F494217
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1472 | 359 | 1472 | 68 |
Family's Representative Sequence
| Representative Sequence | 3300006175|Ga0070712_101141531|Ga0070712_1011415312 |
| Length | 80 |
| Sequence | MNMKIKEIVEMSTDELLTKRRDLRQERLHLRLQQQSGQLEQPSRLRLIRRDVARIETILSRRAKQPQTIPAEDPKAKKNK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2044078001 | Maize rhizosphere soil microbial communities from University of Illinois Energy Farm, Urbana, IL | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 3300002126 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Metagenome | Rhizosphere |
| 4 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 5 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 6 | 3300005277 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) | Metagenome | Rhizosphere |
| 7 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 9 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 10 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 11 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 12 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 16 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 19 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 22 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 24 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 34 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 51 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 52 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 58 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 59 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 60 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 61 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 63 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 67 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 68 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 70 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 71 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 73 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 74 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 75 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 76 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 77 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 78 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 79 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 80 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 81 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 82 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 83 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 84 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 85 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 87 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 88 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 89 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 91 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 92 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 93 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 94 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 95 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 96 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 97 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 99 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 100 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 101 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 113 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300012476 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.yng.070610 | Metagenome | Rhizosphere |
| 116 | 3300012488 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.yng.030610 | Metagenome | Rhizosphere |
| 117 | 3300012505 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 | Metagenome | Rhizosphere |
| 118 | 3300012506 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 | Metagenome | Rhizosphere |
| 119 | 3300012508 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 | Metagenome | Rhizosphere |
| 120 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 134 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 135 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 137 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300027424 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 205 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 209 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 210 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 211 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 212 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 213 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 214 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 215 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 216 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 217 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 218 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 219 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 220 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 221 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 222 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 223 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 224 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 225 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 226 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 227 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 228 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 229 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 230 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 231 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 232 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 233 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 234 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 235 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 236 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 237 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 238 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 239 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 240 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 241 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 242 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 243 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 244 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 245 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 246 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 247 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 248 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 249 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 250 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 251 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 252 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 253 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 254 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 255 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 256 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 257 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 258 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 259 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 260 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 261 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 262 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 263 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 264 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 265 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 328 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 329 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 330 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 331 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 332 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 333 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 334 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 335 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 336 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 337 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 338 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 339 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 340 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 341 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 342 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 343 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 344 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 345 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 346 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 347 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 348 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 349 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 350 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 351 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 352 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 358 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 359 | 3300053728 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.2 |
| Nodule | 0 |
| Rhizoplane | 8.08 |
| Rhizosphere | 90.83 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.88 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | ZMR_F548DK201AME5Z | 2044078001 | Unclassified | 511 |
| 2 | SwRhRL2b_contig_2037418 | 2162886007 | Unclassified | 992 |
| 3 | SwRhRL2b_contig_3078803 | 2162886007 | Bacteria | 880 |
| 4 | SwRhRL2b_contig_3458674 | 2162886007 | Unclassified | 809 |
| 5 | JGI24035J26624_1000389 | 3300002126 | Bacteria | 4130 |
| 6 | JGI24742J22300_10028513 | 3300002244 | Unclassified | 969 |
| 7 | JGI25406J46586_10000001 | 3300003203 | Bacteria | 251772 |
| 8 | JGI25406J46586_10000007 | 3300003203 | Bacteria | 112227 |
| 9 | Ga0065716_1018288 | 3300005277 | Unclassified | 527 |
| 10 | Ga0065714_10128472 | 3300005288 | Bacteria | 1273 |
| 11 | Ga0065704_10002652 | 3300005289 | Bacteria | 8381 |
| 12 | Ga0065704_10048094 | 3300005289 | Unclassified | 1016 |
| 13 | Ga0065704_10097735 | 3300005289 | Bacteria | 2319 |
| 14 | Ga0065704_10282058 | 3300005289 | Unclassified | 920 |
| 15 | Ga0065704_10306099 | 3300005289 | Unclassified | 859 |
| 16 | Ga0065704_10557056 | 3300005289 | Unclassified | 620 |
| 17 | Ga0065704_10850442 | 3300005289 | Unclassified | 509 |
| 18 | Ga0065712_10015466 | 3300005290 | Unclassified | 2442 |
| 19 | Ga0065712_10072999 | 3300005290 | Bacteria | 4536 |
| 20 | Ga0065712_10092159 | 3300005290 | Bacteria | 2342 |
| 21 | Ga0065712_10121918 | 3300005290 | Bacteria | 1658 |
| 22 | Ga0065712_10122169 | 3300005290 | Bacteria | 1655 |
| 23 | Ga0065712_10143777 | 3300005290 | Bacteria | 1426 |
| 24 | Ga0065712_10255670 | 3300005290 | Unclassified | 902 |
| 25 | Ga0065712_10320047 | 3300005290 | Bacteria | 830 |
| 26 | Ga0065712_10366731 | 3300005290 | Bacteria | 768 |
| 27 | Ga0065712_10386138 | 3300005290 | Unclassified | 733 |
| 28 | Ga0065712_10558980 | 3300005290 | Unclassified | 613 |
| 29 | Ga0065712_10597168 | 3300005290 | Unclassified | 592 |
| 30 | Ga0065715_10005591 | 3300005293 | Bacteria | 4285 |
| 31 | Ga0065715_10006003 | 3300005293 | Bacteria | 6856 |
| 32 | Ga0065715_10024370 | 3300005293 | Unclassified | 1667 |
| 33 | Ga0065715_10067002 | 3300005293 | Unclassified | 701 |
| 34 | Ga0065715_10114421 | 3300005293 | Bacteria | 2451 |
| 35 | Ga0065715_10121633 | 3300005293 | Bacteria | 2220 |
| 36 | Ga0065715_10132257 | 3300005293 | Bacteria | 1993 |
| 37 | Ga0065715_10288996 | 3300005293 | Bacteria | 1067 |
| 38 | Ga0065715_10375137 | 3300005293 | Unclassified | 911 |
| 39 | Ga0065715_10389010 | 3300005293 | Bacteria | 842 |
| 40 | Ga0065715_10663438 | 3300005293 | Unclassified | 663 |
| 41 | Ga0065715_10884699 | 3300005293 | Bacteria | 580 |
| 42 | Ga0065707_10007089 | 3300005295 | Bacteria | 2422 |
| 43 | Ga0065707_10011219 | 3300005295 | Bacteria | 1812 |
| 44 | Ga0065707_10470003 | 3300005295 | Unclassified | 783 |
| 45 | Ga0065707_11009080 | 3300005295 | Unclassified | 537 |
| 46 | Ga0070658_10132680 | 3300005327 | Unclassified | 2076 |
| 47 | Ga0070658_11720638 | 3300005327 | Unclassified | 543 |
| 48 | Ga0070676_10023068 | 3300005328 | Bacteria | 3496 |
| 49 | Ga0070676_10023857 | 3300005328 | Bacteria | 3441 |
| 50 | Ga0070676_10031330 | 3300005328 | Bacteria | 3038 |
| 51 | Ga0070676_10032758 | 3300005328 | Bacteria | 2979 |
| 52 | Ga0070676_10328254 | 3300005328 | Bacteria | 1045 |
| 53 | Ga0070676_10356560 | 3300005328 | Bacteria | 1007 |
| 54 | Ga0070676_10441948 | 3300005328 | Bacteria | 913 |
| 55 | Ga0070676_10446245 | 3300005328 | Bacteria | 909 |
| 56 | Ga0070676_10526310 | 3300005328 | Unclassified | 843 |
| 57 | Ga0070683_100014620 | 3300005329 | Bacteria | 6873 |
| 58 | Ga0070683_100054847 | 3300005329 | Bacteria | 3696 |
| 59 | Ga0070683_100200119 | 3300005329 | Unclassified | 1897 |
| 60 | Ga0070683_100221173 | 3300005329 | Bacteria | 1800 |
| 61 | Ga0070683_101010997 | 3300005329 | Bacteria | 798 |
| 62 | Ga0070683_101271548 | 3300005329 | Bacteria | 707 |
| 63 | Ga0070690_100187280 | 3300005330 | Bacteria | 1433 |
| 64 | Ga0070690_100295354 | 3300005330 | Bacteria | 1160 |
| 65 | Ga0070690_100556303 | 3300005330 | Unclassified | 866 |
| 66 | Ga0070670_100000833 | 3300005331 | Bacteria | 24086 |
| 67 | Ga0070670_100003742 | 3300005331 | Bacteria | 12666 |
| 68 | Ga0070670_100068156 | 3300005331 | Bacteria | 3054 |
| 69 | Ga0070670_100260744 | 3300005331 | Unclassified | 1511 |
| 70 | Ga0070670_100414170 | 3300005331 | Bacteria | 1191 |
| 71 | Ga0070670_100586363 | 3300005331 | Bacteria | 997 |
| 72 | Ga0070670_100926530 | 3300005331 | Bacteria | 791 |
| 73 | Ga0070677_10566592 | 3300005333 | Unclassified | 625 |
| 74 | Ga0068869_100412385 | 3300005334 | Bacteria | 1113 |
| 75 | Ga0068869_101792838 | 3300005334 | Unclassified | 549 |
| 76 | Ga0070666_10002056 | 3300005335 | Bacteria | 12212 |
| 77 | Ga0070666_10037434 | 3300005335 | Bacteria | 3225 |
| 78 | Ga0070666_10130584 | 3300005335 | Bacteria | 1745 |
| 79 | Ga0070666_10436454 | 3300005335 | Unclassified | 945 |
| 80 | Ga0070666_10827198 | 3300005335 | Bacteria | 683 |
| 81 | Ga0070666_11014759 | 3300005335 | Unclassified | 616 |
| 82 | Ga0070682_100289295 | 3300005337 | Bacteria | 1198 |
| 83 | Ga0070682_101382440 | 3300005337 | Unclassified | 601 |
| 84 | Ga0068868_100031931 | 3300005338 | Bacteria | 4048 |
| 85 | Ga0068868_100059779 | 3300005338 | Bacteria | 3015 |
| 86 | Ga0068868_100082469 | 3300005338 | Bacteria | 2579 |
| 87 | Ga0068868_100097448 | 3300005338 | Unclassified | 2377 |
| 88 | Ga0068868_100201460 | 3300005338 | Bacteria | 1659 |
| 89 | Ga0068868_100333449 | 3300005338 | Bacteria | 1295 |
| 90 | Ga0068868_100523091 | 3300005338 | Bacteria | 1042 |
| 91 | Ga0068868_101144047 | 3300005338 | Bacteria | 718 |
| 92 | Ga0070660_100408877 | 3300005339 | Bacteria | 1123 |
| 93 | Ga0070660_100989587 | 3300005339 | Unclassified | 710 |
| 94 | Ga0070660_101370569 | 3300005339 | Unclassified | 601 |
| 95 | Ga0070689_100009585 | 3300005340 | Bacteria | 6870 |
| 96 | Ga0070689_100083277 | 3300005340 | Bacteria | 2514 |
| 97 | Ga0070689_100161584 | 3300005340 | Bacteria | 1811 |
| 98 | Ga0070689_100308993 | 3300005340 | Bacteria | 1318 |
| 99 | Ga0070689_101513560 | 3300005340 | Unclassified | 608 |
| 100 | Ga0070689_102155027 | 3300005340 | Unclassified | 511 |
| 101 | Ga0070687_100000382 | 3300005343 | Bacteria | 15047 |
| 102 | Ga0070687_100216105 | 3300005343 | Bacteria | 1171 |
| 103 | Ga0070687_100711471 | 3300005343 | Unclassified | 703 |
| 104 | Ga0070687_100806730 | 3300005343 | Unclassified | 665 |
| 105 | Ga0070661_100081299 | 3300005344 | Bacteria | 2392 |
| 106 | Ga0070661_100120618 | 3300005344 | Bacteria | 1964 |
| 107 | Ga0070661_100930326 | 3300005344 | Bacteria | 719 |
| 108 | Ga0070661_101207687 | 3300005344 | Unclassified | 633 |
| 109 | Ga0070661_101588495 | 3300005344 | Bacteria | 553 |
| 110 | Ga0070692_11164096 | 3300005345 | Unclassified | 547 |
| 111 | Ga0070668_100000403 | 3300005347 | Bacteria | 28684 |
| 112 | Ga0070668_100004836 | 3300005347 | Bacteria | 9989 |
| 113 | Ga0070668_100056885 | 3300005347 | Bacteria | 3021 |
| 114 | Ga0070668_100120521 | 3300005347 | Bacteria | 2096 |
| 115 | Ga0070668_100379489 | 3300005347 | Bacteria | 1202 |
| 116 | Ga0070668_100519859 | 3300005347 | Bacteria | 1033 |
| 117 | Ga0070669_100002011 | 3300005353 | Bacteria | 14710 |
| 118 | Ga0070669_100006097 | 3300005353 | Bacteria | 8698 |
| 119 | Ga0070669_100049923 | 3300005353 | Bacteria | 3055 |
| 120 | Ga0070669_100064706 | 3300005353 | Bacteria | 2693 |
| 121 | Ga0070669_100080338 | 3300005353 | Bacteria | 2427 |
| 122 | Ga0070669_100746041 | 3300005353 | Bacteria | 829 |
| 123 | Ga0070669_101543803 | 3300005353 | Unclassified | 578 |
| 124 | Ga0070675_100004678 | 3300005354 | Bacteria | 10447 |
| 125 | Ga0070675_100063526 | 3300005354 | Bacteria | 3052 |
| 126 | Ga0070675_100087471 | 3300005354 | Unclassified | 2606 |
| 127 | Ga0070675_100182810 | 3300005354 | Bacteria | 1813 |
| 128 | Ga0070675_100277633 | 3300005354 | Unclassified | 1472 |
| 129 | Ga0070675_100376792 | 3300005354 | Bacteria | 1262 |
| 130 | Ga0070675_100638029 | 3300005354 | Unclassified | 967 |
| 131 | Ga0070675_101142101 | 3300005354 | Unclassified | 717 |
| 132 | Ga0070675_101652152 | 3300005354 | Bacteria | 591 |
| 133 | Ga0070671_100000283 | 3300005355 | Bacteria | 34469 |
| 134 | Ga0070671_100011495 | 3300005355 | Bacteria | 7116 |
| 135 | Ga0070671_100042031 | 3300005355 | Bacteria | 3799 |
| 136 | Ga0070671_100054306 | 3300005355 | Bacteria | 3331 |
| 137 | Ga0070671_100149154 | 3300005355 | Unclassified | 1974 |
| 138 | Ga0070671_100187094 | 3300005355 | Bacteria | 1755 |
| 139 | Ga0070671_100198585 | 3300005355 | Unclassified | 1701 |
| 140 | Ga0070671_100731117 | 3300005355 | Unclassified | 859 |
| 141 | Ga0070671_100872664 | 3300005355 | Bacteria | 785 |
| 142 | Ga0070671_101666516 | 3300005355 | Unclassified | 566 |
| 143 | Ga0070671_101823379 | 3300005355 | Bacteria | 541 |
| 144 | Ga0070671_101827865 | 3300005355 | Unclassified | 540 |
| 145 | Ga0070674_100000912 | 3300005356 | Bacteria | 15424 |
| 146 | Ga0070674_100007500 | 3300005356 | Bacteria | 6436 |
| 147 | Ga0070674_100064029 | 3300005356 | Bacteria | 2575 |
| 148 | Ga0070674_100297400 | 3300005356 | Unclassified | 1285 |
| 149 | Ga0070674_100341788 | 3300005356 | Unclassified | 1206 |
| 150 | Ga0070674_100414870 | 3300005356 | Bacteria | 1103 |
| 151 | Ga0070673_100008141 | 3300005364 | Bacteria | 6955 |
| 152 | Ga0070673_100017182 | 3300005364 | Bacteria | 5136 |
| 153 | Ga0070673_100159647 | 3300005364 | Bacteria | 1916 |
| 154 | Ga0070673_100235191 | 3300005364 | Unclassified | 1591 |
| 155 | Ga0070673_100999699 | 3300005364 | Unclassified | 779 |
| 156 | Ga0070673_101564425 | 3300005364 | Bacteria | 622 |
| 157 | Ga0070673_102383003 | 3300005364 | Unclassified | 503 |
| 158 | Ga0070673_102403155 | 3300005364 | Unclassified | 501 |
| 159 | Ga0070688_100000733 | 3300005365 | Bacteria | 16191 |
| 160 | Ga0070688_100001414 | 3300005365 | Bacteria | 11953 |
| 161 | Ga0070688_100139371 | 3300005365 | Bacteria | 1645 |
| 162 | Ga0070688_100347104 | 3300005365 | Bacteria | 1086 |
| 163 | Ga0070659_100002483 | 3300005366 | Bacteria | 13098 |
| 164 | Ga0070659_100051342 | 3300005366 | Bacteria | 3242 |
| 165 | Ga0070659_100326979 | 3300005366 | Bacteria | 1282 |
| 166 | Ga0070659_100591895 | 3300005366 | Unclassified | 952 |
| 167 | Ga0070659_100648570 | 3300005366 | Bacteria | 910 |
| 168 | Ga0070659_100774997 | 3300005366 | Unclassified | 833 |
| 169 | Ga0070667_100004665 | 3300005367 | Bacteria | 11504 |
| 170 | Ga0070667_100103912 | 3300005367 | Unclassified | 2456 |
| 171 | Ga0070667_100196145 | 3300005367 | Bacteria | 1790 |
| 172 | Ga0070667_100392191 | 3300005367 | Bacteria | 1262 |
| 173 | Ga0070667_100408504 | 3300005367 | Bacteria | 1237 |
| 174 | Ga0070667_100565364 | 3300005367 | Bacteria | 1046 |
| 175 | Ga0070667_100773818 | 3300005367 | Unclassified | 890 |
| 176 | Ga0070703_10152115 | 3300005406 | Unclassified | 870 |
| 177 | Ga0070703_10376251 | 3300005406 | Unclassified | 612 |
| 178 | Ga0070709_10026650 | 3300005434 | Bacteria | 3428 |
| 179 | Ga0070709_10042905 | 3300005434 | Bacteria | 2795 |
| 180 | Ga0070709_10232892 | 3300005434 | Bacteria | 1319 |
| 181 | Ga0070709_10238921 | 3300005434 | Unclassified | 1304 |
| 182 | Ga0070709_10630820 | 3300005434 | Bacteria | 828 |
| 183 | Ga0070709_10852976 | 3300005434 | Bacteria | 718 |
| 184 | Ga0070709_11054064 | 3300005434 | Bacteria | 649 |
| 185 | Ga0070709_11313628 | 3300005434 | Unclassified | 584 |
| 186 | Ga0070709_11469253 | 3300005434 | Unclassified | 553 |
| 187 | Ga0070714_100054897 | 3300005435 | Bacteria | 3404 |
| 188 | Ga0070714_100477608 | 3300005435 | Unclassified | 1187 |
| 189 | Ga0070714_100493973 | 3300005435 | Bacteria | 1166 |
| 190 | Ga0070714_100917821 | 3300005435 | Unclassified | 850 |
| 191 | Ga0070714_100959005 | 3300005435 | Unclassified | 831 |
| 192 | Ga0070714_100961468 | 3300005435 | Bacteria | 830 |
| 193 | Ga0070714_101213946 | 3300005435 | Unclassified | 736 |
| 194 | Ga0070714_101950425 | 3300005435 | Unclassified | 573 |
| 195 | Ga0070714_102051069 | 3300005435 | Unclassified | 558 |
| 196 | Ga0070714_102423308 | 3300005435 | Unclassified | 510 |
| 197 | Ga0070713_100019600 | 3300005436 | Bacteria | 5170 |
| 198 | Ga0070713_100040250 | 3300005436 | Bacteria | 3798 |
| 199 | Ga0070713_100219364 | 3300005436 | Bacteria | 1725 |
| 200 | Ga0070713_100702222 | 3300005436 | Bacteria | 966 |
| 201 | Ga0070713_101618955 | 3300005436 | Bacteria | 628 |
| 202 | Ga0070710_10079151 | 3300005437 | Bacteria | 1914 |
| 203 | Ga0070710_10086739 | 3300005437 | Bacteria | 1838 |
| 204 | Ga0070710_10136630 | 3300005437 | Unclassified | 1499 |
| 205 | Ga0070710_10505510 | 3300005437 | Bacteria | 828 |
| 206 | Ga0070710_10998595 | 3300005437 | Unclassified | 610 |
| 207 | Ga0070710_11322454 | 3300005437 | Unclassified | 536 |
| 208 | Ga0070701_10288547 | 3300005438 | Bacteria | 1004 |
| 209 | Ga0070701_10410151 | 3300005438 | Unclassified | 860 |
| 210 | Ga0070711_100005001 | 3300005439 | Bacteria | 7876 |
| 211 | Ga0070711_100078511 | 3300005439 | Bacteria | 2345 |
| 212 | Ga0070711_100098324 | 3300005439 | Bacteria | 2124 |
| 213 | Ga0070711_100120740 | 3300005439 | Bacteria | 1938 |
| 214 | Ga0070711_100530968 | 3300005439 | Bacteria | 974 |
| 215 | Ga0070711_100647742 | 3300005439 | Unclassified | 885 |
| 216 | Ga0070711_100718031 | 3300005439 | Bacteria | 842 |
| 217 | Ga0070711_101022999 | 3300005439 | Unclassified | 709 |
| 218 | Ga0070711_101968767 | 3300005439 | Unclassified | 514 |
| 219 | Ga0070711_102000964 | 3300005439 | Unclassified | 510 |
| 220 | Ga0070705_100035279 | 3300005440 | Bacteria | 2802 |
| 221 | Ga0070705_100098129 | 3300005440 | Bacteria | 1843 |
| 222 | Ga0070705_100176112 | 3300005440 | Bacteria | 1444 |
| 223 | Ga0070705_100300175 | 3300005440 | Unclassified | 1150 |
| 224 | Ga0070705_100332086 | 3300005440 | Bacteria | 1102 |
| 225 | Ga0070705_101002997 | 3300005440 | Unclassified | 678 |
| 226 | Ga0070700_100003660 | 3300005441 | Bacteria | 7944 |
| 227 | Ga0070700_100458768 | 3300005441 | Unclassified | 971 |
| 228 | Ga0070694_100047799 | 3300005444 | Bacteria | 2877 |
| 229 | Ga0070694_100206737 | 3300005444 | Bacteria | 1466 |
| 230 | Ga0070708_100003581 | 3300005445 | Bacteria | 12183 |
| 231 | Ga0070708_100057410 | 3300005445 | Bacteria | 3465 |
| 232 | Ga0070708_100071203 | 3300005445 | Bacteria | 3129 |
| 233 | Ga0070708_100094148 | 3300005445 | Bacteria | 2733 |
| 234 | Ga0070708_100109539 | 3300005445 | Bacteria | 2537 |
| 235 | Ga0070708_100147839 | 3300005445 | Bacteria | 2184 |
| 236 | Ga0070708_100204579 | 3300005445 | Bacteria | 1849 |
| 237 | Ga0070708_100372965 | 3300005445 | Unclassified | 1345 |
| 238 | Ga0070708_100469463 | 3300005445 | Bacteria | 1187 |
| 239 | Ga0070708_100700962 | 3300005445 | Bacteria | 953 |
| 240 | Ga0070708_100856679 | 3300005445 | Unclassified | 854 |
| 241 | Ga0070708_100958394 | 3300005445 | Unclassified | 803 |
| 242 | Ga0070708_101967356 | 3300005445 | Unclassified | 541 |
| 243 | Ga0070663_100524402 | 3300005455 | Bacteria | 987 |
| 244 | Ga0070663_100528518 | 3300005455 | Unclassified | 983 |
| 245 | Ga0070663_100714757 | 3300005455 | Bacteria | 853 |
| 246 | Ga0070663_100896687 | 3300005455 | Unclassified | 766 |
| 247 | Ga0070678_100192276 | 3300005456 | Bacteria | 1678 |
| 248 | Ga0070678_100346738 | 3300005456 | Bacteria | 1275 |
| 249 | Ga0070678_100399598 | 3300005456 | Unclassified | 1193 |
| 250 | Ga0070678_100585095 | 3300005456 | Bacteria | 995 |
| 251 | Ga0070678_100699967 | 3300005456 | Bacteria | 913 |
| 252 | Ga0070678_101641204 | 3300005456 | Unclassified | 604 |
| 253 | Ga0070662_100007763 | 3300005457 | Bacteria | 6969 |
| 254 | Ga0070662_100016152 | 3300005457 | Bacteria | 5009 |
| 255 | Ga0070662_100037174 | 3300005457 | Bacteria | 3450 |
| 256 | Ga0070662_100095014 | 3300005457 | Bacteria | 2246 |
| 257 | Ga0070662_100099149 | 3300005457 | Unclassified | 2202 |
| 258 | Ga0070662_100240971 | 3300005457 | Bacteria | 1450 |
| 259 | Ga0070662_100365989 | 3300005457 | Unclassified | 1184 |
| 260 | Ga0070662_100579263 | 3300005457 | Unclassified | 942 |
| 261 | Ga0070662_100586305 | 3300005457 | Unclassified | 937 |
| 262 | Ga0070662_101544927 | 3300005457 | Bacteria | 573 |
| 263 | Ga0070662_101696171 | 3300005457 | Bacteria | 546 |
| 264 | Ga0070681_10687646 | 3300005458 | Bacteria | 938 |
| 265 | Ga0070681_10964939 | 3300005458 | Unclassified | 772 |
| 266 | Ga0068867_100212037 | 3300005459 | Bacteria | 1556 |
| 267 | Ga0068867_100383797 | 3300005459 | Bacteria | 1181 |
