496107_0084269_1398_1928 176
1294 3300048910 Ga0496107_0765599 Ga0496107_0765599_20_550 176
1295 3300048911 Ga0496108_0267633 Ga0496108_0267633_459_989 176
1296 3300048911 Ga0496108_0276122 Ga0496108_0276122_696_1226 176
1297 3300048911 Ga0496108_0459592 Ga0496108_0459592_344_874 176
1298 3300048911 Ga0496108_0675677 Ga0496108_0675677_201_731 176
1299 3300048911 Ga0496108_1182871 Ga0496108_1182871_34_564 176
1300 3300048911 Ga0496108_1201958 Ga0496108_1201958_88_627 176
1301 3300048912 Ga0496109_0021697 Ga0496109_0021697_2539_3120 176
1302 3300048912 Ga0496109_0162309 Ga0496109_0162309_384_914 176
1303 3300048912 Ga0496109_0196394 Ga0496109_0196394_67_597 176
1304 3300048912 Ga0496109_1219651 Ga0496109_1219651_119_649 176
1305 3300048912 Ga0496109_1502556 Ga0496109_1502556_50_580 176
1306 3300048913 Ga0496110_0088471 Ga0496110_0088471_822_1352 176
1307 3300048913 Ga0496110_0125988 Ga0496110_0125988_1302_1883 176
1308 3300048913 Ga0496110_0174824 Ga0496110_0174824_1206_1736 176
1309 3300048913 Ga0496110_0731836 Ga0496110_0731836_209_739 176
1310 3300048913 Ga0496110_1069359 Ga0496110_1069359_18_599 176
1311 3300048914 Ga0496111_0131513 Ga0496111_0131513_1094_1624 176
1312 3300048914 Ga0496111_0142191 Ga0496111_0142191_1144_1674 176
1313 3300048914 Ga0496111_0244844 Ga0496111_0244844_416_946 176
1314 3300048915 Ga0496112_0070075 Ga0496112_0070075_2236_2766 176
1315 3300048915 Ga0496112_0123986 Ga0496112_0123986_1431_1961 176
1316 3300048915 Ga0496112_0520433 Ga0496112_0520433_290_820 176
1317 3300048915 Ga0496112_0798307 Ga0496112_0798307_289_819 176
1318 3300048916 Ga0496113_0053535 Ga0496113_0053535_76_606 176
1319 3300048916 Ga0496113_0084992 Ga0496113_0084992_1251_1832 176
1320 3300048916 Ga0496113_0105250 Ga0496113_0105250_1405_1935 176
1321 3300048916 Ga0496113_0325241 Ga0496113_0325241_510_1040 176
1322 3300048916 Ga0496113_0632027 Ga0496113_0632027_205_735 176
1323 3300048916 Ga0496113_0710822 Ga0496113_0710822_161_691 176
1324 3300048917 Ga0496114_0305804 Ga0496114_0305804_545_1075 176
1325 3300048917 Ga0496114_0436833 Ga0496114_0436833_391_921 176
1326 3300048918 Ga0496115_0084663 Ga0496115_0084663_551_1081 176
1327 3300048918 Ga0496115_0157355 Ga0496115_0157355_984_1514 176
1328 3300048918 Ga0496115_0237536 Ga0496115_0237536_73_603 176
1329 3300048919 Ga0496116_0165046 Ga0496116_0165046_568_1098 176
1330 3300048919 Ga0496116_0174683 Ga0496116_0174683_584_1114 176
1331 3300048919 Ga0496116_0294710 Ga0496116_0294710_217_747 176
1332 3300048920 Ga0496117_0133093 Ga0496117_0133093_494_1024 176
1333 3300048920 Ga0496117_0226790 Ga0496117_0226790_67_597 176
1334 3300048920 Ga0496117_0410600 Ga0496117_0410600_18_548 176
1335 3300048921 Ga0496118_0037135 Ga0496118_0037135_3271_3801 176
1336 3300048921 Ga0496118_0166548 Ga0496118_0166548_136_717 176
1337 3300048921 Ga0496118_0211512 Ga0496118_0211512_588_1118 176