| 268 | Ga0068867_100489945 | 3300005459 | Bacteria | 1055 |
| 269 | Ga0068867_100834244 | 3300005459 | Bacteria | 825 |
| 270 | Ga0070685_10028429 | 3300005466 | Unclassified | 3097 |
| 271 | Ga0070685_10405925 | 3300005466 | Unclassified | 945 |
| 272 | Ga0070685_11030439 | 3300005466 | Unclassified | 619 |
| 273 | Ga0070706_100020444 | 3300005467 | Bacteria | 6102 |
| 274 | Ga0070706_100020521 | 3300005467 | Bacteria | 6089 |
| 275 | Ga0070706_100025982 | 3300005467 | Bacteria | 5388 |
| 276 | Ga0070706_100078781 | 3300005467 | Bacteria | 3050 |
| 277 | Ga0070706_100193232 | 3300005467 | Bacteria | 1902 |
| 278 | Ga0070706_100283190 | 3300005467 | Bacteria | 1547 |
| 279 | Ga0070706_100461289 | 3300005467 | Bacteria | 1182 |
| 280 | Ga0070706_100594887 | 3300005467 | Unclassified | 1028 |
| 281 | Ga0070706_100790315 | 3300005467 | Unclassified | 879 |
| 282 | Ga0070706_100939008 | 3300005467 | Unclassified | 798 |
| 283 | Ga0070707_100016188 | 3300005468 | Bacteria | 6997 |
| 284 | Ga0070707_100030502 | 3300005468 | Bacteria | 5134 |
| 285 | Ga0070707_100032046 | 3300005468 | Bacteria | 5006 |
| 286 | Ga0070707_100039193 | 3300005468 | Bacteria | 4529 |
| 287 | Ga0070707_100226431 | 3300005468 | Bacteria | 1821 |
| 288 | Ga0070707_100311609 | 3300005468 | Unclassified | 1530 |
| 289 | Ga0070707_100454279 | 3300005468 | Bacteria | 1242 |
| 290 | Ga0070707_100564921 | 3300005468 | Bacteria | 1100 |
| 291 | Ga0070707_100753710 | 3300005468 | Bacteria | 937 |
| 292 | Ga0070707_101140792 | 3300005468 | Unclassified | 745 |
| 293 | Ga0070707_101276289 | 3300005468 | Unclassified | 701 |
| 294 | Ga0070707_101300077 | 3300005468 | Bacteria | 694 |
| 295 | Ga0070698_100001836 | 3300005471 | Bacteria | 23657 |
| 296 | Ga0070698_100032196 | 3300005471 | Bacteria | 5431 |
| 297 | Ga0070698_100086365 | 3300005471 | Bacteria | 3123 |
| 298 | Ga0070698_100225558 | 3300005471 | Bacteria | 1807 |
| 299 | Ga0070698_100368308 | 3300005471 | Unclassified | 1369 |
| 300 | Ga0070698_100584666 | 3300005471 | Bacteria | 1057 |
| 301 | Ga0070699_100027581 | 3300005518 | Bacteria | 4897 |
| 302 | Ga0070699_100171466 | 3300005518 | Bacteria | 1923 |
| 303 | Ga0070699_100291268 | 3300005518 | Unclassified | 1464 |
| 304 | Ga0070699_100307974 | 3300005518 | Bacteria | 1422 |
| 305 | Ga0070699_101112176 | 3300005518 | Unclassified | 725 |
| 306 | Ga0070699_101327060 | 3300005518 | Unclassified | 660 |
| 307 | Ga0070699_101775268 | 3300005518 | Unclassified | 565 |
| 308 | Ga0070699_102098553 | 3300005518 | Unclassified | 516 |
| 309 | Ga0070679_100399447 | 3300005530 | Bacteria | 1320 |
| 310 | Ga0070679_100949578 | 3300005530 | Unclassified | 803 |
| 311 | Ga0070679_101214875 | 3300005530 | Unclassified | 699 |
| 312 | Ga0070679_101287559 | 3300005530 | Unclassified | 677 |
| 313 | Ga0070684_100001312 | 3300005535 | Bacteria | 17819 |
| 314 | Ga0070684_100029216 | 3300005535 | Bacteria | 4670 |
| 315 | Ga0070684_100188477 | 3300005535 | Bacteria | 1876 |
| 316 | Ga0070684_100440346 | 3300005535 | Unclassified | 1204 |
| 317 | Ga0070697_100002201 | 3300005536 | Bacteria | 14963 |
| 318 | Ga0070697_100002768 | 3300005536 | Bacteria | 13496 |
| 319 | Ga0070697_100045287 | 3300005536 | Unclassified | 3565 |
| 320 | Ga0070697_100113122 | 3300005536 | Bacteria | 2264 |
| 321 | Ga0070697_100242433 | 3300005536 | Bacteria | 1539 |
| 322 | Ga0070697_100245790 | 3300005536 | Bacteria | 1529 |
| 323 | Ga0070697_100326741 | 3300005536 | Unclassified | 1322 |
| 324 | Ga0070697_100329225 | 3300005536 | Unclassified | 1317 |
| 325 | Ga0070697_100420599 | 3300005536 | Bacteria | 1161 |
| 326 | Ga0070697_100423823 | 3300005536 | Bacteria | 1157 |
| 327 | Ga0070697_100483148 | 3300005536 | Unclassified | 1082 |
| 328 | Ga0070697_101352537 | 3300005536 | Unclassified | 636 |
| 329 | Ga0070697_101574173 | 3300005536 | Unclassified | 588 |
| 330 | Ga0070697_101625032 | 3300005536 | Unclassified | 578 |
| 331 | Ga0070697_101780141 | 3300005536 | Unclassified | 551 |
| 332 | Ga0070697_101906263 | 3300005536 | Unclassified | 532 |
| 333 | Ga0070697_102007451 | 3300005536 | Unclassified | 518 |
| 334 | Ga0068853_100107206 | 3300005539 | Bacteria | 2477 |
| 335 | Ga0070672_100000353 | 3300005543 | Bacteria | 26400 |
| 336 | Ga0070672_100004247 | 3300005543 | Bacteria | 9368 |
| 337 | Ga0070672_100050273 | 3300005543 | Bacteria | 3246 |
| 338 | Ga0070672_100254174 | 3300005543 | Bacteria | 1481 |
| 339 | Ga0070672_100280675 | 3300005543 | Unclassified | 1408 |
| 340 | Ga0070672_100484203 | 3300005543 | Bacteria | 1069 |
| 341 | Ga0070672_100574021 | 3300005543 | Unclassified | 981 |
| 342 | Ga0070672_101107711 | 3300005543 | Bacteria | 704 |
| 343 | Ga0070672_101129499 | 3300005543 | Bacteria | 697 |
| 344 | Ga0070672_102163394 | 3300005543 | Unclassified | 501 |
| 345 | Ga0070686_100601766 | 3300005544 | Bacteria | 866 |
| 346 | Ga0070686_100876519 | 3300005544 | Unclassified | 729 |
| 347 | Ga0070696_100058415 | 3300005546 | Bacteria | 2693 |
| 348 | Ga0070696_101129055 | 3300005546 | Bacteria | 660 |
| 349 | Ga0070696_101979962 | 3300005546 | Bacteria | 506 |
| 350 | Ga0070693_100807177 | 3300005547 | Unclassified | 696 |
| 351 | Ga0070665_100008787 | 3300005548 | Bacteria | 10223 |
| 352 | Ga0070665_100024438 | 3300005548 | Bacteria | 6085 |
| 353 | Ga0070665_100070912 | 3300005548 | Bacteria | 3491 |
| 354 | Ga0070665_100145325 | 3300005548 | Bacteria | 2375 |
| 355 | Ga0070665_100147588 | 3300005548 | Bacteria | 2355 |
| 356 | Ga0070665_100484511 | 3300005548 | Unclassified | 1248 |
| 357 | Ga0070665_100753700 | 3300005548 | Unclassified | 987 |
| 358 | Ga0070665_101338704 | 3300005548 | Bacteria | 726 |
| 359 | Ga0070704_100227148 | 3300005549 | Unclassified | 1520 |
| 360 | Ga0070704_100517147 | 3300005549 | Bacteria | 1038 |
| 361 | Ga0070704_102075988 | 3300005549 | Unclassified | 528 |
| 362 | Ga0068855_102313345 | 3300005563 | Bacteria | 538 |
| 363 | Ga0070664_100121453 | 3300005564 | Bacteria | 2288 |
| 364 | Ga0070664_100311564 | 3300005564 | Bacteria | 1424 |
| 365 | Ga0070664_100598245 | 3300005564 | Bacteria | 1022 |
| 366 | Ga0070664_100687425 | 3300005564 | Unclassified | 952 |
| 367 | Ga0070664_101435616 | 3300005564 | Unclassified | 653 |
| 368 | Ga0068857_101242883 | 3300005577 | Bacteria | 722 |
| 369 | Ga0068856_100062548 | 3300005614 | Bacteria | 3677 |
| 370 | Ga0068856_100237795 | 3300005614 | Unclassified | 1837 |
| 371 | Ga0068856_100402187 | 3300005614 | Bacteria | 1389 |
| 372 | Ga0068856_101616404 | 3300005614 | Unclassified | 661 |
| 373 | Ga0068856_102303089 | 3300005614 | Unclassified | 547 |
| 374 | Ga0070702_100018870 | 3300005615 | Bacteria | 3585 |
| 375 | Ga0070702_100470434 | 3300005615 | Bacteria | 916 |
| 376 | Ga0070702_100720088 | 3300005615 | Bacteria | 763 |
| 377 | Ga0068852_100383840 | 3300005616 | Bacteria | 1379 |
| 378 | Ga0068852_100902141 | 3300005616 | Bacteria | 901 |
| 379 | Ga0068852_102776274 | 3300005616 | Unclassified | 508 |
| 380 | Ga0068859_100326644 | 3300005617 | Bacteria | 1628 |
| 381 | Ga0068866_10041728 | 3300005718 | Bacteria | 2278 |
| 382 | Ga0068866_10099689 | 3300005718 | Bacteria | 1600 |
| 383 | Ga0068866_10170873 | 3300005718 | Unclassified | 1276 |
| 384 | Ga0068866_10258928 | 3300005718 | Bacteria | 1068 |
| 385 | Ga0068866_10440135 | 3300005718 | Unclassified | 850 |
| 386 | Ga0068861_100173761 | 3300005719 | Unclassified | 1788 |
| 387 | Ga0068861_100549046 | 3300005719 | Unclassified | 1053 |
| 388 | Ga0068861_102070470 | 3300005719 | Unclassified | 569 |
| 389 | Ga0068851_10407291 | 3300005834 | Bacteria | 801 |
| 390 | Ga0068863_100007967 | 3300005841 | Bacteria | 10355 |
| 391 | Ga0068863_100722959 | 3300005841 | Bacteria | 990 |
| 392 | Ga0068858_100168633 | 3300005842 | Unclassified | 2064 |
| 393 | Ga0068858_100283900 | 3300005842 | Bacteria | 1576 |
| 394 | Ga0068858_100347541 | 3300005842 | Bacteria | 1420 |
| 395 | Ga0068858_102379344 | 3300005842 | Unclassified | 523 |
| 396 | Ga0068860_100010603 | 3300005843 | Bacteria | 9101 |
| 397 | Ga0068860_100174781 | 3300005843 | Bacteria | 2076 |
| 398 | Ga0068860_100244584 | 3300005843 | Bacteria | 1745 |
| 399 | Ga0068860_100806876 | 3300005843 | Unclassified | 952 |
| 400 | Ga0068860_101101196 | 3300005843 | Unclassified | 814 |
| 401 | Ga0068860_101420721 | 3300005843 | Unclassified | 715 |
| 402 | Ga0068860_102157230 | 3300005843 | Unclassified | 578 |
| 403 | Ga0068862_100008330 | 3300005844 | Bacteria | 8579 |
| 404 | Ga0068862_100180595 | 3300005844 | Bacteria | 1894 |
| 405 | Ga0068862_100258378 | 3300005844 | Bacteria | 1589 |
| 406 | Ga0068862_101487649 | 3300005844 | Unclassified | 682 |
| 407 | Ga0068862_101842946 | 3300005844 | Unclassified | 614 |
| 408 | Ga0081455_10000328 | 3300005937 | Bacteria | 62204 |
| 409 | Ga0081455_10001697 | 3300005937 | Bacteria | 26660 |
| 410 | Ga0081455_10021927 | 3300005937 | Bacteria | 5982 |
| 411 | Ga0081455_10031292 | 3300005937 | Bacteria | 4817 |
| 412 | Ga0081455_10040030 | 3300005937 | Bacteria | 4137 |
| 413 | Ga0081455_10040051 | 3300005937 | Bacteria | 4136 |
| 414 | Ga0081455_10151731 | 3300005937 | Unclassified | 1786 |
| 415 | Ga0081455_10170692 | 3300005937 | Bacteria | 1657 |
| 416 | Ga0081455_10884439 | 3300005937 | Bacteria | 556 |
| 417 | Ga0081455_10887284 | 3300005937 | Unclassified | 555 |
| 418 | Ga0081538_10334323 | 3300005981 | Unclassified | 550 |
| 419 | Ga0081540_1000036 | 3300005983 | Bacteria | 140805 |
| 420 | Ga0081540_1032359 | 3300005983 | Bacteria | 2857 |
| 421 | Ga0081540_1041372 | 3300005983 | Bacteria | 2390 |
| 422 | Ga0081540_1053610 | 3300005983 | Bacteria | 1976 |
| 423 | Ga0081540_1075382 | 3300005983 | Bacteria | 1542 |
| 424 | Ga0081539_10000014 | 3300005985 | Bacteria | 411270 |
| 425 | Ga0081539_10157760 | 3300005985 | Bacteria | 1085 |
| 426 | Ga0070717_10028090 | 3300006028 | Bacteria | 4500 |
| 427 | Ga0070717_10030233 | 3300006028 | Bacteria | 4352 |
| 428 | Ga0070717_10067091 | 3300006028 | Bacteria | 2984 |
| 429 | Ga0070717_10297754 | 3300006028 | Bacteria | 1434 |
| 430 | Ga0070717_10495388 | 3300006028 | Unclassified | 1104 |
| 431 | Ga0070717_10708003 | 3300006028 | Unclassified | 915 |
| 432 | Ga0070715_10020578 | 3300006163 | Bacteria | 2547 |
| 433 | Ga0070715_10036615 | 3300006163 | Bacteria | 2025 |
| 434 | Ga0070715_10100296 | 3300006163 | Unclassified | 1349 |
| 435 | Ga0070715_10178518 | 3300006163 | Unclassified | 1063 |
| 436 | Ga0070715_10242314 | 3300006163 | Bacteria | 938 |
| 437 | Ga0070715_11000156 | 3300006163 | Unclassified | 521 |
| 438 | Ga0070716_100063071 | 3300006173 | Bacteria | 2150 |
| 439 | Ga0070716_100094785 | 3300006173 | Bacteria | 1815 |
| 440 | Ga0070716_100608707 | 3300006173 | Unclassified | 823 |
| 441 | Ga0070716_100668291 | 3300006173 | Bacteria | 790 |
| 442 | Ga0070716_100888438 | 3300006173 | Bacteria | 697 |
| 443 | Ga0070716_101035850 | 3300006173 | Bacteria | 651 |
| 444 | Ga0070716_101537437 | 3300006173 | Unclassified | 545 |
| 445 | Ga0070712_100010939 | 3300006175 | Bacteria | 5740 |
| 446 | Ga0070712_100023808 | 3300006175 | Bacteria | 4049 |
| 447 | Ga0070712_100052822 | 3300006175 | Bacteria | 2836 |
| 448 | Ga0070712_100095268 | 3300006175 | Bacteria | 2190 |
| 449 | Ga0070712_100123126 | 3300006175 | Bacteria | 1954 |
| 450 | Ga0070712_100151058 | 3300006175 | Bacteria | 1783 |
| 451 | Ga0070712_100273381 | 3300006175 | Bacteria | 1358 |
| 452 | Ga0070712_100472181 | 3300006175 | Unclassified | 1047 |
| 453 | Ga0070712_100547686 | 3300006175 | Bacteria | 974 |
| 454 | Ga0070712_100568278 | 3300006175 | Unclassified | 957 |
| 455 | Ga0070712_100584958 | 3300006175 | Unclassified | 943 |
| 456 | Ga0070712_100598006 | 3300006175 | Bacteria | 933 |
| 457 | Ga0070712_100609873 | 3300006175 | Unclassified | 924 |
| 458 | Ga0070712_101025854 | 3300006175 | Unclassified | 714 |
| 459 | Ga0070712_101037364 | 3300006175 | Unclassified | 710 |
| 460 | Ga0070712_101141531 | 3300006175 | Unclassified | 677 |
| 461 | Ga0070712_101295793 | 3300006175 | Unclassified | 635 |
| 462 | Ga0070712_101918852 | 3300006175 | Unclassified | 519 |
| 463 | Ga0070712_101962750 | 3300006175 | Unclassified | 512 |
| 464 | Ga0097621_100014055 | 3300006237 | Bacteria | 5982 |
| 465 | Ga0097621_100018403 | 3300006237 | Bacteria | 5335 |
| 466 | Ga0097621_100040994 | 3300006237 | Bacteria | 3725 |
| 467 | Ga0097621_100318606 | 3300006237 | Bacteria | 1377 |
| 468 | Ga0097621_100815610 | 3300006237 | Bacteria | 865 |
| 469 | Ga0097621_101322106 | 3300006237 | Bacteria | 681 |
| 470 | Ga0097621_102254817 | 3300006237 | Unclassified | 521 |
| 471 | Ga0068871_100038389 | 3300006358 | Bacteria | 3824 |
| 472 | Ga0068871_100096963 | 3300006358 | Bacteria | 2464 |
| 473 | Ga0068871_100138801 | 3300006358 | Bacteria | 2066 |
| 474 | Ga0068871_100191878 | 3300006358 | Bacteria | 1760 |
| 475 | Ga0068871_100424331 | 3300006358 | Bacteria | 1188 |
| 476 | Ga0068871_101234300 | 3300006358 | Unclassified | 702 |
| 477 | Ga0068871_101285743 | 3300006358 | Unclassified | 688 |
| 478 | Ga0068871_101867525 | 3300006358 | Bacteria | 571 |
| 479 | Ga0075428_100095839 | 3300006844 | Bacteria | 3235 |
| 480 | Ga0075428_100416463 | 3300006844 | Unclassified | 1440 |
| 481 | Ga0075431_100816203 | 3300006847 | Bacteria | 905 |
| 482 | Ga0075433_10756944 | 3300006852 | Unclassified | 850 |
| 483 | Ga0075434_100255607 | 3300006871 | Bacteria | 1771 |
| 484 | Ga0075434_100738231 | 3300006871 | Bacteria | 1002 |
| 485 | Ga0075434_101015835 | 3300006871 | Unclassified | 843 |
| 486 | Ga0075434_101178183 | 3300006871 | Unclassified | 778 |
| 487 | Ga0075434_101790846 | 3300006871 | Unclassified | 621 |
| 488 | Ga0068865_100017414 | 3300006881 | Bacteria | 4621 |
| 489 | Ga0068865_100079884 | 3300006881 | Bacteria | 2344 |
| 490 | Ga0068865_100343715 | 3300006881 | Unclassified | 1207 |
| 491 | Ga0068865_100477358 | 3300006881 | Bacteria | 1036 |
| 492 | Ga0068865_100531144 | 3300006881 | Bacteria | 985 |
| 493 | Ga0068865_100713279 | 3300006881 | Unclassified | 858 |
| 494 | Ga0068865_101858950 | 3300006881 | Unclassified | 545 |
| 495 | Ga0075436_100089519 | 3300006914 | Bacteria | 2139 |
| 496 | Ga0075436_100257488 | 3300006914 | Bacteria | 1244 |
| 497 | Ga0075436_100283948 | 3300006914 | Unclassified | 1184 |
| 498 | Ga0075436_100313760 | 3300006914 | Bacteria | 1125 |
| 499 | Ga0075436_100633678 | 3300006914 | Bacteria | 789 |
| 500 | Ga0097620_100326689 | 3300006931 | Bacteria | 1628 |
| 501 | Ga0075435_100988217 | 3300007076 | Bacteria | 735 |
| 502 | Ga0075435_101892357 | 3300007076 | Bacteria | 524 |
| 503 | Ga0075435_101969206 | 3300007076 | Unclassified | 513 |
| 504 | Ga0099794_10020565 | 3300007265 | Bacteria | 2989 |
| 505 | Ga0099794_10145936 | 3300007265 | Unclassified | 1200 |
| 506 | Ga0099794_10325814 | 3300007265 | Bacteria | 797 |
| 507 | Ga0099795_10021968 | 3300007788 | Bacteria | 2101 |
| 508 | Ga0099795_10056361 | 3300007788 | Unclassified | 1445 |
| 509 | Ga0105240_10636431 | 3300009093 | Bacteria | 1171 |
| 510 | Ga0105240_10784265 | 3300009093 | Bacteria | 1033 |
| 511 | Ga0105240_11038689 | 3300009093 | Bacteria | 875 |
| 512 | Ga0105240_12244662 | 3300009093 | Bacteria | 566 |
| 513 | Ga0111539_10676556 | 3300009094 | Unclassified | 1201 |
| 514 | Ga0111539_10865884 | 3300009094 | Bacteria | 1051 |
| 515 | Ga0111539_11300927 | 3300009094 | Bacteria | 844 |
| 516 | Ga0111539_12853814 | 3300009094 | Bacteria | 559 |
| 517 | Ga0105245_10006614 | 3300009098 | Bacteria | 10180 |
| 518 | Ga0105245_10030852 | 3300009098 | Bacteria | 4740 |
| 519 | Ga0105245_10124129 | 3300009098 | Unclassified | 2414 |
| 520 | Ga0105245_10192863 | 3300009098 | Bacteria | 1952 |
| 521 | Ga0105245_10726772 | 3300009098 | Unclassified | 1027 |
| 522 | Ga0105245_11078215 | 3300009098 | Bacteria | 849 |
| 523 | Ga0105245_11740269 | 3300009098 | Unclassified | 676 |
| 524 | Ga0105245_12552963 | 3300009098 | Unclassified | 564 |
| 525 | Ga0105247_10223822 | 3300009101 | Unclassified | 1275 |
| 526 | Ga0114129_10003445 | 3300009147 | Bacteria | 22244 |
| 527 | Ga0114129_10071980 | 3300009147 | Bacteria | 4820 |
| 528 | Ga0114129_10218235 | 3300009147 | Bacteria | 2574 |
| 529 | Ga0114129_11432233 | 3300009147 | Unclassified | 851 |
| 530 | Ga0105243_10272788 | 3300009148 | Bacteria | 1519 |
| 531 | Ga0105243_11229588 | 3300009148 | Unclassified | 763 |
| 532 | Ga0105243_11380156 | 3300009148 | Bacteria | 724 |
| 533 | Ga0105241_11846708 | 3300009174 | Unclassified | 591 |
| 534 | Ga0105241_11992440 | 3300009174 | Unclassified | 571 |
| 535 | Ga0105242_10043482 | 3300009176 | Bacteria | 3634 |
| 536 | Ga0105242_10229921 | 3300009176 | Bacteria | 1662 |
| 537 | Ga0105242_10328839 | 3300009176 | Bacteria | 1405 |
| 538 | Ga0105242_10549724 | 3300009176 | Bacteria | 1107 |
| 539 | Ga0105242_10996553 | 3300009176 | Unclassified | 845 |
| 540 | Ga0105248_11169531 | 3300009177 | Bacteria | 870 |
| 541 | Ga0105248_11193886 | 3300009177 | Bacteria | 860 |
| 542 | Ga0105248_11410730 | 3300009177 | Bacteria | 788 |
| 543 | Ga0105248_12002321 | 3300009177 | Unclassified | 658 |
| 544 | Ga0105237_10444563 | 3300009545 | Bacteria | 1302 |
| 545 | Ga0105237_10528861 | 3300009545 | Bacteria | 1186 |
| 546 | Ga0105237_10820507 | 3300009545 | Unclassified | 937 |
| 547 | Ga0105249_10011097 | 3300009553 | Bacteria | 7914 |
| 548 | Ga0105249_10470133 | 3300009553 | Bacteria | 1299 |
| 549 | Ga0105249_10544884 | 3300009553 | Bacteria | 1210 |
| 550 | Ga0105249_11320275 | 3300009553 | Unclassified | 793 |
| 551 | Ga0105249_11853859 | 3300009553 | Bacteria | 676 |
| 552 | Ga0105249_13178574 | 3300009553 | Bacteria | 528 |
| 553 | Ga0105249_13388451 | 3300009553 | Unclassified | 513 |
| 554 | Ga0099796_10005301 | 3300010159 | Bacteria | 3206 |
| 555 | Ga0099796_10061942 | 3300010159 | Unclassified | 1329 |
| 556 | Ga0099796_10094571 | 3300010159 | Unclassified | 1116 |
| 557 | Ga0099796_10346725 | 3300010159 | Unclassified | 639 |
| 558 | Ga0105239_10070002 | 3300010375 | Bacteria | 3853 |
| 559 | Ga0105239_10225186 | 3300010375 | Bacteria | 2103 |
| 560 | Ga0105239_10292714 | 3300010375 | Bacteria | 1833 |
| 561 | Ga0105239_10518088 | 3300010375 | Bacteria | 1356 |
| 562 | Ga0105239_10823425 | 3300010375 | Bacteria | 1064 |
| 563 | Ga0105239_10991354 | 3300010375 | Bacteria | 966 |
| 564 | Ga0105239_12290191 | 3300010375 | Bacteria | 629 |
| 565 | Ga0105246_10459510 | 3300011119 | Bacteria | 1072 |
| 566 | Ga0105246_10874569 | 3300011119 | Unclassified | 804 |
| 567 | Ga0157344_1016044 | 3300012476 | Unclassified | 601 |
| 568 | Ga0157343_1016333 | 3300012488 | Bacteria | 629 |
| 569 | Ga0157339_1012990 | 3300012505 | Unclassified | 790 |
| 570 | Ga0157324_1023983 | 3300012506 | Bacteria | 644 |
| 571 | Ga0157315_1041195 | 3300012508 | Unclassified | 585 |
| 572 | Ga0157315_1060043 | 3300012508 | Unclassified | 534 |
| 573 | Ga0157373_10396341 | 3300013100 | Unclassified | 989 |
| 574 | Ga0157373_10698598 | 3300013100 | Bacteria | 743 |
| 575 | Ga0157371_10265362 | 3300013102 | Bacteria | 1238 |
| 576 | Ga0157371_10550303 | 3300013102 | Bacteria | 855 |
| 577 | Ga0157371_11002497 | 3300013102 | Bacteria | 637 |
| 578 | Ga0157371_11321911 | 3300013102 | Unclassified | 558 |
| 579 | Ga0157370_10322896 | 3300013104 | Bacteria | 1424 |
| 580 | Ga0157369_10117876 | 3300013105 | Bacteria | 2818 |
| 581 | Ga0157374_10001473 | 3300013296 | Bacteria | 19879 |
| 582 | Ga0157374_10005577 | 3300013296 | Bacteria | 10597 |
| 583 | Ga0157374_10019745 | 3300013296 | Bacteria | 5970 |
| 584 | Ga0157374_10033688 | 3300013296 | Bacteria | 4675 |
| 585 | Ga0157374_10094662 | 3300013296 | Bacteria | 2855 |
| 586 | Ga0157374_10103065 | 3300013296 | Bacteria | 2738 |
| 587 | Ga0157374_10120813 | 3300013296 | Bacteria | 2528 |
| 588 | Ga0157374_10130202 | 3300013296 | Bacteria | 2435 |
| 589 | Ga0157374_10222850 | 3300013296 | Bacteria | 1851 |
| 590 | Ga0157374_10549440 | 3300013296 | Bacteria | 1163 |
| 591 | Ga0157374_10566828 | 3300013296 | Bacteria | 1144 |
| 592 | Ga0157374_11011256 | 3300013296 | Unclassified | 851 |
| 593 | Ga0157374_11551143 | 3300013296 | Bacteria | 686 |
| 594 | Ga0157374_11573636 | 3300013296 | Bacteria | 681 |
| 595 | Ga0157374_12237170 | 3300013296 | Unclassified | 574 |
| 596 | Ga0157374_12818952 | 3300013296 | Unclassified | 514 |
| 597 | Ga0157378_10005509 | 3300013297 | Bacteria | 11097 |
| 598 | Ga0157378_10009019 | 3300013297 | Bacteria | 8684 |
| 599 | Ga0157378_10009704 | 3300013297 | Bacteria | 8385 |
| 600 | Ga0157378_10026553 | 3300013297 | Bacteria | 5104 |
| 601 | Ga0157378_10041332 | 3300013297 | Bacteria | 4089 |
| 602 | Ga0157378_10066060 | 3300013297 | Unclassified | 3239 |
| 603 | Ga0157378_10141935 | 3300013297 | Bacteria | 2231 |
| 604 | Ga0157378_10190256 | 3300013297 | Unclassified | 1935 |
| 605 | Ga0157378_10237043 | 3300013297 | Bacteria | 1741 |
| 606 | Ga0157378_10292746 | 3300013297 | Bacteria | 1573 |
| 607 | Ga0157378_10338887 | 3300013297 | Bacteria | 1466 |
| 608 | Ga0157378_10350425 | 3300013297 | Bacteria | 1442 |
| 609 | Ga0157378_10644156 | 3300013297 | Unclassified | 1075 |
| 610 | Ga0157378_10668405 | 3300013297 | Unclassified | 1056 |
| 611 | Ga0157378_10758292 | 3300013297 | Bacteria | 994 |
| 612 | Ga0157378_10853698 | 3300013297 | Unclassified | 939 |
| 613 | Ga0157378_10891673 | 3300013297 | Unclassified | 920 |
| 614 | Ga0157378_11168955 | 3300013297 | Bacteria | 808 |
| 615 | Ga0157378_11552705 | 3300013297 | Unclassified | 707 |
| 616 | Ga0157378_11849135 | 3300013297 | Bacteria | 652 |
| 617 | Ga0163162_10003249 | 3300013306 | Bacteria | 15541 |
| 618 | Ga0163162_10014121 | 3300013306 | Bacteria | 7805 |
| 619 | Ga0163162_10017445 | 3300013306 | Bacteria | 7024 |
| 620 | Ga0163162_10105792 | 3300013306 | Bacteria | 2908 |
| 621 | Ga0163162_10118628 | 3300013306 | Bacteria | 2748 |
| 622 | Ga0163162_10300351 | 3300013306 | Bacteria | 1738 |
| 623 | Ga0163162_10609774 | 3300013306 | Bacteria | 1217 |
| 624 | Ga0163162_10824833 | 3300013306 | Bacteria | 1044 |
| 625 | Ga0163162_11278146 | 3300013306 | Unclassified | 833 |
| 626 | Ga0163162_11548759 | 3300013306 | Unclassified | 756 |
| 627 | Ga0163162_12295981 | 3300013306 | Bacteria | 620 |
| 628 | Ga0163162_12699018 | 3300013306 | Unclassified | 572 |
| 629 | Ga0163162_12904674 | 3300013306 | Bacteria | 551 |
| 630 | Ga0157372_10037163 | 3300013307 | Bacteria | 5368 |
| 631 | Ga0157372_10135936 | 3300013307 | Bacteria | 2831 |
| 632 | Ga0157372_10198123 | 3300013307 | Bacteria | 2326 |
| 633 | Ga0157372_10553780 | 3300013307 | Bacteria | 1341 |
| 634 | Ga0157372_10912415 | 3300013307 | Unclassified | 1019 |
| 635 | Ga0157372_11456901 | 3300013307 | Unclassified | 789 |
| 636 | Ga0157375_10000287 | 3300013308 | Bacteria | 45998 |
| 637 | Ga0157375_10001868 | 3300013308 | Bacteria | 18135 |
| 638 | Ga0157375_10007782 | 3300013308 | Bacteria | 9374 |
| 639 | Ga0157375_10136768 | 3300013308 | Bacteria | 2575 |
| 640 | Ga0157375_10138523 | 3300013308 | Bacteria | 2559 |
| 641 | Ga0157375_10449240 | 3300013308 | Unclassified | 1455 |
| 642 | Ga0157375_10708632 | 3300013308 | Bacteria | 1160 |
| 643 | Ga0157375_10998323 | 3300013308 | Unclassified | 977 |
| 644 | Ga0157375_11011837 | 3300013308 | Unclassified | 970 |
| 645 | Ga0157375_11529705 | 3300013308 | Unclassified | 788 |
| 646 | Ga0157375_11890947 | 3300013308 | Unclassified | 708 |
| 647 | Ga0163163_10175148 | 3300014325 | Unclassified | 2192 |
| 648 | Ga0163163_11302229 | 3300014325 | Unclassified | 789 |
| 649 | Ga0163163_11869470 | 3300014325 | Bacteria | 660 |
| 650 | Ga0163163_13233606 | 3300014325 | Unclassified | 508 |
| 651 | Ga0157377_10190634 | 3300014745 | Bacteria | 1295 |
| 652 | Ga0157377_10234421 | 3300014745 | Bacteria | 1182 |
| 653 | Ga0157377_10334221 | 3300014745 | Unclassified | 1011 |
| 654 | Ga0157377_10608791 | 3300014745 | Unclassified | 780 |
| 655 | Ga0157377_10872791 | 3300014745 | Bacteria | 670 |
| 656 | Ga0157377_11466850 | 3300014745 | Unclassified | 541 |
| 657 | Ga0157379_10005647 | 3300014968 | Bacteria | 10748 |
| 658 | Ga0157379_10178685 | 3300014968 | Bacteria | 1917 |
| 659 | Ga0157379_10362342 | 3300014968 | Unclassified | 1329 |
| 660 | Ga0157379_11131810 | 3300014968 | Unclassified | 751 |
| 661 | Ga0157379_11295907 | 3300014968 | Bacteria | 703 |
| 662 | Ga0157376_10009509 | 3300014969 | Bacteria | 7064 |
| 663 | Ga0157376_10064325 | 3300014969 | Bacteria | 3093 |
| 664 | Ga0157376_10300272 | 3300014969 | Bacteria | 1520 |
| 665 | Ga0157376_10332488 | 3300014969 | Unclassified | 1448 |
| 666 | Ga0157376_10378555 | 3300014969 | Bacteria | 1363 |
| 667 | Ga0157376_10943728 | 3300014969 | Unclassified | 883 |
| 668 | Ga0157376_10950725 | 3300014969 | Bacteria | 880 |
| 669 | Ga0157376_11935218 | 3300014969 | Bacteria | 627 |
| 670 | Ga0157376_12107002 | 3300014969 | Unclassified | 602 |
| 671 | Ga0157376_12876303 | 3300014969 | Unclassified | 521 |
| 672 | Ga0182006_1152729 | 3300015261 | Unclassified | 782 |
| 673 | Ga0182005_1017656 | 3300015265 | Bacteria | 1974 |
| 674 | Ga0163161_10046543 | 3300017792 | Bacteria | 3130 |
| 675 | Ga0163161_10125832 | 3300017792 | Bacteria | 1930 |
| 676 | Ga0163161_10570979 | 3300017792 | Bacteria | 929 |
| 677 | Ga0163161_10710536 | 3300017792 | Bacteria | 838 |
| 678 | Ga0163161_11078881 | 3300017792 | Unclassified | 689 |
| 679 | Ga0213875_10310544 | 3300021388 | Unclassified | 747 |
| 680 | Ga0207666_1005260 | 3300025271 | Bacteria | 1649 |
| 681 | Ga0207666_1008686 | 3300025271 | Bacteria | 1360 |
| 682 | Ga0207673_1000205 | 3300025290 | Bacteria | 5944 |
| 683 | Ga0207673_1000900 | 3300025290 | Unclassified | 3196 |
| 684 | Ga0207673_1005925 | 3300025290 | Unclassified | 1502 |
| 685 | Ga0207673_1006109 | 3300025290 | Bacteria | 1484 |
| 686 | Ga0207673_1028027 | 3300025290 | Bacteria | 775 |
| 687 | Ga0207673_1055722 | 3300025290 | Unclassified | 561 |
| 688 | Ga0207697_10000010 | 3300025315 | Bacteria | 65144 |
| 689 | Ga0207697_10000131 | 3300025315 | Bacteria | 36154 |
| 690 | Ga0207697_10000495 | 3300025315 | Bacteria | 22147 |
| 691 | Ga0207697_10002230 | 3300025315 | Bacteria | 10127 |
| 692 | Ga0207697_10002322 | 3300025315 | Bacteria | 9909 |
| 693 | Ga0207697_10021301 | 3300025315 | Bacteria | 2654 |
| 694 | Ga0207697_10042806 | 3300025315 | Bacteria | 1861 |
| 695 | Ga0207697_10062383 | 3300025315 | Bacteria | 1552 |
| 696 | Ga0207697_10110706 | 3300025315 | Bacteria | 1176 |
| 697 | Ga0207697_10209187 | 3300025315 | Unclassified | 859 |
| 698 | Ga0207697_10229814 | 3300025315 | Unclassified | 819 |
| 699 | Ga0207697_10274420 | 3300025315 | Unclassified | 747 |
| 700 | Ga0207697_10302285 | 3300025315 | Unclassified | 710 |
| 701 | Ga0207697_10374245 | 3300025315 | Bacteria | 633 |
| 702 | Ga0207697_10460044 | 3300025315 | Unclassified | 564 |
| 703 | Ga0207697_10487975 | 3300025315 | Unclassified | 545 |
| 704 | Ga0207653_10001694 | 3300025885 | Bacteria | 7052 |
| 705 | Ga0207682_10024517 | 3300025893 | Bacteria | 2389 |
| 706 | Ga0207692_10115326 | 3300025898 | Unclassified | 1496 |
| 707 | Ga0207692_10123175 | 3300025898 | Bacteria | 1454 |
| 708 | Ga0207692_10472491 | 3300025898 | Unclassified | 792 |
| 709 | Ga0207692_10796278 | 3300025898 | Unclassified | 618 |
| 710 | Ga0207692_11018310 | 3300025898 | Bacteria | 547 |
| 711 | Ga0207642_10073381 | 3300025899 | Bacteria | 1636 |
| 712 | Ga0207642_10142597 | 3300025899 | Unclassified | 1265 |
| 713 | Ga0207642_10626882 | 3300025899 | Bacteria | 672 |
| 714 | Ga0207688_10007718 | 3300025901 | Bacteria | 5860 |
| 715 | Ga0207688_10014566 | 3300025901 | Bacteria | 4271 |
| 716 | Ga0207688_10023688 | 3300025901 | Bacteria | 3364 |
| 717 | Ga0207688_10245931 | 3300025901 | Bacteria | 1082 |
| 718 | Ga0207688_10591109 | 3300025901 | Bacteria | 699 |
| 719 | Ga0207680_10025390 | 3300025903 | Bacteria | 3268 |
| 720 | Ga0207680_10094129 | 3300025903 | Unclassified | 1912 |
| 721 | Ga0207680_10212819 | 3300025903 | Bacteria | 1322 |
| 722 | Ga0207680_10921954 | 3300025903 | Unclassified | 626 |
| 723 | Ga0207647_10022311 | 3300025904 | Unclassified | 4207 |
| 724 | Ga0207647_10616614 | 3300025904 | Bacteria | 597 |
| 725 | Ga0207647_10725049 | 3300025904 | Bacteria | 540 |
| 726 | Ga0207685_10003968 | 3300025905 | Bacteria | 3683 |
| 727 | Ga0207685_10079697 | 3300025905 | Bacteria | 1352 |
| 728 | Ga0207685_10530412 | 3300025905 | Bacteria | 623 |
| 729 | Ga0207685_10607541 | 3300025905 | Unclassified | 587 |
| 730 | Ga0207685_10664344 | 3300025905 | Unclassified | 565 |
| 731 | Ga0207699_10008911 | 3300025906 | Bacteria | 4974 |
| 732 | Ga0207699_10020861 | 3300025906 | Bacteria | 3520 |
| 733 | Ga0207699_10099551 | 3300025906 | Bacteria | 1842 |
| 734 | Ga0207699_10406362 | 3300025906 | Unclassified | 970 |
| 735 | Ga0207699_10761832 | 3300025906 | Bacteria | 710 |
| 736 | Ga0207699_10989558 | 3300025906 | Unclassified | 622 |
| 737 | Ga0207699_11018544 | 3300025906 | Unclassified | 612 |
| 738 | Ga0207645_10001786 | 3300025907 | Bacteria | 17391 |
| 739 | Ga0207645_10002762 | 3300025907 | Bacteria | 13659 |
| 740 | Ga0207645_10004253 | 3300025907 | Bacteria | 10632 |
| 741 | Ga0207645_10004432 | 3300025907 | Bacteria | 10394 |
| 742 | Ga0207645_10133103 | 3300025907 | Bacteria | 1619 |
| 743 | Ga0207645_10245051 | 3300025907 | Bacteria | 1185 |
| 744 | Ga0207645_10252534 | 3300025907 | Bacteria | 1167 |
| 745 | Ga0207645_10363541 | 3300025907 | Bacteria | 969 |
| 746 | Ga0207645_10457105 | 3300025907 | Unclassified | 862 |
| 747 | Ga0207684_10000028 | 3300025910 | Bacteria | 306450 |
| 748 | Ga0207684_10003766 | 3300025910 | Bacteria | 14658 |
| 749 | Ga0207684_10008671 | 3300025910 | Bacteria | 9025 |
| 750 | Ga0207684_10011143 | 3300025910 | Bacteria | 7871 |
| 751 | Ga0207684_10042797 | 3300025910 | Bacteria | 3840 |
| 752 | Ga0207684_10059810 | 3300025910 | Bacteria | 3235 |
| 753 | Ga0207684_10068412 | 3300025910 | Bacteria | 3018 |
| 754 | Ga0207684_10105479 | 3300025910 | Bacteria | 2411 |
| 755 | Ga0207684_10348575 | 3300025910 | Unclassified | 1275 |
| 756 | Ga0207684_10408111 | 3300025910 | Bacteria | 1168 |
| 757 | Ga0207684_10422941 | 3300025910 | Unclassified | 1145 |
| 758 | Ga0207684_10451794 | 3300025910 | Bacteria | 1103 |
| 759 | Ga0207684_10577943 | 3300025910 | Unclassified | 960 |
| 760 | Ga0207684_10756763 | 3300025910 | Bacteria | 823 |
| 761 | Ga0207684_11493755 | 3300025910 | Unclassified | 550 |
| 762 | Ga0207707_10308527 | 3300025912 | Unclassified | 1367 |
| 763 | Ga0207707_10561492 | 3300025912 | Bacteria | 969 |
| 764 | Ga0207671_10363757 | 3300025914 | Bacteria | 1148 |
| 765 | Ga0207671_10448470 | 3300025914 | Bacteria | 1027 |
| 766 | Ga0207693_10000889 | 3300025915 | Bacteria | 26818 |
| 767 | Ga0207693_10006942 | 3300025915 | Bacteria | 9356 |
| 768 | Ga0207693_10019110 | 3300025915 | Bacteria | 5453 |
| 769 | Ga0207693_10021211 | 3300025915 | Bacteria | 5163 |
| 770 | Ga0207693_10032567 | 3300025915 | Bacteria | 4113 |
| 771 | Ga0207693_10035010 | 3300025915 | Bacteria | 3961 |
| 772 | Ga0207693_10090298 | 3300025915 | Bacteria | 2401 |
| 773 | Ga0207693_10278653 | 3300025915 | Unclassified | 1310 |
| 774 | Ga0207693_10393342 | 3300025915 | Unclassified | 1084 |
| 775 | Ga0207693_10490403 | 3300025915 | Bacteria | 959 |
| 776 | Ga0207693_10496489 | 3300025915 | Unclassified | 953 |
| 777 | Ga0207693_10593130 | 3300025915 | Unclassified | 863 |
| 778 | Ga0207663_10002290 | 3300025916 | Bacteria | 9171 |
| 779 | Ga0207663_10135856 | 3300025916 | Bacteria | 1706 |
| 780 | Ga0207663_10396420 | 3300025916 | Bacteria | 1055 |
| 781 | Ga0207663_10472442 | 3300025916 | Bacteria | 970 |
| 782 | Ga0207663_10519887 | 3300025916 | Bacteria | 927 |
| 783 | Ga0207663_10581841 | 3300025916 | Unclassified | 878 |
| 784 | Ga0207663_10633405 | 3300025916 | Bacteria | 843 |
| 785 | Ga0207663_11321577 | 3300025916 | Bacteria | 581 |
| 786 | Ga0207663_11622674 | 3300025916 | Bacteria | 520 |
| 787 | Ga0207660_10167820 | 3300025917 | Bacteria | 1697 |
| 788 | Ga0207662_10000699 | 3300025918 | Bacteria | 15308 |
| 789 | Ga0207662_10010494 | 3300025918 | Bacteria | 5118 |
| 790 | Ga0207662_10074228 | 3300025918 | Unclassified | 2064 |
| 791 | Ga0207662_10080381 | 3300025918 | Bacteria | 1988 |
| 792 | Ga0207662_10309233 | 3300025918 | Bacteria | 1053 |
| 793 | Ga0207662_10325515 | 3300025918 | Bacteria | 1027 |
| 794 | Ga0207657_10214387 | 3300025919 | Bacteria | 1544 |
| 795 | Ga0207657_10860162 | 3300025919 | Bacteria | 699 |
| 796 | Ga0207649_10043554 | 3300025920 | Bacteria | 2745 |
| 797 | Ga0207649_10333051 | 3300025920 | Bacteria | 1119 |
| 798 | Ga0207649_10489834 | 3300025920 | Unclassified | 933 |
| 799 | Ga0207649_10520278 | 3300025920 | Bacteria | 907 |
| 800 | Ga0207649_10605067 | 3300025920 | Unclassified | 843 |
| 801 | Ga0207652_10485669 | 3300025921 | Bacteria | 1112 |
| 802 | Ga0207652_10712104 | 3300025921 | Unclassified | 895 |
| 803 | Ga0207652_11202675 | 3300025921 | Unclassified | 660 |
| 804 | Ga0207646_10000191 | 3300025922 | Bacteria | 83638 |
| 805 | Ga0207646_10005640 | 3300025922 | Bacteria | 13143 |
| 806 | Ga0207646_10009621 | 3300025922 | Bacteria | 9535 |
| 807 | Ga0207646_10010143 | 3300025922 | Bacteria | 9230 |
| 808 | Ga0207646_10028198 | 3300025922 | Bacteria | 5113 |
| 809 | Ga0207646_10051798 | 3300025922 | Unclassified | 3673 |
| 810 | Ga0207646_10085456 | 3300025922 | Bacteria | 2823 |
| 811 | Ga0207646_10121006 | 3300025922 | Bacteria | 2351 |
| 812 | Ga0207646_10171540 | 3300025922 | Bacteria | 1959 |
| 813 | Ga0207646_10207391 | 3300025922 | Unclassified | 1770 |
| 814 | Ga0207646_10260717 | 3300025922 | Unclassified | 1566 |
| 815 | Ga0207646_10308099 | 3300025922 | Unclassified | 1431 |
| 816 | Ga0207646_10413113 | 3300025922 | Bacteria | 1218 |
| 817 | Ga0207646_11037387 | 3300025922 | Bacteria | 723 |
| 818 | Ga0207646_11083370 | 3300025922 | Bacteria | 706 |
| 819 | Ga0207646_11189447 | 3300025922 | Unclassified | 669 |
| 820 | Ga0207646_11657266 | 3300025922 | Unclassified | 550 |
| 821 | Ga0207646_11713471 | 3300025922 | Unclassified | 539 |
| 822 | Ga0207646_11731199 | 3300025922 | Unclassified | 536 |
| 823 | Ga0207681_10004055 | 3300025923 | Bacteria | 9086 |
| 824 | Ga0207681_10088623 | 3300025923 | Bacteria | 2204 |
| 825 | Ga0207681_10116369 | 3300025923 | Unclassified | 1953 |
| 826 | Ga0207681_10234539 | 3300025923 | Unclassified | 1425 |
| 827 | Ga0207681_10441433 | 3300025923 | Bacteria | 1057 |
| 828 | Ga0207681_10655769 | 3300025923 | Unclassified | 870 |
| 829 | Ga0207681_10856794 | 3300025923 | Bacteria | 760 |
| 830 | Ga0207681_11184317 | 3300025923 | Bacteria | 642 |
| 831 | Ga0207681_11224475 | 3300025923 | Bacteria | 631 |
| 832 | Ga0207650_10006836 | 3300025925 | Bacteria | 7782 |
| 833 | Ga0207650_10007428 | 3300025925 | Bacteria | 7468 |
| 834 | Ga0207650_10093277 | 3300025925 | Unclassified | 2304 |
| 835 | Ga0207650_10319489 | 3300025925 | Bacteria | 1271 |
| 836 | Ga0207650_10346946 | 3300025925 | Unclassified | 1220 |
| 837 | Ga0207650_10427224 | 3300025925 | Bacteria | 1100 |
| 838 | Ga0207650_11540295 | 3300025925 | Bacteria | 565 |
| 839 | Ga0207659_10003512 | 3300025926 | Bacteria | 9421 |
| 840 | Ga0207659_10049761 | 3300025926 | Bacteria | 2974 |
| 841 | Ga0207659_10053684 | 3300025926 | Bacteria | 2875 |
| 842 | Ga0207659_10067573 | 3300025926 | Bacteria | 2596 |
| 843 | Ga0207659_10127931 | 3300025926 | Bacteria | 1956 |
| 844 | Ga0207659_10179125 | 3300025926 | Bacteria | 1678 |
| 845 | Ga0207659_10222696 | 3300025926 | Bacteria | 1518 |
| 846 | Ga0207659_10225081 | 3300025926 | Bacteria | 1510 |
| 847 | Ga0207659_10807541 | 3300025926 | Bacteria | 806 |
| 848 | Ga0207687_10095481 | 3300025927 | Bacteria | 2177 |
| 849 | Ga0207687_10694367 | 3300025927 | Unclassified | 863 |
| 850 | Ga0207687_11162978 | 3300025927 | Unclassified | 663 |
| 851 | Ga0207687_11337954 | 3300025927 | Unclassified | 616 |
| 852 | Ga0207687_11504157 | 3300025927 | Unclassified | 578 |
| 853 | Ga0207687_11664935 | 3300025927 | Unclassified | 547 |
| 854 | Ga0207700_10003893 | 3300025928 | Bacteria | 8714 |
| 855 | Ga0207700_10069264 | 3300025928 | Bacteria | 2707 |
| 856 | Ga0207700_10087236 | 3300025928 | Bacteria | 2454 |
| 857 | Ga0207700_10156867 | 3300025928 | Bacteria | 1886 |
| 858 | Ga0207700_10185843 | 3300025928 | Bacteria | 1743 |
| 859 | Ga0207700_10725583 | 3300025928 | Unclassified | 888 |
| 860 | Ga0207664_10112083 | 3300025929 | Bacteria | 2270 |
| 861 | Ga0207664_10122505 | 3300025929 | Bacteria | 2178 |
| 862 | Ga0207664_10142540 | 3300025929 | Bacteria | 2029 |
| 863 | Ga0207664_10681007 | 3300025929 | Unclassified | 925 |
| 864 | Ga0207664_10697046 | 3300025929 | Bacteria | 913 |
| 865 | Ga0207664_11417441 | 3300025929 | Unclassified | 616 |
| 866 | Ga0207664_11665513 | 3300025929 | Unclassified | 560 |
| 867 | Ga0207664_11810705 | 3300025929 | Unclassified | 533 |
| 868 | Ga0207644_10033707 | 3300025931 | Bacteria | 3581 |
| 869 | Ga0207644_10058479 | 3300025931 | Bacteria | 2786 |
| 870 | Ga0207644_10196648 | 3300025931 | Bacteria | 1588 |
| 871 | Ga0207644_10254840 | 3300025931 | Bacteria | 1401 |
| 872 | Ga0207644_10344956 | 3300025931 | Bacteria | 1208 |
| 873 | Ga0207644_10545561 | 3300025931 | Bacteria | 959 |
| 874 | Ga0207644_10692706 | 3300025931 | Unclassified | 849 |
| 875 | Ga0207644_11813834 | 3300025931 | Unclassified | 510 |
| 876 | Ga0207690_10075123 | 3300025932 | Bacteria | 2343 |
| 877 | Ga0207690_10098203 | 3300025932 | Bacteria | 2085 |
| 878 | Ga0207690_10182904 | 3300025932 | Bacteria | 1580 |
| 879 | Ga0207690_11019648 | 3300025932 | Bacteria | 689 |
| 880 | Ga0207706_10008197 | 3300025933 | Bacteria | 9637 |
| 881 | Ga0207706_10070025 | 3300025933 | Bacteria | 3084 |
| 882 | Ga0207706_10130216 | 3300025933 | Unclassified | 2213 |
| 883 | Ga0207706_10216094 | 3300025933 | Bacteria | 1679 |
| 884 | Ga0207706_10252504 | 3300025933 | Bacteria | 1540 |
| 885 | Ga0207706_10397992 | 3300025933 | Unclassified | 1194 |
| 886 | Ga0207706_10532738 | 3300025933 | Bacteria | 1012 |
| 887 | Ga0207706_10554217 | 3300025933 | Unclassified | 989 |
| 888 | Ga0207706_11016521 | 3300025933 | Unclassified | 696 |
| 889 | Ga0207686_10157569 | 3300025934 | Unclassified | 1588 |
| 890 | Ga0207686_11520114 | 3300025934 | Bacteria | 552 |
| 891 | Ga0207686_11644433 | 3300025934 | Unclassified | 531 |
| 892 | Ga0207709_10405195 | 3300025935 | Bacteria | 1044 |
| 893 | Ga0207709_10620733 | 3300025935 | Unclassified | 858 |
| 894 | Ga0207670_10020026 | 3300025936 | Unclassified | 4101 |
| 895 | Ga0207670_10186652 | 3300025936 | Bacteria | 1566 |
| 896 | Ga0207670_10246226 | 3300025936 | Bacteria | 1379 |
| 897 | Ga0207670_10787345 | 3300025936 | Bacteria | 792 |
| 898 | Ga0207670_11168912 | 3300025936 | Unclassified | 651 |
| 899 | Ga0207669_10007177 | 3300025937 | Bacteria | 5131 |
| 900 | Ga0207669_10011026 | 3300025937 | Bacteria | 4378 |
| 901 | Ga0207669_10194696 | 3300025937 | Bacteria | 1466 |
| 902 | Ga0207704_10046539 | 3300025938 | Bacteria | 2586 |
| 903 | Ga0207704_10336220 | 3300025938 | Bacteria | 1170 |
| 904 | Ga0207704_10483166 | 3300025938 | Bacteria | 995 |
| 905 | Ga0207704_10655411 | 3300025938 | Bacteria | 865 |
| 906 | Ga0207704_10949398 | 3300025938 | Unclassified | 725 |
| 907 | Ga0207704_11051630 | 3300025938 | Unclassified | 690 |
| 908 | Ga0207704_11655212 | 3300025938 | Unclassified | 550 |
| 909 | Ga0207665_10023457 | 3300025939 | Bacteria | 4066 |
| 910 | Ga0207665_10026852 | 3300025939 | Unclassified | 3803 |
| 911 | Ga0207665_10046134 | 3300025939 | Bacteria | 2920 |
| 912 | Ga0207665_10048049 | 3300025939 | Bacteria | 2863 |
| 913 | Ga0207665_10054073 | 3300025939 | Bacteria | 2707 |
| 914 | Ga0207665_10192231 | 3300025939 | Unclassified | 1483 |
| 915 | Ga0207665_10204530 | 3300025939 | Bacteria | 1440 |
| 916 | Ga0207665_10232318 | 3300025939 | Unclassified | 1356 |
| 917 | Ga0207665_10451432 | 3300025939 | Bacteria | 987 |
| 918 | Ga0207665_10552833 | 3300025939 | Unclassified | 894 |
| 919 | Ga0207665_10841249 | 3300025939 | Bacteria | 726 |
| 920 | Ga0207691_10000142 | 3300025940 | Bacteria | 66224 |
| 921 | Ga0207691_10000247 | 3300025940 | Bacteria | 53502 |
| 922 | Ga0207691_10037047 | 3300025940 | Bacteria | 4518 |
| 923 | Ga0207691_10151876 | 3300025940 | Bacteria | 2036 |
| 924 | Ga0207691_11415241 | 3300025940 | Unclassified | 571 |
| 925 | Ga0207711_11097234 | 3300025941 | Unclassified | 737 |
| 926 | Ga0207689_10086541 | 3300025942 | Bacteria | 2576 |
| 927 | Ga0207689_10111933 | 3300025942 | Unclassified | 2244 |
| 928 | Ga0207689_11087503 | 3300025942 | Bacteria | 674 |
| 929 | Ga0207661_10035276 | 3300025944 | Bacteria | 3896 |
| 930 | Ga0207661_10393064 | 3300025944 | Bacteria | 1256 |
| 931 | Ga0207661_10452819 | 3300025944 | Unclassified | 1169 |
| 932 | Ga0207661_11031626 | 3300025944 | Unclassified | 757 |
| 933 | Ga0207679_10094203 | 3300025945 | Bacteria | 2325 |
| 934 | Ga0207679_10401318 | 3300025945 | Bacteria | 1206 |
| 935 | Ga0207679_10418466 | 3300025945 | Bacteria | 1182 |
| 936 | Ga0207679_10673068 | 3300025945 | Unclassified | 937 |
| 937 | Ga0207667_11436943 | 3300025949 | Bacteria | 662 |
| 938 | Ga0207651_10007253 | 3300025960 | Bacteria | 5894 |
| 939 | Ga0207651_10059097 | 3300025960 | Bacteria | 2653 |
| 940 | Ga0207651_10081121 | 3300025960 | Bacteria | 2337 |
| 941 | Ga0207651_10098725 | 3300025960 | Bacteria | 2160 |
| 942 | Ga0207651_10277686 | 3300025960 | Unclassified | 1383 |
| 943 | Ga0207651_10296423 | 3300025960 | Unclassified | 1343 |
| 944 | Ga0207651_11566462 | 3300025960 | Unclassified | 593 |
| 945 | Ga0207712_10010310 | 3300025961 | Bacteria | 5932 |
| 946 | Ga0207712_10860402 | 3300025961 | Bacteria | 800 |
| 947 | Ga0207712_10873704 | 3300025961 | Bacteria | 793 |
| 948 | Ga0207668_10009836 | 3300025972 | Bacteria | 5747 |
| 949 | Ga0207668_10052709 | 3300025972 | Bacteria | 2816 |
| 950 | Ga0207668_10079305 | 3300025972 | Bacteria | 2374 |
| 951 | Ga0207668_10110386 | 3300025972 | Bacteria | 2062 |
| 952 | Ga0207668_10116809 | 3300025972 | Bacteria | 2012 |
| 953 | Ga0207668_12007131 | 3300025972 | Unclassified | 521 |
| 954 | Ga0207640_10198487 | 3300025981 | Bacteria | 1518 |
| 955 | Ga0207640_10777008 | 3300025981 | Bacteria | 828 |
| 956 | Ga0207640_11992280 | 3300025981 | Unclassified | 526 |
| 957 | Ga0207658_10036520 | 3300025986 | Bacteria | 3523 |
| 958 | Ga0207658_10043698 | 3300025986 | Bacteria | 3259 |
| 959 | Ga0207658_10076513 | 3300025986 | Unclassified | 2550 |
| 960 | Ga0207658_10336677 | 3300025986 | Bacteria | 1310 |
| 961 | Ga0207677_10032534 | 3300026023 | Bacteria | 3354 |
| 962 | Ga0207677_10091729 | 3300026023 | Bacteria | 2210 |
| 963 | Ga0207677_10433420 | 3300026023 | Bacteria | 1122 |
| 964 | Ga0207677_10433542 | 3300026023 | Unclassified | 1122 |
| 965 | Ga0207677_10563597 | 3300026023 | Bacteria | 995 |
| 966 | Ga0207677_10695856 | 3300026023 | Unclassified | 901 |
| 967 | Ga0207677_10733847 | 3300026023 | Unclassified | 879 |
| 968 | Ga0207677_10848651 | 3300026023 | Bacteria | 821 |
| 969 | Ga0207677_11383214 | 3300026023 | Bacteria | 648 |
| 970 | Ga0207677_11497088 | 3300026023 | Bacteria | 623 |
| 971 | Ga0207703_10003624 | 3300026035 | Bacteria | 12889 |
| 972 | Ga0207703_10203169 | 3300026035 | Unclassified | 1762 |
| 973 | Ga0207703_10549854 | 3300026035 | Bacteria | 1088 |
| 974 | Ga0207703_10900518 | 3300026035 | Bacteria | 847 |
| 975 | Ga0207703_11952313 | 3300026035 | Unclassified | 563 |
| 976 | Ga0207639_11033099 | 3300026041 | Unclassified | 770 |
| 977 | Ga0207678_10020455 | 3300026067 | Bacteria | 5804 |
| 978 | Ga0207678_10234839 | 3300026067 | Bacteria | 1570 |
| 979 | Ga0207678_10529024 | 3300026067 | Bacteria | 1029 |
| 980 | Ga0207678_11209444 | 3300026067 | Unclassified | 669 |
| 981 | Ga0207708_10030364 | 3300026075 | Bacteria | 4097 |
| 982 | Ga0207708_10521317 | 3300026075 | Unclassified | 999 |
| 983 | Ga0207708_10644573 | 3300026075 | Unclassified | 901 |
| 984 | Ga0207702_10255395 | 3300026078 | Bacteria | 1648 |
| 985 | Ga0207702_10937471 | 3300026078 | Bacteria | 858 |
| 986 | Ga0207702_11133263 | 3300026078 | Unclassified | 776 |
| 987 | Ga0207702_11455685 | 3300026078 | Bacteria | 679 |
| 988 | Ga0207702_12099462 | 3300026078 | Bacteria | 555 |
| 989 | Ga0207641_10022387 | 3300026088 | Bacteria | 5202 |
| 990 | Ga0207641_10717521 | 3300026088 | Bacteria | 985 |
| 991 | Ga0207641_11141571 | 3300026088 | Bacteria | 778 |
| 992 | Ga0207641_11206454 | 3300026088 | Bacteria | 756 |
| 993 | Ga0207648_10108555 | 3300026089 | Bacteria | 2436 |
| 994 | Ga0207648_10302676 | 3300026089 | Unclassified | 1434 |
| 995 | Ga0207648_10708852 | 3300026089 | Bacteria | 933 |
| 996 | Ga0207676_10895426 | 3300026095 | Unclassified | 870 |
| 997 | Ga0207674_10342675 | 3300026116 | Bacteria | 1445 |
| 998 | Ga0207674_10995977 | 3300026116 | Bacteria | 807 |
| 999 | Ga0207675_100066854 | 3300026118 | Bacteria | 3360 |
| 1000 | Ga0207675_100085155 | 3300026118 | Bacteria | 2966 |
| 1001 | Ga0207675_100094187 | 3300026118 | Bacteria | 2817 |
| 1002 | Ga0207675_100551996 | 3300026118 | Bacteria | 1151 |
| 1003 | Ga0207675_101879321 | 3300026118 | Unclassified | 617 |
| 1004 | Ga0207683_10006977 | 3300026121 | Bacteria | 9683 |
| 1005 | Ga0207683_10008842 | 3300026121 | Bacteria | 8591 |
| 1006 | Ga0207683_10015583 | 3300026121 | Bacteria | 6470 |
| 1007 | Ga0207683_10089065 | 3300026121 | Bacteria | 2746 |
| 1008 | Ga0207683_10428382 | 3300026121 | Bacteria | 1219 |
| 1009 | Ga0207683_10433660 | 3300026121 | Unclassified | 1211 |
| 1010 | Ga0207683_10887783 | 3300026121 | Unclassified | 828 |
| 1011 | Ga0207683_11438819 | 3300026121 | Bacteria | 637 |
| 1012 | Ga0207698_10435666 | 3300026142 | Unclassified | 1262 |
| 1013 | Ga0207698_11609693 | 3300026142 | Unclassified | 665 |
| 1014 | Ga0207698_11896038 | 3300026142 | Unclassified | 611 |
| 1015 | Ga0209984_1014198 | 3300027424 | Bacteria | 1049 |
| 1016 | Ga0209970_1035731 | 3300027614 | Bacteria | 874 |
| 1017 | Ga0210002_1069008 | 3300027617 | Bacteria | 622 |
| 1018 | Ga0209974_10002731 | 3300027876 | Bacteria | 6397 |
| 1019 | Ga0209974_10165190 | 3300027876 | Bacteria | 805 |
| 1020 | Ga0209974_10175797 | 3300027876 | Unclassified | 782 |
| 1021 | Ga0207428_10537082 | 3300027907 | Bacteria | 847 |
| 1022 | Ga0268266_10004179 | 3300028379 | Bacteria | 13926 |
| 1023 | Ga0268266_10026994 | 3300028379 | Bacteria | 4885 |
| 1024 | Ga0268266_10194689 | 3300028379 | Bacteria | 1852 |
| 1025 | Ga0268266_10391086 | 3300028379 | Unclassified | 1313 |
| 1026 | Ga0268266_10395399 | 3300028379 | Bacteria | 1306 |
| 1027 | Ga0268266_10488001 | 3300028379 | Unclassified | 1175 |
| 1028 | Ga0268266_10787947 | 3300028379 | Bacteria | 918 |
| 1029 | Ga0268265_10198884 | 3300028380 | Bacteria | 1737 |
| 1030 | Ga0268265_10831073 | 3300028380 | Bacteria | 902 |
| 1031 | Ga0268265_10971562 | 3300028380 | Bacteria | 838 |
| 1032 | Ga0268265_11672712 | 3300028380 | Unclassified | 642 |
| 1033 | Ga0268264_10029276 | 3300028381 | Unclassified | 4509 |
| 1034 | Ga0268264_10236756 | 3300028381 | Unclassified | 1689 |
| 1035 | Ga0268264_10458954 | 3300028381 | Unclassified | 1236 |
| 1036 | Ga0268264_10697174 | 3300028381 | Bacteria | 1008 |
| 1037 | Ga0268264_11102608 | 3300028381 | Bacteria | 802 |
| 1038 | Ga0268264_11969376 | 3300028381 | Unclassified | 594 |
| 1039 | Ga0307513_10023335 | 3300031456 | Bacteria | 7230 |
| 1040 | Ga0373926_0071067 | 3300035083 | Bacteria | 1279 |
| 1041 | Ga0373926_0467032 | 3300035083 | Bacteria | 502 |
| 1042 | Ga0373934_0458744 | 3300035086 | Unclassified | 534 |
| 1043 | Ga0373944_0030278 | 3300035089 | Bacteria | 1623 |
| 1044 | Ga0373952_0131002 | 3300035092 | Unclassified | 689 |
| 1045 | Ga0373923_0370181 | 3300035111 | Bacteria | 686 |
| 1046 | Ga0373932_0144460 | 3300035112 | Bacteria | 812 |
| 1047 | Ga0373936_0063141 | 3300035113 | Bacteria | 1516 |
| 1048 | Ga0373936_0089102 | 3300035113 | Bacteria | 1292 |
| 1049 | Ga0373939_0144169 | 3300035114 | Bacteria | 861 |
| 1050 | Ga0373939_0199620 | 3300035114 | Bacteria | 756 |
| 1051 | Ga0373941_0275716 | 3300035115 | Unclassified | 664 |
| 1052 | Ga0373945_0017219 | 3300035116 | Bacteria | 2446 |
| 1053 | Ga0373945_0049243 | 3300035116 | Bacteria | 1546 |
| 1054 | Ga0373945_0227619 | 3300035116 | Unclassified | 781 |
| 1055 | Ga0373945_0309808 | 3300035116 | Unclassified | 678 |
| 1056 | Ga0373953_0246233 | 3300035117 | Bacteria | 776 |
| 1057 | Ga0373953_0264792 | 3300035117 | Unclassified | 748 |
| 1058 | Ga0373954_0144032 | 3300035118 | Bacteria | 1163 |
| 1059 | Ga0373954_0263820 | 3300035118 | Unclassified | 848 |
| 1060 | Ga0373956_0096615 | 3300035119 | Unclassified | 1367 |
| 1061 | Ga0373956_0513677 | 3300035119 | Unclassified | 572 |
| 1062 | Ga0373957_0043978 | 3300035120 | Bacteria | 1689 |
| 1063 | Ga0373960_0186212 | 3300035121 | Bacteria | 727 |
| 1064 | Ga0373943_0005531 | 3300035170 | Bacteria | 5673 |
| 1065 | Ga0373943_0075146 | 3300035170 | Bacteria | 1720 |
| 1066 | Ga0373943_0130170 | 3300035170 | Unclassified | 1346 |
| 1067 | Ga0373943_0146425 | 3300035170 | Bacteria | 1276 |
| 1068 | Ga0373943_0220985 | 3300035170 | Bacteria | 1055 |
| 1069 | Ga0373943_0237915 | 3300035170 | Bacteria | 1019 |
| 1070 | Ga0373943_0319387 | 3300035170 | Unclassified | 885 |
| 1071 | Ga0373943_0355223 | 3300035170 | Unclassified | 840 |
| 1072 | Ga0373943_0436808 | 3300035170 | Bacteria | 759 |
| 1073 | Ga0373946_0014471 | 3300035171 | Unclassified | 2976 |
| 1074 | Ga0373946_0043328 | 3300035171 | Unclassified | 1854 |
| 1075 | Ga0373946_0103567 | 3300035171 | Bacteria | 1279 |
| 1076 | Ga0373946_0167595 | 3300035171 | Bacteria | 1035 |
| 1077 | Ga0373946_0226075 | 3300035171 | Bacteria | 905 |
| 1078 | Ga0373946_0325878 | 3300035171 | Bacteria | 764 |
| 1079 | Ga0373955_0133643 | 3300035172 | Bacteria | 1450 |
| 1080 | Ga0373955_0248788 | 3300035172 | Unclassified | 1065 |
| 1081 | Ga0373942_0045221 | 3300035207 | Unclassified | 1216 |
| 1082 | Ga0373961_0190229 | 3300035241 | Bacteria | 719 |
| 1083 | Ga0373924_0014324 | 3300035410 | Bacteria | 2995 |
| 1084 | Ga0373924_0202054 | 3300035410 | Unclassified | 877 |
| 1085 | Ga0373931_0027301 | 3300035691 | Bacteria | 2914 |
| 1086 | Ga0373931_0062699 | 3300035691 | Bacteria | 2008 |
| 1087 | Ga0373935_0034641 | 3300035692 | Bacteria | 3148 |
| 1088 | Ga0373935_0100133 | 3300035692 | Bacteria | 1909 |
| 1089 | Ga0373935_0334591 | 3300035692 | Bacteria | 1077 |
| 1090 | Ga0373935_0459287 | 3300035692 | Unclassified | 921 |
| 1091 | Ga0373935_0725297 | 3300035692 | Unclassified | 732 |
| 1092 | Ga0373927_0010910 | 3300035695 | Bacteria | 6049 |
| 1093 | Ga0373927_0031651 | 3300035695 | Bacteria | 3446 |
| 1094 | Ga0373927_0040560 | 3300035695 | Bacteria | 3020 |
| 1095 | Ga0373927_0125798 | 3300035695 | Bacteria | 1673 |
| 1096 | Ga0373927_0202058 | 3300035695 | Unclassified | 1305 |
| 1097 | Ga0373927_0266811 | 3300035695 | Bacteria | 1126 |
| 1098 | Ga0373933_0088778 | 3300035724 | Unclassified | 1905 |
| 1099 | Ga0373933_0394291 | 3300035724 | Unclassified | 902 |
| 1100 | Ga0373933_0687695 | 3300035724 | Unclassified | 672 |
| 1101 | Ga0373947_0031650 | 3300035725 | Bacteria | 3115 |
| 1102 | Ga0373947_0036106 | 3300035725 | Bacteria | 2929 |
| 1103 | Ga0373947_0044039 | 3300035725 | Bacteria | 2667 |
| 1104 | Ga0373947_0107417 | 3300035725 | Unclassified | 1760 |
| 1105 | Ga0373947_0107458 | 3300035725 | Unclassified | 1759 |
| 1106 | Ga0373947_0113974 | 3300035725 | Unclassified | 1711 |
| 1107 | Ga0373947_0195825 | 3300035725 | Unclassified | 1320 |
| 1108 | Ga0373947_0225808 | 3300035725 | Unclassified | 1232 |
| 1109 | Ga0373947_0475836 | 3300035725 | Unclassified | 847 |
| 1110 | Ga0373937_0007935 | 3300036401 | Bacteria | 9202 |
| 1111 | Ga0373937_0065643 | 3300036401 | Bacteria | 3341 |
| 1112 | Ga0373937_0195834 | 3300036401 | Unclassified | 1899 |
| 1113 | Ga0373937_0420927 | 3300036401 | Bacteria | 1268 |