1338 3300048921 Ga0496118_0484516 Ga0496118_0484516_14_544 176
1339 3300048922 Ga0496119_0054547 Ga0496119_0054547_883_1413 176
1340 3300048922 Ga0496119_0059029 Ga0496119_0059029_1339_1869 176
1341 3300048922 Ga0496119_0102491 Ga0496119_0102491_1018_1548 176
1342 3300048923 Ga0496120_0040266 Ga0496120_0040266_2130_2660 176
1343 3300048924 Ga0496121_0096171 Ga0496121_0096171_456_1037 176
1344 3300048924 Ga0496121_0126343 Ga0496121_0126343_130_660 176
1345 3300048924 Ga0496121_0138497 Ga0496121_0138497_995_1525 176
1346 3300048924 Ga0496121_0264483 Ga0496121_0264483_88_618 176
1347 3300048924 Ga0496121_0288805 Ga0496121_0288805_379_909 176
1348 3300048925 Ga0496122_0267463 Ga0496122_0267463_307_837 176
1349 3300048927 Ga0496124_0164318 Ga0496124_0164318_639_1169 176
1350 3300048927 Ga0496124_0288202 Ga0496124_0288202_417_947 176
1351 3300048927 Ga0496124_0398661 Ga0496124_0398661_278_808 176
1352 3300048927 Ga0496124_0489142 Ga0496124_0489142_17_547 176
1353 3300048928 Ga0496125_0012916 Ga0496125_0012916_1948_2478 176
1354 3300048928 Ga0496125_0166528 Ga0496125_0166528_769_1350 176
1355 3300048928 Ga0496125_0182460 Ga0496125_0182460_522_1052 176
1356 3300048929 Ga0496126_0008213 Ga0496126_0008213_6782_7312 176
1357 3300048929 Ga0496126_0153361 Ga0496126_0153361_939_1469 176
1358 3300048929 Ga0496126_0219098 Ga0496126_0219098_748_1278 176
1359 3300048929 Ga0496126_0239605 Ga0496126_0239605_374_955 176
1360 3300048929 Ga0496126_0514831 Ga0496126_0514831_175_705 176
1361 3300048929 Ga0496126_0608735 Ga0496126_0608735_137_667 176
1362 3300048929 Ga0496126_0647077 Ga0496126_0647077_245_775 176
1363 3300048929 Ga0496126_0666168 Ga0496126_0666168_233_763 176
1364 3300049459 Ga0495678_166440 Ga0495678_166440_31_612 176
1365 3300049460 Ga0495682_0024271 Ga0495682_0024271_1265_1795 176
1366 3300049582 Ga0501048_0306506 Ga0501048_0306506_268_798 176
1367 3300049583 Ga0501067_0144909 Ga0501067_0144909_143_673 176
1368 3300049742 Ga0501080_0696706 Ga0501080_0696706_71_601 176
1369 3300050489 nmdc:mga03683_100167_c1 nmdc:mga03683_100167_c1_637_1218 176
1370 3300050489 nmdc:mga03683_195531_c1 nmdc:mga03683_195531_c1_15_545 176
1371 3300050489 nmdc:mga03683_63870_c1 nmdc:mga03683_63870_c1_490_1020 176
1372 3300050489 nmdc:mga03683_78981_c1 nmdc:mga03683_78981_c1_827_1357 176
1373 3300050490 nmdc:mga03n38_25280_c1 nmdc:mga03n38_25280_c1_1763_2293 176
1374 3300050490 nmdc:mga03n38_51750_c1 nmdc:mga03n38_51750_c1_551_1081 176
1375 3300050491 nmdc:mga00v17_104028_c1 nmdc:mga00v17_104028_c1_953_1483 176
1376 3300050491 nmdc:mga00v17_134887_c1 nmdc:mga00v17_134887_c1_876_1406 176
1377 3300050491 nmdc:mga00v17_399883_c1 nmdc:mga00v17_399883_c1_275_805 176
1378 3300050492 nmdc:mga0yw44_136693_c1 nmdc:mga0yw44_136693_c1_422_952 176
1379 3300050492 nmdc:mga0yw44_197542_c1 nmdc:mga0yw44_197542_c1_309_839 176
1380 3300050492 nmdc:mga0yw44_234584_c1 nmdc:mga0yw44_234584_c1_566_1096 176