| 1114 | Ga0373925_0034819 | 3300037068 | Bacteria | 3713 |
| 1115 | Ga0373925_0040917 | 3300037068 | Bacteria | 3433 |
| 1116 | Ga0373925_0065822 | 3300037068 | Bacteria | 2731 |
| 1117 | Ga0373925_0068631 | 3300037068 | Bacteria | 2677 |
| 1118 | Ga0373925_0160554 | 3300037068 | Bacteria | 1770 |
| 1119 | Ga0373925_0176068 | 3300037068 | Unclassified | 1691 |
| 1120 | Ga0373925_0180445 | 3300037068 | Bacteria | 1671 |
| 1121 | Ga0373925_0259036 | 3300037068 | Bacteria | 1397 |
| 1122 | Ga0373925_0337231 | 3300037068 | Bacteria | 1222 |
| 1123 | Ga0373925_0774564 | 3300037068 | Unclassified | 791 |
| 1124 | Ga0373925_0831281 | 3300037068 | Bacteria | 761 |
| 1125 | Ga0373925_0992707 | 3300037068 | Unclassified | 691 |
| 1126 | Ga0395899_0047074 | 3300037312 | Bacteria | 3211 |
| 1127 | Ga0395899_0141540 | 3300037312 | Bacteria | 1711 |
| 1128 | Ga0395899_0633035 | 3300037312 | Unclassified | 678 |
| 1129 | Ga0395900_0008031 | 3300037418 | Bacteria | 10861 |
| 1130 | Ga0395900_0014812 | 3300037418 | Bacteria | 7946 |
| 1131 | Ga0395900_0111523 | 3300037418 | Bacteria | 2810 |
| 1132 | Ga0395900_0706607 | 3300037418 | Bacteria | 941 |
| 1133 | Ga0395900_0759771 | 3300037418 | Unclassified | 899 |
| 1134 | Ga0395900_1784311 | 3300037418 | Unclassified | 526 |
| 1135 | Ga0395898_0002044 | 3300037466 | Bacteria | 25218 |
| 1136 | Ga0395898_0041866 | 3300037466 | Bacteria | 4522 |
| 1137 | Ga0395898_0602115 | 3300037466 | Bacteria | 1042 |
| 1138 | Ga0395905_0357397 | 3300037471 | Bacteria | 1353 |
| 1139 | Ga0395905_0753845 | 3300037471 | Unclassified | 876 |
| 1140 | Ga0395905_1300248 | 3300037471 | Unclassified | 631 |
| 1141 | Ga0436364_0850081 | 3300037853 | Bacteria | 798 |
| 1142 | Ga0395901_0002964 | 3300038443 | Bacteria | 17124 |
| 1143 | Ga0395901_0064660 | 3300038443 | Bacteria | 3808 |
| 1144 | Ga0395901_0173793 | 3300038443 | Bacteria | 2260 |
| 1145 | Ga0395901_0437562 | 3300038443 | Bacteria | 1339 |
| 1146 | Ga0436365_0345467 | 3300039437 | Unclassified | 755 |
| 1147 | Ga0436363_1186420 | 3300039450 | Unclassified | 556 |
| 1148 | Ga0436363_1236879 | 3300039450 | Bacteria | 675 |
| 1149 | Ga0451789_1020370 | 3300041443 | Unclassified | 627 |
| 1150 | Ga0451791_1864675 | 3300041451 | Bacteria | 610 |
| 1151 | Ga0451793_0969996 | 3300041452 | Bacteria | 627 |
| 1152 | Ga0451795_0375776 | 3300041456 | Unclassified | 525 |
| 1153 | Ga0451802_0741526 | 3300041460 | Unclassified | 600 |
| 1154 | Ga0451802_0769737 | 3300041460 | Bacteria | 616 |
| 1155 | Ga0451802_1371756 | 3300041460 | Bacteria | 564 |
| 1156 | Ga0451807_0068204 | 3300041486 | Bacteria | 1000 |
| 1157 | Ga0451845_0545397 | 3300041501 | Unclassified | 990 |
| 1158 | Ga0451849_0026473 | 3300041505 | Unclassified | 571 |
| 1159 | Ga0451855_0802694 | 3300041511 | Bacteria | 542 |
| 1160 | Ga0451853_0516564 | 3300041512 | Unclassified | 579 |
| 1161 | Ga0451853_1896950 | 3300041512 | Bacteria | 860 |
| 1162 | Ga0451853_1958043 | 3300041512 | Unclassified | 724 |
| 1163 | Ga0451853_3591552 | 3300041512 | Unclassified | 602 |
| 1164 | Ga0439448_0063421 | 3300042005 | Bacteria | 1224 |
| 1165 | Ga0439448_0078090 | 3300042005 | Unclassified | 1109 |
| 1166 | Ga0439451_039740 | 3300042009 | Bacteria | 945 |
| 1167 | Ga0439451_067856 | 3300042009 | Unclassified | 714 |
| 1168 | Ga0439454_003697 | 3300042011 | Unclassified | 1722 |
| 1169 | Ga0439455_0005259 | 3300042012 | Bacteria | 2616 |
| 1170 | Ga0439455_0209736 | 3300042012 | Unclassified | 565 |
| 1171 | Ga0450905_061433 | 3300042142 | Unclassified | 628 |
| 1172 | Ga0439458_0011685 | 3300042157 | Bacteria | 1965 |
| 1173 | Ga0439458_0054144 | 3300042157 | Bacteria | 994 |
| 1174 | Ga0439464_0082385 | 3300042439 | Unclassified | 962 |
| 1175 | Ga0439440_0037206 | 3300042993 | Bacteria | 1174 |
| 1176 | Ga0451576_0146081 | 3300045051 | Bacteria | 2466 |
| 1177 | Ga0451576_0278466 | 3300045051 | Bacteria | 1749 |
| 1178 | Ga0466967_0339308 | 3300045976 | Bacteria | 1453 |
| 1179 | Ga0495592_0049064 | 3300046454 | Unclassified | 3138 |
| 1180 | Ga0495592_0082388 | 3300046454 | Bacteria | 2325 |
| 1181 | Ga0495603_0104836 | 3300046455 | Unclassified | 1650 |
| 1182 | Ga0495603_0401225 | 3300046455 | Unclassified | 786 |
| 1183 | Ga0495603_0407001 | 3300046455 | Unclassified | 780 |
| 1184 | Ga0495590_0103909 | 3300046457 | Unclassified | 1011 |
| 1185 | Ga0495629_0008333 | 3300046459 | Bacteria | 7622 |
| 1186 | Ga0495629_0204547 | 3300046459 | Bacteria | 1364 |
| 1187 | Ga0495629_0334860 | 3300046459 | Bacteria | 1034 |
| 1188 | Ga0495629_0757639 | 3300046459 | Bacteria | 642 |
| 1189 | Ga0495641_0062450 | 3300046461 | Bacteria | 1680 |
| 1190 | Ga0495651_0122706 | 3300046462 | Unclassified | 1906 |
| 1191 | Ga0495651_0371381 | 3300046462 | Bacteria | 940 |
| 1192 | Ga0495651_0448787 | 3300046462 | Bacteria | 834 |
| 1193 | Ga0495651_0511913 | 3300046462 | Unclassified | 767 |
| 1194 | Ga0495651_0680814 | 3300046462 | Unclassified | 642 |
| 1195 | Ga0495653_0360908 | 3300046463 | Unclassified | 932 |
| 1196 | Ga0495653_0484627 | 3300046463 | Unclassified | 773 |
| 1197 | Ga0495653_0679411 | 3300046463 | Unclassified | 627 |
| 1198 | Ga0495580_0359881 | 3300046472 | Unclassified | 985 |
| 1199 | Ga0495580_0597622 | 3300046472 | Bacteria | 729 |
| 1200 | Ga0495580_0937449 | 3300046472 | Unclassified | 555 |
| 1201 | Ga0495582_0314706 | 3300046473 | Bacteria | 900 |
| 1202 | Ga0495605_0076983 | 3300046474 | Bacteria | 1566 |
| 1203 | Ga0495639_0374997 | 3300046475 | Unclassified | 717 |
| 1204 | Ga0495662_0056346 | 3300046476 | Unclassified | 1899 |
| 1205 | Ga0495662_0342468 | 3300046476 | Unclassified | 735 |
| 1206 | Ga0495664_0127274 | 3300046477 | Bacteria | 1541 |
| 1207 | Ga0495664_0135201 | 3300046477 | Bacteria | 1494 |
| 1208 | Ga0495594_0151606 | 3300046499 | Bacteria | 1316 |
| 1209 | Ga0495607_0125264 | 3300046501 | Bacteria | 1344 |
| 1210 | Ga0495608_0443139 | 3300046511 | Unclassified | 791 |
| 1211 | Ga0495608_0454416 | 3300046511 | Unclassified | 779 |
| 1212 | Ga0495608_0602489 | 3300046511 | Unclassified | 659 |
| 1213 | Ga0495616_0311018 | 3300046513 | Unclassified | 663 |
| 1214 | Ga0495618_0059321 | 3300046514 | Bacteria | 2425 |
| 1215 | Ga0495618_0223091 | 3300046514 | Unclassified | 1188 |
| 1216 | Ga0495618_0260021 | 3300046514 | Bacteria | 1087 |
| 1217 | Ga0495628_0004287 | 3300046516 | Bacteria | 12686 |
| 1218 | Ga0495628_0079826 | 3300046516 | Unclassified | 2544 |
| 1219 | Ga0495630_0017678 | 3300046517 | Bacteria | 5227 |
| 1220 | Ga0495630_0217786 | 3300046517 | Unclassified | 1457 |
| 1221 | Ga0495630_1310000 | 3300046517 | Unclassified | 546 |
| 1222 | Ga0495644_0096747 | 3300046523 | Bacteria | 1116 |
| 1223 | Ga0495666_0122893 | 3300046526 | Bacteria | 1215 |
| 1224 | Ga0495666_0492359 | 3300046526 | Unclassified | 548 |
| 1225 | Ga0495642_0054188 | 3300046528 | Bacteria | 1654 |
| 1226 | Ga0495652_0045601 | 3300046529 | Bacteria | 3767 |
| 1227 | Ga0495652_0064185 | 3300046529 | Unclassified | 3089 |
| 1228 | Ga0495665_0529948 | 3300046531 | Unclassified | 592 |
| 1229 | Ga0495640_0027037 | 3300046533 | Unclassified | 4142 |
| 1230 | Ga0495640_0354961 | 3300046533 | Bacteria | 904 |
| 1231 | Ga0495640_0591582 | 3300046533 | Bacteria | 670 |
| 1232 | Ga0495640_0776756 | 3300046533 | Unclassified | 572 |
| 1233 | Ga0495586_0014140 | 3300046535 | Bacteria | 4240 |
| 1234 | Ga0495586_0350618 | 3300046535 | Bacteria | 848 |
| 1235 | Ga0495587_0004117 | 3300046536 | Bacteria | 9614 |
| 1236 | Ga0495587_0101619 | 3300046536 | Bacteria | 1656 |
| 1237 | Ga0495598_0000901 | 3300046537 | Bacteria | 5725 |
| 1238 | Ga0495598_0012406 | 3300046537 | Bacteria | 2092 |
| 1239 | Ga0495598_0016088 | 3300046537 | Bacteria | 1902 |
| 1240 | Ga0495598_0029599 | 3300046537 | Bacteria | 1528 |
| 1241 | Ga0495598_0148939 | 3300046537 | Bacteria | 815 |
| 1242 | Ga0495621_0292057 | 3300046539 | Bacteria | 674 |
| 1243 | Ga0495621_0438891 | 3300046539 | Unclassified | 558 |
| 1244 | Ga0495645_0001076 | 3300046543 | Bacteria | 18525 |
| 1245 | Ga0495645_0489335 | 3300046543 | Unclassified | 770 |
| 1246 | Ga0495633_0290065 | 3300046558 | Bacteria | 744 |
| 1247 | Ga0495667_0032250 | 3300046559 | Bacteria | 3513 |
| 1248 | Ga0495667_0071324 | 3300046559 | Bacteria | 2266 |
| 1249 | Ga0495668_0620313 | 3300046616 | Unclassified | 598 |
| 1250 | Ga0495634_0131202 | 3300046642 | Bacteria | 1597 |
| 1251 | Ga0495634_0355677 | 3300046642 | Unclassified | 876 |
| 1252 | Ga0495611_0136393 | 3300046648 | Bacteria | 1146 |
| 1253 | Ga0495635_0204821 | 3300046663 | Bacteria | 1337 |
| 1254 | Ga0495635_0244606 | 3300046663 | Bacteria | 1210 |
| 1255 | Ga0495635_0342139 | 3300046663 | Unclassified | 999 |
| 1256 | Ga0495659_0280987 | 3300046664 | Bacteria | 699 |
| 1257 | Ga0495659_0442193 | 3300046664 | Bacteria | 565 |
| 1258 | Ga0495588_0189414 | 3300046674 | Bacteria | 1087 |
| 1259 | Ga0495588_0212760 | 3300046674 | Bacteria | 1021 |
| 1260 | Ga0495588_0650476 | 3300046674 | Unclassified | 552 |
| 1261 | Ga0495657_0091838 | 3300046675 | Bacteria | 1946 |
| 1262 | Ga0495657_0226063 | 3300046675 | Bacteria | 1133 |
| 1263 | Ga0495599_0000317 | 3300046678 | Bacteria | 28802 |
| 1264 | Ga0495623_0000811 | 3300046679 | Bacteria | 21045 |
| 1265 | Ga0495646_0002940 | 3300046680 | Bacteria | 10561 |
| 1266 | Ga0495646_0435121 | 3300046680 | Unclassified | 679 |
| 1267 | Ga0495658_0145447 | 3300046683 | Bacteria | 1452 |
| 1268 | Ga0495658_0209856 | 3300046683 | Bacteria | 1216 |
| 1269 | Ga0495658_0460690 | 3300046683 | Unclassified | 812 |
| 1270 | Ga0495658_0825100 | 3300046683 | Unclassified | 593 |
| 1271 | Ga0495669_0032455 | 3300046684 | Bacteria | 2295 |
| 1272 | Ga0495669_0039850 | 3300046684 | Bacteria | 2081 |
| 1273 | Ga0495669_0178602 | 3300046684 | Bacteria | 1011 |
| 1274 | Ga0495669_0478282 | 3300046684 | Unclassified | 605 |
| 1275 | Ga0495669_0524567 | 3300046684 | Unclassified | 576 |
| 1276 | Ga0495669_0610218 | 3300046684 | Bacteria | 531 |
| 1277 | Ga0495613_0374245 | 3300046689 | Unclassified | 975 |
| 1278 | Ga0495613_0381763 | 3300046689 | Unclassified | 963 |
| 1279 | Ga0495613_0386688 | 3300046689 | Bacteria | 956 |
| 1280 | Ga0495613_0463783 | 3300046689 | Unclassified | 857 |
| 1281 | Ga0495624_0308077 | 3300046690 | Bacteria | 954 |
| 1282 | Ga0495624_0508779 | 3300046690 | Bacteria | 720 |
| 1283 | Ga0495624_0778555 | 3300046690 | Unclassified | 566 |
| 1284 | Ga0495624_0894089 | 3300046690 | Unclassified | 523 |
| 1285 | Ga0495624_0919858 | 3300046690 | Unclassified | 514 |
| 1286 | Ga0495671_0555448 | 3300046692 | Unclassified | 547 |
| 1287 | Ga0495600_0595268 | 3300046809 | Unclassified | 672 |
| 1288 | Ga0495600_0807626 | 3300046809 | Unclassified | 558 |
| 1289 | Ga0495581_0081281 | 3300047315 | Bacteria | 1876 |
| 1290 | Ga0495604_0053697 | 3300047317 | Bacteria | 3112 |
| 1291 | Ga0495604_0288710 | 3300047317 | Bacteria | 1105 |
| 1292 | Ga0495604_0331125 | 3300047317 | Bacteria | 1016 |
| 1293 | Ga0495604_0378222 | 3300047317 | Unclassified | 936 |
| 1294 | Ga0495636_0151276 | 3300047318 | Unclassified | 1042 |
| 1295 | Ga0495674_0195915 | 3300047319 | Bacteria | 1678 |
| 1296 | Ga0495674_0400841 | 3300047319 | Bacteria | 1107 |
| 1297 | Ga0495674_0599809 | 3300047319 | Bacteria | 872 |
| 1298 | Ga0495674_0882155 | 3300047319 | Unclassified | 691 |
| 1299 | Ga0495676_0261423 | 3300047321 | Bacteria | 1177 |
| 1300 | Ga0495676_0315817 | 3300047321 | Unclassified | 1051 |
| 1301 | Ga0495676_0394561 | 3300047321 | Bacteria | 919 |
| 1302 | Ga0495680_0209613 | 3300047322 | Bacteria | 1395 |
| 1303 | Ga0495675_0002584 | 3300047444 | Bacteria | 10850 |
| 1304 | Ga0495675_0044543 | 3300047444 | Unclassified | 2826 |
| 1305 | Ga0495679_120646 | 3300047446 | Unclassified | 717 |
| 1306 | Ga0495685_086151 | 3300047447 | Bacteria | 1044 |
| 1307 | Ga0495685_184777 | 3300047447 | Bacteria | 671 |
| 1308 | Ga0495684_0029134 | 3300047471 | Unclassified | 4237 |
| 1309 | Ga0495684_0064236 | 3300047471 | Bacteria | 2789 |
| 1310 | Ga0495684_0218935 | 3300047471 | Bacteria | 1397 |
| 1311 | Ga0495602_0109432 | 3300048088 | Unclassified | 2248 |
| 1312 | Ga0495602_0121992 | 3300048088 | Bacteria | 2095 |
| 1313 | Ga0495602_0593907 | 3300048088 | Unclassified | 762 |
| 1314 | Ga0495602_0977255 | 3300048088 | Bacteria | 560 |
| 1315 | Ga0495615_0317945 | 3300048090 | Unclassified | 508 |
| 1316 | Ga0495626_0170422 | 3300048091 | Unclassified | 908 |
| 1317 | Ga0496100_0146491 | 3300048903 | Bacteria | 1680 |
| 1318 | Ga0496100_0253997 | 3300048903 | Bacteria | 1301 |
| 1319 | Ga0496100_0998686 | 3300048903 | Unclassified | 658 |
| 1320 | Ga0496101_0033960 | 3300048904 | Bacteria | 3602 |
| 1321 | Ga0496101_0120036 | 3300048904 | Bacteria | 1987 |
| 1322 | Ga0496101_0133843 | 3300048904 | Unclassified | 1884 |
| 1323 | Ga0496101_0244550 | 3300048904 | Bacteria | 1397 |
| 1324 | Ga0496101_0420246 | 3300048904 | Bacteria | 1054 |
| 1325 | Ga0496101_0531947 | 3300048904 | Bacteria | 929 |
| 1326 | Ga0496101_1119624 | 3300048904 | Bacteria | 618 |
| 1327 | Ga0496102_0018921 | 3300048905 | Bacteria | 6059 |
| 1328 | Ga0496102_0028763 | 3300048905 | Bacteria | 4968 |
| 1329 | Ga0496102_0035336 | 3300048905 | Bacteria | 4498 |
| 1330 | Ga0496102_0081398 | 3300048905 | Bacteria | 2985 |
| 1331 | Ga0496102_0120716 | 3300048905 | Bacteria | 2448 |
| 1332 | Ga0496102_0499163 | 3300048905 | Unclassified | 1139 |
| 1333 | Ga0496102_0712924 | 3300048905 | Bacteria | 926 |
| 1334 | Ga0496102_0809927 | 3300048905 | Unclassified | 859 |
| 1335 | Ga0496103_0153708 | 3300048906 | Unclassified | 1474 |
| 1336 | Ga0496103_0220069 | 3300048906 | Bacteria | 1221 |
| 1337 | Ga0496103_0242836 | 3300048906 | Bacteria | 1159 |
| 1338 | Ga0496103_0393747 | 3300048906 | Bacteria | 890 |
| 1339 | Ga0496103_0773709 | 3300048906 | Unclassified | 606 |
| 1340 | Ga0496104_0072184 | 3300048907 | Bacteria | 3282 |
| 1341 | Ga0496104_0102699 | 3300048907 | Bacteria | 2738 |
| 1342 | Ga0496104_0108532 | 3300048907 | Bacteria | 2660 |
| 1343 | Ga0496104_0136889 | 3300048907 | Bacteria | 2353 |
| 1344 | Ga0496104_0168761 | 3300048907 | Bacteria | 2099 |
| 1345 | Ga0496104_0291714 | 3300048907 | Unclassified | 1544 |
| 1346 | Ga0496104_0699020 | 3300048907 | Unclassified | 922 |
| 1347 | Ga0496104_0909073 | 3300048907 | Bacteria | 785 |
| 1348 | Ga0496104_1609662 | 3300048907 | Unclassified | 552 |
| 1349 | Ga0496105_0014160 | 3300048908 | Bacteria | 6346 |
| 1350 | Ga0496105_0044348 | 3300048908 | Bacteria | 3668 |
| 1351 | Ga0496105_0201100 | 3300048908 | Bacteria | 1626 |
| 1352 | Ga0496105_0228200 | 3300048908 | Bacteria | 1514 |
| 1353 | Ga0496105_0424240 | 3300048908 | Unclassified | 1053 |
| 1354 | Ga0496105_0495460 | 3300048908 | Bacteria | 960 |
| 1355 | Ga0496105_1023973 | 3300048908 | Bacteria | 616 |
| 1356 | Ga0496106_0003085 | 3300048909 | Bacteria | 12426 |
| 1357 | Ga0496106_0181663 | 3300048909 | Bacteria | 1670 |
| 1358 | Ga0496106_0243904 | 3300048909 | Bacteria | 1436 |
| 1359 | Ga0496106_0669279 | 3300048909 | Unclassified | 829 |
| 1360 | Ga0496106_1489843 | 3300048909 | Unclassified | 521 |
| 1361 | Ga0496107_0018540 | 3300048910 | Bacteria | 4901 |
| 1362 | Ga0496107_0057367 | 3300048910 | Bacteria | 2815 |
| 1363 | Ga0496107_0515995 | 3300048910 | Unclassified | 886 |
| 1364 | Ga0496107_0701611 | 3300048910 | Bacteria | 744 |
| 1365 | Ga0496108_0074789 | 3300048911 | Bacteria | 2861 |
| 1366 | Ga0496108_0227271 | 3300048911 | Bacteria | 1622 |
| 1367 | Ga0496108_0278310 | 3300048911 | Unclassified | 1457 |
| 1368 | Ga0496108_0289492 | 3300048911 | Bacteria | 1426 |
| 1369 | Ga0496108_0385699 | 3300048911 | Unclassified | 1223 |
| 1370 | Ga0496108_0647903 | 3300048911 | Bacteria | 918 |
| 1371 | Ga0496108_0735373 | 3300048911 | Unclassified | 854 |
| 1372 | Ga0496108_1474427 | 3300048911 | Unclassified | 567 |
| 1373 | Ga0496109_0007242 | 3300048912 | Bacteria | 9381 |
| 1374 | Ga0496109_0063355 | 3300048912 | Bacteria | 3382 |
| 1375 | Ga0496109_0402868 | 3300048912 | Bacteria | 1292 |
| 1376 | Ga0496109_0427849 | 3300048912 | Bacteria | 1251 |
| 1377 | Ga0496109_0477618 | 3300048912 | Unclassified | 1177 |
| 1378 | Ga0496109_0583767 | 3300048912 | Unclassified | 1053 |
| 1379 | Ga0496109_0661893 | 3300048912 | Bacteria | 981 |
| 1380 | Ga0496109_0664459 | 3300048912 | Bacteria | 979 |
| 1381 | Ga0496109_1056448 | 3300048912 | Bacteria | 749 |
| 1382 | Ga0496109_1264628 | 3300048912 | Unclassified | 674 |
| 1383 | Ga0496110_0085553 | 3300048913 | Bacteria | 2814 |
| 1384 | Ga0496110_0167148 | 3300048913 | Bacteria | 1995 |
| 1385 | Ga0496110_0209266 | 3300048913 | Bacteria | 1773 |
| 1386 | Ga0496110_0348670 | 3300048913 | Bacteria | 1349 |
| 1387 | Ga0496110_0504270 | 3300048913 | Bacteria | 1102 |
| 1388 | Ga0496110_0633012 | 3300048913 | Bacteria | 969 |
| 1389 | Ga0496110_0957120 | 3300048913 | Unclassified | 763 |
| 1390 | Ga0496111_0090259 | 3300048914 | Bacteria | 2245 |
| 1391 | Ga0496111_0162316 | 3300048914 | Unclassified | 1659 |
| 1392 | Ga0496111_0486546 | 3300048914 | Bacteria | 909 |
| 1393 | Ga0496111_1002304 | 3300048914 | Bacteria | 598 |
| 1394 | Ga0496112_0190669 | 3300048915 | Unclassified | 2012 |
| 1395 | Ga0496112_0198324 | 3300048915 | Bacteria | 1967 |
| 1396 | Ga0496112_0221378 | 3300048915 | Bacteria | 1848 |
| 1397 | Ga0496112_0223765 | 3300048915 | Unclassified | 1837 |
| 1398 | Ga0496112_0225271 | 3300048915 | Bacteria | 1830 |
| 1399 | Ga0496112_0245973 | 3300048915 | Bacteria | 1740 |
| 1400 | Ga0496112_0320945 | 3300048915 | Unclassified | 1493 |
| 1401 | Ga0496112_0360815 | 3300048915 | Bacteria | 1395 |
| 1402 | Ga0496112_0394307 | 3300048915 | Unclassified | 1324 |
| 1403 | Ga0496112_0481075 | 3300048915 | Bacteria | 1178 |
| 1404 | Ga0496112_0753857 | 3300048915 | Bacteria | 900 |
| 1405 | Ga0496112_1117331 | 3300048915 | Unclassified | 706 |
| 1406 | Ga0496113_0069914 | 3300048916 | Bacteria | 2667 |
| 1407 | Ga0496113_0102219 | 3300048916 | Bacteria | 2222 |
| 1408 | Ga0496113_0322952 | 3300048916 | Unclassified | 1237 |
| 1409 | Ga0496113_0565248 | 3300048916 | Unclassified | 912 |
| 1410 | Ga0496113_0630181 | 3300048916 | Unclassified | 858 |
| 1411 | Ga0496113_0916518 | 3300048916 | Unclassified | 693 |
| 1412 | Ga0496113_1029711 | 3300048916 | Unclassified | 648 |
| 1413 | Ga0496114_0012997 | 3300048917 | Bacteria | 6672 |
| 1414 | Ga0496114_0035218 | 3300048917 | Bacteria | 4133 |
| 1415 | Ga0496114_0115165 | 3300048917 | Bacteria | 2306 |
| 1416 | Ga0496114_0533694 | 3300048917 | Unclassified | 1037 |
| 1417 | Ga0496114_0582057 | 3300048917 | Bacteria | 988 |
| 1418 | Ga0496114_0598799 | 3300048917 | Bacteria | 972 |
| 1419 | Ga0496115_0002575 | 3300048918 | Bacteria | 13018 |
| 1420 | Ga0496115_0004314 | 3300048918 | Bacteria | 10290 |
| 1421 | Ga0496115_0009305 | 3300048918 | Bacteria | 7301 |
| 1422 | Ga0496115_0026271 | 3300048918 | Bacteria | 4543 |
| 1423 | Ga0496115_0128133 | 3300048918 | Bacteria | 2091 |
| 1424 | Ga0496115_0177184 | 3300048918 | Bacteria | 1763 |
| 1425 | Ga0496115_0294208 | 3300048918 | Bacteria | 1331 |
| 1426 | Ga0496115_0387746 | 3300048918 | Bacteria | 1135 |
| 1427 | Ga0496115_1437681 | 3300048918 | Unclassified | 508 |
| 1428 | Ga0501068_0449667 | 3300049584 | Unclassified | 833 |
| 1429 | Ga0501069_0570360 | 3300049585 | Unclassified | 678 |
| 1430 | nmdc:mga05p37_135223_c1 | 3300050507 | Bacteria | 3024 |
| 1431 | nmdc:mga05p37_2087035_c1 | 3300050507 | Bacteria | 532 |
| 1432 | nmdc:mga05p37_2090916_c1 | 3300050507 | Unclassified | 531 |
| 1433 | nmdc:mga05p37_35285_c2 | 3300050507 | Bacteria | 4319 |
| 1434 | nmdc:mga05p37_473501_c1 | 3300050507 | Bacteria | 1444 |
| 1435 | nmdc:mga06r32_971239_c1 | 3300050510 | Bacteria | 803 |
| 1436 | nmdc:mga08y16_1099761_c1 | 3300050511 | Unclassified | 770 |
| 1437 | nmdc:mga08y16_1770500_c1 | 3300050511 | Unclassified | 571 |
| 1438 | nmdc:mga08y16_247448_c1 | 3300050511 | Bacteria | 1842 |
| 1439 | nmdc:mga08y16_738675_c1 | 3300050511 | Unclassified | 981 |
| 1440 | nmdc:mga08y16_811526_c1 | 3300050511 | Unclassified | 928 |
| 1441 | nmdc:mga0n895_1162717_c1 | 3300050512 | Unclassified | 747 |
| 1442 | nmdc:mga0n895_1466075_c1 | 3300050512 | Unclassified | 649 |
| 1443 | nmdc:mga0n895_212360_c1 | 3300050512 | Bacteria | 1965 |
| 1444 | nmdc:mga0n895_233774_c1 | 3300050512 | Unclassified | 1345 |
| 1445 | nmdc:mga0n895_759064_c1 | 3300050512 | Unclassified | 962 |
| 1446 | nmdc:mga0n895_784220_c1 | 3300050512 | Bacteria | 944 |
| 1447 | nmdc:mga0n895_929477_c1 | 3300050512 | Unclassified | 854 |
| 1448 | nmdc:mga0rr50_1203860_c1 | 3300050513 | Bacteria | 643 |
| 1449 | nmdc:mga0rr50_383536_c1 | 3300050513 | Bacteria | 1185 |
| 1450 | nmdc:mga08x19_266662_c1 | 3300050514 | Unclassified | 1184 |
| 1451 | nmdc:mga08x19_28098_c1 | 3300050514 | Bacteria | 3521 |
| 1452 | nmdc:mga08x19_520835_c1 | 3300050514 | Unclassified | 840 |
| 1453 | nmdc:mga08x19_631307_c1 | 3300050514 | Unclassified | 759 |
| 1454 | nmdc:mga0a205_1135164_c1 | 3300050515 | Unclassified | 629 |
| 1455 | nmdc:mga0a205_415093_c1 | 3300050515 | Unclassified | 1208 |
| 1456 | Ga0495601_0001921 | 3300053077 | Bacteria | 11624 |
| 1457 | Ga0495601_0027550 | 3300053077 | Unclassified | 3514 |
| 1458 | Ga0495601_0292224 | 3300053077 | Bacteria | 1062 |
| 1459 | Ga0495612_0031116 | 3300053078 | Unclassified | 2151 |
| 1460 | Ga0495655_0145261 | 3300053083 | Unclassified | 742 |
| 1461 | Ga0495655_0362173 | 3300053083 | Unclassified | 509 |
| 1462 | Ga0495595_0035542 | 3300053084 | Bacteria | 2257 |
| 1463 | Ga0495595_0039367 | 3300053084 | Unclassified | 2156 |
| 1464 | Ga0495595_0090399 | 3300053084 | Bacteria | 1468 |
| 1465 | Ga0495595_0431575 | 3300053084 | Unclassified | 669 |
| 1466 | Ga0495619_0083552 | 3300053085 | Bacteria | 2154 |
| 1467 | Ga0495619_0164194 | 3300053085 | Bacteria | 1534 |
| 1468 | Ga0495619_0259855 | 3300053085 | Unclassified | 1203 |
| 1469 | Ga0495619_0272881 | 3300053085 | Bacteria | 1172 |
| 1470 | Ga0500618_058191 | 3300053125 | Unclassified | 870 |
| 1471 | Ga0500636_0323809 | 3300053177 | Unclassified | 748 |
| 1472 | Ga0500657_161662 | 3300053728 | Bacteria | 811 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005290 | Ga0065712_10597168 | Ga0065712_105971682 | 59 |
| 2 | 3300005331 | Ga0070670_100000833 | Ga0070670_10000083327 | 59 |
| 3 | 3300005331 | Ga0070670_100003742 | Ga0070670_10000374219 | 59 |
| 4 | 3300005335 | Ga0070666_10130584 | Ga0070666_101305844 | 59 |
| 5 | 3300005335 | Ga0070666_11014759 | Ga0070666_110147592 | 59 |
| 6 | 3300005338 | Ga0068868_100031931 | Ga0068868_1000319316 | 59 |
| 7 | 3300005347 | Ga0070668_100000403 | Ga0070668_10000040329 | 59 |
| 8 | 3300005355 | Ga0070671_100000283 | Ga0070671_10000028337 | 59 |
| 9 | 3300005355 | Ga0070671_100872664 | Ga0070671_1008726643 | 59 |
| 10 | 3300005364 | Ga0070673_100999699 | Ga0070673_1009996992 | 59 |
| 11 | 3300005364 | Ga0070673_102383003 | Ga0070673_1023830031 | 59 |
| 12 | 3300005435 | Ga0070714_100477608 | Ga0070714_1004776082 | 59 |
| 13 | 3300005456 | Ga0070678_101641204 | Ga0070678_1016412042 | 59 |
| 14 | 3300005530 | Ga0070679_101214875 | Ga0070679_1012148752 | 59 |
| 15 | 3300005543 | Ga0070672_101129499 | Ga0070672_1011294992 | 59 |
| 16 | 3300005548 | Ga0070665_100024438 | Ga0070665_1000244389 | 59 |
| 17 | 3300005564 | Ga0070664_100121453 | Ga0070664_1001214533 | 59 |
| 18 | 3300005616 | Ga0068852_100902141 | Ga0068852_1009021412 | 59 |
| 19 | 3300005844 | Ga0068862_100258378 | Ga0068862_1002583783 | 59 |
| 20 | 3300006237 | Ga0097621_100018403 | Ga0097621_1000184035 | 59 |
| 21 | 3300006358 | Ga0068871_100038389 | Ga0068871_1000383893 | 59 |
| 22 | 3300006881 | Ga0068865_100017414 | Ga0068865_1000174147 | 59 |
| 23 | 3300006914 | Ga0075436_100089519 | Ga0075436_1000895193 | 59 |
| 24 | 3300006914 | Ga0075436_100313760 | Ga0075436_1003137602 | 59 |
| 25 | 3300025315 | Ga0207697_10000010 | Ga0207697_1000001059 | 59 |
| 26 | 3300025899 | Ga0207642_10142597 | Ga0207642_101425973 | 59 |
| 27 | 3300025901 | Ga0207688_10007718 | Ga0207688_1000771811 | 59 |
| 28 | 3300025903 | Ga0207680_10094129 | Ga0207680_100941294 | 59 |
| 29 | 3300025907 | Ga0207645_10004432 | Ga0207645_1000443210 | 59 |
| 30 | 3300025925 | Ga0207650_10007428 | Ga0207650_1000742810 | 59 |
| 31 | 3300025931 | Ga0207644_10058479 | Ga0207644_100584794 | 59 |
| 32 | 3300025936 | Ga0207670_10246226 | Ga0207670_102462261 | 59 |
| 33 | 3300025938 | Ga0207704_10046539 | Ga0207704_100465395 | 59 |
| 34 | 3300025940 | Ga0207691_10000142 | Ga0207691_1000014215 | 59 |
| 35 | 3300025960 | Ga0207651_10007253 | Ga0207651_100072532 | 59 |
| 36 | 3300025972 | Ga0207668_10009836 | Ga0207668_100098368 | 59 |
| 37 | 3300026142 | Ga0207698_10435666 | Ga0207698_104356663 | 59 |
| 38 | 3300028379 | Ga0268266_10004179 | Ga0268266_1000417910 | 59 |
| 39 | 3300039450 | Ga0436363_1186420 | Ga0436363_1186420_19_216 | 59 |
| 40 | 3300048904 | Ga0496101_0531947 | Ga0496101_0531947_11_208 | 59 |
| 41 | 3300005289 | Ga0065704_10097735 | Ga0065704_100977353 | 62 |
| 42 | 3300005435 | Ga0070714_101950425 | Ga0070714_1019504252 | 64 |
| 43 | 3300005445 | Ga0070708_100958394 | Ga0070708_1009583942 | 64 |
| 44 | 3300005471 | Ga0070698_100225558 | Ga0070698_1002255582 | 64 |
| 45 | 3300006871 | Ga0075434_101015835 | Ga0075434_1010158352 | 64 |
| 46 | 3300025910 | Ga0207684_10000028 | Ga0207684_1000002816 | 64 |
| 47 | 3300025922 | Ga0207646_10005640 | Ga0207646_100056406 | 64 |
| 48 | 3300025929 | Ga0207664_11665513 | Ga0207664_116655132 | 64 |
| 49 | 3300025936 | Ga0207670_11168912 | Ga0207670_111689123 | 64 |
| 50 | 3300037418 | Ga0395900_1784311 | Ga0395900_1784311_204_407 | 64 |
| 51 | 3300050512 | nmdc:mga0n895_929477_c1 | nmdc:mga0n895_929477_c1_473_670 | 64 |
| 52 | 3300005289 | Ga0065704_10002652 | Ga0065704_1000265214 | 65 |
| 53 | 3300005289 | Ga0065704_10282058 | Ga0065704_102820583 | 65 |
| 54 | 3300005289 | Ga0065704_10306099 | Ga0065704_103060991 | 65 |