1381 3300050492 nmdc:mga0yw44_4136_c1 nmdc:mga0yw44_4136_c1_5031_5561 176
1382 3300050492 nmdc:mga0yw44_61384_c1 nmdc:mga0yw44_61384_c1_279_809 176
1383 3300050492 nmdc:mga0yw44_702768_c1 nmdc:mga0yw44_702768_c1_74_604 176
1384 3300050492 nmdc:mga0yw44_94133_c1 nmdc:mga0yw44_94133_c1_304_834 176
1385 3300050493 nmdc:mga0k408_114095_c1 nmdc:mga0k408_114095_c1_480_1010 176
1386 3300050493 nmdc:mga0k408_245765_c1 nmdc:mga0k408_245765_c1_32_613 176
1387 3300050493 nmdc:mga0k408_311530_c1 nmdc:mga0k408_311530_c1_112_642 176
1388 3300050493 nmdc:mga0k408_49688_c1 nmdc:mga0k408_49688_c1_1143_1673 176
1389 3300050493 nmdc:mga0k408_632294_c1 nmdc:mga0k408_632294_c1_83_613 176
1390 3300050493 nmdc:mga0k408_68006_c1 nmdc:mga0k408_68006_c1_740_1270 176
1391 3300050494 nmdc:mga06z11_164199_c1 nmdc:mga06z11_164199_c1_581_1111 176
1392 3300050494 nmdc:mga06z11_247797_c1 nmdc:mga06z11_247797_c1_30_560 176
1393 3300050495 nmdc:mga04h51_39790_c1 nmdc:mga04h51_39790_c1_599_1129 176
1394 3300050495 nmdc:mga04h51_4594_c1 nmdc:mga04h51_4594_c1_2458_2988 176
1395 3300050496 nmdc:mga07m45_49037_c1 nmdc:mga07m45_49037_c1_826_1356 176
1396 3300050496 nmdc:mga07m45_72272_c1 nmdc:mga07m45_72272_c1_147_677 176
1397 3300050496 nmdc:mga07m45_85238_c1 nmdc:mga07m45_85238_c1_638_1168 176
1398 3300050507 nmdc:mga05p37_715928_c1 nmdc:mga05p37_715928_c1_72_602 176
1399 3300050507 nmdc:mga05p37_766833_c1 nmdc:mga05p37_766833_c1_100_630 176
1400 3300050511 nmdc:mga08y16_1079285_c1 nmdc:mga08y16_1079285_c1_64_594 176
1401 3300050512 nmdc:mga0n895_1169042_c1 nmdc:mga0n895_1169042_c1_62_592 176
1402 3300050512 nmdc:mga0n895_55593_c1 nmdc:mga0n895_55593_c1_960_1490 176
1403 3300050513 nmdc:mga0rr50_401671_c1 nmdc:mga0rr50_401671_c1_299_829 176
1404 3300050513 nmdc:mga0rr50_812014_c1 nmdc:mga0rr50_812014_c1_242_781 176
1405 3300050516 nmdc:mga0sz30_201948_c1 nmdc:mga0sz30_201948_c1_205_735 176
1406 3300050516 nmdc:mga0sz30_240549_c1 nmdc:mga0sz30_240549_c1_74_655 176
1407 3300050516 nmdc:mga0sz30_24637_c2 nmdc:mga0sz30_24637_c2_912_1442 176
1408 3300050516 nmdc:mga0sz30_276370_c1 nmdc:mga0sz30_276370_c1_102_632 176
1409 3300050516 nmdc:mga0sz30_52513_c1 nmdc:mga0sz30_52513_c1_50_580 176
1410 3300050516 nmdc:mga0sz30_6719_c1 nmdc:mga0sz30_6719_c1_99_629 176
1411 3300053080 Ga0500635_0083337 Ga0500635_0083337_285_815 176
1412 3300053083 Ga0495655_0017739 Ga0495655_0017739_50_580 176
1413 3300053083 Ga0495655_0028351 Ga0495655_0028351_647_1177 176
1414 3300053083 Ga0495655_0130147 Ga0495655_0130147_140_670 176
1415 3300053085 Ga0495619_0232345 Ga0495619_0232345_372_902 176
1416 3300053087 Ga0500643_000112 Ga0500643_000112_17468_17998 176
1417 3300053091 Ga0500647_0087402 Ga0500647_0087402_14_544 176
1418 3300053092 Ga0500583_0109258 Ga0500583_0109258_647_1177 176
1419 3300053092 Ga0500583_0389437 Ga0500583_0389437_69_599 176