| 55 | 3300005290 | Ga0065712_10072999 | Ga0065712_100729995 | 65 |
| 56 | 3300005290 | Ga0065712_10121918 | Ga0065712_101219185 | 65 |
| 57 | 3300005290 | Ga0065712_10320047 | Ga0065712_103200473 | 65 |
| 58 | 3300005293 | Ga0065715_10024370 | Ga0065715_100243704 | 65 |
| 59 | 3300005293 | Ga0065715_10389010 | Ga0065715_103890102 | 65 |
| 60 | 3300005293 | Ga0065715_10884699 | Ga0065715_108846992 | 65 |
| 61 | 3300005295 | Ga0065707_10007089 | Ga0065707_100070895 | 65 |
| 62 | 3300005295 | Ga0065707_10470003 | Ga0065707_104700032 | 65 |
| 63 | 3300005328 | Ga0070676_10031330 | Ga0070676_100313303 | 65 |
| 64 | 3300005328 | Ga0070676_10441948 | Ga0070676_104419482 | 65 |
| 65 | 3300005331 | Ga0070670_100260744 | Ga0070670_1002607443 | 65 |
| 66 | 3300005333 | Ga0070677_10566592 | Ga0070677_105665922 | 65 |
| 67 | 3300005334 | Ga0068869_100412385 | Ga0068869_1004123853 | 65 |
| 68 | 3300005335 | Ga0070666_10037434 | Ga0070666_100374343 | 65 |
| 69 | 3300005335 | Ga0070666_10827198 | Ga0070666_108271981 | 65 |
| 70 | 3300005338 | Ga0068868_100059779 | Ga0068868_1000597794 | 65 |
| 71 | 3300005338 | Ga0068868_100201460 | Ga0068868_1002014602 | 65 |
| 72 | 3300005339 | Ga0070660_100408877 | Ga0070660_1004088772 | 65 |
| 73 | 3300005340 | Ga0070689_101513560 | Ga0070689_1015135601 | 65 |
| 74 | 3300005343 | Ga0070687_100711471 | Ga0070687_1007114711 | 65 |
| 75 | 3300005344 | Ga0070661_101207687 | Ga0070661_1012076872 | 65 |
| 76 | 3300005344 | Ga0070661_101588495 | Ga0070661_1015884952 | 65 |
| 77 | 3300005347 | Ga0070668_100004836 | Ga0070668_1000048365 | 65 |
| 78 | 3300005347 | Ga0070668_100519859 | Ga0070668_1005198592 | 65 |
| 79 | 3300005353 | Ga0070669_100064706 | Ga0070669_1000647062 | 65 |
| 80 | 3300005354 | Ga0070675_101142101 | Ga0070675_1011421012 | 65 |
| 81 | 3300005354 | Ga0070675_101652152 | Ga0070675_1016521522 | 65 |
| 82 | 3300005355 | Ga0070671_100149154 | Ga0070671_1001491543 | 65 |
| 83 | 3300005355 | Ga0070671_100198585 | Ga0070671_1001985853 | 65 |
| 84 | 3300005356 | Ga0070674_100000912 | Ga0070674_10000091220 | 65 |
| 85 | 3300005356 | Ga0070674_100341788 | Ga0070674_1003417882 | 65 |
| 86 | 3300005364 | Ga0070673_100017182 | Ga0070673_1000171826 | 65 |
| 87 | 3300005364 | Ga0070673_101564425 | Ga0070673_1015644251 | 65 |
| 88 | 3300005367 | Ga0070667_100773818 | Ga0070667_1007738183 | 65 |
| 89 | 3300005434 | Ga0070709_10042905 | Ga0070709_100429053 | 65 |
| 90 | 3300005434 | Ga0070709_10232892 | Ga0070709_102328922 | 65 |
| 91 | 3300005434 | Ga0070709_10238921 | Ga0070709_102389212 | 65 |
| 92 | 3300005435 | Ga0070714_100493973 | Ga0070714_1004939732 | 65 |
| 93 | 3300005435 | Ga0070714_100917821 | Ga0070714_1009178211 | 65 |
| 94 | 3300005435 | Ga0070714_100959005 | Ga0070714_1009590053 | 65 |
| 95 | 3300005436 | Ga0070713_100702222 | Ga0070713_1007022222 | 65 |
| 96 | 3300005436 | Ga0070713_101618955 | Ga0070713_1016189551 | 65 |
| 97 | 3300005437 | Ga0070710_10086739 | Ga0070710_100867393 | 65 |
| 98 | 3300005437 | Ga0070710_10998595 | Ga0070710_109985952 | 65 |
| 99 | 3300005438 | Ga0070701_10410151 | Ga0070701_104101513 | 65 |
| 100 | 3300005439 | Ga0070711_100005001 | Ga0070711_1000050015 | 65 |
| 101 | 3300005439 | Ga0070711_100647742 | Ga0070711_1006477421 | 65 |
| 102 | 3300005440 | Ga0070705_100035279 | Ga0070705_1000352796 | 65 |
| 103 | 3300005455 | Ga0070663_100528518 | Ga0070663_1005285183 | 65 |
| 104 | 3300005455 | Ga0070663_100896687 | Ga0070663_1008966872 | 65 |
| 105 | 3300005456 | Ga0070678_100399598 | Ga0070678_1003995982 | 65 |
| 106 | 3300005456 | Ga0070678_100699967 | Ga0070678_1006999673 | 65 |
| 107 | 3300005457 | Ga0070662_100037174 | Ga0070662_1000371745 | 65 |
| 108 | 3300005457 | Ga0070662_100099149 | Ga0070662_1000991494 | 65 |
| 109 | 3300005457 | Ga0070662_100579263 | Ga0070662_1005792632 | 65 |
| 110 | 3300005458 | Ga0070681_10964939 | Ga0070681_109649392 | 65 |
| 111 | 3300005459 | Ga0068867_100383797 | Ga0068867_1003837973 | 65 |
| 112 | 3300005467 | Ga0070706_100025982 | Ga0070706_1000259824 | 65 |
| 113 | 3300005468 | Ga0070707_100032046 | Ga0070707_10003204610 | 65 |
| 114 | 3300005536 | Ga0070697_100326741 | Ga0070697_1003267412 | 65 |
| 115 | 3300005543 | Ga0070672_100050273 | Ga0070672_1000502734 | 65 |
| 116 | 3300005543 | Ga0070672_101107711 | Ga0070672_1011077111 | 65 |
| 117 | 3300005546 | Ga0070696_100058415 | Ga0070696_1000584156 | 65 |
| 118 | 3300005546 | Ga0070696_101979962 | Ga0070696_1019799621 | 65 |
| 119 | 3300005547 | Ga0070693_100807177 | Ga0070693_1008071771 | 65 |
| 120 | 3300005548 | Ga0070665_101338704 | Ga0070665_1013387042 | 65 |
| 121 | 3300005549 | Ga0070704_100227148 | Ga0070704_1002271483 | 65 |
| 122 | 3300005563 | Ga0068855_102313345 | Ga0068855_1023133452 | 65 |
| 123 | 3300005614 | Ga0068856_100237795 | Ga0068856_1002377953 | 65 |
| 124 | 3300005614 | Ga0068856_102303089 | Ga0068856_1023030891 | 65 |
| 125 | 3300005615 | Ga0070702_100018870 | Ga0070702_1000188702 | 65 |
| 126 | 3300005718 | Ga0068866_10041728 | Ga0068866_100417283 | 65 |
| 127 | 3300005719 | Ga0068861_100173761 | Ga0068861_1001737612 | 65 |
| 128 | 3300005843 | Ga0068860_100174781 | Ga0068860_1001747812 | 65 |
| 129 | 3300005844 | Ga0068862_101842946 | Ga0068862_1018429462 | 65 |
| 130 | 3300006163 | Ga0070715_10100296 | Ga0070715_101002963 | 65 |
| 131 | 3300006173 | Ga0070716_100608707 | Ga0070716_1006087073 | 65 |
| 132 | 3300006173 | Ga0070716_101035850 | Ga0070716_1010358502 | 65 |
| 133 | 3300006175 | Ga0070712_100010939 | Ga0070712_1000109399 | 65 |
| 134 | 3300006175 | Ga0070712_100598006 | Ga0070712_1005980063 | 65 |
| 135 | 3300006175 | Ga0070712_101025854 | Ga0070712_1010258541 | 65 |
| 136 | 3300006358 | Ga0068871_101285743 | Ga0068871_1012857432 | 65 |
| 137 | 3300006871 | Ga0075434_101178183 | Ga0075434_1011781832 | 65 |
| 138 | 3300006871 | Ga0075434_101790846 | Ga0075434_1017908462 | 65 |
| 139 | 3300006914 | Ga0075436_100283948 | Ga0075436_1002839482 | 65 |
| 140 | 3300007076 | Ga0075435_100988217 | Ga0075435_1009882173 | 65 |
| 141 | 3300007788 | Ga0099795_10056361 | Ga0099795_100563612 | 65 |
| 142 | 3300009101 | Ga0105247_10223822 | Ga0105247_102238223 | 65 |
| 143 | 3300009174 | Ga0105241_11992440 | Ga0105241_119924402 | 65 |
| 144 | 3300009176 | Ga0105242_10229921 | Ga0105242_102299212 | 65 |
| 145 | 3300009177 | Ga0105248_11410730 | Ga0105248_114107302 | 65 |
| 146 | 3300009553 | Ga0105249_11320275 | Ga0105249_113202751 | 65 |
| 147 | 3300010159 | Ga0099796_10005301 | Ga0099796_100053017 | 65 |
| 148 | 3300010375 | Ga0105239_10292714 | Ga0105239_102927143 | 65 |
| 149 | 3300011119 | Ga0105246_10874569 | Ga0105246_108745692 | 65 |
| 150 | 3300012488 | Ga0157343_1016333 | Ga0157343_10163333 | 65 |
| 151 | 3300012505 | Ga0157339_1012990 | Ga0157339_10129901 | 65 |
| 152 | 3300012506 | Ga0157324_1023983 | Ga0157324_10239832 | 65 |
| 153 | 3300012508 | Ga0157315_1060043 | Ga0157315_10600432 | 65 |
| 154 | 3300013100 | Ga0157373_10698598 | Ga0157373_106985981 | 65 |
| 155 | 3300013102 | Ga0157371_10265362 | Ga0157371_102653623 | 65 |
| 156 | 3300013102 | Ga0157371_11321911 | Ga0157371_113219112 | 65 |
| 157 | 3300013296 | Ga0157374_10019745 | Ga0157374_100197456 | 65 |
| 158 | 3300013296 | Ga0157374_11011256 | Ga0157374_110112562 | 65 |
| 159 | 3300013297 | Ga0157378_10644156 | Ga0157378_106441563 | 65 |
| 160 | 3300013297 | Ga0157378_11552705 | Ga0157378_115527052 | 65 |
| 161 | 3300013306 | Ga0163162_10017445 | Ga0163162_100174455 | 65 |
| 162 | 3300013306 | Ga0163162_10300351 | Ga0163162_103003512 | 65 |
| 163 | 3300013307 | Ga0157372_10912415 | Ga0157372_109124152 | 65 |
| 164 | 3300013308 | Ga0157375_10136768 | Ga0157375_101367685 | 65 |
| 165 | 3300013308 | Ga0157375_10138523 | Ga0157375_101385235 | 65 |
| 166 | 3300013308 | Ga0157375_11011837 | Ga0157375_110118373 | 65 |
| 167 | 3300014745 | Ga0157377_10608791 | Ga0157377_106087911 | 65 |
| 168 | 3300014745 | Ga0157377_11466850 | Ga0157377_114668502 | 65 |
| 169 | 3300014968 | Ga0157379_10362342 | Ga0157379_103623422 | 65 |
| 170 | 3300014969 | Ga0157376_10064325 | Ga0157376_100643253 | 65 |
| 171 | 3300014969 | Ga0157376_10943728 | Ga0157376_109437282 | 65 |
| 172 | 3300014969 | Ga0157376_12876303 | Ga0157376_128763032 | 65 |
| 173 | 3300017792 | Ga0163161_10046543 | Ga0163161_100465433 | 65 |
| 174 | 3300017792 | Ga0163161_10125832 | Ga0163161_101258324 | 65 |
| 175 | 3300025290 | Ga0207673_1055722 | Ga0207673_10557222 | 65 |
| 176 | 3300025315 | Ga0207697_10000131 | Ga0207697_1000013132 | 65 |
| 177 | 3300025315 | Ga0207697_10000495 | Ga0207697_1000049510 | 65 |
| 178 | 3300025315 | Ga0207697_10229814 | Ga0207697_102298142 | 65 |
| 179 | 3300025315 | Ga0207697_10274420 | Ga0207697_102744202 | 65 |
| 180 | 3300025893 | Ga0207682_10024517 | Ga0207682_100245172 | 65 |
| 181 | 3300025898 | Ga0207692_10123175 | Ga0207692_101231754 | 65 |
| 182 | 3300025899 | Ga0207642_10073381 | Ga0207642_100733813 | 65 |
| 183 | 3300025901 | Ga0207688_10014566 | Ga0207688_100145662 | 65 |
| 184 | 3300025903 | Ga0207680_10921954 | Ga0207680_109219542 | 65 |
| 185 | 3300025905 | Ga0207685_10664344 | Ga0207685_106643441 | 65 |
| 186 | 3300025906 | Ga0207699_10020861 | Ga0207699_100208612 | 65 |
| 187 | 3300025906 | Ga0207699_11018544 | Ga0207699_110185442 | 65 |
| 188 | 3300025907 | Ga0207645_10004253 | Ga0207645_100042537 | 65 |
| 189 | 3300025907 | Ga0207645_10363541 | Ga0207645_103635413 | 65 |
| 190 | 3300025910 | Ga0207684_10422941 | Ga0207684_104229411 | 65 |
| 191 | 3300025915 | Ga0207693_10000889 | Ga0207693_1000088925 | 65 |
| 192 | 3300025915 | Ga0207693_10496489 | Ga0207693_104964893 | 65 |
| 193 | 3300025916 | Ga0207663_10002290 | Ga0207663_1000229013 | 65 |
| 194 | 3300025916 | Ga0207663_10135856 | Ga0207663_101358565 | 65 |
| 195 | 3300025918 | Ga0207662_10074228 | Ga0207662_100742284 | 65 |
| 196 | 3300025919 | Ga0207657_10860162 | Ga0207657_108601623 | 65 |
| 197 | 3300025920 | Ga0207649_10520278 | Ga0207649_105202782 | 65 |
| 198 | 3300025921 | Ga0207652_11202675 | Ga0207652_112026751 | 65 |
| 199 | 3300025923 | Ga0207681_10234539 | Ga0207681_102345392 | 65 |
| 200 | 3300025923 | Ga0207681_10655769 | Ga0207681_106557692 | 65 |
| 201 | 3300025925 | Ga0207650_10006836 | Ga0207650_1000683611 | 65 |
| 202 | 3300025926 | Ga0207659_10222696 | Ga0207659_102226963 | 65 |
| 203 | 3300025926 | Ga0207659_10225081 | Ga0207659_102250813 | 65 |
| 204 | 3300025926 | Ga0207659_10807541 | Ga0207659_108075412 | 65 |
| 205 | 3300025928 | Ga0207700_10185843 | Ga0207700_101858435 | 65 |
| 206 | 3300025929 | Ga0207664_11417441 | Ga0207664_114174412 | 65 |
| 207 | 3300025931 | Ga0207644_10033707 | Ga0207644_100337074 | 65 |
| 208 | 3300025931 | Ga0207644_10545561 | Ga0207644_105455612 | 65 |
| 209 | 3300025933 | Ga0207706_10070025 | Ga0207706_100700257 | 65 |
| 210 | 3300025933 | Ga0207706_10532738 | Ga0207706_105327383 | 65 |
| 211 | 3300025937 | Ga0207669_10007177 | Ga0207669_100071773 | 65 |
| 212 | 3300025938 | Ga0207704_10949398 | Ga0207704_109493981 | 65 |
| 213 | 3300025939 | Ga0207665_10046134 | Ga0207665_100461343 | 65 |
| 214 | 3300025939 | Ga0207665_10048049 | Ga0207665_100480492 | 65 |
| 215 | 3300025939 | Ga0207665_10192231 | Ga0207665_101922313 | 65 |
| 216 | 3300025940 | Ga0207691_10000247 | Ga0207691_1000024714 | 65 |
| 217 | 3300025941 | Ga0207711_11097234 | Ga0207711_110972342 | 65 |
| 218 | 3300025949 | Ga0207667_11436943 | Ga0207667_114369432 | 65 |
| 219 | 3300025960 | Ga0207651_10098725 | Ga0207651_100987253 | 65 |
| 220 | 3300025961 | Ga0207712_10873704 | Ga0207712_108737042 | 65 |
| 221 | 3300025972 | Ga0207668_10079305 | Ga0207668_100793056 | 65 |
| 222 | 3300025972 | Ga0207668_12007131 | Ga0207668_120071312 | 65 |
| 223 | 3300025986 | Ga0207658_10336677 | Ga0207658_103366771 | 65 |
| 224 | 3300026023 | Ga0207677_10091729 | Ga0207677_100917293 | 65 |
| 225 | 3300026023 | Ga0207677_10433420 | Ga0207677_104334203 | 65 |
| 226 | 3300026023 | Ga0207677_10733847 | Ga0207677_107338472 | 65 |
| 227 | 3300026035 | Ga0207703_10203169 | Ga0207703_102031693 | 65 |
| 228 | 3300026078 | Ga0207702_11133263 | Ga0207702_111332631 | 65 |
| 229 | 3300026118 | Ga0207675_100094187 | Ga0207675_1000941877 | 65 |
| 230 | 3300026121 | Ga0207683_10006977 | Ga0207683_100069774 | 65 |
| 231 | 3300026121 | Ga0207683_10008842 | Ga0207683_100088427 | 65 |
| 232 | 3300026121 | Ga0207683_10887783 | Ga0207683_108877832 | 65 |
| 233 | 3300028379 | Ga0268266_10787947 | Ga0268266_107879472 | 65 |
| 234 | 3300028380 | Ga0268265_11672712 | Ga0268265_116727122 | 65 |
| 235 | 3300028381 | Ga0268264_10458954 | Ga0268264_104589542 | 65 |
| 236 | 3300035083 | Ga0373926_0467032 | Ga0373926_0467032_188_385 | 65 |
| 237 | 3300035089 | Ga0373944_0030278 | Ga0373944_0030278_970_1167 | 65 |
| 238 | 3300035092 | Ga0373952_0131002 | Ga0373952_0131002_47_244 | 65 |
| 239 | 3300035116 | Ga0373945_0017219 | Ga0373945_0017219_920_1117 | 65 |
| 240 | 3300035170 | Ga0373943_0005531 | Ga0373943_0005531_160_357 | 65 |
| 241 | 3300035170 | Ga0373943_0220985 | Ga0373943_0220985_793_990 | 65 |
| 242 | 3300035170 | Ga0373943_0237915 | Ga0373943_0237915_29_226 | 65 |
| 243 | 3300035170 | Ga0373943_0355223 | Ga0373943_0355223_600_797 | 65 |
| 244 | 3300035171 | Ga0373946_0043328 | Ga0373946_0043328_958_1155 | 65 |
| 245 | 3300035171 | Ga0373946_0226075 | Ga0373946_0226075_340_537 | 65 |
| 246 | 3300035207 | Ga0373942_0045221 | Ga0373942_0045221_953_1150 | 65 |
| 247 | 3300035691 | Ga0373931_0027301 | Ga0373931_0027301_1204_1401 | 65 |
| 248 | 3300035691 | Ga0373931_0062699 | Ga0373931_0062699_1174_1371 | 65 |
| 249 | 3300035692 | Ga0373935_0100133 | Ga0373935_0100133_1267_1464 | 65 |
| 250 | 3300035692 | Ga0373935_0459287 | Ga0373935_0459287_278_475 | 65 |
| 251 | 3300035695 | Ga0373927_0031651 | Ga0373927_0031651_277_474 | 65 |
| 252 | 3300035695 | Ga0373927_0125798 | Ga0373927_0125798_105_302 | 65 |
| 253 | 3300035695 | Ga0373927_0202058 | Ga0373927_0202058_978_1175 | 65 |
| 254 | 3300035725 | Ga0373947_0107458 | Ga0373947_0107458_322_519 | 65 |
| 255 | 3300035725 | Ga0373947_0113974 | Ga0373947_0113974_702_899 | 65 |
| 256 | 3300037068 | Ga0373925_0337231 | Ga0373925_0337231_593_790 | 65 |
| 257 | 3300037068 | Ga0373925_0992707 | Ga0373925_0992707_210_407 | 65 |
| 258 | 3300037312 | Ga0395899_0141540 | Ga0395899_0141540_1194_1391 | 65 |
| 259 | 3300037418 | Ga0395900_0014812 | Ga0395900_0014812_212_409 | 65 |
| 260 | 3300037466 | Ga0395898_0041866 | Ga0395898_0041866_2461_2658 | 65 |
| 261 | 3300038443 | Ga0395901_0173793 | Ga0395901_0173793_1910_2107 | 65 |
| 262 | 3300046472 | Ga0495580_0597622 | Ga0495580_0597622_443_640 | 65 |
| 263 | 3300046472 | Ga0495580_0937449 | Ga0495580_0937449_110_307 | 65 |
| 264 | 3300046513 | Ga0495616_0311018 | Ga0495616_0311018_380_577 | 65 |
| 265 | 3300046528 | Ga0495642_0054188 | Ga0495642_0054188_914_1111 | 65 |
| 266 | 3300046537 | Ga0495598_0000901 | Ga0495598_0000901_1379_1576 | 65 |
| 267 | 3300046558 | Ga0495633_0290065 | Ga0495633_0290065_64_261 | 65 |
| 268 | 3300046664 | Ga0495659_0280987 | Ga0495659_0280987_465_662 | 65 |
| 269 | 3300046684 | Ga0495669_0032455 | Ga0495669_0032455_1966_2163 | 65 |
| 270 | 3300047446 | Ga0495679_120646 | Ga0495679_120646_477_674 | 65 |
| 271 | 3300047447 | Ga0495685_184777 | Ga0495685_184777_447_644 | 65 |
| 272 | 3300048903 | Ga0496100_0146491 | Ga0496100_0146491_1311_1508 | 65 |
| 273 | 3300048904 | Ga0496101_0133843 | Ga0496101_0133843_926_1123 | 65 |
| 274 | 3300048905 | Ga0496102_0018921 | Ga0496102_0018921_4128_4325 | 65 |
| 275 | 3300048905 | Ga0496102_0499163 | Ga0496102_0499163_336_533 | 65 |
| 276 | 3300048906 | Ga0496103_0153708 | Ga0496103_0153708_1182_1379 | 65 |
| 277 | 3300048906 | Ga0496103_0773709 | Ga0496103_0773709_373_570 | 65 |
| 278 | 3300048907 | Ga0496104_0072184 | Ga0496104_0072184_826_1023 | 65 |
| 279 | 3300048907 | Ga0496104_0291714 | Ga0496104_0291714_322_519 | 65 |
| 280 | 3300048907 | Ga0496104_0909073 | Ga0496104_0909073_217_414 | 65 |
| 281 | 3300048908 | Ga0496105_0044348 | Ga0496105_0044348_3437_3634 | 65 |
| 282 | 3300048908 | Ga0496105_0495460 | Ga0496105_0495460_712_909 | 65 |
| 283 | 3300048909 | Ga0496106_0003085 | Ga0496106_0003085_10665_10862 | 65 |
| 284 | 3300048909 | Ga0496106_0243904 | Ga0496106_0243904_148_345 | 65 |
| 285 | 3300048910 | Ga0496107_0018540 | Ga0496107_0018540_3863_4060 | 65 |
| 286 | 3300048910 | Ga0496107_0057367 | Ga0496107_0057367_1202_1399 | 65 |
| 287 | 3300048911 | Ga0496108_0074789 | Ga0496108_0074789_1663_1860 | 65 |
| 288 | 3300048911 | Ga0496108_0278310 | Ga0496108_0278310_585_782 | 65 |
| 289 | 3300048911 | Ga0496108_0647903 | Ga0496108_0647903_313_510 | 65 |
| 290 | 3300048912 | Ga0496109_0477618 | Ga0496109_0477618_414_611 | 65 |
| 291 | 3300048912 | Ga0496109_0664459 | Ga0496109_0664459_666_863 | 65 |
| 292 | 3300048912 | Ga0496109_1056448 | Ga0496109_1056448_301_498 | 65 |
| 293 | 3300048913 | Ga0496110_0209266 | Ga0496110_0209266_422_619 | 65 |
| 294 | 3300048913 | Ga0496110_0633012 | Ga0496110_0633012_720_917 | 65 |
| 295 | 3300048914 | Ga0496111_0090259 | Ga0496111_0090259_1502_1699 | 65 |
| 296 | 3300048914 | Ga0496111_0486546 | Ga0496111_0486546_470_667 | 65 |
| 297 | 3300048915 | Ga0496112_0198324 | Ga0496112_0198324_839_1036 | 65 |
| 298 | 3300048915 | Ga0496112_0225271 | Ga0496112_0225271_1209_1406 | 65 |
| 299 | 3300048915 | Ga0496112_0481075 | Ga0496112_0481075_239_436 | 65 |
| 300 | 3300048915 | Ga0496112_0753857 | Ga0496112_0753857_507_704 | 65 |
| 301 | 3300048916 | Ga0496113_0322952 | Ga0496113_0322952_151_348 | 65 |
| 302 | 3300048918 | Ga0496115_0009305 | Ga0496115_0009305_6122_6319 | 65 |
| 303 | 3300048918 | Ga0496115_0177184 | Ga0496115_0177184_574_771 | 65 |
| 304 | 3300050512 | nmdc:mga0n895_784220_c1 | nmdc:mga0n895_784220_c1_727_924 | 65 |
| 305 | 3300050514 | nmdc:mga08x19_266662_c1 | nmdc:mga08x19_266662_c1_861_1058 | 65 |
| 306 | 3300053083 | Ga0495655_0362173 | Ga0495655_0362173_179_376 | 65 |
| 307 | 3300003203 | JGI25406J46586_10000001 | JGI25406J46586_10000001193 | 66 |
| 308 | 3300003203 | JGI25406J46586_10000007 | JGI25406J46586_1000000781 | 66 |
| 309 | 3300005293 | Ga0065715_10067002 | Ga0065715_100670022 | 66 |
| 310 | 3300005440 | Ga0070705_101002997 | Ga0070705_1010029972 | 66 |
| 311 | 3300005445 | Ga0070708_100109539 | Ga0070708_1001095393 | 66 |
| 312 | 3300005536 | Ga0070697_100420599 | Ga0070697_1004205992 | 66 |
| 313 | 3300005985 | Ga0081539_10000014 | Ga0081539_10000014299 | 66 |
| 314 | 2044078001 | ZMR_F548DK201AME5Z | ZMR_573220 | 67 |
| 315 | 2162886007 | SwRhRL2b_contig_2037418 | SwRhRL2b_0980.00007230 | 67 |
| 316 | 2162886007 | SwRhRL2b_contig_3078803 | SwRhRL2b_0907.00008390 | 67 |
| 317 | 2162886007 | SwRhRL2b_contig_3458674 | SwRhRL2b_0395.00003350 | 67 |
| 318 | 3300002126 | JGI24035J26624_1000389 | JGI24035J26624_10003897 | 67 |
| 319 | 3300002244 | JGI24742J22300_10028513 | JGI24742J22300_100285132 | 67 |
| 320 | 3300005277 | Ga0065716_1018288 | Ga0065716_10182881 | 67 |
| 321 | 3300005288 | Ga0065714_10128472 | Ga0065714_101284724 | 67 |
| 322 | 3300005289 | Ga0065704_10048094 | Ga0065704_100480942 | 67 |
| 323 | 3300005289 | Ga0065704_10557056 | Ga0065704_105570561 | 67 |
| 324 | 3300005289 | Ga0065704_10850442 | Ga0065704_108504422 | 67 |
| 325 | 3300005290 | Ga0065712_10015466 | Ga0065712_100154663 | 67 |
| 326 | 3300005290 | Ga0065712_10092159 | Ga0065712_100921594 | 67 |
| 327 | 3300005290 | Ga0065712_10122169 | Ga0065712_101221695 | 67 |
| 328 | 3300005290 | Ga0065712_10143777 | Ga0065712_101437774 | 67 |
| 329 | 3300005290 | Ga0065712_10255670 | Ga0065712_102556702 | 67 |
| 330 | 3300005290 | Ga0065712_10366731 | Ga0065712_103667312 | 67 |
| 331 | 3300005290 | Ga0065712_10386138 | Ga0065712_103861382 | 67 |
| 332 | 3300005290 | Ga0065712_10558980 | Ga0065712_105589801 | 67 |
| 333 | 3300005293 | Ga0065715_10005591 | Ga0065715_100055915 | 67 |
| 334 | 3300005293 | Ga0065715_10006003 | Ga0065715_100060035 | 67 |
| 335 | 3300005293 | Ga0065715_10114421 | Ga0065715_101144214 | 67 |
| 336 | 3300005293 | Ga0065715_10121633 | Ga0065715_101216335 | 67 |
| 337 | 3300005293 | Ga0065715_10132257 | Ga0065715_101322572 | 67 |
| 338 | 3300005293 | Ga0065715_10288996 | Ga0065715_102889962 | 67 |
| 339 | 3300005293 | Ga0065715_10375137 | Ga0065715_103751372 | 67 |
| 340 | 3300005293 | Ga0065715_10663438 | Ga0065715_106634382 | 67 |
| 341 | 3300005295 | Ga0065707_10011219 | Ga0065707_100112194 | 67 |
| 342 | 3300005295 | Ga0065707_11009080 | Ga0065707_110090802 | 67 |
| 343 | 3300005327 | Ga0070658_10132680 | Ga0070658_101326804 | 67 |
| 344 | 3300005327 | Ga0070658_11720638 | Ga0070658_117206382 | 67 |
| 345 | 3300005328 | Ga0070676_10023068 | Ga0070676_100230685 | 67 |
| 346 | 3300005328 | Ga0070676_10023857 | Ga0070676_100238577 | 67 |
| 347 | 3300005328 | Ga0070676_10032758 | Ga0070676_100327582 | 67 |
| 348 | 3300005328 | Ga0070676_10328254 | Ga0070676_103282542 | 67 |
| 349 | 3300005328 | Ga0070676_10356560 | Ga0070676_103565602 | 67 |
| 350 | 3300005328 | Ga0070676_10446245 | Ga0070676_104462453 | 67 |
| 351 | 3300005328 | Ga0070676_10526310 | Ga0070676_105263101 | 67 |
| 352 | 3300005329 | Ga0070683_100014620 | Ga0070683_1000146203 | 67 |
| 353 | 3300005329 | Ga0070683_100054847 | Ga0070683_1000548473 | 67 |
| 354 | 3300005329 | Ga0070683_100200119 | Ga0070683_1002001194 | 67 |
| 355 | 3300005329 | Ga0070683_100221173 | Ga0070683_1002211734 | 67 |
| 356 | 3300005329 | Ga0070683_101010997 | Ga0070683_1010109972 | 67 |
| 357 | 3300005329 | Ga0070683_101271548 | Ga0070683_1012715482 | 67 |
| 358 | 3300005330 | Ga0070690_100187280 | Ga0070690_1001872803 | 67 |
| 359 | 3300005330 | Ga0070690_100295354 | Ga0070690_1002953543 | 67 |
| 360 | 3300005330 | Ga0070690_100556303 | Ga0070690_1005563032 | 67 |
| 361 | 3300005331 | Ga0070670_100068156 | Ga0070670_1000681565 | 67 |
| 362 | 3300005331 | Ga0070670_100414170 | Ga0070670_1004141703 | 67 |
| 363 | 3300005331 | Ga0070670_100586363 | Ga0070670_1005863632 | 67 |
| 364 | 3300005331 | Ga0070670_100926530 | Ga0070670_1009265302 | 67 |
| 365 | 3300005334 | Ga0068869_101792838 | Ga0068869_1017928382 | 67 |
| 366 | 3300005335 | Ga0070666_10002056 | Ga0070666_100020564 | 67 |
| 367 | 3300005335 | Ga0070666_10436454 | Ga0070666_104364542 | 67 |
| 368 | 3300005337 | Ga0070682_100289295 | Ga0070682_1002892953 | 67 |
| 369 | 3300005337 | Ga0070682_101382440 | Ga0070682_1013824401 | 67 |
| 370 | 3300005338 | Ga0068868_100082469 | Ga0068868_1000824695 | 67 |
| 371 | 3300005338 | Ga0068868_100097448 | Ga0068868_1000974485 | 67 |
| 372 | 3300005338 | Ga0068868_100333449 | Ga0068868_1003334493 | 67 |
| 373 | 3300005338 | Ga0068868_100523091 | Ga0068868_1005230912 | 67 |
| 374 | 3300005338 | Ga0068868_101144047 | Ga0068868_1011440472 | 67 |
| 375 | 3300005339 | Ga0070660_100989587 | Ga0070660_1009895872 | 67 |
| 376 | 3300005339 | Ga0070660_101370569 | Ga0070660_1013705692 | 67 |
| 377 | 3300005340 | Ga0070689_100009585 | Ga0070689_1000095855 | 67 |
| 378 | 3300005340 | Ga0070689_100083277 | Ga0070689_1000832775 | 67 |
| 379 | 3300005340 | Ga0070689_100161584 | Ga0070689_1001615842 | 67 |
| 380 | 3300005340 | Ga0070689_100308993 | Ga0070689_1003089934 | 67 |
| 381 | 3300005340 | Ga0070689_102155027 | Ga0070689_1021550271 | 67 |
| 382 | 3300005343 | Ga0070687_100000382 | Ga0070687_10000038213 | 67 |
| 383 | 3300005343 | Ga0070687_100216105 | Ga0070687_1002161052 | 67 |
| 384 | 3300005343 | Ga0070687_100806730 | Ga0070687_1008067302 | 67 |
| 385 | 3300005344 | Ga0070661_100081299 | Ga0070661_1000812995 | 67 |
| 386 | 3300005344 | Ga0070661_100120618 | Ga0070661_1001206183 | 67 |
| 387 | 3300005344 | Ga0070661_100930326 | Ga0070661_1009303262 | 67 |
| 388 | 3300005345 | Ga0070692_11164096 | Ga0070692_111640962 | 67 |
| 389 | 3300005347 | Ga0070668_100056885 | Ga0070668_1000568857 | 67 |
| 390 | 3300005347 | Ga0070668_100120521 | Ga0070668_1001205213 | 67 |
| 391 | 3300005347 | Ga0070668_100379489 | Ga0070668_1003794892 | 67 |
| 392 | 3300005353 | Ga0070669_100002011 | Ga0070669_10000201117 | 67 |
| 393 | 3300005353 | Ga0070669_100006097 | Ga0070669_1000060973 | 67 |
| 394 | 3300005353 | Ga0070669_100049923 | Ga0070669_1000499234 | 67 |
| 395 | 3300005353 | Ga0070669_100080338 | Ga0070669_1000803383 | 67 |
| 396 | 3300005353 | Ga0070669_100746041 | Ga0070669_1007460412 | 67 |
| 397 | 3300005353 | Ga0070669_101543803 | Ga0070669_1015438032 | 67 |
| 398 | 3300005354 | Ga0070675_100004678 | Ga0070675_10000467814 | 67 |
| 399 | 3300005354 | Ga0070675_100063526 | Ga0070675_1000635265 | 67 |
| 400 | 3300005354 | Ga0070675_100087471 | Ga0070675_1000874713 | 67 |
| 401 | 3300005354 | Ga0070675_100182810 | Ga0070675_1001828103 | 67 |
| 402 | 3300005354 | Ga0070675_100277633 | Ga0070675_1002776333 | 67 |
| 403 | 3300005354 | Ga0070675_100376792 | Ga0070675_1003767922 | 67 |
| 404 | 3300005354 | Ga0070675_100638029 | Ga0070675_1006380292 | 67 |
| 405 | 3300005355 | Ga0070671_100011495 | Ga0070671_1000114954 | 67 |
| 406 | 3300005355 | Ga0070671_100042031 | Ga0070671_1000420312 | 67 |
| 407 | 3300005355 | Ga0070671_100054306 | Ga0070671_1000543068 | 67 |
| 408 | 3300005355 | Ga0070671_100187094 | Ga0070671_1001870945 | 67 |
| 409 | 3300005355 | Ga0070671_100731117 | Ga0070671_1007311171 | 67 |
| 410 | 3300005355 | Ga0070671_101666516 | Ga0070671_1016665161 | 67 |
| 411 | 3300005355 | Ga0070671_101823379 | Ga0070671_1018233792 | 67 |
| 412 | 3300005355 | Ga0070671_101827865 | Ga0070671_1018278652 | 67 |
| 413 | 3300005356 | Ga0070674_100007500 | Ga0070674_1000075009 | 67 |
| 414 | 3300005356 | Ga0070674_100064029 | Ga0070674_1000640294 | 67 |
| 415 | 3300005356 | Ga0070674_100297400 | Ga0070674_1002974003 | 67 |
| 416 | 3300005356 | Ga0070674_100414870 | Ga0070674_1004148703 | 67 |
| 417 | 3300005364 | Ga0070673_100008141 | Ga0070673_10000814111 | 67 |
| 418 | 3300005364 | Ga0070673_100159647 | Ga0070673_1001596475 | 67 |
| 419 | 3300005364 | Ga0070673_100235191 | Ga0070673_1002351913 | 67 |
| 420 | 3300005364 | Ga0070673_102403155 | Ga0070673_1024031552 | 67 |
| 421 | 3300005365 | Ga0070688_100000733 | Ga0070688_10000073310 | 67 |
| 422 | 3300005365 | Ga0070688_100001414 | Ga0070688_10000141411 | 67 |
| 423 | 3300005365 | Ga0070688_100139371 | Ga0070688_1001393712 | 67 |
| 424 | 3300005365 | Ga0070688_100347104 | Ga0070688_1003471042 | 67 |
| 425 | 3300005366 | Ga0070659_100002483 | Ga0070659_10000248312 | 67 |
| 426 | 3300005366 | Ga0070659_100051342 | Ga0070659_1000513422 | 67 |
| 427 | 3300005366 | Ga0070659_100326979 | Ga0070659_1003269792 | 67 |
| 428 | 3300005366 | Ga0070659_100591895 | Ga0070659_1005918952 | 67 |
| 429 | 3300005366 | Ga0070659_100648570 | Ga0070659_1006485702 | 67 |
| 430 | 3300005366 | Ga0070659_100774997 | Ga0070659_1007749971 | 67 |
| 431 | 3300005367 | Ga0070667_100004665 | Ga0070667_10000466510 | 67 |
| 432 | 3300005367 | Ga0070667_100103912 | Ga0070667_1001039122 | 67 |
| 433 | 3300005367 | Ga0070667_100196145 | Ga0070667_1001961453 | 67 |
| 434 | 3300005367 | Ga0070667_100392191 | Ga0070667_1003921912 | 67 |
| 435 | 3300005367 | Ga0070667_100408504 | Ga0070667_1004085042 | 67 |
| 436 | 3300005367 | Ga0070667_100565364 | Ga0070667_1005653642 | 67 |
| 437 | 3300005406 | Ga0070703_10152115 | Ga0070703_101521152 | 67 |
| 438 | 3300005406 | Ga0070703_10376251 | Ga0070703_103762512 | 67 |
| 439 | 3300005434 | Ga0070709_10026650 | Ga0070709_100266506 | 67 |
| 440 | 3300005434 | Ga0070709_10630820 | Ga0070709_106308202 | 67 |
| 441 | 3300005434 | Ga0070709_10852976 | Ga0070709_108529762 | 67 |
| 442 | 3300005434 | Ga0070709_11054064 | Ga0070709_110540641 | 67 |
| 443 | 3300005434 | Ga0070709_11313628 | Ga0070709_113136281 | 67 |
| 444 | 3300005434 | Ga0070709_11469253 | Ga0070709_114692532 | 67 |
| 445 | 3300005435 | Ga0070714_100054897 | Ga0070714_1000548972 | 67 |
| 446 | 3300005435 | Ga0070714_100961468 | Ga0070714_1009614682 | 67 |
| 447 | 3300005435 | Ga0070714_101213946 | Ga0070714_1012139462 | 67 |
| 448 | 3300005435 | Ga0070714_102051069 | Ga0070714_1020510691 | 67 |
| 449 | 3300005435 | Ga0070714_102423308 | Ga0070714_1024233081 | 67 |
| 450 | 3300005436 | Ga0070713_100019600 | Ga0070713_1000196003 | 67 |
| 451 | 3300005436 | Ga0070713_100040250 | Ga0070713_1000402508 | 67 |
| 452 | 3300005436 | Ga0070713_100219364 | Ga0070713_1002193645 | 67 |
| 453 | 3300005437 | Ga0070710_10079151 | Ga0070710_100791514 | 67 |
| 454 | 3300005437 | Ga0070710_10136630 | Ga0070710_101366303 | 67 |
| 455 | 3300005437 | Ga0070710_10505510 | Ga0070710_105055102 | 67 |
| 456 | 3300005437 | Ga0070710_11322454 | Ga0070710_113224542 | 67 |
| 457 | 3300005438 | Ga0070701_10288547 | Ga0070701_102885471 | 67 |
| 458 | 3300005439 | Ga0070711_100078511 | Ga0070711_1000785116 | 67 |
| 459 | 3300005439 | Ga0070711_100098324 | Ga0070711_1000983242 | 67 |
| 460 | 3300005439 | Ga0070711_100120740 | Ga0070711_1001207405 | 67 |
| 461 | 3300005439 | Ga0070711_100530968 | Ga0070711_1005309682 | 67 |
| 462 | 3300005439 | Ga0070711_100718031 | Ga0070711_1007180312 | 67 |
| 463 | 3300005439 | Ga0070711_101022999 | Ga0070711_1010229992 | 67 |
| 464 | 3300005439 | Ga0070711_101968767 | Ga0070711_1019687671 | 67 |
| 465 | 3300005439 | Ga0070711_102000964 | Ga0070711_1020009641 | 67 |
| 466 | 3300005440 | Ga0070705_100098129 | Ga0070705_1000981292 | 67 |
| 467 | 3300005440 | Ga0070705_100176112 | Ga0070705_1001761122 | 67 |
| 468 | 3300005440 | Ga0070705_100300175 | Ga0070705_1003001753 | 67 |
| 469 | 3300005440 | Ga0070705_100332086 | Ga0070705_1003320863 | 67 |
| 470 | 3300005441 | Ga0070700_100003660 | Ga0070700_1000036604 | 67 |
| 471 | 3300005441 | Ga0070700_100458768 | Ga0070700_1004587682 | 67 |
| 472 | 3300005444 | Ga0070694_100047799 | Ga0070694_1000477995 | 67 |
| 473 | 3300005444 | Ga0070694_100206737 | Ga0070694_1002067371 | 67 |
| 474 | 3300005445 | Ga0070708_100003581 | Ga0070708_1000035817 | 67 |
| 475 | 3300005445 | Ga0070708_100057410 | Ga0070708_1000574108 | 67 |
| 476 | 3300005445 | Ga0070708_100071203 | Ga0070708_1000712033 | 67 |
| 477 | 3300005445 | Ga0070708_100094148 | Ga0070708_1000941486 | 67 |
| 478 | 3300005445 | Ga0070708_100147839 | Ga0070708_1001478393 | 67 |
| 479 | 3300005445 | Ga0070708_100204579 | Ga0070708_1002045793 | 67 |
| 480 | 3300005445 | Ga0070708_100372965 | Ga0070708_1003729651 | 67 |
| 481 | 3300005445 | Ga0070708_100469463 | Ga0070708_1004694632 | 67 |
| 482 | 3300005445 | Ga0070708_100700962 | Ga0070708_1007009622 | 67 |
| 483 | 3300005445 | Ga0070708_100856679 | Ga0070708_1008566792 | 67 |
| 484 | 3300005445 | Ga0070708_101967356 | Ga0070708_1019673561 | 67 |
| 485 | 3300005455 | Ga0070663_100524402 | Ga0070663_1005244021 | 67 |
| 486 | 3300005455 | Ga0070663_100714757 | Ga0070663_1007147572 | 67 |
| 487 | 3300005456 | Ga0070678_100192276 | Ga0070678_1001922763 | 67 |
| 488 | 3300005456 | Ga0070678_100346738 | Ga0070678_1003467383 | 67 |
| 489 | 3300005456 | Ga0070678_100585095 | Ga0070678_1005850952 | 67 |
| 490 | 3300005457 | Ga0070662_100007763 | Ga0070662_10000776312 | 67 |
| 491 | 3300005457 | Ga0070662_100016152 | Ga0070662_1000161525 | 67 |
| 492 | 3300005457 | Ga0070662_100095014 | Ga0070662_1000950144 | 67 |
| 493 | 3300005457 | Ga0070662_100240971 | Ga0070662_1002409714 | 67 |
| 494 | 3300005457 | Ga0070662_100365989 | Ga0070662_1003659893 | 67 |
| 495 | 3300005457 | Ga0070662_100586305 | Ga0070662_1005863052 | 67 |
| 496 | 3300005457 | Ga0070662_101544927 | Ga0070662_1015449272 | 67 |
| 497 | 3300005457 | Ga0070662_101696171 | Ga0070662_1016961711 | 67 |
| 498 | 3300005458 | Ga0070681_10687646 | Ga0070681_106876462 | 67 |
| 499 | 3300005459 | Ga0068867_100212037 | Ga0068867_1002120372 | 67 |
| 500 | 3300005459 | Ga0068867_100489945 | Ga0068867_1004899453 | 67 |
| 501 | 3300005459 | Ga0068867_100834244 | Ga0068867_1008342441 | 67 |
| 502 | 3300005466 | Ga0070685_10028429 | Ga0070685_100284293 | 67 |
| 503 | 3300005466 | Ga0070685_10405925 | Ga0070685_104059252 | 67 |
| 504 | 3300005466 | Ga0070685_11030439 | Ga0070685_110304392 | 67 |
| 505 | 3300005467 | Ga0070706_100020444 | Ga0070706_10002044410 | 67 |
| 506 | 3300005467 | Ga0070706_100020521 | Ga0070706_10002052111 | 67 |
| 507 | 3300005467 | Ga0070706_100078781 | Ga0070706_1000787815 | 67 |
| 508 | 3300005467 | Ga0070706_100193232 | Ga0070706_1001932323 | 67 |
| 509 | 3300005467 | Ga0070706_100283190 | Ga0070706_1002831902 | 67 |
| 510 | 3300005467 | Ga0070706_100461289 | Ga0070706_1004612892 | 67 |
| 511 | 3300005467 | Ga0070706_100594887 | Ga0070706_1005948873 | 67 |
| 512 | 3300005467 | Ga0070706_100790315 | Ga0070706_1007903153 | 67 |
| 513 | 3300005467 | Ga0070706_100939008 | Ga0070706_1009390082 | 67 |
| 514 | 3300005468 | Ga0070707_100016188 | Ga0070707_10001618811 | 67 |
| 515 | 3300005468 | Ga0070707_100030502 | Ga0070707_1000305029 | 67 |
| 516 | 3300005468 | Ga0070707_100039193 | Ga0070707_1000391931 | 67 |
| 517 | 3300005468 | Ga0070707_100226431 | Ga0070707_1002264312 | 67 |
| 518 | 3300005468 | Ga0070707_100311609 | Ga0070707_1003116093 | 67 |
| 519 | 3300005468 | Ga0070707_100454279 | Ga0070707_1004542792 | 67 |
| 520 | 3300005468 | Ga0070707_100564921 | Ga0070707_1005649213 | 67 |
| 521 | 3300005468 | Ga0070707_100753710 | Ga0070707_1007537103 | 67 |
| 522 | 3300005468 | Ga0070707_101140792 | Ga0070707_1011407922 | 67 |
| 523 | 3300005468 | Ga0070707_101276289 | Ga0070707_1012762891 | 67 |
| 524 | 3300005468 | Ga0070707_101300077 | Ga0070707_1013000772 | 67 |
| 525 | 3300005471 | Ga0070698_100001836 | Ga0070698_10000183620 | 67 |
| 526 | 3300005471 | Ga0070698_100032196 | Ga0070698_1000321969 | 67 |
| 527 | 3300005471 | Ga0070698_100086365 | Ga0070698_1000863655 | 67 |
| 528 | 3300005471 | Ga0070698_100368308 | Ga0070698_1003683082 | 67 |
| 529 | 3300005471 | Ga0070698_100584666 | Ga0070698_1005846663 | 67 |
| 530 | 3300005518 | Ga0070699_100027581 | Ga0070699_1000275817 | 67 |
| 531 | 3300005518 | Ga0070699_100171466 | Ga0070699_1001714665 | 67 |
| 532 | 3300005518 | Ga0070699_100291268 | Ga0070699_1002912682 | 67 |
| 533 | 3300005518 | Ga0070699_100307974 | Ga0070699_1003079744 | 67 |
| 534 | 3300005518 | Ga0070699_101112176 | Ga0070699_1011121762 | 67 |
| 535 | 3300005518 | Ga0070699_101327060 | Ga0070699_1013270602 | 67 |
| 536 | 3300005518 | Ga0070699_101775268 | Ga0070699_1017752682 | 67 |
| 537 | 3300005518 | Ga0070699_102098553 | Ga0070699_1020985532 | 67 |
| 538 | 3300005530 | Ga0070679_100399447 | Ga0070679_1003994472 | 67 |
| 539 | 3300005530 | Ga0070679_100949578 | Ga0070679_1009495782 | 67 |
| 540 | 3300005530 | Ga0070679_101287559 | Ga0070679_1012875592 | 67 |
| 541 | 3300005535 | Ga0070684_100001312 | Ga0070684_1000013122 | 67 |
| 542 | 3300005535 | Ga0070684_100029216 | Ga0070684_1000292163 | 67 |
| 543 | 3300005535 | Ga0070684_100188477 | Ga0070684_1001884773 | 67 |
| 544 | 3300005535 | Ga0070684_100440346 | Ga0070684_1004403463 | 67 |
| 545 | 3300005536 | Ga0070697_100002201 | Ga0070697_1000022017 | 67 |
| 546 | 3300005536 | Ga0070697_100002768 | Ga0070697_10000276812 | 67 |
| 547 | 3300005536 | Ga0070697_100045287 | Ga0070697_1000452872 | 67 |
| 548 | 3300005536 | Ga0070697_100113122 | Ga0070697_1001131223 | 67 |
| 549 | 3300005536 | Ga0070697_100242433 | Ga0070697_1002424332 | 67 |
| 550 | 3300005536 | Ga0070697_100245790 | Ga0070697_1002457901 | 67 |
| 551 | 3300005536 | Ga0070697_100329225 | Ga0070697_1003292253 | 67 |
| 552 | 3300005536 | Ga0070697_100423823 | Ga0070697_1004238232 | 67 |
| 553 | 3300005536 | Ga0070697_100483148 | Ga0070697_1004831482 | 67 |
| 554 | 3300005536 | Ga0070697_101352537 | Ga0070697_1013525371 | 67 |
| 555 | 3300005536 | Ga0070697_101574173 | Ga0070697_1015741732 | 67 |
| 556 | 3300005536 | Ga0070697_101625032 | Ga0070697_1016250321 | 67 |
| 557 | 3300005536 | Ga0070697_101780141 | Ga0070697_1017801412 | 67 |
| 558 | 3300005536 | Ga0070697_101906263 | Ga0070697_1019062632 | 67 |
| 559 | 3300005536 | Ga0070697_102007451 | Ga0070697_1020074512 | 67 |
| 560 | 3300005539 | Ga0068853_100107206 | Ga0068853_1001072062 | 67 |
| 561 | 3300005543 | Ga0070672_100000353 | Ga0070672_10000035327 | 67 |
| 562 | 3300005543 | Ga0070672_100004247 | Ga0070672_10000424716 | 67 |
| 563 | 3300005543 | Ga0070672_100254174 | Ga0070672_1002541743 | 67 |
| 564 | 3300005543 | Ga0070672_100280675 | Ga0070672_1002806753 | 67 |
| 565 | 3300005543 | Ga0070672_100484203 | Ga0070672_1004842033 | 67 |
| 566 | 3300005543 | Ga0070672_100574021 | Ga0070672_1005740213 | 67 |
| 567 | 3300005543 | Ga0070672_102163394 | Ga0070672_1021633942 | 67 |
| 568 | 3300005544 | Ga0070686_100601766 | Ga0070686_1006017661 | 67 |
| 569 | 3300005544 | Ga0070686_100876519 | Ga0070686_1008765192 | 67 |
| 570 | 3300005546 | Ga0070696_101129055 | Ga0070696_1011290552 | 67 |
| 571 | 3300005548 | Ga0070665_100008787 | Ga0070665_10000878712 | 67 |
| 572 | 3300005548 | Ga0070665_100070912 | Ga0070665_1000709129 | 67 |
| 573 | 3300005548 | Ga0070665_100145325 | Ga0070665_1001453254 | 67 |
| 574 | 3300005548 | Ga0070665_100147588 | Ga0070665_1001475886 | 67 |
| 575 | 3300005548 | Ga0070665_100484511 | Ga0070665_1004845113 | 67 |
| 576 | 3300005548 | Ga0070665_100753700 | Ga0070665_1007537002 | 67 |
| 577 | 3300005549 | Ga0070704_100517147 | Ga0070704_1005171472 | 67 |
| 578 | 3300005549 | Ga0070704_102075988 | Ga0070704_1020759882 | 67 |
| 579 | 3300005564 | Ga0070664_100311564 | Ga0070664_1003115642 | 67 |
| 580 | 3300005564 | Ga0070664_100598245 | Ga0070664_1005982452 | 67 |
| 581 | 3300005564 | Ga0070664_100687425 | Ga0070664_1006874253 | 67 |
| 582 | 3300005564 | Ga0070664_101435616 | Ga0070664_1014356161 | 67 |
| 583 | 3300005577 | Ga0068857_101242883 | Ga0068857_1012428832 | 67 |
| 584 | 3300005614 | Ga0068856_100062548 | Ga0068856_1000625482 | 67 |
| 585 | 3300005614 | Ga0068856_100402187 | Ga0068856_1004021874 | 67 |
| 586 | 3300005614 | Ga0068856_101616404 | Ga0068856_1016164042 | 67 |
| 587 | 3300005615 | Ga0070702_100470434 | Ga0070702_1004704341 | 67 |
| 588 | 3300005615 | Ga0070702_100720088 | Ga0070702_1007200882 | 67 |
| 589 | 3300005616 | Ga0068852_100383840 | Ga0068852_1003838403 | 67 |
| 590 | 3300005616 | Ga0068852_102776274 | Ga0068852_1027762741 | 67 |
| 591 | 3300005617 | Ga0068859_100326644 | Ga0068859_1003266442 | 67 |
| 592 | 3300005718 | Ga0068866_10099689 | Ga0068866_100996894 | 67 |
| 593 | 3300005718 | Ga0068866_10170873 | Ga0068866_101708731 | 67 |
| 594 | 3300005718 | Ga0068866_10258928 | Ga0068866_102589283 | 67 |
| 595 | 3300005718 | Ga0068866_10440135 | Ga0068866_104401353 | 67 |
| 596 | 3300005719 | Ga0068861_100549046 | Ga0068861_1005490462 | 67 |
| 597 | 3300005719 | Ga0068861_102070470 | Ga0068861_1020704702 | 67 |
| 598 | 3300005834 | Ga0068851_10407291 | Ga0068851_104072912 | 67 |
| 599 | 3300005841 | Ga0068863_100007967 | Ga0068863_10000796711 | 67 |
| 600 | 3300005841 | Ga0068863_100722959 | Ga0068863_1007229592 | 67 |
| 601 | 3300005842 | Ga0068858_100168633 | Ga0068858_1001686333 | 67 |
| 602 | 3300005842 | Ga0068858_100283900 | Ga0068858_1002839002 | 67 |
| 603 | 3300005842 | Ga0068858_100347541 | Ga0068858_1003475414 | 67 |
| 604 | 3300005842 | Ga0068858_102379344 | Ga0068858_1023793442 | 67 |
| 605 | 3300005843 | Ga0068860_100010603 | Ga0068860_1000106037 | 67 |
| 606 | 3300005843 | Ga0068860_100244584 | Ga0068860_1002445844 | 67 |
| 607 | 3300005843 | Ga0068860_100806876 | Ga0068860_1008068762 | 67 |
| 608 | 3300005843 | Ga0068860_101101196 | Ga0068860_1011011963 | 67 |
| 609 | 3300005843 | Ga0068860_101420721 | Ga0068860_1014207212 | 67 |
| 610 | 3300005843 | Ga0068860_102157230 | Ga0068860_1021572302 | 67 |
| 611 | 3300005844 | Ga0068862_100008330 | Ga0068862_1000083302 | 67 |
| 612 | 3300005844 | Ga0068862_100180595 | Ga0068862_1001805952 | 67 |
| 613 | 3300005844 | Ga0068862_101487649 | Ga0068862_1014876492 | 67 |
| 614 | 3300005937 | Ga0081455_10000328 | Ga0081455_1000032844 | 67 |
| 615 | 3300005937 | Ga0081455_10001697 | Ga0081455_100016974 | 67 |
| 616 | 3300005937 | Ga0081455_10021927 | Ga0081455_1002192710 | 67 |
| 617 | 3300005937 | Ga0081455_10031292 | Ga0081455_100312923 | 67 |
| 618 | 3300005937 | Ga0081455_10040030 | Ga0081455_100400305 | 67 |
| 619 | 3300005937 | Ga0081455_10040051 | Ga0081455_100400515 | 67 |
| 620 | 3300005937 | Ga0081455_10151731 | Ga0081455_101517314 | 67 |
| 621 | 3300005937 | Ga0081455_10170692 | Ga0081455_101706923 | 67 |
| 622 | 3300005937 | Ga0081455_10884439 | Ga0081455_108844391 | 67 |
| 623 | 3300005937 | Ga0081455_10887284 | Ga0081455_108872842 | 67 |
| 624 | 3300005981 | Ga0081538_10334323 | Ga0081538_103343231 | 67 |
| 625 | 3300005983 | Ga0081540_1000036 | Ga0081540_100003636 | 67 |
| 626 | 3300005983 | Ga0081540_1032359 | Ga0081540_10323594 | 67 |
| 627 | 3300005983 | Ga0081540_1041372 | Ga0081540_10413724 | 67 |
| 628 | 3300005983 | Ga0081540_1053610 | Ga0081540_10536102 | 67 |
| 629 | 3300005983 | Ga0081540_1075382 | Ga0081540_10753822 | 67 |
| 630 | 3300005985 | Ga0081539_10157760 | Ga0081539_101577603 | 67 |
| 631 | 3300006028 | Ga0070717_10028090 | Ga0070717_100280909 | 67 |
| 632 | 3300006028 | Ga0070717_10030233 | Ga0070717_100302335 | 67 |
| 633 | 3300006028 | Ga0070717_10067091 | Ga0070717_100670916 | 67 |
| 634 | 3300006028 | Ga0070717_10297754 | Ga0070717_102977543 | 67 |
| 635 | 3300006028 | Ga0070717_10495388 | Ga0070717_104953882 | 67 |
| 636 | 3300006028 | Ga0070717_10708003 | Ga0070717_107080032 | 67 |
| 637 | 3300006163 | Ga0070715_10020578 | Ga0070715_100205785 | 67 |
| 638 | 3300006163 | Ga0070715_10036615 | Ga0070715_100366155 | 67 |
| 639 | 3300006163 | Ga0070715_10178518 | Ga0070715_101785184 | 67 |
| 640 | 3300006163 | Ga0070715_10242314 | Ga0070715_102423142 | 67 |
| 641 | 3300006163 | Ga0070715_11000156 | Ga0070715_110001562 | 67 |
| 642 | 3300006173 | Ga0070716_100063071 | Ga0070716_1000630713 | 67 |
| 643 | 3300006173 | Ga0070716_100094785 | Ga0070716_1000947855 | 67 |
| 644 | 3300006173 | Ga0070716_100668291 | Ga0070716_1006682912 | 67 |
| 645 | 3300006173 | Ga0070716_100888438 | Ga0070716_1008884382 | 67 |
| 646 | 3300006173 | Ga0070716_101537437 | Ga0070716_1015374372 | 67 |
| 647 | 3300006175 | Ga0070712_100023808 | Ga0070712_1000238086 | 67 |
| 648 | 3300006175 | Ga0070712_100052822 | Ga0070712_1000528222 | 67 |
| 649 | 3300006175 | Ga0070712_100095268 | Ga0070712_1000952685 | 67 |
| 650 | 3300006175 | Ga0070712_100123126 | Ga0070712_1001231263 | 67 |
| 651 | 3300006175 | Ga0070712_100151058 | Ga0070712_1001510583 | 67 |
| 652 | 3300006175 | Ga0070712_100273381 | Ga0070712_1002733811 | 67 |
| 653 | 3300006175 | Ga0070712_100472181 | Ga0070712_1004721812 | 67 |
| 654 | 3300006175 | Ga0070712_100547686 | Ga0070712_1005476862 | 67 |
| 655 | 3300006175 | Ga0070712_100568278 | Ga0070712_1005682782 | 67 |
| 656 | 3300006175 | Ga0070712_100584958 | Ga0070712_1005849582 | 67 |
| 657 | 3300006175 | Ga0070712_100609873 | Ga0070712_1006098733 | 67 |
| 658 | 3300006175 | Ga0070712_101037364 | Ga0070712_1010373643 | 67 |
| 659 | 3300006175 | Ga0070712_101141531 | Ga0070712_1011415312 | 67 |
| 660 | 3300006175 | Ga0070712_101295793 | Ga0070712_1012957932 | 67 |
| 661 | 3300006175 | Ga0070712_101918852 | Ga0070712_1019188522 | 67 |
| 662 | 3300006175 | Ga0070712_101962750 | Ga0070712_1019627501 | 67 |
| 663 | 3300006237 | Ga0097621_100014055 | Ga0097621_1000140557 | 67 |
| 664 | 3300006237 | Ga0097621_100040994 | Ga0097621_1000409947 | 67 |
| 665 | 3300006237 | Ga0097621_100318606 | Ga0097621_1003186064 | 67 |
| 666 | 3300006237 | Ga0097621_100815610 | Ga0097621_1008156102 | 67 |
| 667 | 3300006237 | Ga0097621_101322106 | Ga0097621_1013221062 | 67 |
| 668 | 3300006237 | Ga0097621_102254817 | Ga0097621_1022548171 | 67 |
| 669 | 3300006358 | Ga0068871_100096963 | Ga0068871_1000969632 | 67 |
| 670 | 3300006358 | Ga0068871_100138801 | Ga0068871_1001388013 | 67 |
| 671 | 3300006358 | Ga0068871_100191878 | Ga0068871_1001918785 | 67 |
| 672 | 3300006358 | Ga0068871_100424331 | Ga0068871_1004243313 | 67 |
| 673 | 3300006358 | Ga0068871_101234300 | Ga0068871_1012343002 | 67 |
| 674 | 3300006358 | Ga0068871_101867525 | Ga0068871_1018675252 | 67 |
| 675 | 3300006844 | Ga0075428_100095839 | Ga0075428_1000958398 | 67 |
| 676 | 3300006844 | Ga0075428_100416463 | Ga0075428_1004164633 | 67 |
| 677 | 3300006847 | Ga0075431_100816203 | Ga0075431_1008162032 | 67 |
| 678 | 3300006852 | Ga0075433_10756944 | Ga0075433_107569442 | 67 |
| 679 | 3300006871 | Ga0075434_100255607 | Ga0075434_1002556072 | 67 |
| 680 | 3300006871 | Ga0075434_100738231 | Ga0075434_1007382313 | 67 |
| 681 | 3300006881 | Ga0068865_100079884 | Ga0068865_1000798845 | 67 |
| 682 | 3300006881 | Ga0068865_100343715 | Ga0068865_1003437152 | 67 |
| 683 | 3300006881 | Ga0068865_100477358 | Ga0068865_1004773583 | 67 |
| 684 | 3300006881 | Ga0068865_100531144 | Ga0068865_1005311443 | 67 |
| 685 | 3300006881 | Ga0068865_100713279 | Ga0068865_1007132792 | 67 |
| 686 | 3300006881 | Ga0068865_101858950 | Ga0068865_1018589502 | 67 |
| 687 | 3300006914 | Ga0075436_100257488 | Ga0075436_1002574883 | 67 |
| 688 | 3300006914 | Ga0075436_100633678 | Ga0075436_1006336782 | 67 |
| 689 | 3300006931 | Ga0097620_100326689 | Ga0097620_1003266892 | 67 |
| 690 | 3300007076 | Ga0075435_101892357 | Ga0075435_1018923572 | 67 |
| 691 | 3300007076 | Ga0075435_101969206 | Ga0075435_1019692062 | 67 |
| 692 | 3300007265 | Ga0099794_10020565 | Ga0099794_100205653 | 67 |
| 693 | 3300007265 | Ga0099794_10145936 | Ga0099794_101459361 | 67 |
| 694 | 3300007265 | Ga0099794_10325814 | Ga0099794_103258142 | 67 |
| 695 | 3300007788 | Ga0099795_10021968 | Ga0099795_100219681 | 67 |
| 696 | 3300009093 | Ga0105240_10636431 | Ga0105240_106364314 | 67 |
| 697 | 3300009093 | Ga0105240_10784265 | Ga0105240_107842652 | 67 |
| 698 | 3300009093 | Ga0105240_11038689 | Ga0105240_110386892 | 67 |
| 699 | 3300009093 | Ga0105240_12244662 | Ga0105240_122446622 | 67 |
| 700 | 3300009094 | Ga0111539_10676556 | Ga0111539_106765562 | 67 |
| 701 | 3300009094 | Ga0111539_10865884 | Ga0111539_108658843 | 67 |
| 702 | 3300009094 | Ga0111539_11300927 | Ga0111539_113009272 | 67 |
| 703 | 3300009094 | Ga0111539_12853814 | Ga0111539_128538142 | 67 |
| 704 | 3300009098 | Ga0105245_10006614 | Ga0105245_100066145 | 67 |
| 705 | 3300009098 | Ga0105245_10030852 | Ga0105245_100308525 | 67 |
| 706 | 3300009098 | Ga0105245_10124129 | Ga0105245_101241293 | 67 |
| 707 | 3300009098 | Ga0105245_10192863 | Ga0105245_101928635 | 67 |
| 708 | 3300009098 | Ga0105245_10726772 | Ga0105245_107267722 | 67 |
| 709 | 3300009098 | Ga0105245_11078215 | Ga0105245_110782152 | 67 |
| 710 | 3300009098 | Ga0105245_11740269 | Ga0105245_117402692 | 67 |
| 711 | 3300009098 | Ga0105245_12552963 | Ga0105245_125529632 | 67 |
| 712 | 3300009147 | Ga0114129_10003445 | Ga0114129_1000344524 | 67 |
| 713 | 3300009147 | Ga0114129_10071980 | Ga0114129_100719807 | 67 |
| 714 | 3300009147 | Ga0114129_10218235 | Ga0114129_102182355 | 67 |
| 715 | 3300009147 | Ga0114129_11432233 | Ga0114129_114322333 | 67 |
| 716 | 3300009148 | Ga0105243_10272788 | Ga0105243_102727882 | 67 |
| 717 | 3300009148 | Ga0105243_11229588 | Ga0105243_112295882 | 67 |
| 718 | 3300009148 | Ga0105243_11380156 | Ga0105243_113801563 | 67 |
| 719 | 3300009174 | Ga0105241_11846708 | Ga0105241_118467082 | 67 |
| 720 | 3300009176 | Ga0105242_10043482 | Ga0105242_100434828 | 67 |
| 721 | 3300009176 | Ga0105242_10328839 | Ga0105242_103288393 | 67 |
| 722 | 3300009176 | Ga0105242_10549724 | Ga0105242_105497243 | 67 |
| 723 | 3300009176 | Ga0105242_10996553 | Ga0105242_109965533 | 67 |
| 724 | 3300009177 | Ga0105248_11169531 | Ga0105248_111695313 | 67 |
| 725 | 3300009177 | Ga0105248_11193886 | Ga0105248_111938862 | 67 |
| 726 | 3300009177 | Ga0105248_12002321 | Ga0105248_120023212 | 67 |
| 727 | 3300009545 | Ga0105237_10444563 | Ga0105237_104445633 | 67 |
| 728 | 3300009545 | Ga0105237_10528861 | Ga0105237_105288613 | 67 |
| 729 | 3300009545 | Ga0105237_10820507 | Ga0105237_108205073 | 67 |
| 730 | 3300009553 | Ga0105249_10011097 | Ga0105249_1001109713 | 67 |
| 731 | 3300009553 | Ga0105249_10470133 | Ga0105249_104701333 | 67 |
| 732 | 3300009553 | Ga0105249_10544884 | Ga0105249_105448842 | 67 |
| 733 | 3300009553 | Ga0105249_11853859 | Ga0105249_118538592 | 67 |
| 734 | 3300009553 | Ga0105249_13178574 | Ga0105249_131785742 | 67 |
| 735 | 3300009553 | Ga0105249_13388451 | Ga0105249_133884511 | 67 |
| 736 | 3300010159 | Ga0099796_10061942 | Ga0099796_100619422 | 67 |
| 737 | 3300010159 | Ga0099796_10094571 | Ga0099796_100945713 | 67 |
| 738 | 3300010159 | Ga0099796_10346725 | Ga0099796_103467251 | 67 |
| 739 | 3300010375 | Ga0105239_10070002 | Ga0105239_100700022 | 67 |
| 740 | 3300010375 | Ga0105239_10225186 | Ga0105239_102251862 | 67 |
| 741 | 3300010375 | Ga0105239_10518088 | Ga0105239_105180882 | 67 |
| 742 | 3300010375 | Ga0105239_10823425 | Ga0105239_108234252 | 67 |
| 743 | 3300010375 | Ga0105239_10991354 | Ga0105239_109913542 | 67 |
| 744 | 3300010375 | Ga0105239_12290191 | Ga0105239_122901912 | 67 |
| 745 | 3300011119 | Ga0105246_10459510 | Ga0105246_104595102 | 67 |
| 746 | 3300012476 | Ga0157344_1016044 | Ga0157344_10160442 | 67 |
| 747 | 3300012508 | Ga0157315_1041195 | Ga0157315_10411951 | 67 |
| 748 | 3300013100 | Ga0157373_10396341 | Ga0157373_103963413 | 67 |
| 749 | 3300013102 | Ga0157371_10550303 | Ga0157371_105503032 | 67 |
| 750 | 3300013102 | Ga0157371_11002497 | Ga0157371_110024972 | 67 |
| 751 | 3300013104 | Ga0157370_10322896 | Ga0157370_103228963 | 67 |
| 752 | 3300013105 | Ga0157369_10117876 | Ga0157369_101178764 | 67 |
| 753 | 3300013296 | Ga0157374_10001473 | Ga0157374_1000147313 | 67 |
| 754 | 3300013296 | Ga0157374_10005577 | Ga0157374_1000557710 | 67 |
| 755 | 3300013296 | Ga0157374_10033688 | Ga0157374_100336883 | 67 |
| 756 | 3300013296 | Ga0157374_10094662 | Ga0157374_100946625 | 67 |
| 757 | 3300013296 | Ga0157374_10103065 | Ga0157374_101030652 | 67 |
| 758 | 3300013296 | Ga0157374_10120813 | Ga0157374_101208131 | 67 |
| 759 | 3300013296 | Ga0157374_10130202 | Ga0157374_101302023 | 67 |
| 760 | 3300013296 | Ga0157374_10222850 | Ga0157374_102228505 | 67 |
| 761 | 3300013296 | Ga0157374_10549440 | Ga0157374_105494403 | 67 |
| 762 | 3300013296 | Ga0157374_10566828 | Ga0157374_105668282 | 67 |
| 763 | 3300013296 | Ga0157374_11551143 | Ga0157374_115511432 | 67 |
| 764 | 3300013296 | Ga0157374_11573636 | Ga0157374_115736362 | 67 |
| 765 | 3300013296 | Ga0157374_12237170 | Ga0157374_122371702 | 67 |
| 766 | 3300013296 | Ga0157374_12818952 | Ga0157374_128189522 | 67 |
| 767 | 3300013297 | Ga0157378_10005509 | Ga0157378_1000550916 | 67 |
| 768 | 3300013297 | Ga0157378_10009019 | Ga0157378_1000901913 | 67 |
| 769 | 3300013297 | Ga0157378_10009704 | Ga0157378_100097045 | 67 |
| 770 | 3300013297 | Ga0157378_10026553 | Ga0157378_1002655311 | 67 |
| 771 | 3300013297 | Ga0157378_10041332 | Ga0157378_100413327 | 67 |
| 772 | 3300013297 | Ga0157378_10066060 | Ga0157378_100660603 | 67 |
| 773 | 3300013297 | Ga0157378_10141935 | Ga0157378_101419354 | 67 |
| 774 | 3300013297 | Ga0157378_10190256 | Ga0157378_101902563 | 67 |
| 775 | 3300013297 | Ga0157378_10237043 | Ga0157378_102370434 | 67 |
| 776 | 3300013297 | Ga0157378_10292746 | Ga0157378_102927462 | 67 |
| 777 | 3300013297 | Ga0157378_10338887 | Ga0157378_103388873 | 67 |
| 778 | 3300013297 | Ga0157378_10350425 | Ga0157378_103504253 | 67 |
| 779 | 3300013297 | Ga0157378_10668405 | Ga0157378_106684052 | 67 |
| 780 | 3300013297 | Ga0157378_10758292 | Ga0157378_107582923 | 67 |
| 781 | 3300013297 | Ga0157378_10853698 | Ga0157378_108536983 | 67 |
| 782 | 3300013297 | Ga0157378_10891673 | Ga0157378_108916732 | 67 |
| 783 | 3300013297 | Ga0157378_11168955 | Ga0157378_111689552 | 67 |
| 784 | 3300013297 | Ga0157378_11849135 | Ga0157378_118491351 | 67 |
| 785 | 3300013306 | Ga0163162_10003249 | Ga0163162_1000324919 | 67 |
| 786 | 3300013306 | Ga0163162_10014121 | Ga0163162_1001412110 | 67 |
| 787 | 3300013306 | Ga0163162_10105792 | Ga0163162_101057923 | 67 |
| 788 | 3300013306 | Ga0163162_10118628 | Ga0163162_101186284 | 67 |