1420 3300053093 Ga0500651_0204118 Ga0500651_0204118_344_874 176
1421 3300053093 Ga0500651_0426263 Ga0500651_0426263_78_608 176
1422 3300053093 Ga0500651_0613454 Ga0500651_0613454_33_563 176
1423 3300053094 Ga0500566_0060656 Ga0500566_0060656_490_1020 176
1424 3300053095 Ga0500640_031812 Ga0500640_031812_780_1310 176
1425 3300053096 Ga0500641_0005732 Ga0500641_0005732_1333_1863 176
1426 3300053096 Ga0500641_0034832 Ga0500641_0034832_440_970 176
1427 3300053098 Ga0500650_0182444 Ga0500650_0182444_100_630 176
1428 3300053102 Ga0500554_084081 Ga0500554_084081_215_745 176
1429 3300053103 Ga0500555_029367 Ga0500555_029367_1014_1544 176
1430 3300053105 Ga0500557_000021 Ga0500557_000021_44470_45000 176
1431 3300053108 Ga0500562_005565 Ga0500562_005565_1362_1892 176
1432 3300053108 Ga0500562_077165 Ga0500562_077165_261_842 176
1433 3300053109 Ga0500569_005793 Ga0500569_005793_1116_1646 176
1434 3300053109 Ga0500569_145089 Ga0500569_145089_239_769 176
1435 3300053109 Ga0500569_184397 Ga0500569_184397_165_695 176
1436 3300053119 Ga0500595_004714 Ga0500595_004714_4809_5339 176
1437 3300053119 Ga0500595_030265 Ga0500595_030265_117_647 176
1438 3300053121 Ga0500607_037964 Ga0500607_037964_1941_2471 176
1439 3300053124 Ga0500617_129887 Ga0500617_129887_32_562 176
1440 3300053126 Ga0500621_219643 Ga0500621_219643_49_579 176
1441 3300053128 Ga0500626_120643 Ga0500626_120643_446_976 176
1442 3300053130 Ga0500642_0000362 Ga0500642_0000362_8271_8801 176
1443 3300053130 Ga0500642_0083225 Ga0500642_0083225_453_983 176
1444 3300053130 Ga0500642_0161139 Ga0500642_0161139_345_875 176
1445 3300053133 Ga0500655_058384 Ga0500655_058384_45_575 176
1446 3300053134 Ga0500658_0061598 Ga0500658_0061598_149_679 176
1447 3300053134 Ga0500658_0103613 Ga0500658_0103613_631_1212 176
1448 3300053134 Ga0500658_0335099 Ga0500658_0335099_22_552 176
1449 3300053137 Ga0500561_0027024 Ga0500561_0027024_287_868 176
1450 3300053139 Ga0500568_0011399 Ga0500568_0011399_2385_2915 176
1451 3300053144 Ga0500585_051506 Ga0500585_051506_390_920 176
1452 3300053146 Ga0500588_0251092 Ga0500588_0251092_34_564 176
1453 3300053146 Ga0500588_0311862 Ga0500588_0311862_44_574 176
1454 3300053147 Ga0500589_139840 Ga0500589_139840_15_545 176
1455 3300053148 Ga0500590_012459 Ga0500590_012459_1339_1869 176
1456 3300053151 Ga0500604_0283040 Ga0500604_0283040_17_547 176
1457 3300053153 Ga0500616_0125886 Ga0500616_0125886_301_831 176
1458 3300053154 Ga0500619_164871 Ga0500619_164871_129_659 176
1459 3300053155 Ga0500620_051888 Ga0500620_051888_100_630 176
1460 3300053156 Ga0500622_0005248 Ga0500622_0005248_6850_7380 176
1461 3300053158 Ga0500627_0091031 Ga0500627_0091031_310_840 176
1462 3300053158 Ga0500627_0149510 Ga0500627_0149510_237_767 176
1463 3300053158 Ga0500627_0173120 Ga0500627_0173120_384_914 176
1464 3300053158 Ga0500627_0310906 Ga0500627_0310906_106_636 176
1465 3300053160 Ga0500633_0074370 Ga0500633_0074370_364_894 176
1466 3300053163 Ga0500639_267963 Ga0500639_267963_93_623 176
1467 3300053177 Ga0500636_0000834 Ga0500636_0000834_6105_6635 176
1468 3300053177 Ga0500636_0114438 Ga0500636_0114438_903_1433 176
1469 3300053177 Ga0500636_0262295 Ga0500636_0262295_298_828 176
1470 3300053178 Ga0500637_0544021 Ga0500637_0544021_18_548 176
1471 3300053722 Ga0500649_206274 Ga0500649_206274_48_578 176
1472 3300053722 Ga0500649_208297 Ga0500649_208297_42_572 176
1473 3300053729 Ga0500625_054654 Ga0500625_054654_1145_1675 176
1474 3300053730 Ga0500645_092338 Ga0500645_092338_41_571 176
1475 3300053731 Ga0500609_012382 Ga0500609_012382_79_609 176
1476 3300053736 Ga0500599_002952 Ga0500599_002952_1090_1620 176
1477 3300053737 Ga0500601_000419 Ga0500601_000419_4270_4800 176
1478 3300055283 Ga0500661_010749 Ga0500661_010749_749_1279 176
1479 3300055283 Ga0500661_061784 Ga0500661_061784_46_576 176
1480 3300060353 Ga0501082_0323771 Ga0501082_0323771_544_1074 176

Structural Annotation

Top 5 Hits

ID Description Score Start End
6zvt-assembly1.cif.gz_A c13 symmetry: bacterial vipp1 and pspa are members of the ancient escrt-iii membrane-remodeling superfamily. 0.4187 25 170
6zvs-assembly1.cif.gz_A c12 symmetry: bacterial vipp1 and pspa are members of the ancient escrt-iii membrane-remodeling superfamily. 0.4169 25 170
6zw6-assembly1.cif.gz_A c16 symmetry: bacterial vipp1 and pspa are members of the ancient escrt-iii membrane-remodeling superfamily. 0.4145 25 170
6zw5-assembly1.cif.gz_A c15 symmetry: bacterial vipp1 and pspa are members of the ancient escrt-iii membrane-remodeling superfamily. 0.4122 25 170
6zw4-assembly1.cif.gz_A c14 symmetry: bacterial vipp1 and pspa are members of the ancient escrt-iii membrane-remodeling superfamily. 0.4107 25 170
ID Description Score Start End Superfamily
af_Q9VEW3_1_165_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.5172 56 134 1.20.140.150
af_Q8NF91_7459_7567_1.20.58.60 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.4514 17 126 1.20.58.60
af_Q8NF91_7459_7567_1.20.58.60 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.4395 17 126 1.20.58.60
af_R9PY72_1_190_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.4371 7 143 1.20.140.150
af_Q7K1I4_1_105_1.20.120.350 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Voltage-gated potassium channels. Chain C 0.4357 56 144 1.20.120.350
ID Description Score Start End GO Terms
AF-A0A4Q0S4M6-F1-model_v4 Uncharacterized protein 0.8869 29 139 GO:0016020
AF-A0A4Q0S4M6-F1-model_v4 Uncharacterized protein 0.865 29 139 GO:0016020
AF-A0A0N0GPP8-F1-model_v4 Transmembrane protein 0.7504 13 164
AF-A0A537SV41-F1-model_v4 Uncharacterized protein 0.7267 31 176 GO:0016020
AF-A0A537SV41-F1-model_v4 Uncharacterized protein 0.7179 31 176 GO:0016020

Feature Viewer

pLDDT pTM Quality
83.24 0.66 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map