| 789 | 3300013306 | Ga0163162_10609774 | Ga0163162_106097742 | 67 |
| 790 | 3300013306 | Ga0163162_10824833 | Ga0163162_108248333 | 67 |
| 791 | 3300013306 | Ga0163162_11278146 | Ga0163162_112781462 | 67 |
| 792 | 3300013306 | Ga0163162_11548759 | Ga0163162_115487592 | 67 |
| 793 | 3300013306 | Ga0163162_12295981 | Ga0163162_122959812 | 67 |
| 794 | 3300013306 | Ga0163162_12699018 | Ga0163162_126990182 | 67 |
| 795 | 3300013306 | Ga0163162_12904674 | Ga0163162_129046742 | 67 |
| 796 | 3300013307 | Ga0157372_10037163 | Ga0157372_100371637 | 67 |
| 797 | 3300013307 | Ga0157372_10135936 | Ga0157372_101359365 | 67 |
| 798 | 3300013307 | Ga0157372_10198123 | Ga0157372_101981232 | 67 |
| 799 | 3300013307 | Ga0157372_10553780 | Ga0157372_105537802 | 67 |
| 800 | 3300013307 | Ga0157372_11456901 | Ga0157372_114569012 | 67 |
| 801 | 3300013308 | Ga0157375_10000287 | Ga0157375_1000028720 | 67 |
| 802 | 3300013308 | Ga0157375_10001868 | Ga0157375_1000186813 | 67 |
| 803 | 3300013308 | Ga0157375_10007782 | Ga0157375_1000778211 | 67 |
| 804 | 3300013308 | Ga0157375_10449240 | Ga0157375_104492403 | 67 |
| 805 | 3300013308 | Ga0157375_10708632 | Ga0157375_107086322 | 67 |
| 806 | 3300013308 | Ga0157375_10998323 | Ga0157375_109983232 | 67 |
| 807 | 3300013308 | Ga0157375_11529705 | Ga0157375_115297052 | 67 |
| 808 | 3300013308 | Ga0157375_11890947 | Ga0157375_118909472 | 67 |
| 809 | 3300014325 | Ga0163163_10175148 | Ga0163163_101751483 | 67 |
| 810 | 3300014325 | Ga0163163_11302229 | Ga0163163_113022292 | 67 |
| 811 | 3300014325 | Ga0163163_11869470 | Ga0163163_118694702 | 67 |
| 812 | 3300014325 | Ga0163163_13233606 | Ga0163163_132336062 | 67 |
| 813 | 3300014745 | Ga0157377_10190634 | Ga0157377_101906343 | 67 |
| 814 | 3300014745 | Ga0157377_10234421 | Ga0157377_102344213 | 67 |
| 815 | 3300014745 | Ga0157377_10334221 | Ga0157377_103342212 | 67 |
| 816 | 3300014745 | Ga0157377_10872791 | Ga0157377_108727912 | 67 |
| 817 | 3300014968 | Ga0157379_10005647 | Ga0157379_1000564712 | 67 |
| 818 | 3300014968 | Ga0157379_10178685 | Ga0157379_101786852 | 67 |
| 819 | 3300014968 | Ga0157379_11131810 | Ga0157379_111318102 | 67 |
| 820 | 3300014968 | Ga0157379_11295907 | Ga0157379_112959072 | 67 |
| 821 | 3300014969 | Ga0157376_10009509 | Ga0157376_1000950910 | 67 |
| 822 | 3300014969 | Ga0157376_10300272 | Ga0157376_103002723 | 67 |
| 823 | 3300014969 | Ga0157376_10332488 | Ga0157376_103324883 | 67 |
| 824 | 3300014969 | Ga0157376_10378555 | Ga0157376_103785553 | 67 |
| 825 | 3300014969 | Ga0157376_10950725 | Ga0157376_109507252 | 67 |
| 826 | 3300014969 | Ga0157376_11935218 | Ga0157376_119352182 | 67 |
| 827 | 3300014969 | Ga0157376_12107002 | Ga0157376_121070022 | 67 |
| 828 | 3300015261 | Ga0182006_1152729 | Ga0182006_11527292 | 67 |
| 829 | 3300015265 | Ga0182005_1017656 | Ga0182005_10176564 | 67 |
| 830 | 3300017792 | Ga0163161_10570979 | Ga0163161_105709793 | 67 |
| 831 | 3300017792 | Ga0163161_10710536 | Ga0163161_107105362 | 67 |
| 832 | 3300017792 | Ga0163161_11078881 | Ga0163161_110788812 | 67 |
| 833 | 3300021388 | Ga0213875_10310544 | Ga0213875_103105442 | 67 |
| 834 | 3300025271 | Ga0207666_1005260 | Ga0207666_10052602 | 67 |
| 835 | 3300025271 | Ga0207666_1008686 | Ga0207666_10086862 | 67 |
| 836 | 3300025290 | Ga0207673_1000205 | Ga0207673_100020512 | 67 |
| 837 | 3300025290 | Ga0207673_1000900 | Ga0207673_10009003 | 67 |
| 838 | 3300025290 | Ga0207673_1005925 | Ga0207673_10059253 | 67 |
| 839 | 3300025290 | Ga0207673_1006109 | Ga0207673_10061093 | 67 |
| 840 | 3300025290 | Ga0207673_1028027 | Ga0207673_10280272 | 67 |
| 841 | 3300025315 | Ga0207697_10002230 | Ga0207697_100022304 | 67 |
| 842 | 3300025315 | Ga0207697_10002322 | Ga0207697_1000232216 | 67 |
| 843 | 3300025315 | Ga0207697_10021301 | Ga0207697_100213013 | 67 |
| 844 | 3300025315 | Ga0207697_10042806 | Ga0207697_100428065 | 67 |
| 845 | 3300025315 | Ga0207697_10062383 | Ga0207697_100623833 | 67 |
| 846 | 3300025315 | Ga0207697_10110706 | Ga0207697_101107062 | 67 |
| 847 | 3300025315 | Ga0207697_10209187 | Ga0207697_102091871 | 67 |
| 848 | 3300025315 | Ga0207697_10302285 | Ga0207697_103022852 | 67 |
| 849 | 3300025315 | Ga0207697_10374245 | Ga0207697_103742452 | 67 |
| 850 | 3300025315 | Ga0207697_10460044 | Ga0207697_104600442 | 67 |
| 851 | 3300025315 | Ga0207697_10487975 | Ga0207697_104879751 | 67 |
| 852 | 3300025885 | Ga0207653_10001694 | Ga0207653_100016944 | 67 |
| 853 | 3300025898 | Ga0207692_10115326 | Ga0207692_101153263 | 67 |
| 854 | 3300025898 | Ga0207692_10472491 | Ga0207692_104724912 | 67 |
| 855 | 3300025898 | Ga0207692_10796278 | Ga0207692_107962781 | 67 |
| 856 | 3300025898 | Ga0207692_11018310 | Ga0207692_110183102 | 67 |
| 857 | 3300025899 | Ga0207642_10626882 | Ga0207642_106268822 | 67 |
| 858 | 3300025901 | Ga0207688_10023688 | Ga0207688_100236886 | 67 |
| 859 | 3300025901 | Ga0207688_10245931 | Ga0207688_102459312 | 67 |
| 860 | 3300025901 | Ga0207688_10591109 | Ga0207688_105911092 | 67 |
| 861 | 3300025903 | Ga0207680_10025390 | Ga0207680_100253902 | 67 |
| 862 | 3300025903 | Ga0207680_10212819 | Ga0207680_102128191 | 67 |
| 863 | 3300025904 | Ga0207647_10022311 | Ga0207647_100223115 | 67 |
| 864 | 3300025904 | Ga0207647_10616614 | Ga0207647_106166142 | 67 |
| 865 | 3300025904 | Ga0207647_10725049 | Ga0207647_107250492 | 67 |
| 866 | 3300025905 | Ga0207685_10003968 | Ga0207685_100039682 | 67 |
| 867 | 3300025905 | Ga0207685_10079697 | Ga0207685_100796972 | 67 |
| 868 | 3300025905 | Ga0207685_10530412 | Ga0207685_105304122 | 67 |
| 869 | 3300025905 | Ga0207685_10607541 | Ga0207685_106075412 | 67 |
| 870 | 3300025906 | Ga0207699_10008911 | Ga0207699_100089113 | 67 |
| 871 | 3300025906 | Ga0207699_10099551 | Ga0207699_100995513 | 67 |
| 872 | 3300025906 | Ga0207699_10406362 | Ga0207699_104063621 | 67 |
| 873 | 3300025906 | Ga0207699_10761832 | Ga0207699_107618322 | 67 |
| 874 | 3300025906 | Ga0207699_10989558 | Ga0207699_109895582 | 67 |
| 875 | 3300025907 | Ga0207645_10001786 | Ga0207645_1000178616 | 67 |
| 876 | 3300025907 | Ga0207645_10002762 | Ga0207645_1000276211 | 67 |
| 877 | 3300025907 | Ga0207645_10133103 | Ga0207645_101331035 | 67 |
| 878 | 3300025907 | Ga0207645_10245051 | Ga0207645_102450513 | 67 |
| 879 | 3300025907 | Ga0207645_10252534 | Ga0207645_102525342 | 67 |
| 880 | 3300025907 | Ga0207645_10457105 | Ga0207645_104571052 | 67 |
| 881 | 3300025910 | Ga0207684_10003766 | Ga0207684_100037665 | 67 |
| 882 | 3300025910 | Ga0207684_10008671 | Ga0207684_1000867112 | 67 |
| 883 | 3300025910 | Ga0207684_10011143 | Ga0207684_100111434 | 67 |
| 884 | 3300025910 | Ga0207684_10042797 | Ga0207684_100427973 | 67 |
| 885 | 3300025910 | Ga0207684_10059810 | Ga0207684_100598103 | 67 |
| 886 | 3300025910 | Ga0207684_10068412 | Ga0207684_100684126 | 67 |
| 887 | 3300025910 | Ga0207684_10105479 | Ga0207684_101054795 | 67 |
| 888 | 3300025910 | Ga0207684_10348575 | Ga0207684_103485753 | 67 |
| 889 | 3300025910 | Ga0207684_10408111 | Ga0207684_104081113 | 67 |
| 890 | 3300025910 | Ga0207684_10451794 | Ga0207684_104517943 | 67 |
| 891 | 3300025910 | Ga0207684_10577943 | Ga0207684_105779433 | 67 |
| 892 | 3300025910 | Ga0207684_10756763 | Ga0207684_107567632 | 67 |
| 893 | 3300025910 | Ga0207684_11493755 | Ga0207684_114937552 | 67 |
| 894 | 3300025912 | Ga0207707_10308527 | Ga0207707_103085272 | 67 |
| 895 | 3300025912 | Ga0207707_10561492 | Ga0207707_105614923 | 67 |
| 896 | 3300025914 | Ga0207671_10363757 | Ga0207671_103637572 | 67 |
| 897 | 3300025914 | Ga0207671_10448470 | Ga0207671_104484702 | 67 |
| 898 | 3300025915 | Ga0207693_10006942 | Ga0207693_1000694210 | 67 |
| 899 | 3300025915 | Ga0207693_10019110 | Ga0207693_100191107 | 67 |
| 900 | 3300025915 | Ga0207693_10021211 | Ga0207693_100212113 | 67 |
| 901 | 3300025915 | Ga0207693_10032567 | Ga0207693_100325675 | 67 |
| 902 | 3300025915 | Ga0207693_10035010 | Ga0207693_100350109 | 67 |
| 903 | 3300025915 | Ga0207693_10090298 | Ga0207693_100902986 | 67 |
| 904 | 3300025915 | Ga0207693_10278653 | Ga0207693_102786534 | 67 |
| 905 | 3300025915 | Ga0207693_10393342 | Ga0207693_103933422 | 67 |
| 906 | 3300025915 | Ga0207693_10490403 | Ga0207693_104904033 | 67 |
| 907 | 3300025915 | Ga0207693_10593130 | Ga0207693_105931303 | 67 |
| 908 | 3300025916 | Ga0207663_10396420 | Ga0207663_103964202 | 67 |
| 909 | 3300025916 | Ga0207663_10472442 | Ga0207663_104724422 | 67 |
| 910 | 3300025916 | Ga0207663_10519887 | Ga0207663_105198873 | 67 |
| 911 | 3300025916 | Ga0207663_10581841 | Ga0207663_105818412 | 67 |
| 912 | 3300025916 | Ga0207663_10633405 | Ga0207663_106334052 | 67 |
| 913 | 3300025916 | Ga0207663_11321577 | Ga0207663_113215772 | 67 |
| 914 | 3300025916 | Ga0207663_11622674 | Ga0207663_116226742 | 67 |
| 915 | 3300025917 | Ga0207660_10167820 | Ga0207660_101678202 | 67 |
| 916 | 3300025918 | Ga0207662_10000699 | Ga0207662_1000069913 | 67 |
| 917 | 3300025918 | Ga0207662_10010494 | Ga0207662_100104947 | 67 |
| 918 | 3300025918 | Ga0207662_10080381 | Ga0207662_100803814 | 67 |
| 919 | 3300025918 | Ga0207662_10309233 | Ga0207662_103092332 | 67 |
| 920 | 3300025918 | Ga0207662_10325515 | Ga0207662_103255154 | 67 |
| 921 | 3300025919 | Ga0207657_10214387 | Ga0207657_102143873 | 67 |
| 922 | 3300025920 | Ga0207649_10043554 | Ga0207649_100435545 | 67 |
| 923 | 3300025920 | Ga0207649_10333051 | Ga0207649_103330513 | 67 |
| 924 | 3300025920 | Ga0207649_10489834 | Ga0207649_104898342 | 67 |
| 925 | 3300025920 | Ga0207649_10605067 | Ga0207649_106050672 | 67 |
| 926 | 3300025921 | Ga0207652_10485669 | Ga0207652_104856693 | 67 |
| 927 | 3300025921 | Ga0207652_10712104 | Ga0207652_107121042 | 67 |
| 928 | 3300025922 | Ga0207646_10000191 | Ga0207646_1000019124 | 67 |
| 929 | 3300025922 | Ga0207646_10009621 | Ga0207646_1000962117 | 67 |
| 930 | 3300025922 | Ga0207646_10010143 | Ga0207646_100101438 | 67 |
| 931 | 3300025922 | Ga0207646_10028198 | Ga0207646_100281984 | 67 |
| 932 | 3300025922 | Ga0207646_10051798 | Ga0207646_100517984 | 67 |
| 933 | 3300025922 | Ga0207646_10085456 | Ga0207646_100854565 | 67 |
| 934 | 3300025922 | Ga0207646_10121006 | Ga0207646_101210064 | 67 |
| 935 | 3300025922 | Ga0207646_10171540 | Ga0207646_101715406 | 67 |
| 936 | 3300025922 | Ga0207646_10207391 | Ga0207646_102073913 | 67 |
| 937 | 3300025922 | Ga0207646_10260717 | Ga0207646_102607174 | 67 |
| 938 | 3300025922 | Ga0207646_10308099 | Ga0207646_103080992 | 67 |
| 939 | 3300025922 | Ga0207646_10413113 | Ga0207646_104131132 | 67 |
| 940 | 3300025922 | Ga0207646_11037387 | Ga0207646_110373871 | 67 |
| 941 | 3300025922 | Ga0207646_11083370 | Ga0207646_110833701 | 67 |
| 942 | 3300025922 | Ga0207646_11189447 | Ga0207646_111894472 | 67 |
| 943 | 3300025922 | Ga0207646_11657266 | Ga0207646_116572662 | 67 |
| 944 | 3300025922 | Ga0207646_11713471 | Ga0207646_117134712 | 67 |
| 945 | 3300025922 | Ga0207646_11731199 | Ga0207646_117311992 | 67 |
| 946 | 3300025923 | Ga0207681_10004055 | Ga0207681_100040552 | 67 |
| 947 | 3300025923 | Ga0207681_10088623 | Ga0207681_100886234 | 67 |
| 948 | 3300025923 | Ga0207681_10116369 | Ga0207681_101163693 | 67 |
| 949 | 3300025923 | Ga0207681_10441433 | Ga0207681_104414332 | 67 |
| 950 | 3300025923 | Ga0207681_10856794 | Ga0207681_108567941 | 67 |
| 951 | 3300025923 | Ga0207681_11184317 | Ga0207681_111843172 | 67 |
| 952 | 3300025923 | Ga0207681_11224475 | Ga0207681_112244752 | 67 |
| 953 | 3300025925 | Ga0207650_10093277 | Ga0207650_100932771 | 67 |
| 954 | 3300025925 | Ga0207650_10319489 | Ga0207650_103194892 | 67 |
| 955 | 3300025925 | Ga0207650_10346946 | Ga0207650_103469463 | 67 |
| 956 | 3300025925 | Ga0207650_10427224 | Ga0207650_104272244 | 67 |
| 957 | 3300025925 | Ga0207650_11540295 | Ga0207650_115402953 | 67 |
| 958 | 3300025926 | Ga0207659_10003512 | Ga0207659_1000351211 | 67 |
| 959 | 3300025926 | Ga0207659_10049761 | Ga0207659_100497618 | 67 |
| 960 | 3300025926 | Ga0207659_10053684 | Ga0207659_100536844 | 67 |
| 961 | 3300025926 | Ga0207659_10067573 | Ga0207659_100675733 | 67 |
| 962 | 3300025926 | Ga0207659_10127931 | Ga0207659_101279314 | 67 |
| 963 | 3300025926 | Ga0207659_10179125 | Ga0207659_101791253 | 67 |
| 964 | 3300025927 | Ga0207687_10095481 | Ga0207687_100954811 | 67 |
| 965 | 3300025927 | Ga0207687_10694367 | Ga0207687_106943672 | 67 |
| 966 | 3300025927 | Ga0207687_11162978 | Ga0207687_111629782 | 67 |
| 967 | 3300025927 | Ga0207687_11337954 | Ga0207687_113379541 | 67 |
| 968 | 3300025927 | Ga0207687_11504157 | Ga0207687_115041572 | 67 |
| 969 | 3300025927 | Ga0207687_11664935 | Ga0207687_116649352 | 67 |
| 970 | 3300025928 | Ga0207700_10003893 | Ga0207700_1000389312 | 67 |
| 971 | 3300025928 | Ga0207700_10069264 | Ga0207700_100692646 | 67 |
| 972 | 3300025928 | Ga0207700_10087236 | Ga0207700_100872367 | 67 |
| 973 | 3300025928 | Ga0207700_10156867 | Ga0207700_101568675 | 67 |
| 974 | 3300025928 | Ga0207700_10725583 | Ga0207700_107255832 | 67 |
| 975 | 3300025929 | Ga0207664_10112083 | Ga0207664_101120835 | 67 |
| 976 | 3300025929 | Ga0207664_10122505 | Ga0207664_101225053 | 67 |
| 977 | 3300025929 | Ga0207664_10142540 | Ga0207664_101425403 | 67 |
| 978 | 3300025929 | Ga0207664_10681007 | Ga0207664_106810073 | 67 |
| 979 | 3300025929 | Ga0207664_10697046 | Ga0207664_106970461 | 67 |
| 980 | 3300025929 | Ga0207664_11810705 | Ga0207664_118107052 | 67 |
| 981 | 3300025931 | Ga0207644_10196648 | Ga0207644_101966482 | 67 |
| 982 | 3300025931 | Ga0207644_10254840 | Ga0207644_102548402 | 67 |
| 983 | 3300025931 | Ga0207644_10344956 | Ga0207644_103449563 | 67 |
| 984 | 3300025931 | Ga0207644_10692706 | Ga0207644_106927062 | 67 |
| 985 | 3300025931 | Ga0207644_11813834 | Ga0207644_118138341 | 67 |
| 986 | 3300025932 | Ga0207690_10075123 | Ga0207690_100751233 | 67 |
| 987 | 3300025932 | Ga0207690_10098203 | Ga0207690_100982034 | 67 |
| 988 | 3300025932 | Ga0207690_10182904 | Ga0207690_101829042 | 67 |
| 989 | 3300025932 | Ga0207690_11019648 | Ga0207690_110196482 | 67 |
| 990 | 3300025933 | Ga0207706_10008197 | Ga0207706_1000819716 | 67 |
| 991 | 3300025933 | Ga0207706_10130216 | Ga0207706_101302162 | 67 |
| 992 | 3300025933 | Ga0207706_10216094 | Ga0207706_102160943 | 67 |
| 993 | 3300025933 | Ga0207706_10252504 | Ga0207706_102525044 | 67 |
| 994 | 3300025933 | Ga0207706_10397992 | Ga0207706_103979923 | 67 |
| 995 | 3300025933 | Ga0207706_10554217 | Ga0207706_105542172 | 67 |
| 996 | 3300025933 | Ga0207706_11016521 | Ga0207706_110165212 | 67 |
| 997 | 3300025934 | Ga0207686_10157569 | Ga0207686_101575693 | 67 |
| 998 | 3300025934 | Ga0207686_11520114 | Ga0207686_115201142 | 67 |
| 999 | 3300025934 | Ga0207686_11644433 | Ga0207686_116444332 | 67 |
| 1000 | 3300025935 | Ga0207709_10405195 | Ga0207709_104051952 | 67 |
| 1001 | 3300025935 | Ga0207709_10620733 | Ga0207709_106207333 | 67 |
| 1002 | 3300025936 | Ga0207670_10020026 | Ga0207670_100200265 | 67 |
| 1003 | 3300025936 | Ga0207670_10186652 | Ga0207670_101866522 | 67 |
| 1004 | 3300025936 | Ga0207670_10787345 | Ga0207670_107873453 | 67 |
| 1005 | 3300025937 | Ga0207669_10011026 | Ga0207669_100110263 | 67 |
| 1006 | 3300025937 | Ga0207669_10194696 | Ga0207669_101946963 | 67 |
| 1007 | 3300025938 | Ga0207704_10336220 | Ga0207704_103362203 | 67 |
| 1008 | 3300025938 | Ga0207704_10483166 | Ga0207704_104831663 | 67 |
| 1009 | 3300025938 | Ga0207704_10655411 | Ga0207704_106554112 | 67 |
| 1010 | 3300025938 | Ga0207704_11051630 | Ga0207704_110516302 | 67 |
| 1011 | 3300025938 | Ga0207704_11655212 | Ga0207704_116552122 | 67 |
| 1012 | 3300025939 | Ga0207665_10023457 | Ga0207665_100234573 | 67 |
| 1013 | 3300025939 | Ga0207665_10026852 | Ga0207665_100268523 | 67 |
| 1014 | 3300025939 | Ga0207665_10054073 | Ga0207665_100540734 | 67 |
| 1015 | 3300025939 | Ga0207665_10204530 | Ga0207665_102045303 | 67 |
| 1016 | 3300025939 | Ga0207665_10232318 | Ga0207665_102323182 | 67 |
| 1017 | 3300025939 | Ga0207665_10451432 | Ga0207665_104514323 | 67 |
| 1018 | 3300025939 | Ga0207665_10552833 | Ga0207665_105528331 | 67 |
| 1019 | 3300025939 | Ga0207665_10841249 | Ga0207665_108412492 | 67 |
| 1020 | 3300025940 | Ga0207691_10037047 | Ga0207691_100370475 | 67 |
| 1021 | 3300025940 | Ga0207691_10151876 | Ga0207691_101518762 | 67 |
| 1022 | 3300025940 | Ga0207691_11415241 | Ga0207691_114152412 | 67 |
| 1023 | 3300025942 | Ga0207689_10086541 | Ga0207689_100865412 | 67 |
| 1024 | 3300025942 | Ga0207689_10111933 | Ga0207689_101119333 | 67 |
| 1025 | 3300025942 | Ga0207689_11087503 | Ga0207689_110875032 | 67 |
| 1026 | 3300025944 | Ga0207661_10035276 | Ga0207661_100352762 | 67 |
| 1027 | 3300025944 | Ga0207661_10393064 | Ga0207661_103930642 | 67 |
| 1028 | 3300025944 | Ga0207661_10452819 | Ga0207661_104528192 | 67 |
| 1029 | 3300025944 | Ga0207661_11031626 | Ga0207661_110316262 | 67 |
| 1030 | 3300025945 | Ga0207679_10094203 | Ga0207679_100942035 | 67 |
| 1031 | 3300025945 | Ga0207679_10401318 | Ga0207679_104013184 | 67 |
| 1032 | 3300025945 | Ga0207679_10418466 | Ga0207679_104184663 | 67 |
| 1033 | 3300025945 | Ga0207679_10673068 | Ga0207679_106730683 | 67 |
| 1034 | 3300025960 | Ga0207651_10059097 | Ga0207651_100590973 | 67 |
| 1035 | 3300025960 | Ga0207651_10081121 | Ga0207651_100811212 | 67 |
| 1036 | 3300025960 | Ga0207651_10277686 | Ga0207651_102776862 | 67 |
| 1037 | 3300025960 | Ga0207651_10296423 | Ga0207651_102964232 | 67 |
| 1038 | 3300025960 | Ga0207651_11566462 | Ga0207651_115664622 | 67 |
| 1039 | 3300025961 | Ga0207712_10010310 | Ga0207712_1001031011 | 67 |
| 1040 | 3300025961 | Ga0207712_10860402 | Ga0207712_108604023 | 67 |
| 1041 | 3300025972 | Ga0207668_10052709 | Ga0207668_100527091 | 67 |
| 1042 | 3300025972 | Ga0207668_10110386 | Ga0207668_101103862 | 67 |
| 1043 | 3300025972 | Ga0207668_10116809 | Ga0207668_101168092 | 67 |
| 1044 | 3300025981 | Ga0207640_10198487 | Ga0207640_101984872 | 67 |
| 1045 | 3300025981 | Ga0207640_10777008 | Ga0207640_107770081 | 67 |
| 1046 | 3300025981 | Ga0207640_11992280 | Ga0207640_119922801 | 67 |
| 1047 | 3300025986 | Ga0207658_10036520 | Ga0207658_100365206 | 67 |
| 1048 | 3300025986 | Ga0207658_10043698 | Ga0207658_100436984 | 67 |
| 1049 | 3300025986 | Ga0207658_10076513 | Ga0207658_100765136 | 67 |
| 1050 | 3300026023 | Ga0207677_10032534 | Ga0207677_100325343 | 67 |
| 1051 | 3300026023 | Ga0207677_10433542 | Ga0207677_104335423 | 67 |
| 1052 | 3300026023 | Ga0207677_10563597 | Ga0207677_105635972 | 67 |
| 1053 | 3300026023 | Ga0207677_10695856 | Ga0207677_106958562 | 67 |
| 1054 | 3300026023 | Ga0207677_10848651 | Ga0207677_108486513 | 67 |
| 1055 | 3300026023 | Ga0207677_11383214 | Ga0207677_113832142 | 67 |
| 1056 | 3300026023 | Ga0207677_11497088 | Ga0207677_114970881 | 67 |
| 1057 | 3300026035 | Ga0207703_10003624 | Ga0207703_1000362425 | 67 |
| 1058 | 3300026035 | Ga0207703_10549854 | Ga0207703_105498542 | 67 |
| 1059 | 3300026035 | Ga0207703_10900518 | Ga0207703_109005182 | 67 |
| 1060 | 3300026035 | Ga0207703_11952313 | Ga0207703_119523131 | 67 |
| 1061 | 3300026041 | Ga0207639_11033099 | Ga0207639_110330992 | 67 |
| 1062 | 3300026067 | Ga0207678_10020455 | Ga0207678_1002045511 | 67 |
| 1063 | 3300026067 | Ga0207678_10234839 | Ga0207678_102348392 | 67 |
| 1064 | 3300026067 | Ga0207678_10529024 | Ga0207678_105290242 | 67 |
| 1065 | 3300026067 | Ga0207678_11209444 | Ga0207678_112094442 | 67 |
| 1066 | 3300026075 | Ga0207708_10030364 | Ga0207708_100303643 | 67 |
| 1067 | 3300026075 | Ga0207708_10521317 | Ga0207708_105213172 | 67 |
| 1068 | 3300026075 | Ga0207708_10644573 | Ga0207708_106445732 | 67 |
| 1069 | 3300026078 | Ga0207702_10255395 | Ga0207702_102553952 | 67 |
| 1070 | 3300026078 | Ga0207702_10937471 | Ga0207702_109374713 | 67 |
| 1071 | 3300026078 | Ga0207702_11455685 | Ga0207702_114556851 | 67 |
| 1072 | 3300026078 | Ga0207702_12099462 | Ga0207702_120994622 | 67 |
| 1073 | 3300026088 | Ga0207641_10022387 | Ga0207641_1002238711 | 67 |
| 1074 | 3300026088 | Ga0207641_10717521 | Ga0207641_107175212 | 67 |
| 1075 | 3300026088 | Ga0207641_11141571 | Ga0207641_111415712 | 67 |
| 1076 | 3300026088 | Ga0207641_11206454 | Ga0207641_112064541 | 67 |
| 1077 | 3300026089 | Ga0207648_10108555 | Ga0207648_101085556 | 67 |
| 1078 | 3300026089 | Ga0207648_10302676 | Ga0207648_103026763 | 67 |
| 1079 | 3300026089 | Ga0207648_10708852 | Ga0207648_107088521 | 67 |
| 1080 | 3300026095 | Ga0207676_10895426 | Ga0207676_108954263 | 67 |
| 1081 | 3300026116 | Ga0207674_10342675 | Ga0207674_103426753 | 67 |
| 1082 | 3300026116 | Ga0207674_10995977 | Ga0207674_109959772 | 67 |
| 1083 | 3300026118 | Ga0207675_100066854 | Ga0207675_1000668543 | 67 |
| 1084 | 3300026118 | Ga0207675_100085155 | Ga0207675_1000851556 | 67 |
| 1085 | 3300026118 | Ga0207675_100551996 | Ga0207675_1005519963 | 67 |
| 1086 | 3300026118 | Ga0207675_101879321 | Ga0207675_1018793212 | 67 |
| 1087 | 3300026121 | Ga0207683_10015583 | Ga0207683_1001558311 | 67 |
| 1088 | 3300026121 | Ga0207683_10089065 | Ga0207683_100890653 | 67 |
| 1089 | 3300026121 | Ga0207683_10428382 | Ga0207683_104283822 | 67 |
| 1090 | 3300026121 | Ga0207683_10433660 | Ga0207683_104336602 | 67 |
| 1091 | 3300026121 | Ga0207683_11438819 | Ga0207683_114388191 | 67 |
| 1092 | 3300026142 | Ga0207698_11609693 | Ga0207698_116096931 | 67 |
| 1093 | 3300026142 | Ga0207698_11896038 | Ga0207698_118960382 | 67 |
| 1094 | 3300027424 | Ga0209984_1014198 | Ga0209984_10141982 | 67 |
| 1095 | 3300027614 | Ga0209970_1035731 | Ga0209970_10357313 | 67 |
| 1096 | 3300027617 | Ga0210002_1069008 | Ga0210002_10690082 | 67 |
| 1097 | 3300027876 | Ga0209974_10002731 | Ga0209974_100027315 | 67 |
| 1098 | 3300027876 | Ga0209974_10165190 | Ga0209974_101651901 | 67 |
| 1099 | 3300027876 | Ga0209974_10175797 | Ga0209974_101757971 | 67 |
| 1100 | 3300027907 | Ga0207428_10537082 | Ga0207428_105370822 | 67 |
| 1101 | 3300028379 | Ga0268266_10026994 | Ga0268266_100269944 | 67 |
| 1102 | 3300028379 | Ga0268266_10194689 | Ga0268266_101946894 | 67 |
| 1103 | 3300028379 | Ga0268266_10391086 | Ga0268266_103910862 | 67 |
| 1104 | 3300028379 | Ga0268266_10395399 | Ga0268266_103953991 | 67 |
| 1105 | 3300028379 | Ga0268266_10488001 | Ga0268266_104880013 | 67 |
| 1106 | 3300028380 | Ga0268265_10198884 | Ga0268265_101988844 | 67 |
| 1107 | 3300028380 | Ga0268265_10831073 | Ga0268265_108310732 | 67 |
| 1108 | 3300028380 | Ga0268265_10971562 | Ga0268265_109715623 | 67 |
| 1109 | 3300028381 | Ga0268264_10029276 | Ga0268264_100292767 | 67 |
| 1110 | 3300028381 | Ga0268264_10236756 | Ga0268264_102367562 | 67 |
| 1111 | 3300028381 | Ga0268264_10697174 | Ga0268264_106971742 | 67 |
| 1112 | 3300028381 | Ga0268264_11102608 | Ga0268264_111026082 | 67 |
| 1113 | 3300028381 | Ga0268264_11969376 | Ga0268264_119693761 | 67 |
| 1114 | 3300031456 | Ga0307513_10023335 | Ga0307513_1002333511 | 67 |
| 1115 | 3300035083 | Ga0373926_0071067 | Ga0373926_0071067_500_703 | 67 |
| 1116 | 3300035086 | Ga0373934_0458744 | Ga0373934_0458744_46_249 | 67 |
| 1117 | 3300035111 | Ga0373923_0370181 | Ga0373923_0370181_306_527 | 67 |
| 1118 | 3300035112 | Ga0373932_0144460 | Ga0373932_0144460_389_595 | 67 |
| 1119 | 3300035113 | Ga0373936_0063141 | Ga0373936_0063141_931_1134 | 67 |
| 1120 | 3300035113 | Ga0373936_0089102 | Ga0373936_0089102_604_807 | 67 |
| 1121 | 3300035114 | Ga0373939_0144169 | Ga0373939_0144169_369_575 | 67 |
| 1122 | 3300035114 | Ga0373939_0199620 | Ga0373939_0199620_32_238 | 67 |
| 1123 | 3300035115 | Ga0373941_0275716 | Ga0373941_0275716_448_651 | 67 |
| 1124 | 3300035116 | Ga0373945_0049243 | Ga0373945_0049243_546_749 | 67 |
| 1125 | 3300035116 | Ga0373945_0227619 | Ga0373945_0227619_496_699 | 67 |
| 1126 | 3300035116 | Ga0373945_0309808 | Ga0373945_0309808_72_275 | 67 |
| 1127 | 3300035117 | Ga0373953_0246233 | Ga0373953_0246233_403_606 | 67 |
| 1128 | 3300035117 | Ga0373953_0264792 | Ga0373953_0264792_464_691 | 67 |
| 1129 | 3300035118 | Ga0373954_0144032 | Ga0373954_0144032_66_269 | 67 |
| 1130 | 3300035118 | Ga0373954_0263820 | Ga0373954_0263820_568_771 | 67 |
| 1131 | 3300035119 | Ga0373956_0096615 | Ga0373956_0096615_43_270 | 67 |
| 1132 | 3300035119 | Ga0373956_0513677 | Ga0373956_0513677_313_516 | 67 |
| 1133 | 3300035120 | Ga0373957_0043978 | Ga0373957_0043978_961_1164 | 67 |
| 1134 | 3300035121 | Ga0373960_0186212 | Ga0373960_0186212_312_518 | 67 |
| 1135 | 3300035170 | Ga0373943_0075146 | Ga0373943_0075146_1393_1596 | 67 |
| 1136 | 3300035170 | Ga0373943_0130170 | Ga0373943_0130170_21_224 | 67 |
| 1137 | 3300035170 | Ga0373943_0146425 | Ga0373943_0146425_278_481 | 67 |
| 1138 | 3300035170 | Ga0373943_0319387 | Ga0373943_0319387_58_276 | 67 |
| 1139 | 3300035170 | Ga0373943_0436808 | Ga0373943_0436808_416_619 | 67 |
| 1140 | 3300035171 | Ga0373946_0014471 | Ga0373946_0014471_604_807 | 67 |
| 1141 | 3300035171 | Ga0373946_0103567 | Ga0373946_0103567_531_749 | 67 |
| 1142 | 3300035171 | Ga0373946_0167595 | Ga0373946_0167595_724_927 | 67 |
| 1143 | 3300035171 | Ga0373946_0325878 | Ga0373946_0325878_121_324 | 67 |
| 1144 | 3300035172 | Ga0373955_0133643 | Ga0373955_0133643_956_1183 | 67 |
| 1145 | 3300035172 | Ga0373955_0248788 | Ga0373955_0248788_766_969 | 67 |
| 1146 | 3300035241 | Ga0373961_0190229 | Ga0373961_0190229_332_538 | 67 |
| 1147 | 3300035410 | Ga0373924_0014324 | Ga0373924_0014324_981_1208 | 67 |
| 1148 | 3300035410 | Ga0373924_0202054 | Ga0373924_0202054_53_256 | 67 |
| 1149 | 3300035692 | Ga0373935_0034641 | Ga0373935_0034641_1396_1599 | 67 |
| 1150 | 3300035692 | Ga0373935_0334591 | Ga0373935_0334591_612_830 | 67 |
| 1151 | 3300035692 | Ga0373935_0725297 | Ga0373935_0725297_304_507 | 67 |
| 1152 | 3300035695 | Ga0373927_0010910 | Ga0373927_0010910_4877_5080 | 67 |
| 1153 | 3300035695 | Ga0373927_0040560 | Ga0373927_0040560_1673_1876 | 67 |
| 1154 | 3300035695 | Ga0373927_0266811 | Ga0373927_0266811_268_471 | 67 |
| 1155 | 3300035724 | Ga0373933_0088778 | Ga0373933_0088778_443_670 | 67 |
| 1156 | 3300035724 | Ga0373933_0394291 | Ga0373933_0394291_454_657 | 67 |
| 1157 | 3300035724 | Ga0373933_0687695 | Ga0373933_0687695_400_603 | 67 |
| 1158 | 3300035725 | Ga0373947_0031650 | Ga0373947_0031650_1330_1533 | 67 |
| 1159 | 3300035725 | Ga0373947_0036106 | Ga0373947_0036106_2127_2330 | 67 |
| 1160 | 3300035725 | Ga0373947_0044039 | Ga0373947_0044039_510_728 | 67 |
| 1161 | 3300035725 | Ga0373947_0107417 | Ga0373947_0107417_737_940 | 67 |
| 1162 | 3300035725 | Ga0373947_0195825 | Ga0373947_0195825_182_385 | 67 |
| 1163 | 3300035725 | Ga0373947_0225808 | Ga0373947_0225808_714_917 | 67 |
| 1164 | 3300035725 | Ga0373947_0475836 | Ga0373947_0475836_597_800 | 67 |
| 1165 | 3300036401 | Ga0373937_0007935 | Ga0373937_0007935_525_728 | 67 |
| 1166 | 3300036401 | Ga0373937_0065643 | Ga0373937_0065643_747_950 | 67 |
| 1167 | 3300036401 | Ga0373937_0195834 | Ga0373937_0195834_100_327 | 67 |
| 1168 | 3300036401 | Ga0373937_0420927 | Ga0373937_0420927_79_300 | 67 |
| 1169 | 3300037068 | Ga0373925_0034819 | Ga0373925_0034819_2134_2337 | 67 |
| 1170 | 3300037068 | Ga0373925_0040917 | Ga0373925_0040917_3172_3390 | 67 |
| 1171 | 3300037068 | Ga0373925_0065822 | Ga0373925_0065822_1210_1413 | 67 |
| 1172 | 3300037068 | Ga0373925_0068631 | Ga0373925_0068631_214_417 | 67 |
| 1173 | 3300037068 | Ga0373925_0160554 | Ga0373925_0160554_724_927 | 67 |
| 1174 | 3300037068 | Ga0373925_0176068 | Ga0373925_0176068_563_766 | 67 |
| 1175 | 3300037068 | Ga0373925_0180445 | Ga0373925_0180445_764_991 | 67 |
| 1176 | 3300037068 | Ga0373925_0259036 | Ga0373925_0259036_1048_1251 | 67 |
| 1177 | 3300037068 | Ga0373925_0774564 | Ga0373925_0774564_40_258 | 67 |
| 1178 | 3300037068 | Ga0373925_0831281 | Ga0373925_0831281_142_378 | 67 |
| 1179 | 3300037312 | Ga0395899_0047074 | Ga0395899_0047074_1506_1709 | 67 |
| 1180 | 3300037312 | Ga0395899_0633035 | Ga0395899_0633035_52_255 | 67 |
| 1181 | 3300037418 | Ga0395900_0008031 | Ga0395900_0008031_4868_5071 | 67 |
| 1182 | 3300037418 | Ga0395900_0111523 | Ga0395900_0111523_781_984 | 67 |
| 1183 | 3300037418 | Ga0395900_0706607 | Ga0395900_0706607_493_696 | 67 |
| 1184 | 3300037418 | Ga0395900_0759771 | Ga0395900_0759771_611_814 | 67 |
| 1185 | 3300037466 | Ga0395898_0002044 | Ga0395898_0002044_20964_21167 | 67 |
| 1186 | 3300037466 | Ga0395898_0602115 | Ga0395898_0602115_772_975 | 67 |
| 1187 | 3300037471 | Ga0395905_0357397 | Ga0395905_0357397_252_455 | 67 |
| 1188 | 3300037471 | Ga0395905_0753845 | Ga0395905_0753845_301_504 | 67 |
| 1189 | 3300037471 | Ga0395905_1300248 | Ga0395905_1300248_165_368 | 67 |
| 1190 | 3300037853 | Ga0436364_0850081 | Ga0436364_0850081_335_541 | 67 |
| 1191 | 3300038443 | Ga0395901_0002964 | Ga0395901_0002964_13667_13870 | 67 |
| 1192 | 3300038443 | Ga0395901_0064660 | Ga0395901_0064660_1894_2097 | 67 |
| 1193 | 3300038443 | Ga0395901_0437562 | Ga0395901_0437562_337_540 | 67 |
| 1194 | 3300039437 | Ga0436365_0345467 | Ga0436365_0345467_464_670 | 67 |
| 1195 | 3300039450 | Ga0436363_1236879 | Ga0436363_1236879_366_602 | 67 |
| 1196 | 3300041443 | Ga0451789_1020370 | Ga0451789_1020370_323_526 | 67 |
| 1197 | 3300041451 | Ga0451791_1864675 | Ga0451791_1864675_141_344 | 67 |
| 1198 | 3300041452 | Ga0451793_0969996 | Ga0451793_0969996_64_267 | 67 |
| 1199 | 3300041456 | Ga0451795_0375776 | Ga0451795_0375776_280_483 | 67 |
| 1200 | 3300041460 | Ga0451802_0741526 | Ga0451802_0741526_318_521 | 67 |
| 1201 | 3300041460 | Ga0451802_0769737 | Ga0451802_0769737_285_503 | 67 |
| 1202 | 3300041460 | Ga0451802_1371756 | Ga0451802_1371756_131_334 | 67 |
| 1203 | 3300041486 | Ga0451807_0068204 | Ga0451807_0068204_182_385 | 67 |
| 1204 | 3300041501 | Ga0451845_0545397 | Ga0451845_0545397_112_315 | 67 |
| 1205 | 3300041505 | Ga0451849_0026473 | Ga0451849_0026473_180_383 | 67 |
| 1206 | 3300041511 | Ga0451855_0802694 | Ga0451855_0802694_301_504 | 67 |
| 1207 | 3300041512 | Ga0451853_0516564 | Ga0451853_0516564_94_297 | 67 |
| 1208 | 3300041512 | Ga0451853_1896950 | Ga0451853_1896950_610_813 | 67 |
| 1209 | 3300041512 | Ga0451853_1958043 | Ga0451853_1958043_429_632 | 67 |
| 1210 | 3300041512 | Ga0451853_3591552 | Ga0451853_3591552_263_466 | 67 |
| 1211 | 3300042005 | Ga0439448_0063421 | Ga0439448_0063421_704_907 | 67 |
| 1212 | 3300042005 | Ga0439448_0078090 | Ga0439448_0078090_480_683 | 67 |
| 1213 | 3300042009 | Ga0439451_039740 | Ga0439451_039740_460_663 | 67 |
| 1214 | 3300042009 | Ga0439451_067856 | Ga0439451_067856_429_632 | 67 |
| 1215 | 3300042011 | Ga0439454_003697 | Ga0439454_003697_275_478 | 67 |
| 1216 | 3300042012 | Ga0439455_0005259 | Ga0439455_0005259_2293_2496 | 67 |
| 1217 | 3300042012 | Ga0439455_0209736 | Ga0439455_0209736_328_531 | 67 |
| 1218 | 3300042142 | Ga0450905_061433 | Ga0450905_061433_11_214 | 67 |
| 1219 | 3300042157 | Ga0439458_0011685 | Ga0439458_0011685_755_958 | 67 |
| 1220 | 3300042157 | Ga0439458_0054144 | Ga0439458_0054144_504_707 | 67 |
| 1221 | 3300042439 | Ga0439464_0082385 | Ga0439464_0082385_442_645 | 67 |
| 1222 | 3300042993 | Ga0439440_0037206 | Ga0439440_0037206_91_294 | 67 |
| 1223 | 3300045051 | Ga0451576_0146081 | Ga0451576_0146081_1960_2163 | 67 |
| 1224 | 3300045051 | Ga0451576_0278466 | Ga0451576_0278466_1195_1398 | 67 |
| 1225 | 3300045976 | Ga0466967_0339308 | Ga0466967_0339308_104_316 | 67 |
| 1226 | 3300046454 | Ga0495592_0049064 | Ga0495592_0049064_486_689 | 67 |
| 1227 | 3300046454 | Ga0495592_0082388 | Ga0495592_0082388_803_1030 | 67 |
| 1228 | 3300046455 | Ga0495603_0104836 | Ga0495603_0104836_709_912 | 67 |
| 1229 | 3300046455 | Ga0495603_0401225 | Ga0495603_0401225_423_626 | 67 |
| 1230 | 3300046455 | Ga0495603_0407001 | Ga0495603_0407001_500_703 | 67 |
| 1231 | 3300046457 | Ga0495590_0103909 | Ga0495590_0103909_455_658 | 67 |
| 1232 | 3300046459 | Ga0495629_0008333 | Ga0495629_0008333_3621_3824 | 67 |
| 1233 | 3300046459 | Ga0495629_0204547 | Ga0495629_0204547_496_699 | 67 |
| 1234 | 3300046459 | Ga0495629_0334860 | Ga0495629_0334860_79_297 | 67 |
| 1235 | 3300046459 | Ga0495629_0757639 | Ga0495629_0757639_158_376 | 67 |
| 1236 | 3300046461 | Ga0495641_0062450 | Ga0495641_0062450_271_474 | 67 |
| 1237 | 3300046462 | Ga0495651_0122706 | Ga0495651_0122706_1202_1429 | 67 |
| 1238 | 3300046462 | Ga0495651_0371381 | Ga0495651_0371381_659_865 | 67 |
| 1239 | 3300046462 | Ga0495651_0448787 | Ga0495651_0448787_280_492 | 67 |
| 1240 | 3300046462 | Ga0495651_0511913 | Ga0495651_0511913_467_670 | 67 |
| 1241 | 3300046462 | Ga0495651_0680814 | Ga0495651_0680814_223_426 | 67 |
| 1242 | 3300046463 | Ga0495653_0360908 | Ga0495653_0360908_543_746 | 67 |
| 1243 | 3300046463 | Ga0495653_0484627 | Ga0495653_0484627_448_651 | 67 |
| 1244 | 3300046463 | Ga0495653_0679411 | Ga0495653_0679411_139_342 | 67 |
| 1245 | 3300046472 | Ga0495580_0359881 | Ga0495580_0359881_385_588 | 67 |
| 1246 | 3300046473 | Ga0495582_0314706 | Ga0495582_0314706_568_771 | 67 |
| 1247 | 3300046474 | Ga0495605_0076983 | Ga0495605_0076983_56_259 | 67 |
| 1248 | 3300046475 | Ga0495639_0374997 | Ga0495639_0374997_289_492 | 67 |
| 1249 | 3300046476 | Ga0495662_0056346 | Ga0495662_0056346_1645_1848 | 67 |
| 1250 | 3300046476 | Ga0495662_0342468 | Ga0495662_0342468_434_637 | 67 |
| 1251 | 3300046477 | Ga0495664_0127274 | Ga0495664_0127274_864_1067 | 67 |
| 1252 | 3300046477 | Ga0495664_0135201 | Ga0495664_0135201_958_1185 | 67 |
| 1253 | 3300046499 | Ga0495594_0151606 | Ga0495594_0151606_339_542 | 67 |
| 1254 | 3300046501 | Ga0495607_0125264 | Ga0495607_0125264_119_325 | 67 |
| 1255 | 3300046511 | Ga0495608_0443139 | Ga0495608_0443139_341_568 | 67 |
| 1256 | 3300046511 | Ga0495608_0454416 | Ga0495608_0454416_216_419 | 67 |
| 1257 | 3300046511 | Ga0495608_0602489 | Ga0495608_0602489_216_419 | 67 |
| 1258 | 3300046514 | Ga0495618_0059321 | Ga0495618_0059321_540_743 | 67 |
| 1259 | 3300046514 | Ga0495618_0223091 | Ga0495618_0223091_43_246 | 67 |
| 1260 | 3300046514 | Ga0495618_0260021 | Ga0495618_0260021_758_985 | 67 |
| 1261 | 3300046516 | Ga0495628_0004287 | Ga0495628_0004287_10983_11186 | 67 |
| 1262 | 3300046516 | Ga0495628_0079826 | Ga0495628_0079826_2110_2337 | 67 |
| 1263 | 3300046517 | Ga0495630_0017678 | Ga0495630_0017678_4164_4391 | 67 |
| 1264 | 3300046517 | Ga0495630_0217786 | Ga0495630_0217786_22_225 | 67 |
| 1265 | 3300046517 | Ga0495630_1310000 | Ga0495630_1310000_82_285 | 67 |
| 1266 | 3300046523 | Ga0495644_0096747 | Ga0495644_0096747_226_429 | 67 |
| 1267 | 3300046526 | Ga0495666_0122893 | Ga0495666_0122893_908_1111 | 67 |
| 1268 | 3300046526 | Ga0495666_0492359 | Ga0495666_0492359_265_468 | 67 |
| 1269 | 3300046529 | Ga0495652_0045601 | Ga0495652_0045601_933_1136 | 67 |
| 1270 | 3300046529 | Ga0495652_0064185 | Ga0495652_0064185_2056_2283 | 67 |
| 1271 | 3300046531 | Ga0495665_0529948 | Ga0495665_0529948_299_502 | 67 |
| 1272 | 3300046533 | Ga0495640_0027037 | Ga0495640_0027037_1935_2162 | 67 |
| 1273 | 3300046533 | Ga0495640_0354961 | Ga0495640_0354961_102_305 | 67 |
| 1274 | 3300046533 | Ga0495640_0591582 | Ga0495640_0591582_216_419 | 67 |
| 1275 | 3300046533 | Ga0495640_0776756 | Ga0495640_0776756_228_431 | 67 |
| 1276 | 3300046535 | Ga0495586_0014140 | Ga0495586_0014140_1828_2031 | 67 |
| 1277 | 3300046535 | Ga0495586_0350618 | Ga0495586_0350618_11_214 | 67 |
| 1278 | 3300046536 | Ga0495587_0004117 | Ga0495587_0004117_7990_8193 | 67 |
| 1279 | 3300046536 | Ga0495587_0101619 | Ga0495587_0101619_937_1164 | 67 |
| 1280 | 3300046537 | Ga0495598_0012406 | Ga0495598_0012406_232_450 | 67 |
| 1281 | 3300046537 | Ga0495598_0016088 | Ga0495598_0016088_266_472 | 67 |
| 1282 | 3300046537 | Ga0495598_0029599 | Ga0495598_0029599_872_1075 | 67 |
| 1283 | 3300046537 | Ga0495598_0148939 | Ga0495598_0148939_343_546 | 67 |
| 1284 | 3300046539 | Ga0495621_0292057 | Ga0495621_0292057_371_589 | 67 |
| 1285 | 3300046539 | Ga0495621_0438891 | Ga0495621_0438891_100_303 | 67 |
| 1286 | 3300046543 | Ga0495645_0001076 | Ga0495645_0001076_2560_2763 | 67 |
| 1287 | 3300046543 | Ga0495645_0489335 | Ga0495645_0489335_345_572 | 67 |
| 1288 | 3300046559 | Ga0495667_0032250 | Ga0495667_0032250_1624_1827 | 67 |
| 1289 | 3300046559 | Ga0495667_0071324 | Ga0495667_0071324_1641_1844 | 67 |
| 1290 | 3300046616 | Ga0495668_0620313 | Ga0495668_0620313_296_499 | 67 |
| 1291 | 3300046642 | Ga0495634_0131202 | Ga0495634_0131202_906_1109 | 67 |
| 1292 | 3300046642 | Ga0495634_0355677 | Ga0495634_0355677_295_522 | 67 |
| 1293 | 3300046648 | Ga0495611_0136393 | Ga0495611_0136393_411_614 | 67 |
| 1294 | 3300046663 | Ga0495635_0204821 | Ga0495635_0204821_731_934 | 67 |
| 1295 | 3300046663 | Ga0495635_0244606 | Ga0495635_0244606_918_1124 | 67 |
| 1296 | 3300046663 | Ga0495635_0342139 | Ga0495635_0342139_93_320 | 67 |
| 1297 | 3300046664 | Ga0495659_0442193 | Ga0495659_0442193_266_484 | 67 |
| 1298 | 3300046674 | Ga0495588_0189414 | Ga0495588_0189414_185_388 | 67 |
| 1299 | 3300046674 | Ga0495588_0212760 | Ga0495588_0212760_147_350 | 67 |
| 1300 | 3300046674 | Ga0495588_0650476 | Ga0495588_0650476_179_382 | 67 |
| 1301 | 3300046675 | Ga0495657_0091838 | Ga0495657_0091838_965_1168 | 67 |
| 1302 | 3300046675 | Ga0495657_0226063 | Ga0495657_0226063_231_434 | 67 |
| 1303 | 3300046678 | Ga0495599_0000317 | Ga0495599_0000317_11820_12023 | 67 |
| 1304 | 3300046679 | Ga0495623_0000811 | Ga0495623_0000811_14283_14486 | 67 |
| 1305 | 3300046680 | Ga0495646_0002940 | Ga0495646_0002940_5381_5584 | 67 |
| 1306 | 3300046680 | Ga0495646_0435121 | Ga0495646_0435121_36_263 | 67 |
| 1307 | 3300046683 | Ga0495658_0145447 | Ga0495658_0145447_426_632 | 67 |
| 1308 | 3300046683 | Ga0495658_0209856 | Ga0495658_0209856_331_534 | 67 |
| 1309 | 3300046683 | Ga0495658_0460690 | Ga0495658_0460690_48_251 | 67 |
| 1310 | 3300046683 | Ga0495658_0825100 | Ga0495658_0825100_103_306 | 67 |
| 1311 | 3300046684 | Ga0495669_0039850 | Ga0495669_0039850_1649_1876 | 67 |
| 1312 | 3300046684 | Ga0495669_0178602 | Ga0495669_0178602_703_909 | 67 |
| 1313 | 3300046684 | Ga0495669_0478282 | Ga0495669_0478282_213_416 | 67 |
| 1314 | 3300046684 | Ga0495669_0524567 | Ga0495669_0524567_107_310 | 67 |
| 1315 | 3300046684 | Ga0495669_0610218 | Ga0495669_0610218_38_244 | 67 |
| 1316 | 3300046689 | Ga0495613_0374245 | Ga0495613_0374245_258_461 | 67 |
| 1317 | 3300046689 | Ga0495613_0381763 | Ga0495613_0381763_514_717 | 67 |
| 1318 | 3300046689 | Ga0495613_0386688 | Ga0495613_0386688_699_917 | 67 |
| 1319 | 3300046689 | Ga0495613_0463783 | Ga0495613_0463783_199_426 | 67 |
| 1320 | 3300046690 | Ga0495624_0308077 | Ga0495624_0308077_232_435 | 67 |
| 1321 | 3300046690 | Ga0495624_0508779 | Ga0495624_0508779_381_587 | 67 |
| 1322 | 3300046690 | Ga0495624_0778555 | Ga0495624_0778555_230_433 | 67 |
| 1323 | 3300046690 | Ga0495624_0894089 | Ga0495624_0894089_31_249 | 67 |
| 1324 | 3300046690 | Ga0495624_0919858 | Ga0495624_0919858_119_322 | 67 |
| 1325 | 3300046692 | Ga0495671_0555448 | Ga0495671_0555448_218_421 | 67 |
| 1326 | 3300046809 | Ga0495600_0595268 | Ga0495600_0595268_451_654 | 67 |
| 1327 | 3300046809 | Ga0495600_0807626 | Ga0495600_0807626_127_330 | 67 |
| 1328 | 3300047315 | Ga0495581_0081281 | Ga0495581_0081281_1308_1511 | 67 |
| 1329 | 3300047317 | Ga0495604_0053697 | Ga0495604_0053697_2732_2935 | 67 |
| 1330 | 3300047317 | Ga0495604_0288710 | Ga0495604_0288710_772_975 | 67 |
| 1331 | 3300047317 | Ga0495604_0331125 | Ga0495604_0331125_427_639 | 67 |
| 1332 | 3300047317 | Ga0495604_0378222 | Ga0495604_0378222_500_727 | 67 |
| 1333 | 3300047318 | Ga0495636_0151276 | Ga0495636_0151276_337_540 | 67 |
| 1334 | 3300047319 | Ga0495674_0195915 | Ga0495674_0195915_1046_1258 | 67 |
| 1335 | 3300047319 | Ga0495674_0400841 | Ga0495674_0400841_166_369 | 67 |
| 1336 | 3300047319 | Ga0495674_0599809 | Ga0495674_0599809_494_697 | 67 |
| 1337 | 3300047319 | Ga0495674_0882155 | Ga0495674_0882155_296_523 | 67 |
| 1338 | 3300047321 | Ga0495676_0261423 | Ga0495676_0261423_682_885 | 67 |
| 1339 | 3300047321 | Ga0495676_0315817 | Ga0495676_0315817_362_565 | 67 |
| 1340 | 3300047321 | Ga0495676_0394561 | Ga0495676_0394561_254_457 | 67 |
| 1341 | 3300047322 | Ga0495680_0209613 | Ga0495680_0209613_400_603 | 67 |
| 1342 | 3300047444 | Ga0495675_0002584 | Ga0495675_0002584_9184_9411 | 67 |
| 1343 | 3300047444 | Ga0495675_0044543 | Ga0495675_0044543_192_395 | 67 |
| 1344 | 3300047447 | Ga0495685_086151 | Ga0495685_086151_707_910 | 67 |
| 1345 | 3300047471 | Ga0495684_0029134 | Ga0495684_0029134_1951_2178 | 67 |
| 1346 | 3300047471 | Ga0495684_0064236 | Ga0495684_0064236_968_1171 | 67 |
| 1347 | 3300047471 | Ga0495684_0218935 | Ga0495684_0218935_80_286 | 67 |
| 1348 | 3300048088 | Ga0495602_0109432 | Ga0495602_0109432_1690_1917 | 67 |
| 1349 | 3300048088 | Ga0495602_0121992 | Ga0495602_0121992_392_595 | 67 |
| 1350 | 3300048088 | Ga0495602_0593907 | Ga0495602_0593907_234_437 | 67 |
| 1351 | 3300048088 | Ga0495602_0977255 | Ga0495602_0977255_162_365 | 67 |
| 1352 | 3300048090 | Ga0495615_0317945 | Ga0495615_0317945_223_441 | 67 |
| 1353 | 3300048091 | Ga0495626_0170422 | Ga0495626_0170422_318_521 | 67 |
| 1354 | 3300048903 | Ga0496100_0253997 | Ga0496100_0253997_762_965 | 67 |
| 1355 | 3300048903 | Ga0496100_0998686 | Ga0496100_0998686_337_540 | 67 |
| 1356 | 3300048904 | Ga0496101_0033960 | Ga0496101_0033960_866_1069 | 67 |
| 1357 | 3300048904 | Ga0496101_0120036 | Ga0496101_0120036_1582_1785 | 67 |
| 1358 | 3300048904 | Ga0496101_0244550 | Ga0496101_0244550_946_1149 | 67 |
| 1359 | 3300048904 | Ga0496101_0420246 | Ga0496101_0420246_175_378 | 67 |
| 1360 | 3300048904 | Ga0496101_1119624 | Ga0496101_1119624_271_474 | 67 |
| 1361 | 3300048905 | Ga0496102_0028763 | Ga0496102_0028763_4111_4314 | 67 |
| 1362 | 3300048905 | Ga0496102_0035336 | Ga0496102_0035336_2246_2449 | 67 |
| 1363 | 3300048905 | Ga0496102_0081398 | Ga0496102_0081398_1750_1953 | 67 |
| 1364 | 3300048905 | Ga0496102_0120716 | Ga0496102_0120716_915_1118 | 67 |
| 1365 | 3300048905 | Ga0496102_0712924 | Ga0496102_0712924_347_550 | 67 |
| 1366 | 3300048905 | Ga0496102_0809927 | Ga0496102_0809927_221_424 | 67 |
| 1367 | 3300048906 | Ga0496103_0220069 | Ga0496103_0220069_876_1079 | 67 |
| 1368 | 3300048906 | Ga0496103_0242836 | Ga0496103_0242836_452_655 | 67 |
| 1369 | 3300048906 | Ga0496103_0393747 | Ga0496103_0393747_285_488 | 67 |
| 1370 | 3300048907 | Ga0496104_0102699 | Ga0496104_0102699_1840_2043 | 67 |
| 1371 | 3300048907 | Ga0496104_0108532 | Ga0496104_0108532_1448_1660 | 67 |
| 1372 | 3300048907 | Ga0496104_0136889 | Ga0496104_0136889_1307_1510 | 67 |
| 1373 | 3300048907 | Ga0496104_0168761 | Ga0496104_0168761_1816_2037 | 67 |
| 1374 | 3300048907 | Ga0496104_0699020 | Ga0496104_0699020_610_813 | 67 |
| 1375 | 3300048907 | Ga0496104_1609662 | Ga0496104_1609662_305_508 | 67 |
| 1376 | 3300048908 | Ga0496105_0014160 | Ga0496105_0014160_1728_1931 | 67 |
| 1377 | 3300048908 | Ga0496105_0201100 | Ga0496105_0201100_463_666 | 67 |
| 1378 | 3300048908 | Ga0496105_0228200 | Ga0496105_0228200_380_583 | 67 |
| 1379 | 3300048908 | Ga0496105_0424240 | Ga0496105_0424240_529_732 | 67 |
| 1380 | 3300048908 | Ga0496105_1023973 | Ga0496105_1023973_380_586 | 67 |
| 1381 | 3300048909 | Ga0496106_0181663 | Ga0496106_0181663_870_1073 | 67 |
| 1382 | 3300048909 | Ga0496106_0669279 | Ga0496106_0669279_226_429 | 67 |
| 1383 | 3300048909 | Ga0496106_1489843 | Ga0496106_1489843_41_262 | 67 |
| 1384 | 3300048910 | Ga0496107_0515995 | Ga0496107_0515995_238_441 | 67 |
| 1385 | 3300048910 | Ga0496107_0701611 | Ga0496107_0701611_264_467 | 67 |
| 1386 | 3300048911 | Ga0496108_0227271 | Ga0496108_0227271_529_735 | 67 |
| 1387 | 3300048911 | Ga0496108_0289492 | Ga0496108_0289492_1006_1209 | 67 |
| 1388 | 3300048911 | Ga0496108_0385699 | Ga0496108_0385699_891_1094 | 67 |
| 1389 | 3300048911 | Ga0496108_0735373 | Ga0496108_0735373_448_651 | 67 |
| 1390 | 3300048911 | Ga0496108_1474427 | Ga0496108_1474427_71_277 | 67 |
| 1391 | 3300048912 | Ga0496109_0007242 | Ga0496109_0007242_8689_8892 | 67 |
| 1392 | 3300048912 | Ga0496109_0063355 | Ga0496109_0063355_2138_2341 | 67 |
| 1393 | 3300048912 | Ga0496109_0402868 | Ga0496109_0402868_125_328 | 67 |
| 1394 | 3300048912 | Ga0496109_0427849 | Ga0496109_0427849_967_1170 | 67 |
| 1395 | 3300048912 | Ga0496109_0583767 | Ga0496109_0583767_292_513 | 67 |
| 1396 | 3300048912 | Ga0496109_0661893 | Ga0496109_0661893_566_772 | 67 |
| 1397 | 3300048912 | Ga0496109_1264628 | Ga0496109_1264628_77_280 | 67 |
| 1398 | 3300048913 | Ga0496110_0085553 | Ga0496110_0085553_1610_1813 | 67 |
| 1399 | 3300048913 | Ga0496110_0167148 | Ga0496110_0167148_1116_1337 | 67 |
| 1400 | 3300048913 | Ga0496110_0348670 | Ga0496110_0348670_379_582 | 67 |
| 1401 | 3300048913 | Ga0496110_0504270 | Ga0496110_0504270_268_471 | 67 |
| 1402 | 3300048913 | Ga0496110_0957120 | Ga0496110_0957120_330_533 | 67 |
| 1403 | 3300048914 | Ga0496111_0162316 | Ga0496111_0162316_1240_1443 | 67 |
| 1404 | 3300048914 | Ga0496111_1002304 | Ga0496111_1002304_145_348 | 67 |
| 1405 | 3300048915 | Ga0496112_0190669 | Ga0496112_0190669_1472_1675 | 67 |
| 1406 | 3300048915 | Ga0496112_0221378 | Ga0496112_0221378_673_894 | 67 |
| 1407 | 3300048915 | Ga0496112_0223765 | Ga0496112_0223765_559_762 | 67 |
| 1408 | 3300048915 | Ga0496112_0245973 | Ga0496112_0245973_1206_1409 | 67 |
| 1409 | 3300048915 | Ga0496112_0320945 | Ga0496112_0320945_973_1176 | 67 |
| 1410 | 3300048915 | Ga0496112_0360815 | Ga0496112_0360815_777_980 | 67 |
| 1411 | 3300048915 | Ga0496112_0394307 | Ga0496112_0394307_1022_1225 | 67 |
| 1412 | 3300048915 | Ga0496112_1117331 | Ga0496112_1117331_160_363 | 67 |
| 1413 | 3300048916 | Ga0496113_0069914 | Ga0496113_0069914_19_222 | 67 |
| 1414 | 3300048916 | Ga0496113_0102219 | Ga0496113_0102219_1689_1892 | 67 |
| 1415 | 3300048916 | Ga0496113_0565248 | Ga0496113_0565248_136_357 | 67 |
| 1416 | 3300048916 | Ga0496113_0630181 | Ga0496113_0630181_639_842 | 67 |
| 1417 | 3300048916 | Ga0496113_0916518 | Ga0496113_0916518_38_241 | 67 |
| 1418 | 3300048916 | Ga0496113_1029711 | Ga0496113_1029711_200_403 | 67 |
| 1419 | 3300048917 | Ga0496114_0012997 | Ga0496114_0012997_4107_4319 | 67 |
| 1420 | 3300048917 | Ga0496114_0035218 | Ga0496114_0035218_697_900 | 67 |
| 1421 | 3300048917 | Ga0496114_0115165 | Ga0496114_0115165_1374_1577 | 67 |
| 1422 | 3300048917 | Ga0496114_0533694 | Ga0496114_0533694_591_812 | 67 |
| 1423 | 3300048917 | Ga0496114_0582057 | Ga0496114_0582057_252_455 | 67 |
| 1424 | 3300048917 | Ga0496114_0598799 | Ga0496114_0598799_264_467 | 67 |
| 1425 | 3300048918 | Ga0496115_0002575 | Ga0496115_0002575_7794_7997 | 67 |
| 1426 | 3300048918 | Ga0496115_0004314 | Ga0496115_0004314_5976_6188 | 67 |
| 1427 | 3300048918 | Ga0496115_0026271 | Ga0496115_0026271_1931_2134 | 67 |
| 1428 | 3300048918 | Ga0496115_0128133 | Ga0496115_0128133_1460_1663 | 67 |
| 1429 | 3300048918 | Ga0496115_0294208 | Ga0496115_0294208_865_1068 | 67 |
| 1430 | 3300048918 | Ga0496115_0387746 | Ga0496115_0387746_650_853 | 67 |
| 1431 | 3300048918 | Ga0496115_1437681 | Ga0496115_1437681_80_283 | 67 |
| 1432 | 3300049584 | Ga0501068_0449667 | Ga0501068_0449667_47_250 | 67 |
| 1433 | 3300049585 | Ga0501069_0570360 | Ga0501069_0570360_346_549 | 67 |
| 1434 | 3300050507 | nmdc:mga05p37_135223_c1 | nmdc:mga05p37_135223_c1_80_283 | 67 |
| 1435 | 3300050507 | nmdc:mga05p37_2087035_c1 | nmdc:mga05p37_2087035_c1_13_216 | 67 |
| 1436 | 3300050507 | nmdc:mga05p37_2090916_c1 | nmdc:mga05p37_2090916_c1_265_468 | 67 |
| 1437 | 3300050507 | nmdc:mga05p37_35285_c2 | nmdc:mga05p37_35285_c2_3526_3729 | 67 |
| 1438 | 3300050507 | nmdc:mga05p37_473501_c1 | nmdc:mga05p37_473501_c1_935_1141 | 67 |
| 1439 | 3300050510 | nmdc:mga06r32_971239_c1 | nmdc:mga06r32_971239_c1_408_614 | 67 |
| 1440 | 3300050511 | nmdc:mga08y16_1099761_c1 | nmdc:mga08y16_1099761_c1_301_504 | 67 |
| 1441 | 3300050511 | nmdc:mga08y16_1770500_c1 | nmdc:mga08y16_1770500_c1_352_555 | 67 |
| 1442 | 3300050511 | nmdc:mga08y16_247448_c1 | nmdc:mga08y16_247448_c1_397_603 | 67 |
| 1443 | 3300050511 | nmdc:mga08y16_738675_c1 | nmdc:mga08y16_738675_c1_249_452 | 67 |
| 1444 | 3300050511 | nmdc:mga08y16_811526_c1 | nmdc:mga08y16_811526_c1_180_383 | 67 |
| 1445 | 3300050512 | nmdc:mga0n895_1162717_c1 | nmdc:mga0n895_1162717_c1_425_628 | 67 |
| 1446 | 3300050512 | nmdc:mga0n895_1466075_c1 | nmdc:mga0n895_1466075_c1_238_441 | 67 |
| 1447 | 3300050512 | nmdc:mga0n895_212360_c1 | nmdc:mga0n895_212360_c1_127_330 | 67 |
| 1448 | 3300050512 | nmdc:mga0n895_233774_c1 | nmdc:mga0n895_233774_c1_864_1067 | 67 |
| 1449 | 3300050512 | nmdc:mga0n895_759064_c1 | nmdc:mga0n895_759064_c1_562_765 | 67 |
| 1450 | 3300050513 | nmdc:mga0rr50_1203860_c1 | nmdc:mga0rr50_1203860_c1_301_504 | 67 |
| 1451 | 3300050513 | nmdc:mga0rr50_383536_c1 | nmdc:mga0rr50_383536_c1_936_1139 | 67 |
| 1452 | 3300050514 | nmdc:mga08x19_28098_c1 | nmdc:mga08x19_28098_c1_421_654 | 67 |
| 1453 | 3300050514 | nmdc:mga08x19_520835_c1 | nmdc:mga08x19_520835_c1_373_606 | 67 |
| 1454 | 3300050514 | nmdc:mga08x19_631307_c1 | nmdc:mga08x19_631307_c1_294_497 | 67 |
| 1455 | 3300050515 | nmdc:mga0a205_1135164_c1 | nmdc:mga0a205_1135164_c1_294_497 | 67 |
| 1456 | 3300050515 | nmdc:mga0a205_415093_c1 | nmdc:mga0a205_415093_c1_137_340 | 67 |
| 1457 | 3300053077 | Ga0495601_0001921 | Ga0495601_0001921_4752_4955 | 67 |
| 1458 | 3300053077 | Ga0495601_0027550 | Ga0495601_0027550_1989_2216 | 67 |
| 1459 | 3300053077 | Ga0495601_0292224 | Ga0495601_0292224_295_498 | 67 |
| 1460 | 3300053078 | Ga0495612_0031116 | Ga0495612_0031116_52_255 | 67 |
| 1461 | 3300053083 | Ga0495655_0145261 | Ga0495655_0145261_182_385 | 67 |
| 1462 | 3300053084 | Ga0495595_0035542 | Ga0495595_0035542_1489_1716 | 67 |
| 1463 | 3300053084 | Ga0495595_0039367 | Ga0495595_0039367_1455_1658 | 67 |
| 1464 | 3300053084 | Ga0495595_0090399 | Ga0495595_0090399_798_1001 | 67 |
| 1465 | 3300053084 | Ga0495595_0431575 | Ga0495595_0431575_295_498 | 67 |
| 1466 | 3300053085 | Ga0495619_0083552 | Ga0495619_0083552_1483_1710 | 67 |
| 1467 | 3300053085 | Ga0495619_0164194 | Ga0495619_0164194_372_575 | 67 |
| 1468 | 3300053085 | Ga0495619_0259855 | Ga0495619_0259855_408_611 | 67 |
| 1469 | 3300053085 | Ga0495619_0272881 | Ga0495619_0272881_184_387 | 67 |
| 1470 | 3300053125 | Ga0500618_058191 | Ga0500618_058191_176_379 | 67 |
| 1471 | 3300053177 | Ga0500636_0323809 | Ga0500636_0323809_169_372 | 67 |
| 1472 | 3300053728 | Ga0500657_161662 | Ga0500657_161662_214_417 | 67 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6qul-assembly1.cif.gz_Z | structure of a bacterial 50s ribosomal subunit in complex with the novel quinoxolidinone antibiotic cadazolid | 0.9809 | 2 | 60 |
| 7nww-assembly1.cif.gz_X | cspa-27 cotranslational folding intermediate 1 | 0.9806 | 2 | 60 |
| 5o60-assembly1.cif.gz_Z | structure of the 50s large ribosomal subunit from mycobacterium smegmatis | 0.9783 | 1 | 61 |
| 6fxc-assembly1.cif.gz_AW | the cryo-em structure of hibernating 100s ribosome dimer from pathogenic staphylococcus aureus | 0.9776 | 2 | 65 |
| 8a57-assembly1.cif.gz_2 | cryo-em structure of hflxr bound to the listeria monocytogenes 50s ribosomal subunit. | 0.9776 | 4 | 60 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4wf9V00 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins; | 0.9724 | 9 | 65 | 1.10.287.310 |
| 1vq5V00 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins; | 0.9596 | 1 | 60 | 1.10.287.310 |
| 4hubV00 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins; | 0.9582 | 1 | 60 | 1.10.287.310 |
| 3cclV00 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins; | 0.9582 | 1 | 60 | 1.10.287.310 |
| 1jj2U00 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins; | 0.9581 | 1 | 60 | 1.10.287.310 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A554LL71-F1-model_v4 | Large ribosomal subunit protein uL29 | 1.002 | 3 | 64 |
GO:0003735
GO:0005840 GO:0006412 GO:1990904 |
| AF-A0A7C5YCB5-F1-model_v4 | Large ribosomal subunit protein uL29 | 0.9962 | 3 | 61 |
GO:0003735
GO:0006412 GO:0022625 |
| AF-A0A849J2I1-F1-model_v4 | Large ribosomal subunit protein uL29 | 0.9958 | 1 | 60 |
GO:0003735
GO:0006412 GO:0022625 |
| AF-A0A1F7U7H3-F1-model_v4 | Large ribosomal subunit protein uL29 | 0.9954 | 2 | 66 |
GO:0003735
GO:0005840 GO:0006412 GO:1990904 |
| AF-A0A7V3XB59-F1-model_v4 | Large ribosomal subunit protein uL29 | 0.9934 | 1 | 65 |
GO:0003735
GO:0006412 GO:0022625 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar