F494217

General Info

Members Datasets Scaffolds Average Seq Length
1472 359 1472 68

Family's Representative Sequence

Representative Sequence 3300006175|Ga0070712_101141531|Ga0070712_1011415312
Length 80
Sequence MNMKIKEIVEMSTDELLTKRRDLRQERLHLRLQQQSGQLEQPSRLRLIRRDVARIETILSRRAKQPQTIPAEDPKAKKNK

Samples

Sample ID Description Type Environment
1 2044078001 Maize rhizosphere soil microbial communities from University of Illinois Energy Farm, Urbana, IL Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
4 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
5 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
6 3300005277 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) Metagenome Rhizosphere
7 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
9 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
10 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
12 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
13 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
14 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
15 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
16 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
17 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
18 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
19 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
20 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
21 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
22 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
23 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
24 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
25 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
26 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
27 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
28 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
29 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
30 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
31 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
32 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
33 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
34 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
35 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
36 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
37 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
38 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
39 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
40 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
41 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
42 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
43 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
44 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
45 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
46 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
47 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
48 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
49 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
50 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
51 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
52 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
53 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
54 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
55 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
56 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
57 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
58 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
59 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
60 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
61 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
62 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
63 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
64 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
65 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
66 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
67 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
68 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
69 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
70 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
71 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
72 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
73 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
74 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
75 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
76 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
77 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
78 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
79 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
80 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
81 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
82 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
83 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
84 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
85 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
86 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
87 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
88 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
89 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
90 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
91 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
92 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
93 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
94 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
95 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
96 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
97 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
98 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
99 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
100 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
101 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
102 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
103 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
104 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
105 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
106 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
107 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
108 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
109 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
110 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
111 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
112 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
113 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
114 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
115 3300012476 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.yng.070610 Metagenome Rhizosphere
116 3300012488 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.yng.030610 Metagenome Rhizosphere
117 3300012505 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 Metagenome Rhizosphere
118 3300012506 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 Metagenome Rhizosphere
119 3300012508 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 Metagenome Rhizosphere
120 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
121 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
122 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
123 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
124 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
125 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
126 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
127 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
128 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
129 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
130 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
131 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
132 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
133 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
134 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
135 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
136 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
137 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
139 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
201 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
202 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
203 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
204 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
205 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
209 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
210 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
211 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
212 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
213 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
214 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
215 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
216 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
217 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
218 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
219 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
220 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
221 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
222 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
223 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
224 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
225 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
226 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
227 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
228 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
229 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
230 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
231 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
232 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
233 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
234 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
235 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
236 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
237 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
238 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
239 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
240 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
241 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
242 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
243 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
244 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
245 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
246 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
247 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
248 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
249 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
250 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
251 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
252 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
253 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
254 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
255 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
256 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
257 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
258 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
259 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
260 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
261 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
262 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
263 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
264 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
265 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
266 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
267 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
268 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
269 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
270 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
271 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
272 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
273 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
274 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
275 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
276 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
277 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
278 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
279 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
280 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
281 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
282 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
283 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
284 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
285 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
286 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
287 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
288 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
289 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
290 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
291 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
292 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
293 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
294 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
295 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
296 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
297 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
298 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
299 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
300 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
301 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
302 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
303 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
304 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
305 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
306 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
307 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
308 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
309 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
310 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
311 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
312 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
313 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
314 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
315 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
316 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
317 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
318 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
319 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
320 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
321 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
322 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
323 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
324 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
325 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
326 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
327 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
328 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
329 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
330 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
331 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
332 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
333 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
334 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
335 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
336 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
337 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
338 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
339 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
340 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
341 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
342 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
343 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
344 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
345 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
346 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
347 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
348 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
349 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
350 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
351 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
352 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
353 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
354 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
355 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
356 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
357 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
358 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
359 3300053728 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.2
Nodule 0
Rhizoplane 8.08
Rhizosphere 90.83
Stem 0
Stem Tuber 0
Unclassified 0.88

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 ZMR_F548DK201AME5Z 2044078001 Unclassified 511
2 SwRhRL2b_contig_2037418 2162886007 Unclassified 992
3 SwRhRL2b_contig_3078803 2162886007 Bacteria 880
4 SwRhRL2b_contig_3458674 2162886007 Unclassified 809
5 JGI24035J26624_1000389 3300002126 Bacteria 4130
6 JGI24742J22300_10028513 3300002244 Unclassified 969
7 JGI25406J46586_10000001 3300003203 Bacteria 251772
8 JGI25406J46586_10000007 3300003203 Bacteria 112227
9 Ga0065716_1018288 3300005277 Unclassified 527
10 Ga0065714_10128472 3300005288 Bacteria 1273
11 Ga0065704_10002652 3300005289 Bacteria 8381
12 Ga0065704_10048094 3300005289 Unclassified 1016
13 Ga0065704_10097735 3300005289 Bacteria 2319
14 Ga0065704_10282058 3300005289 Unclassified 920
15 Ga0065704_10306099 3300005289 Unclassified 859
16 Ga0065704_10557056 3300005289 Unclassified 620
17 Ga0065704_10850442 3300005289 Unclassified 509
18 Ga0065712_10015466 3300005290 Unclassified 2442
19 Ga0065712_10072999 3300005290 Bacteria 4536
20 Ga0065712_10092159 3300005290 Bacteria 2342
21 Ga0065712_10121918 3300005290 Bacteria 1658
22 Ga0065712_10122169 3300005290 Bacteria 1655
23 Ga0065712_10143777 3300005290 Bacteria 1426
24 Ga0065712_10255670 3300005290 Unclassified 902
25 Ga0065712_10320047 3300005290 Bacteria 830
26 Ga0065712_10366731 3300005290 Bacteria 768
27 Ga0065712_10386138 3300005290 Unclassified 733
28 Ga0065712_10558980 3300005290 Unclassified 613
29 Ga0065712_10597168 3300005290 Unclassified 592
30 Ga0065715_10005591 3300005293 Bacteria 4285
31 Ga0065715_10006003 3300005293 Bacteria 6856
32 Ga0065715_10024370 3300005293 Unclassified 1667
33 Ga0065715_10067002 3300005293 Unclassified 701
34 Ga0065715_10114421 3300005293 Bacteria 2451
35 Ga0065715_10121633 3300005293 Bacteria 2220
36 Ga0065715_10132257 3300005293 Bacteria 1993
37 Ga0065715_10288996 3300005293 Bacteria 1067
38 Ga0065715_10375137 3300005293 Unclassified 911
39 Ga0065715_10389010 3300005293 Bacteria 842
40 Ga0065715_10663438 3300005293 Unclassified 663
41 Ga0065715_10884699 3300005293 Bacteria 580
42 Ga0065707_10007089 3300005295 Bacteria 2422
43 Ga0065707_10011219 3300005295 Bacteria 1812
44 Ga0065707_10470003 3300005295 Unclassified 783
45 Ga0065707_11009080 3300005295 Unclassified 537
46 Ga0070658_10132680 3300005327 Unclassified 2076
47 Ga0070658_11720638 3300005327 Unclassified 543
48 Ga0070676_10023068 3300005328 Bacteria 3496
49 Ga0070676_10023857 3300005328 Bacteria 3441
50 Ga0070676_10031330 3300005328 Bacteria 3038
51 Ga0070676_10032758 3300005328 Bacteria 2979
52 Ga0070676_10328254 3300005328 Bacteria 1045
53 Ga0070676_10356560 3300005328 Bacteria 1007
54 Ga0070676_10441948 3300005328 Bacteria 913
55 Ga0070676_10446245 3300005328 Bacteria 909
56 Ga0070676_10526310 3300005328 Unclassified 843
57 Ga0070683_100014620 3300005329 Bacteria 6873
58 Ga0070683_100054847 3300005329 Bacteria 3696
59 Ga0070683_100200119 3300005329 Unclassified 1897
60 Ga0070683_100221173 3300005329 Bacteria 1800
61 Ga0070683_101010997 3300005329 Bacteria 798
62 Ga0070683_101271548 3300005329 Bacteria 707
63 Ga0070690_100187280 3300005330 Bacteria 1433
64 Ga0070690_100295354 3300005330 Bacteria 1160
65 Ga0070690_100556303 3300005330 Unclassified 866
66 Ga0070670_100000833 3300005331 Bacteria 24086
67 Ga0070670_100003742 3300005331 Bacteria 12666
68 Ga0070670_100068156 3300005331 Bacteria 3054
69 Ga0070670_100260744 3300005331 Unclassified 1511
70 Ga0070670_100414170 3300005331 Bacteria 1191
71 Ga0070670_100586363 3300005331 Bacteria 997
72 Ga0070670_100926530 3300005331 Bacteria 791
73 Ga0070677_10566592 3300005333 Unclassified 625
74 Ga0068869_100412385 3300005334 Bacteria 1113
75 Ga0068869_101792838 3300005334 Unclassified 549
76 Ga0070666_10002056 3300005335 Bacteria 12212
77 Ga0070666_10037434 3300005335 Bacteria 3225
78 Ga0070666_10130584 3300005335 Bacteria 1745
79 Ga0070666_10436454 3300005335 Unclassified 945
80 Ga0070666_10827198 3300005335 Bacteria 683
81 Ga0070666_11014759 3300005335 Unclassified 616
82 Ga0070682_100289295 3300005337 Bacteria 1198
83 Ga0070682_101382440 3300005337 Unclassified 601
84 Ga0068868_100031931 3300005338 Bacteria 4048
85 Ga0068868_100059779 3300005338 Bacteria 3015
86 Ga0068868_100082469 3300005338 Bacteria 2579
87 Ga0068868_100097448 3300005338 Unclassified 2377
88 Ga0068868_100201460 3300005338 Bacteria 1659
89 Ga0068868_100333449 3300005338 Bacteria 1295
90 Ga0068868_100523091 3300005338 Bacteria 1042
91 Ga0068868_101144047 3300005338 Bacteria 718
92 Ga0070660_100408877 3300005339 Bacteria 1123
93 Ga0070660_100989587 3300005339 Unclassified 710
94 Ga0070660_101370569 3300005339 Unclassified 601
95 Ga0070689_100009585 3300005340 Bacteria 6870
96 Ga0070689_100083277 3300005340 Bacteria 2514
97 Ga0070689_100161584 3300005340 Bacteria 1811
98 Ga0070689_100308993 3300005340 Bacteria 1318
99 Ga0070689_101513560 3300005340 Unclassified 608
100 Ga0070689_102155027 3300005340 Unclassified 511
101 Ga0070687_100000382 3300005343 Bacteria 15047
102 Ga0070687_100216105 3300005343 Bacteria 1171
103 Ga0070687_100711471 3300005343 Unclassified 703
104 Ga0070687_100806730 3300005343 Unclassified 665
105 Ga0070661_100081299 3300005344 Bacteria 2392
106 Ga0070661_100120618 3300005344 Bacteria 1964
107 Ga0070661_100930326 3300005344 Bacteria 719
108 Ga0070661_101207687 3300005344 Unclassified 633
109 Ga0070661_101588495 3300005344 Bacteria 553
110 Ga0070692_11164096 3300005345 Unclassified 547
111 Ga0070668_100000403 3300005347 Bacteria 28684
112 Ga0070668_100004836 3300005347 Bacteria 9989
113 Ga0070668_100056885 3300005347 Bacteria 3021
114 Ga0070668_100120521 3300005347 Bacteria 2096
115 Ga0070668_100379489 3300005347 Bacteria 1202
116 Ga0070668_100519859 3300005347 Bacteria 1033
117 Ga0070669_100002011 3300005353 Bacteria 14710
118 Ga0070669_100006097 3300005353 Bacteria 8698
119 Ga0070669_100049923 3300005353 Bacteria 3055
120 Ga0070669_100064706 3300005353 Bacteria 2693
121 Ga0070669_100080338 3300005353 Bacteria 2427
122 Ga0070669_100746041 3300005353 Bacteria 829
123 Ga0070669_101543803 3300005353 Unclassified 578
124 Ga0070675_100004678 3300005354 Bacteria 10447
125 Ga0070675_100063526 3300005354 Bacteria 3052
126 Ga0070675_100087471 3300005354 Unclassified 2606
127 Ga0070675_100182810 3300005354 Bacteria 1813
128 Ga0070675_100277633 3300005354 Unclassified 1472
129 Ga0070675_100376792 3300005354 Bacteria 1262
130 Ga0070675_100638029 3300005354 Unclassified 967
131 Ga0070675_101142101 3300005354 Unclassified 717
132 Ga0070675_101652152 3300005354 Bacteria 591
133 Ga0070671_100000283 3300005355 Bacteria 34469
134 Ga0070671_100011495 3300005355 Bacteria 7116
135 Ga0070671_100042031 3300005355 Bacteria 3799
136 Ga0070671_100054306 3300005355 Bacteria 3331
137 Ga0070671_100149154 3300005355 Unclassified 1974
138 Ga0070671_100187094 3300005355 Bacteria 1755
139 Ga0070671_100198585 3300005355 Unclassified 1701
140 Ga0070671_100731117 3300005355 Unclassified 859
141 Ga0070671_100872664 3300005355 Bacteria 785
142 Ga0070671_101666516 3300005355 Unclassified 566
143 Ga0070671_101823379 3300005355 Bacteria 541
144 Ga0070671_101827865 3300005355 Unclassified 540
145 Ga0070674_100000912 3300005356 Bacteria 15424
146 Ga0070674_100007500 3300005356 Bacteria 6436
147 Ga0070674_100064029 3300005356 Bacteria 2575
148 Ga0070674_100297400 3300005356 Unclassified 1285
149 Ga0070674_100341788 3300005356 Unclassified 1206
150 Ga0070674_100414870 3300005356 Bacteria 1103
151 Ga0070673_100008141 3300005364 Bacteria 6955
152 Ga0070673_100017182 3300005364 Bacteria 5136
153 Ga0070673_100159647 3300005364 Bacteria 1916
154 Ga0070673_100235191 3300005364 Unclassified 1591
155 Ga0070673_100999699 3300005364 Unclassified 779
156 Ga0070673_101564425 3300005364 Bacteria 622
157 Ga0070673_102383003 3300005364 Unclassified 503
158 Ga0070673_102403155 3300005364 Unclassified 501
159 Ga0070688_100000733 3300005365 Bacteria 16191
160 Ga0070688_100001414 3300005365 Bacteria 11953
161 Ga0070688_100139371 3300005365 Bacteria 1645
162 Ga0070688_100347104 3300005365 Bacteria 1086
163 Ga0070659_100002483 3300005366 Bacteria 13098
164 Ga0070659_100051342 3300005366 Bacteria 3242
165 Ga0070659_100326979 3300005366 Bacteria 1282
166 Ga0070659_100591895 3300005366 Unclassified 952
167 Ga0070659_100648570 3300005366 Bacteria 910
168 Ga0070659_100774997 3300005366 Unclassified 833
169 Ga0070667_100004665 3300005367 Bacteria 11504
170 Ga0070667_100103912 3300005367 Unclassified 2456
171 Ga0070667_100196145 3300005367 Bacteria 1790
172 Ga0070667_100392191 3300005367 Bacteria 1262
173 Ga0070667_100408504 3300005367 Bacteria 1237
174 Ga0070667_100565364 3300005367 Bacteria 1046
175 Ga0070667_100773818 3300005367 Unclassified 890
176 Ga0070703_10152115 3300005406 Unclassified 870
177 Ga0070703_10376251 3300005406 Unclassified 612
178 Ga0070709_10026650 3300005434 Bacteria 3428
179 Ga0070709_10042905 3300005434 Bacteria 2795
180 Ga0070709_10232892 3300005434 Bacteria 1319
181 Ga0070709_10238921 3300005434 Unclassified 1304
182 Ga0070709_10630820 3300005434 Bacteria 828
183 Ga0070709_10852976 3300005434 Bacteria 718
184 Ga0070709_11054064 3300005434 Bacteria 649
185 Ga0070709_11313628 3300005434 Unclassified 584
186 Ga0070709_11469253 3300005434 Unclassified 553
187 Ga0070714_100054897 3300005435 Bacteria 3404
188 Ga0070714_100477608 3300005435 Unclassified 1187
189 Ga0070714_100493973 3300005435 Bacteria 1166
190 Ga0070714_100917821 3300005435 Unclassified 850
191 Ga0070714_100959005 3300005435 Unclassified 831
192 Ga0070714_100961468 3300005435 Bacteria 830
193 Ga0070714_101213946 3300005435 Unclassified 736
194 Ga0070714_101950425 3300005435 Unclassified 573
195 Ga0070714_102051069 3300005435 Unclassified 558
196 Ga0070714_102423308 3300005435 Unclassified 510
197 Ga0070713_100019600 3300005436 Bacteria 5170
198 Ga0070713_100040250 3300005436 Bacteria 3798
199 Ga0070713_100219364 3300005436 Bacteria 1725
200 Ga0070713_100702222 3300005436 Bacteria 966
201 Ga0070713_101618955 3300005436 Bacteria 628
202 Ga0070710_10079151 3300005437 Bacteria 1914
203 Ga0070710_10086739 3300005437 Bacteria 1838
204 Ga0070710_10136630 3300005437 Unclassified 1499
205 Ga0070710_10505510 3300005437 Bacteria 828
206 Ga0070710_10998595 3300005437 Unclassified 610
207 Ga0070710_11322454 3300005437 Unclassified 536
208 Ga0070701_10288547 3300005438 Bacteria 1004
209 Ga0070701_10410151 3300005438 Unclassified 860
210 Ga0070711_100005001 3300005439 Bacteria 7876
211 Ga0070711_100078511 3300005439 Bacteria 2345
212 Ga0070711_100098324 3300005439 Bacteria 2124
213 Ga0070711_100120740 3300005439 Bacteria 1938
214 Ga0070711_100530968 3300005439 Bacteria 974
215 Ga0070711_100647742 3300005439 Unclassified 885
216 Ga0070711_100718031 3300005439 Bacteria 842
217 Ga0070711_101022999 3300005439 Unclassified 709
218 Ga0070711_101968767 3300005439 Unclassified 514
219 Ga0070711_102000964 3300005439 Unclassified 510
220 Ga0070705_100035279 3300005440 Bacteria 2802
221 Ga0070705_100098129 3300005440 Bacteria 1843
222 Ga0070705_100176112 3300005440 Bacteria 1444
223 Ga0070705_100300175 3300005440 Unclassified 1150
224 Ga0070705_100332086 3300005440 Bacteria 1102
225 Ga0070705_101002997 3300005440 Unclassified 678
226 Ga0070700_100003660 3300005441 Bacteria 7944
227 Ga0070700_100458768 3300005441 Unclassified 971
228 Ga0070694_100047799 3300005444 Bacteria 2877
229 Ga0070694_100206737 3300005444 Bacteria 1466
230 Ga0070708_100003581 3300005445 Bacteria 12183
231 Ga0070708_100057410 3300005445 Bacteria 3465
232 Ga0070708_100071203 3300005445 Bacteria 3129
233 Ga0070708_100094148 3300005445 Bacteria 2733
234 Ga0070708_100109539 3300005445 Bacteria 2537
235 Ga0070708_100147839 3300005445 Bacteria 2184
236 Ga0070708_100204579 3300005445 Bacteria 1849
237 Ga0070708_100372965 3300005445 Unclassified 1345
238 Ga0070708_100469463 3300005445 Bacteria 1187
239 Ga0070708_100700962 3300005445 Bacteria 953
240 Ga0070708_100856679 3300005445 Unclassified 854
241 Ga0070708_100958394 3300005445 Unclassified 803
242 Ga0070708_101967356 3300005445 Unclassified 541
243 Ga0070663_100524402 3300005455 Bacteria 987
244 Ga0070663_100528518 3300005455 Unclassified 983
245 Ga0070663_100714757 3300005455 Bacteria 853
246 Ga0070663_100896687 3300005455 Unclassified 766
247 Ga0070678_100192276 3300005456 Bacteria 1678
248 Ga0070678_100346738 3300005456 Bacteria 1275
249 Ga0070678_100399598 3300005456 Unclassified 1193
250 Ga0070678_100585095 3300005456 Bacteria 995
251 Ga0070678_100699967 3300005456 Bacteria 913
252 Ga0070678_101641204 3300005456 Unclassified 604
253 Ga0070662_100007763 3300005457 Bacteria 6969
254 Ga0070662_100016152 3300005457 Bacteria 5009
255 Ga0070662_100037174 3300005457 Bacteria 3450
256 Ga0070662_100095014 3300005457 Bacteria 2246
257 Ga0070662_100099149 3300005457 Unclassified 2202
258 Ga0070662_100240971 3300005457 Bacteria 1450
259 Ga0070662_100365989 3300005457 Unclassified 1184
260 Ga0070662_100579263 3300005457 Unclassified 942
261 Ga0070662_100586305 3300005457 Unclassified 937
262 Ga0070662_101544927 3300005457 Bacteria 573
263 Ga0070662_101696171 3300005457 Bacteria 546
264 Ga0070681_10687646 3300005458 Bacteria 938
265 Ga0070681_10964939 3300005458 Unclassified 772
266 Ga0068867_100212037 3300005459 Bacteria 1556
267 Ga0068867_100383797 3300005459 Bacteria 1181
268 Ga0068867_100489945 3300005459 Bacteria 1055
269 Ga0068867_100834244 3300005459 Bacteria 825
270 Ga0070685_10028429 3300005466 Unclassified 3097
271 Ga0070685_10405925 3300005466 Unclassified 945
272 Ga0070685_11030439 3300005466 Unclassified 619
273 Ga0070706_100020444 3300005467 Bacteria 6102
274 Ga0070706_100020521 3300005467 Bacteria 6089
275 Ga0070706_100025982 3300005467 Bacteria 5388
276 Ga0070706_100078781 3300005467 Bacteria 3050
277 Ga0070706_100193232 3300005467 Bacteria 1902
278 Ga0070706_100283190 3300005467 Bacteria 1547
279 Ga0070706_100461289 3300005467 Bacteria 1182
280 Ga0070706_100594887 3300005467 Unclassified 1028
281 Ga0070706_100790315 3300005467 Unclassified 879
282 Ga0070706_100939008 3300005467 Unclassified 798
283 Ga0070707_100016188 3300005468 Bacteria 6997
284 Ga0070707_100030502 3300005468 Bacteria 5134
285 Ga0070707_100032046 3300005468 Bacteria 5006
286 Ga0070707_100039193 3300005468 Bacteria 4529
287 Ga0070707_100226431 3300005468 Bacteria 1821
288 Ga0070707_100311609 3300005468 Unclassified 1530
289 Ga0070707_100454279 3300005468 Bacteria 1242
290 Ga0070707_100564921 3300005468 Bacteria 1100
291 Ga0070707_100753710 3300005468 Bacteria 937
292 Ga0070707_101140792 3300005468 Unclassified 745
293 Ga0070707_101276289 3300005468 Unclassified 701
294 Ga0070707_101300077 3300005468 Bacteria 694
295 Ga0070698_100001836 3300005471 Bacteria 23657
296 Ga0070698_100032196 3300005471 Bacteria 5431
297 Ga0070698_100086365 3300005471 Bacteria 3123
298 Ga0070698_100225558 3300005471 Bacteria 1807
299 Ga0070698_100368308 3300005471 Unclassified 1369
300 Ga0070698_100584666 3300005471 Bacteria 1057
301 Ga0070699_100027581 3300005518 Bacteria 4897
302 Ga0070699_100171466 3300005518 Bacteria 1923
303 Ga0070699_100291268 3300005518 Unclassified 1464
304 Ga0070699_100307974 3300005518 Bacteria 1422
305 Ga0070699_101112176 3300005518 Unclassified 725
306 Ga0070699_101327060 3300005518 Unclassified 660
307 Ga0070699_101775268 3300005518 Unclassified 565
308 Ga0070699_102098553 3300005518 Unclassified 516
309 Ga0070679_100399447 3300005530 Bacteria 1320
310 Ga0070679_100949578 3300005530 Unclassified 803
311 Ga0070679_101214875 3300005530 Unclassified 699
312 Ga0070679_101287559 3300005530 Unclassified 677
313 Ga0070684_100001312 3300005535 Bacteria 17819
314 Ga0070684_100029216 3300005535 Bacteria 4670
315 Ga0070684_100188477 3300005535 Bacteria 1876
316 Ga0070684_100440346 3300005535 Unclassified 1204
317 Ga0070697_100002201 3300005536 Bacteria 14963
318 Ga0070697_100002768 3300005536 Bacteria 13496
319 Ga0070697_100045287 3300005536 Unclassified 3565
320 Ga0070697_100113122 3300005536 Bacteria 2264
321 Ga0070697_100242433 3300005536 Bacteria 1539
322 Ga0070697_100245790 3300005536 Bacteria 1529
323 Ga0070697_100326741 3300005536 Unclassified 1322
324 Ga0070697_100329225 3300005536 Unclassified 1317
325 Ga0070697_100420599 3300005536 Bacteria 1161
326 Ga0070697_100423823 3300005536 Bacteria 1157
327 Ga0070697_100483148 3300005536 Unclassified 1082
328 Ga0070697_101352537 3300005536 Unclassified 636
329 Ga0070697_101574173 3300005536 Unclassified 588
330 Ga0070697_101625032 3300005536 Unclassified 578
331 Ga0070697_101780141 3300005536 Unclassified 551
332 Ga0070697_101906263 3300005536 Unclassified 532
333 Ga0070697_102007451 3300005536 Unclassified 518
334 Ga0068853_100107206 3300005539 Bacteria 2477
335 Ga0070672_100000353 3300005543 Bacteria 26400
336 Ga0070672_100004247 3300005543 Bacteria 9368
337 Ga0070672_100050273 3300005543 Bacteria 3246
338 Ga0070672_100254174 3300005543 Bacteria 1481
339 Ga0070672_100280675 3300005543 Unclassified 1408
340 Ga0070672_100484203 3300005543 Bacteria 1069
341 Ga0070672_100574021 3300005543 Unclassified 981
342 Ga0070672_101107711 3300005543 Bacteria 704
343 Ga0070672_101129499 3300005543 Bacteria 697
344 Ga0070672_102163394 3300005543 Unclassified 501
345 Ga0070686_100601766 3300005544 Bacteria 866
346 Ga0070686_100876519 3300005544 Unclassified 729
347 Ga0070696_100058415 3300005546 Bacteria 2693
348 Ga0070696_101129055 3300005546 Bacteria 660
349 Ga0070696_101979962 3300005546 Bacteria 506
350 Ga0070693_100807177 3300005547 Unclassified 696
351 Ga0070665_100008787 3300005548 Bacteria 10223
352 Ga0070665_100024438 3300005548 Bacteria 6085
353 Ga0070665_100070912 3300005548 Bacteria 3491
354 Ga0070665_100145325 3300005548 Bacteria 2375
355 Ga0070665_100147588 3300005548 Bacteria 2355
356 Ga0070665_100484511 3300005548 Unclassified 1248
357 Ga0070665_100753700 3300005548 Unclassified 987
358 Ga0070665_101338704 3300005548 Bacteria 726
359 Ga0070704_100227148 3300005549 Unclassified 1520
360 Ga0070704_100517147 3300005549 Bacteria 1038
361 Ga0070704_102075988 3300005549 Unclassified 528
362 Ga0068855_102313345 3300005563 Bacteria 538
363 Ga0070664_100121453 3300005564 Bacteria 2288
364 Ga0070664_100311564 3300005564 Bacteria 1424
365 Ga0070664_100598245 3300005564 Bacteria 1022
366 Ga0070664_100687425 3300005564 Unclassified 952
367 Ga0070664_101435616 3300005564 Unclassified 653
368 Ga0068857_101242883 3300005577 Bacteria 722
369 Ga0068856_100062548 3300005614 Bacteria 3677
370 Ga0068856_100237795 3300005614 Unclassified 1837
371 Ga0068856_100402187 3300005614 Bacteria 1389
372 Ga0068856_101616404 3300005614 Unclassified 661
373 Ga0068856_102303089 3300005614 Unclassified 547
374 Ga0070702_100018870 3300005615 Bacteria 3585
375 Ga0070702_100470434 3300005615 Bacteria 916
376 Ga0070702_100720088 3300005615 Bacteria 763
377 Ga0068852_100383840 3300005616 Bacteria 1379
378 Ga0068852_100902141 3300005616 Bacteria 901
379 Ga0068852_102776274 3300005616 Unclassified 508
380 Ga0068859_100326644 3300005617 Bacteria 1628
381 Ga0068866_10041728 3300005718 Bacteria 2278
382 Ga0068866_10099689 3300005718 Bacteria 1600
383 Ga0068866_10170873 3300005718 Unclassified 1276
384 Ga0068866_10258928 3300005718 Bacteria 1068
385 Ga0068866_10440135 3300005718 Unclassified 850
386 Ga0068861_100173761 3300005719 Unclassified 1788
387 Ga0068861_100549046 3300005719 Unclassified 1053
388 Ga0068861_102070470 3300005719 Unclassified 569
389 Ga0068851_10407291 3300005834 Bacteria 801
390 Ga0068863_100007967 3300005841 Bacteria 10355
391 Ga0068863_100722959 3300005841 Bacteria 990
392 Ga0068858_100168633 3300005842 Unclassified 2064
393 Ga0068858_100283900 3300005842 Bacteria 1576
394 Ga0068858_100347541 3300005842 Bacteria 1420
395 Ga0068858_102379344 3300005842 Unclassified 523
396 Ga0068860_100010603 3300005843 Bacteria 9101
397 Ga0068860_100174781 3300005843 Bacteria 2076
398 Ga0068860_100244584 3300005843 Bacteria 1745
399 Ga0068860_100806876 3300005843 Unclassified 952
400 Ga0068860_101101196 3300005843 Unclassified 814
401 Ga0068860_101420721 3300005843 Unclassified 715
402 Ga0068860_102157230 3300005843 Unclassified 578
403 Ga0068862_100008330 3300005844 Bacteria 8579
404 Ga0068862_100180595 3300005844 Bacteria 1894
405 Ga0068862_100258378 3300005844 Bacteria 1589
406 Ga0068862_101487649 3300005844 Unclassified 682
407 Ga0068862_101842946 3300005844 Unclassified 614
408 Ga0081455_10000328 3300005937 Bacteria 62204
409 Ga0081455_10001697 3300005937 Bacteria 26660
410 Ga0081455_10021927 3300005937 Bacteria 5982
411 Ga0081455_10031292 3300005937 Bacteria 4817
412 Ga0081455_10040030 3300005937 Bacteria 4137
413 Ga0081455_10040051 3300005937 Bacteria 4136
414 Ga0081455_10151731 3300005937 Unclassified 1786
415 Ga0081455_10170692 3300005937 Bacteria 1657
416 Ga0081455_10884439 3300005937 Bacteria 556
417 Ga0081455_10887284 3300005937 Unclassified 555
418 Ga0081538_10334323 3300005981 Unclassified 550
419 Ga0081540_1000036 3300005983 Bacteria 140805
420 Ga0081540_1032359 3300005983 Bacteria 2857
421 Ga0081540_1041372 3300005983 Bacteria 2390
422 Ga0081540_1053610 3300005983 Bacteria 1976
423 Ga0081540_1075382 3300005983 Bacteria 1542
424 Ga0081539_10000014 3300005985 Bacteria 411270
425 Ga0081539_10157760 3300005985 Bacteria 1085
426 Ga0070717_10028090 3300006028 Bacteria 4500
427 Ga0070717_10030233 3300006028 Bacteria 4352
428 Ga0070717_10067091 3300006028 Bacteria 2984
429 Ga0070717_10297754 3300006028 Bacteria 1434
430 Ga0070717_10495388 3300006028 Unclassified 1104
431 Ga0070717_10708003 3300006028 Unclassified 915
432 Ga0070715_10020578 3300006163 Bacteria 2547
433 Ga0070715_10036615 3300006163 Bacteria 2025
434 Ga0070715_10100296 3300006163 Unclassified 1349
435 Ga0070715_10178518 3300006163 Unclassified 1063
436 Ga0070715_10242314 3300006163 Bacteria 938
437 Ga0070715_11000156 3300006163 Unclassified 521
438 Ga0070716_100063071 3300006173 Bacteria 2150
439 Ga0070716_100094785 3300006173 Bacteria 1815
440 Ga0070716_100608707 3300006173 Unclassified 823
441 Ga0070716_100668291 3300006173 Bacteria 790
442 Ga0070716_100888438 3300006173 Bacteria 697
443 Ga0070716_101035850 3300006173 Bacteria 651
444 Ga0070716_101537437 3300006173 Unclassified 545
445 Ga0070712_100010939 3300006175 Bacteria 5740
446 Ga0070712_100023808 3300006175 Bacteria 4049
447 Ga0070712_100052822 3300006175 Bacteria 2836
448 Ga0070712_100095268 3300006175 Bacteria 2190
449 Ga0070712_100123126 3300006175 Bacteria 1954
450 Ga0070712_100151058 3300006175 Bacteria 1783
451 Ga0070712_100273381 3300006175 Bacteria 1358
452 Ga0070712_100472181 3300006175 Unclassified 1047
453 Ga0070712_100547686 3300006175 Bacteria 974
454 Ga0070712_100568278 3300006175 Unclassified 957
455 Ga0070712_100584958 3300006175 Unclassified 943
456 Ga0070712_100598006 3300006175 Bacteria 933
457 Ga0070712_100609873 3300006175 Unclassified 924
458 Ga0070712_101025854 3300006175 Unclassified 714
459 Ga0070712_101037364 3300006175 Unclassified 710
460 Ga0070712_101141531 3300006175 Unclassified 677
461 Ga0070712_101295793 3300006175 Unclassified 635
462 Ga0070712_101918852 3300006175 Unclassified 519
463 Ga0070712_101962750 3300006175 Unclassified 512
464 Ga0097621_100014055 3300006237 Bacteria 5982
465 Ga0097621_100018403 3300006237 Bacteria 5335
466 Ga0097621_100040994 3300006237 Bacteria 3725
467 Ga0097621_100318606 3300006237 Bacteria 1377
468 Ga0097621_100815610 3300006237 Bacteria 865
469 Ga0097621_101322106 3300006237 Bacteria 681
470 Ga0097621_102254817 3300006237 Unclassified 521
471 Ga0068871_100038389 3300006358 Bacteria 3824
472 Ga0068871_100096963 3300006358 Bacteria 2464
473 Ga0068871_100138801 3300006358 Bacteria 2066
474 Ga0068871_100191878 3300006358 Bacteria 1760
475 Ga0068871_100424331 3300006358 Bacteria 1188
476 Ga0068871_101234300 3300006358 Unclassified 702
477 Ga0068871_101285743 3300006358 Unclassified 688
478 Ga0068871_101867525 3300006358 Bacteria 571
479 Ga0075428_100095839 3300006844 Bacteria 3235
480 Ga0075428_100416463 3300006844 Unclassified 1440
481 Ga0075431_100816203 3300006847 Bacteria 905
482 Ga0075433_10756944 3300006852 Unclassified 850
483 Ga0075434_100255607 3300006871 Bacteria 1771
484 Ga0075434_100738231 3300006871 Bacteria 1002
485 Ga0075434_101015835 3300006871 Unclassified 843
486 Ga0075434_101178183 3300006871 Unclassified 778
487 Ga0075434_101790846 3300006871 Unclassified 621
488 Ga0068865_100017414 3300006881 Bacteria 4621
489 Ga0068865_100079884 3300006881 Bacteria 2344
490 Ga0068865_100343715 3300006881 Unclassified 1207
491 Ga0068865_100477358 3300006881 Bacteria 1036
492 Ga0068865_100531144 3300006881 Bacteria 985
493 Ga0068865_100713279 3300006881 Unclassified 858
494 Ga0068865_101858950 3300006881 Unclassified 545
495 Ga0075436_100089519 3300006914 Bacteria 2139
496 Ga0075436_100257488 3300006914 Bacteria 1244
497 Ga0075436_100283948 3300006914 Unclassified 1184
498 Ga0075436_100313760 3300006914 Bacteria 1125
499 Ga0075436_100633678 3300006914 Bacteria 789
500 Ga0097620_100326689 3300006931 Bacteria 1628
501 Ga0075435_100988217 3300007076 Bacteria 735
502 Ga0075435_101892357 3300007076 Bacteria 524
503 Ga0075435_101969206 3300007076 Unclassified 513
504 Ga0099794_10020565 3300007265 Bacteria 2989
505 Ga0099794_10145936 3300007265 Unclassified 1200
506 Ga0099794_10325814 3300007265 Bacteria 797
507 Ga0099795_10021968 3300007788 Bacteria 2101
508 Ga0099795_10056361 3300007788 Unclassified 1445
509 Ga0105240_10636431 3300009093 Bacteria 1171
510 Ga0105240_10784265 3300009093 Bacteria 1033
511 Ga0105240_11038689 3300009093 Bacteria 875
512 Ga0105240_12244662 3300009093 Bacteria 566
513 Ga0111539_10676556 3300009094 Unclassified 1201
514 Ga0111539_10865884 3300009094 Bacteria 1051
515 Ga0111539_11300927 3300009094 Bacteria 844
516 Ga0111539_12853814 3300009094 Bacteria 559
517 Ga0105245_10006614 3300009098 Bacteria 10180
518 Ga0105245_10030852 3300009098 Bacteria 4740
519 Ga0105245_10124129 3300009098 Unclassified 2414
520 Ga0105245_10192863 3300009098 Bacteria 1952
521 Ga0105245_10726772 3300009098 Unclassified 1027
522 Ga0105245_11078215 3300009098 Bacteria 849
523 Ga0105245_11740269 3300009098 Unclassified 676
524 Ga0105245_12552963 3300009098 Unclassified 564
525 Ga0105247_10223822 3300009101 Unclassified 1275
526 Ga0114129_10003445 3300009147 Bacteria 22244
527 Ga0114129_10071980 3300009147 Bacteria 4820
528 Ga0114129_10218235 3300009147 Bacteria 2574
529 Ga0114129_11432233 3300009147 Unclassified 851
530 Ga0105243_10272788 3300009148 Bacteria 1519
531 Ga0105243_11229588 3300009148 Unclassified 763
532 Ga0105243_11380156 3300009148 Bacteria 724
533 Ga0105241_11846708 3300009174 Unclassified 591
534 Ga0105241_11992440 3300009174 Unclassified 571
535 Ga0105242_10043482 3300009176 Bacteria 3634
536 Ga0105242_10229921 3300009176 Bacteria 1662
537 Ga0105242_10328839 3300009176 Bacteria 1405
538 Ga0105242_10549724 3300009176 Bacteria 1107
539 Ga0105242_10996553 3300009176 Unclassified 845
540 Ga0105248_11169531 3300009177 Bacteria 870
541 Ga0105248_11193886 3300009177 Bacteria 860
542 Ga0105248_11410730 3300009177 Bacteria 788
543 Ga0105248_12002321 3300009177 Unclassified 658
544 Ga0105237_10444563 3300009545 Bacteria 1302
545 Ga0105237_10528861 3300009545 Bacteria 1186
546 Ga0105237_10820507 3300009545 Unclassified 937
547 Ga0105249_10011097 3300009553 Bacteria 7914
548 Ga0105249_10470133 3300009553 Bacteria 1299
549 Ga0105249_10544884 3300009553 Bacteria 1210
550 Ga0105249_11320275 3300009553 Unclassified 793
551 Ga0105249_11853859 3300009553 Bacteria 676
552 Ga0105249_13178574 3300009553 Bacteria 528
553 Ga0105249_13388451 3300009553 Unclassified 513
554 Ga0099796_10005301 3300010159 Bacteria 3206
555 Ga0099796_10061942 3300010159 Unclassified 1329
556 Ga0099796_10094571 3300010159 Unclassified 1116
557 Ga0099796_10346725 3300010159 Unclassified 639
558 Ga0105239_10070002 3300010375 Bacteria 3853
559 Ga0105239_10225186 3300010375 Bacteria 2103
560 Ga0105239_10292714 3300010375 Bacteria 1833
561 Ga0105239_10518088 3300010375 Bacteria 1356
562 Ga0105239_10823425 3300010375 Bacteria 1064
563 Ga0105239_10991354 3300010375 Bacteria 966
564 Ga0105239_12290191 3300010375 Bacteria 629
565 Ga0105246_10459510 3300011119 Bacteria 1072
566 Ga0105246_10874569 3300011119 Unclassified 804
567 Ga0157344_1016044 3300012476 Unclassified 601
568 Ga0157343_1016333 3300012488 Bacteria 629
569 Ga0157339_1012990 3300012505 Unclassified 790
570 Ga0157324_1023983 3300012506 Bacteria 644
571 Ga0157315_1041195 3300012508 Unclassified 585
572 Ga0157315_1060043 3300012508 Unclassified 534
573 Ga0157373_10396341 3300013100 Unclassified 989
574 Ga0157373_10698598 3300013100 Bacteria 743
575 Ga0157371_10265362 3300013102 Bacteria 1238
576 Ga0157371_10550303 3300013102 Bacteria 855
577 Ga0157371_11002497 3300013102 Bacteria 637
578 Ga0157371_11321911 3300013102 Unclassified 558
579 Ga0157370_10322896 3300013104 Bacteria 1424
580 Ga0157369_10117876 3300013105 Bacteria 2818
581 Ga0157374_10001473 3300013296 Bacteria 19879
582 Ga0157374_10005577 3300013296 Bacteria 10597
583 Ga0157374_10019745 3300013296 Bacteria 5970
584 Ga0157374_10033688 3300013296 Bacteria 4675
585 Ga0157374_10094662 3300013296 Bacteria 2855
586 Ga0157374_10103065 3300013296 Bacteria 2738
587 Ga0157374_10120813 3300013296 Bacteria 2528
588 Ga0157374_10130202 3300013296 Bacteria 2435
589 Ga0157374_10222850 3300013296 Bacteria 1851
590 Ga0157374_10549440 3300013296 Bacteria 1163
591 Ga0157374_10566828 3300013296 Bacteria 1144
592 Ga0157374_11011256 3300013296 Unclassified 851
593 Ga0157374_11551143 3300013296 Bacteria 686
594 Ga0157374_11573636 3300013296 Bacteria 681
595 Ga0157374_12237170 3300013296 Unclassified 574
596 Ga0157374_12818952 3300013296 Unclassified 514
597 Ga0157378_10005509 3300013297 Bacteria 11097
598 Ga0157378_10009019 3300013297 Bacteria 8684
599 Ga0157378_10009704 3300013297 Bacteria 8385
600 Ga0157378_10026553 3300013297 Bacteria 5104
601 Ga0157378_10041332 3300013297 Bacteria 4089
602 Ga0157378_10066060 3300013297 Unclassified 3239
603 Ga0157378_10141935 3300013297 Bacteria 2231
604 Ga0157378_10190256 3300013297 Unclassified 1935
605 Ga0157378_10237043 3300013297 Bacteria 1741
606 Ga0157378_10292746 3300013297 Bacteria 1573
607 Ga0157378_10338887 3300013297 Bacteria 1466
608 Ga0157378_10350425 3300013297 Bacteria 1442
609 Ga0157378_10644156 3300013297 Unclassified 1075
610 Ga0157378_10668405 3300013297 Unclassified 1056
611 Ga0157378_10758292 3300013297 Bacteria 994
612 Ga0157378_10853698 3300013297 Unclassified 939
613 Ga0157378_10891673 3300013297 Unclassified 920
614 Ga0157378_11168955 3300013297 Bacteria 808
615 Ga0157378_11552705 3300013297 Unclassified 707
616 Ga0157378_11849135 3300013297 Bacteria 652
617 Ga0163162_10003249 3300013306 Bacteria 15541
618 Ga0163162_10014121 3300013306 Bacteria 7805
619 Ga0163162_10017445 3300013306 Bacteria 7024
620 Ga0163162_10105792 3300013306 Bacteria 2908
621 Ga0163162_10118628 3300013306 Bacteria 2748
622 Ga0163162_10300351 3300013306 Bacteria 1738
623 Ga0163162_10609774 3300013306 Bacteria 1217
624 Ga0163162_10824833 3300013306 Bacteria 1044
625 Ga0163162_11278146 3300013306 Unclassified 833
626 Ga0163162_11548759 3300013306 Unclassified 756
627 Ga0163162_12295981 3300013306 Bacteria 620
628 Ga0163162_12699018 3300013306 Unclassified 572
629 Ga0163162_12904674 3300013306 Bacteria 551
630 Ga0157372_10037163 3300013307 Bacteria 5368
631 Ga0157372_10135936 3300013307 Bacteria 2831
632 Ga0157372_10198123 3300013307 Bacteria 2326
633 Ga0157372_10553780 3300013307 Bacteria 1341
634 Ga0157372_10912415 3300013307 Unclassified 1019
635 Ga0157372_11456901 3300013307 Unclassified 789
636 Ga0157375_10000287 3300013308 Bacteria 45998
637 Ga0157375_10001868 3300013308 Bacteria 18135
638 Ga0157375_10007782 3300013308 Bacteria 9374
639 Ga0157375_10136768 3300013308 Bacteria 2575
640 Ga0157375_10138523 3300013308 Bacteria 2559
641 Ga0157375_10449240 3300013308 Unclassified 1455
642 Ga0157375_10708632 3300013308 Bacteria 1160
643 Ga0157375_10998323 3300013308 Unclassified 977
644 Ga0157375_11011837 3300013308 Unclassified 970
645 Ga0157375_11529705 3300013308 Unclassified 788
646 Ga0157375_11890947 3300013308 Unclassified 708
647 Ga0163163_10175148 3300014325 Unclassified 2192
648 Ga0163163_11302229 3300014325 Unclassified 789
649 Ga0163163_11869470 3300014325 Bacteria 660
650 Ga0163163_13233606 3300014325 Unclassified 508
651 Ga0157377_10190634 3300014745 Bacteria 1295
652 Ga0157377_10234421 3300014745 Bacteria 1182
653 Ga0157377_10334221 3300014745 Unclassified 1011
654 Ga0157377_10608791 3300014745 Unclassified 780
655 Ga0157377_10872791 3300014745 Bacteria 670
656 Ga0157377_11466850 3300014745 Unclassified 541
657 Ga0157379_10005647 3300014968 Bacteria 10748
658 Ga0157379_10178685 3300014968 Bacteria 1917
659 Ga0157379_10362342 3300014968 Unclassified 1329
660 Ga0157379_11131810 3300014968 Unclassified 751
661 Ga0157379_11295907 3300014968 Bacteria 703
662 Ga0157376_10009509 3300014969 Bacteria 7064
663 Ga0157376_10064325 3300014969 Bacteria 3093
664 Ga0157376_10300272 3300014969 Bacteria 1520
665 Ga0157376_10332488 3300014969 Unclassified 1448
666 Ga0157376_10378555 3300014969 Bacteria 1363
667 Ga0157376_10943728 3300014969 Unclassified 883
668 Ga0157376_10950725 3300014969 Bacteria 880
669 Ga0157376_11935218 3300014969 Bacteria 627
670 Ga0157376_12107002 3300014969 Unclassified 602
671 Ga0157376_12876303 3300014969 Unclassified 521
672 Ga0182006_1152729 3300015261 Unclassified 782
673 Ga0182005_1017656 3300015265 Bacteria 1974
674 Ga0163161_10046543 3300017792 Bacteria 3130
675 Ga0163161_10125832 3300017792 Bacteria 1930
676 Ga0163161_10570979 3300017792 Bacteria 929
677 Ga0163161_10710536 3300017792 Bacteria 838
678 Ga0163161_11078881 3300017792 Unclassified 689
679 Ga0213875_10310544 3300021388 Unclassified 747
680 Ga0207666_1005260 3300025271 Bacteria 1649
681 Ga0207666_1008686 3300025271 Bacteria 1360
682 Ga0207673_1000205 3300025290 Bacteria 5944
683 Ga0207673_1000900 3300025290 Unclassified 3196
684 Ga0207673_1005925 3300025290 Unclassified 1502
685 Ga0207673_1006109 3300025290 Bacteria 1484
686 Ga0207673_1028027 3300025290 Bacteria 775
687 Ga0207673_1055722 3300025290 Unclassified 561
688 Ga0207697_10000010 3300025315 Bacteria 65144
689 Ga0207697_10000131 3300025315 Bacteria 36154
690 Ga0207697_10000495 3300025315 Bacteria 22147
691 Ga0207697_10002230 3300025315 Bacteria 10127
692 Ga0207697_10002322 3300025315 Bacteria 9909
693 Ga0207697_10021301 3300025315 Bacteria 2654
694 Ga0207697_10042806 3300025315 Bacteria 1861
695 Ga0207697_10062383 3300025315 Bacteria 1552
696 Ga0207697_10110706 3300025315 Bacteria 1176
697 Ga0207697_10209187 3300025315 Unclassified 859
698 Ga0207697_10229814 3300025315 Unclassified 819
699 Ga0207697_10274420 3300025315 Unclassified 747
700 Ga0207697_10302285 3300025315 Unclassified 710
701 Ga0207697_10374245 3300025315 Bacteria 633
702 Ga0207697_10460044 3300025315 Unclassified 564
703 Ga0207697_10487975 3300025315 Unclassified 545
704 Ga0207653_10001694 3300025885 Bacteria 7052
705 Ga0207682_10024517 3300025893 Bacteria 2389
706 Ga0207692_10115326 3300025898 Unclassified 1496
707 Ga0207692_10123175 3300025898 Bacteria 1454
708 Ga0207692_10472491 3300025898 Unclassified 792
709 Ga0207692_10796278 3300025898 Unclassified 618
710 Ga0207692_11018310 3300025898 Bacteria 547
711 Ga0207642_10073381 3300025899 Bacteria 1636
712 Ga0207642_10142597 3300025899 Unclassified 1265
713 Ga0207642_10626882 3300025899 Bacteria 672
714 Ga0207688_10007718 3300025901 Bacteria 5860
715 Ga0207688_10014566 3300025901 Bacteria 4271
716 Ga0207688_10023688 3300025901 Bacteria 3364
717 Ga0207688_10245931 3300025901 Bacteria 1082
718 Ga0207688_10591109 3300025901 Bacteria 699
719 Ga0207680_10025390 3300025903 Bacteria 3268
720 Ga0207680_10094129 3300025903 Unclassified 1912
721 Ga0207680_10212819 3300025903 Bacteria 1322
722 Ga0207680_10921954 3300025903 Unclassified 626
723 Ga0207647_10022311 3300025904 Unclassified 4207
724 Ga0207647_10616614 3300025904 Bacteria 597
725 Ga0207647_10725049 3300025904 Bacteria 540
726 Ga0207685_10003968 3300025905 Bacteria 3683
727 Ga0207685_10079697 3300025905 Bacteria 1352
728 Ga0207685_10530412 3300025905 Bacteria 623
729 Ga0207685_10607541 3300025905 Unclassified 587
730 Ga0207685_10664344 3300025905 Unclassified 565
731 Ga0207699_10008911 3300025906 Bacteria 4974
732 Ga0207699_10020861 3300025906 Bacteria 3520
733 Ga0207699_10099551 3300025906 Bacteria 1842
734 Ga0207699_10406362 3300025906 Unclassified 970
735 Ga0207699_10761832 3300025906 Bacteria 710
736 Ga0207699_10989558 3300025906 Unclassified 622
737 Ga0207699_11018544 3300025906 Unclassified 612
738 Ga0207645_10001786 3300025907 Bacteria 17391
739 Ga0207645_10002762 3300025907 Bacteria 13659
740 Ga0207645_10004253 3300025907 Bacteria 10632
741 Ga0207645_10004432 3300025907 Bacteria 10394
742 Ga0207645_10133103 3300025907 Bacteria 1619
743 Ga0207645_10245051 3300025907 Bacteria 1185
744 Ga0207645_10252534 3300025907 Bacteria 1167
745 Ga0207645_10363541 3300025907 Bacteria 969
746 Ga0207645_10457105 3300025907 Unclassified 862
747 Ga0207684_10000028 3300025910 Bacteria 306450
748 Ga0207684_10003766 3300025910 Bacteria 14658
749 Ga0207684_10008671 3300025910 Bacteria 9025
750 Ga0207684_10011143 3300025910 Bacteria 7871
751 Ga0207684_10042797 3300025910 Bacteria 3840
752 Ga0207684_10059810 3300025910 Bacteria 3235
753 Ga0207684_10068412 3300025910 Bacteria 3018
754 Ga0207684_10105479 3300025910 Bacteria 2411
755 Ga0207684_10348575 3300025910 Unclassified 1275
756 Ga0207684_10408111 3300025910 Bacteria 1168
757 Ga0207684_10422941 3300025910 Unclassified 1145
758 Ga0207684_10451794 3300025910 Bacteria 1103
759 Ga0207684_10577943 3300025910 Unclassified 960
760 Ga0207684_10756763 3300025910 Bacteria 823
761 Ga0207684_11493755 3300025910 Unclassified 550
762 Ga0207707_10308527 3300025912 Unclassified 1367
763 Ga0207707_10561492 3300025912 Bacteria 969
764 Ga0207671_10363757 3300025914 Bacteria 1148
765 Ga0207671_10448470 3300025914 Bacteria 1027
766 Ga0207693_10000889 3300025915 Bacteria 26818
767 Ga0207693_10006942 3300025915 Bacteria 9356
768 Ga0207693_10019110 3300025915 Bacteria 5453
769 Ga0207693_10021211 3300025915 Bacteria 5163
770 Ga0207693_10032567 3300025915 Bacteria 4113
771 Ga0207693_10035010 3300025915 Bacteria 3961
772 Ga0207693_10090298 3300025915 Bacteria 2401
773 Ga0207693_10278653 3300025915 Unclassified 1310
774 Ga0207693_10393342 3300025915 Unclassified 1084
775 Ga0207693_10490403 3300025915 Bacteria 959
776 Ga0207693_10496489 3300025915 Unclassified 953
777 Ga0207693_10593130 3300025915 Unclassified 863
778 Ga0207663_10002290 3300025916 Bacteria 9171
779 Ga0207663_10135856 3300025916 Bacteria 1706
780 Ga0207663_10396420 3300025916 Bacteria 1055
781 Ga0207663_10472442 3300025916 Bacteria 970
782 Ga0207663_10519887 3300025916 Bacteria 927
783 Ga0207663_10581841 3300025916 Unclassified 878
784 Ga0207663_10633405 3300025916 Bacteria 843
785 Ga0207663_11321577 3300025916 Bacteria 581
786 Ga0207663_11622674 3300025916 Bacteria 520
787 Ga0207660_10167820 3300025917 Bacteria 1697
788 Ga0207662_10000699 3300025918 Bacteria 15308
789 Ga0207662_10010494 3300025918 Bacteria 5118
790 Ga0207662_10074228 3300025918 Unclassified 2064
791 Ga0207662_10080381 3300025918 Bacteria 1988
792 Ga0207662_10309233 3300025918 Bacteria 1053
793 Ga0207662_10325515 3300025918 Bacteria 1027
794 Ga0207657_10214387 3300025919 Bacteria 1544
795 Ga0207657_10860162 3300025919 Bacteria 699
796 Ga0207649_10043554 3300025920 Bacteria 2745
797 Ga0207649_10333051 3300025920 Bacteria 1119
798 Ga0207649_10489834 3300025920 Unclassified 933
799 Ga0207649_10520278 3300025920 Bacteria 907
800 Ga0207649_10605067 3300025920 Unclassified 843
801 Ga0207652_10485669 3300025921 Bacteria 1112
802 Ga0207652_10712104 3300025921 Unclassified 895
803 Ga0207652_11202675 3300025921 Unclassified 660
804 Ga0207646_10000191 3300025922 Bacteria 83638
805 Ga0207646_10005640 3300025922 Bacteria 13143
806 Ga0207646_10009621 3300025922 Bacteria 9535
807 Ga0207646_10010143 3300025922 Bacteria 9230
808 Ga0207646_10028198 3300025922 Bacteria 5113
809 Ga0207646_10051798 3300025922 Unclassified 3673
810 Ga0207646_10085456 3300025922 Bacteria 2823
811 Ga0207646_10121006 3300025922 Bacteria 2351
812 Ga0207646_10171540 3300025922 Bacteria 1959
813 Ga0207646_10207391 3300025922 Unclassified 1770
814 Ga0207646_10260717 3300025922 Unclassified 1566
815 Ga0207646_10308099 3300025922 Unclassified 1431
816 Ga0207646_10413113 3300025922 Bacteria 1218
817 Ga0207646_11037387 3300025922 Bacteria 723
818 Ga0207646_11083370 3300025922 Bacteria 706
819 Ga0207646_11189447 3300025922 Unclassified 669
820 Ga0207646_11657266 3300025922 Unclassified 550
821 Ga0207646_11713471 3300025922 Unclassified 539
822 Ga0207646_11731199 3300025922 Unclassified 536
823 Ga0207681_10004055 3300025923 Bacteria 9086
824 Ga0207681_10088623 3300025923 Bacteria 2204
825 Ga0207681_10116369 3300025923 Unclassified 1953
826 Ga0207681_10234539 3300025923 Unclassified 1425
827 Ga0207681_10441433 3300025923 Bacteria 1057
828 Ga0207681_10655769 3300025923 Unclassified 870
829 Ga0207681_10856794 3300025923 Bacteria 760
830 Ga0207681_11184317 3300025923 Bacteria 642
831 Ga0207681_11224475 3300025923 Bacteria 631
832 Ga0207650_10006836 3300025925 Bacteria 7782
833 Ga0207650_10007428 3300025925 Bacteria 7468
834 Ga0207650_10093277 3300025925 Unclassified 2304
835 Ga0207650_10319489 3300025925 Bacteria 1271
836 Ga0207650_10346946 3300025925 Unclassified 1220
837 Ga0207650_10427224 3300025925 Bacteria 1100
838 Ga0207650_11540295 3300025925 Bacteria 565
839 Ga0207659_10003512 3300025926 Bacteria 9421
840 Ga0207659_10049761 3300025926 Bacteria 2974
841 Ga0207659_10053684 3300025926 Bacteria 2875
842 Ga0207659_10067573 3300025926 Bacteria 2596
843 Ga0207659_10127931 3300025926 Bacteria 1956
844 Ga0207659_10179125 3300025926 Bacteria 1678
845 Ga0207659_10222696 3300025926 Bacteria 1518
846 Ga0207659_10225081 3300025926 Bacteria 1510
847 Ga0207659_10807541 3300025926 Bacteria 806
848 Ga0207687_10095481 3300025927 Bacteria 2177
849 Ga0207687_10694367 3300025927 Unclassified 863
850 Ga0207687_11162978 3300025927 Unclassified 663
851 Ga0207687_11337954 3300025927 Unclassified 616
852 Ga0207687_11504157 3300025927 Unclassified 578
853 Ga0207687_11664935 3300025927 Unclassified 547
854 Ga0207700_10003893 3300025928 Bacteria 8714
855 Ga0207700_10069264 3300025928 Bacteria 2707
856 Ga0207700_10087236 3300025928 Bacteria 2454
857 Ga0207700_10156867 3300025928 Bacteria 1886
858 Ga0207700_10185843 3300025928 Bacteria 1743
859 Ga0207700_10725583 3300025928 Unclassified 888
860 Ga0207664_10112083 3300025929 Bacteria 2270
861 Ga0207664_10122505 3300025929 Bacteria 2178
862 Ga0207664_10142540 3300025929 Bacteria 2029
863 Ga0207664_10681007 3300025929 Unclassified 925
864 Ga0207664_10697046 3300025929 Bacteria 913
865 Ga0207664_11417441 3300025929 Unclassified 616
866 Ga0207664_11665513 3300025929 Unclassified 560
867 Ga0207664_11810705 3300025929 Unclassified 533
868 Ga0207644_10033707 3300025931 Bacteria 3581
869 Ga0207644_10058479 3300025931 Bacteria 2786
870 Ga0207644_10196648 3300025931 Bacteria 1588
871 Ga0207644_10254840 3300025931 Bacteria 1401
872 Ga0207644_10344956 3300025931 Bacteria 1208
873 Ga0207644_10545561 3300025931 Bacteria 959
874 Ga0207644_10692706 3300025931 Unclassified 849
875 Ga0207644_11813834 3300025931 Unclassified 510
876 Ga0207690_10075123 3300025932 Bacteria 2343
877 Ga0207690_10098203 3300025932 Bacteria 2085
878 Ga0207690_10182904 3300025932 Bacteria 1580
879 Ga0207690_11019648 3300025932 Bacteria 689
880 Ga0207706_10008197 3300025933 Bacteria 9637
881 Ga0207706_10070025 3300025933 Bacteria 3084
882 Ga0207706_10130216 3300025933 Unclassified 2213
883 Ga0207706_10216094 3300025933 Bacteria 1679
884 Ga0207706_10252504 3300025933 Bacteria 1540
885 Ga0207706_10397992 3300025933 Unclassified 1194
886 Ga0207706_10532738 3300025933 Bacteria 1012
887 Ga0207706_10554217 3300025933 Unclassified 989
888 Ga0207706_11016521 3300025933 Unclassified 696
889 Ga0207686_10157569 3300025934 Unclassified 1588
890 Ga0207686_11520114 3300025934 Bacteria 552
891 Ga0207686_11644433 3300025934 Unclassified 531
892 Ga0207709_10405195 3300025935 Bacteria 1044
893 Ga0207709_10620733 3300025935 Unclassified 858
894 Ga0207670_10020026 3300025936 Unclassified 4101
895 Ga0207670_10186652 3300025936 Bacteria 1566
896 Ga0207670_10246226 3300025936 Bacteria 1379
897 Ga0207670_10787345 3300025936 Bacteria 792
898 Ga0207670_11168912 3300025936 Unclassified 651
899 Ga0207669_10007177 3300025937 Bacteria 5131
900 Ga0207669_10011026 3300025937 Bacteria 4378
901 Ga0207669_10194696 3300025937 Bacteria 1466
902 Ga0207704_10046539 3300025938 Bacteria 2586
903 Ga0207704_10336220 3300025938 Bacteria 1170
904 Ga0207704_10483166 3300025938 Bacteria 995
905 Ga0207704_10655411 3300025938 Bacteria 865
906 Ga0207704_10949398 3300025938 Unclassified 725
907 Ga0207704_11051630 3300025938 Unclassified 690
908 Ga0207704_11655212 3300025938 Unclassified 550
909 Ga0207665_10023457 3300025939 Bacteria 4066
910 Ga0207665_10026852 3300025939 Unclassified 3803
911 Ga0207665_10046134 3300025939 Bacteria 2920
912 Ga0207665_10048049 3300025939 Bacteria 2863
913 Ga0207665_10054073 3300025939 Bacteria 2707
914 Ga0207665_10192231 3300025939 Unclassified 1483
915 Ga0207665_10204530 3300025939 Bacteria 1440
916 Ga0207665_10232318 3300025939 Unclassified 1356
917 Ga0207665_10451432 3300025939 Bacteria 987
918 Ga0207665_10552833 3300025939 Unclassified 894
919 Ga0207665_10841249 3300025939 Bacteria 726
920 Ga0207691_10000142 3300025940 Bacteria 66224
921 Ga0207691_10000247 3300025940 Bacteria 53502
922 Ga0207691_10037047 3300025940 Bacteria 4518
923 Ga0207691_10151876 3300025940 Bacteria 2036
924 Ga0207691_11415241 3300025940 Unclassified 571
925 Ga0207711_11097234 3300025941 Unclassified 737
926 Ga0207689_10086541 3300025942 Bacteria 2576
927 Ga0207689_10111933 3300025942 Unclassified 2244
928 Ga0207689_11087503 3300025942 Bacteria 674
929 Ga0207661_10035276 3300025944 Bacteria 3896
930 Ga0207661_10393064 3300025944 Bacteria 1256
931 Ga0207661_10452819 3300025944 Unclassified 1169
932 Ga0207661_11031626 3300025944 Unclassified 757
933 Ga0207679_10094203 3300025945 Bacteria 2325
934 Ga0207679_10401318 3300025945 Bacteria 1206
935 Ga0207679_10418466 3300025945 Bacteria 1182
936 Ga0207679_10673068 3300025945 Unclassified 937
937 Ga0207667_11436943 3300025949 Bacteria 662
938 Ga0207651_10007253 3300025960 Bacteria 5894
939 Ga0207651_10059097 3300025960 Bacteria 2653
940 Ga0207651_10081121 3300025960 Bacteria 2337
941 Ga0207651_10098725 3300025960 Bacteria 2160
942 Ga0207651_10277686 3300025960 Unclassified 1383
943 Ga0207651_10296423 3300025960 Unclassified 1343
944 Ga0207651_11566462 3300025960 Unclassified 593
945 Ga0207712_10010310 3300025961 Bacteria 5932
946 Ga0207712_10860402 3300025961 Bacteria 800
947 Ga0207712_10873704 3300025961 Bacteria 793
948 Ga0207668_10009836 3300025972 Bacteria 5747
949 Ga0207668_10052709 3300025972 Bacteria 2816
950 Ga0207668_10079305 3300025972 Bacteria 2374
951 Ga0207668_10110386 3300025972 Bacteria 2062
952 Ga0207668_10116809 3300025972 Bacteria 2012
953 Ga0207668_12007131 3300025972 Unclassified 521
954 Ga0207640_10198487 3300025981 Bacteria 1518
955 Ga0207640_10777008 3300025981 Bacteria 828
956 Ga0207640_11992280 3300025981 Unclassified 526
957 Ga0207658_10036520 3300025986 Bacteria 3523
958 Ga0207658_10043698 3300025986 Bacteria 3259
959 Ga0207658_10076513 3300025986 Unclassified 2550
960 Ga0207658_10336677 3300025986 Bacteria 1310
961 Ga0207677_10032534 3300026023 Bacteria 3354
962 Ga0207677_10091729 3300026023 Bacteria 2210
963 Ga0207677_10433420 3300026023 Bacteria 1122
964 Ga0207677_10433542 3300026023 Unclassified 1122
965 Ga0207677_10563597 3300026023 Bacteria 995
966 Ga0207677_10695856 3300026023 Unclassified 901
967 Ga0207677_10733847 3300026023 Unclassified 879
968 Ga0207677_10848651 3300026023 Bacteria 821
969 Ga0207677_11383214 3300026023 Bacteria 648
970 Ga0207677_11497088 3300026023 Bacteria 623
971 Ga0207703_10003624 3300026035 Bacteria 12889
972 Ga0207703_10203169 3300026035 Unclassified 1762
973 Ga0207703_10549854 3300026035 Bacteria 1088
974 Ga0207703_10900518 3300026035 Bacteria 847
975 Ga0207703_11952313 3300026035 Unclassified 563
976 Ga0207639_11033099 3300026041 Unclassified 770
977 Ga0207678_10020455 3300026067 Bacteria 5804
978 Ga0207678_10234839 3300026067 Bacteria 1570
979 Ga0207678_10529024 3300026067 Bacteria 1029
980 Ga0207678_11209444 3300026067 Unclassified 669
981 Ga0207708_10030364 3300026075 Bacteria 4097
982 Ga0207708_10521317 3300026075 Unclassified 999
983 Ga0207708_10644573 3300026075 Unclassified 901
984 Ga0207702_10255395 3300026078 Bacteria 1648
985 Ga0207702_10937471 3300026078 Bacteria 858
986 Ga0207702_11133263 3300026078 Unclassified 776
987 Ga0207702_11455685 3300026078 Bacteria 679
988 Ga0207702_12099462 3300026078 Bacteria 555
989 Ga0207641_10022387 3300026088 Bacteria 5202
990 Ga0207641_10717521 3300026088 Bacteria 985
991 Ga0207641_11141571 3300026088 Bacteria 778
992 Ga0207641_11206454 3300026088 Bacteria 756
993 Ga0207648_10108555 3300026089 Bacteria 2436
994 Ga0207648_10302676 3300026089 Unclassified 1434
995 Ga0207648_10708852 3300026089 Bacteria 933
996 Ga0207676_10895426 3300026095 Unclassified 870
997 Ga0207674_10342675 3300026116 Bacteria 1445
998 Ga0207674_10995977 3300026116 Bacteria 807
999 Ga0207675_100066854 3300026118 Bacteria 3360
1000 Ga0207675_100085155 3300026118 Bacteria 2966
1001 Ga0207675_100094187 3300026118 Bacteria 2817
1002 Ga0207675_100551996 3300026118 Bacteria 1151
1003 Ga0207675_101879321 3300026118 Unclassified 617
1004 Ga0207683_10006977 3300026121 Bacteria 9683
1005 Ga0207683_10008842 3300026121 Bacteria 8591
1006 Ga0207683_10015583 3300026121 Bacteria 6470
1007 Ga0207683_10089065 3300026121 Bacteria 2746
1008 Ga0207683_10428382 3300026121 Bacteria 1219
1009 Ga0207683_10433660 3300026121 Unclassified 1211
1010 Ga0207683_10887783 3300026121 Unclassified 828
1011 Ga0207683_11438819 3300026121 Bacteria 637
1012 Ga0207698_10435666 3300026142 Unclassified 1262
1013 Ga0207698_11609693 3300026142 Unclassified 665
1014 Ga0207698_11896038 3300026142 Unclassified 611
1015 Ga0209984_1014198 3300027424 Bacteria 1049
1016 Ga0209970_1035731 3300027614 Bacteria 874
1017 Ga0210002_1069008 3300027617 Bacteria 622
1018 Ga0209974_10002731 3300027876 Bacteria 6397
1019 Ga0209974_10165190 3300027876 Bacteria 805
1020 Ga0209974_10175797 3300027876 Unclassified 782
1021 Ga0207428_10537082 3300027907 Bacteria 847
1022 Ga0268266_10004179 3300028379 Bacteria 13926
1023 Ga0268266_10026994 3300028379 Bacteria 4885
1024 Ga0268266_10194689 3300028379 Bacteria 1852
1025 Ga0268266_10391086 3300028379 Unclassified 1313
1026 Ga0268266_10395399 3300028379 Bacteria 1306
1027 Ga0268266_10488001 3300028379 Unclassified 1175
1028 Ga0268266_10787947 3300028379 Bacteria 918
1029 Ga0268265_10198884 3300028380 Bacteria 1737
1030 Ga0268265_10831073 3300028380 Bacteria 902
1031 Ga0268265_10971562 3300028380 Bacteria 838
1032 Ga0268265_11672712 3300028380 Unclassified 642
1033 Ga0268264_10029276 3300028381 Unclassified 4509
1034 Ga0268264_10236756 3300028381 Unclassified 1689
1035 Ga0268264_10458954 3300028381 Unclassified 1236
1036 Ga0268264_10697174 3300028381 Bacteria 1008
1037 Ga0268264_11102608 3300028381 Bacteria 802
1038 Ga0268264_11969376 3300028381 Unclassified 594
1039 Ga0307513_10023335 3300031456 Bacteria 7230
1040 Ga0373926_0071067 3300035083 Bacteria 1279
1041 Ga0373926_0467032 3300035083 Bacteria 502
1042 Ga0373934_0458744 3300035086 Unclassified 534
1043 Ga0373944_0030278 3300035089 Bacteria 1623
1044 Ga0373952_0131002 3300035092 Unclassified 689
1045 Ga0373923_0370181 3300035111 Bacteria 686
1046 Ga0373932_0144460 3300035112 Bacteria 812
1047 Ga0373936_0063141 3300035113 Bacteria 1516
1048 Ga0373936_0089102 3300035113 Bacteria 1292
1049 Ga0373939_0144169 3300035114 Bacteria 861
1050 Ga0373939_0199620 3300035114 Bacteria 756
1051 Ga0373941_0275716 3300035115 Unclassified 664
1052 Ga0373945_0017219 3300035116 Bacteria 2446
1053 Ga0373945_0049243 3300035116 Bacteria 1546
1054 Ga0373945_0227619 3300035116 Unclassified 781
1055 Ga0373945_0309808 3300035116 Unclassified 678
1056 Ga0373953_0246233 3300035117 Bacteria 776
1057 Ga0373953_0264792 3300035117 Unclassified 748
1058 Ga0373954_0144032 3300035118 Bacteria 1163
1059 Ga0373954_0263820 3300035118 Unclassified 848
1060 Ga0373956_0096615 3300035119 Unclassified 1367
1061 Ga0373956_0513677 3300035119 Unclassified 572
1062 Ga0373957_0043978 3300035120 Bacteria 1689
1063 Ga0373960_0186212 3300035121 Bacteria 727
1064 Ga0373943_0005531 3300035170 Bacteria 5673
1065 Ga0373943_0075146 3300035170 Bacteria 1720
1066 Ga0373943_0130170 3300035170 Unclassified 1346
1067 Ga0373943_0146425 3300035170 Bacteria 1276
1068 Ga0373943_0220985 3300035170 Bacteria 1055
1069 Ga0373943_0237915 3300035170 Bacteria 1019
1070 Ga0373943_0319387 3300035170 Unclassified 885
1071 Ga0373943_0355223 3300035170 Unclassified 840
1072 Ga0373943_0436808 3300035170 Bacteria 759
1073 Ga0373946_0014471 3300035171 Unclassified 2976
1074 Ga0373946_0043328 3300035171 Unclassified 1854
1075 Ga0373946_0103567 3300035171 Bacteria 1279
1076 Ga0373946_0167595 3300035171 Bacteria 1035
1077 Ga0373946_0226075 3300035171 Bacteria 905
1078 Ga0373946_0325878 3300035171 Bacteria 764
1079 Ga0373955_0133643 3300035172 Bacteria 1450
1080 Ga0373955_0248788 3300035172 Unclassified 1065
1081 Ga0373942_0045221 3300035207 Unclassified 1216
1082 Ga0373961_0190229 3300035241 Bacteria 719
1083 Ga0373924_0014324 3300035410 Bacteria 2995
1084 Ga0373924_0202054 3300035410 Unclassified 877
1085 Ga0373931_0027301 3300035691 Bacteria 2914
1086 Ga0373931_0062699 3300035691 Bacteria 2008
1087 Ga0373935_0034641 3300035692 Bacteria 3148
1088 Ga0373935_0100133 3300035692 Bacteria 1909
1089 Ga0373935_0334591 3300035692 Bacteria 1077
1090 Ga0373935_0459287 3300035692 Unclassified 921
1091 Ga0373935_0725297 3300035692 Unclassified 732
1092 Ga0373927_0010910 3300035695 Bacteria 6049
1093 Ga0373927_0031651 3300035695 Bacteria 3446
1094 Ga0373927_0040560 3300035695 Bacteria 3020
1095 Ga0373927_0125798 3300035695 Bacteria 1673
1096 Ga0373927_0202058 3300035695 Unclassified 1305
1097 Ga0373927_0266811 3300035695 Bacteria 1126
1098 Ga0373933_0088778 3300035724 Unclassified 1905
1099 Ga0373933_0394291 3300035724 Unclassified 902
1100 Ga0373933_0687695 3300035724 Unclassified 672
1101 Ga0373947_0031650 3300035725 Bacteria 3115
1102 Ga0373947_0036106 3300035725 Bacteria 2929
1103 Ga0373947_0044039 3300035725 Bacteria 2667
1104 Ga0373947_0107417 3300035725 Unclassified 1760
1105 Ga0373947_0107458 3300035725 Unclassified 1759
1106 Ga0373947_0113974 3300035725 Unclassified 1711
1107 Ga0373947_0195825 3300035725 Unclassified 1320
1108 Ga0373947_0225808 3300035725 Unclassified 1232
1109 Ga0373947_0475836 3300035725 Unclassified 847
1110 Ga0373937_0007935 3300036401 Bacteria 9202
1111 Ga0373937_0065643 3300036401 Bacteria 3341
1112 Ga0373937_0195834 3300036401 Unclassified 1899
1113 Ga0373937_0420927 3300036401 Bacteria 1268
1114 Ga0373925_0034819 3300037068 Bacteria 3713
1115 Ga0373925_0040917 3300037068 Bacteria 3433
1116 Ga0373925_0065822 3300037068 Bacteria 2731
1117 Ga0373925_0068631 3300037068 Bacteria 2677
1118 Ga0373925_0160554 3300037068 Bacteria 1770
1119 Ga0373925_0176068 3300037068 Unclassified 1691
1120 Ga0373925_0180445 3300037068 Bacteria 1671
1121 Ga0373925_0259036 3300037068 Bacteria 1397
1122 Ga0373925_0337231 3300037068 Bacteria 1222
1123 Ga0373925_0774564 3300037068 Unclassified 791
1124 Ga0373925_0831281 3300037068 Bacteria 761
1125 Ga0373925_0992707 3300037068 Unclassified 691
1126 Ga0395899_0047074 3300037312 Bacteria 3211
1127 Ga0395899_0141540 3300037312 Bacteria 1711
1128 Ga0395899_0633035 3300037312 Unclassified 678
1129 Ga0395900_0008031 3300037418 Bacteria 10861
1130 Ga0395900_0014812 3300037418 Bacteria 7946
1131 Ga0395900_0111523 3300037418 Bacteria 2810
1132 Ga0395900_0706607 3300037418 Bacteria 941
1133 Ga0395900_0759771 3300037418 Unclassified 899
1134 Ga0395900_1784311 3300037418 Unclassified 526
1135 Ga0395898_0002044 3300037466 Bacteria 25218
1136 Ga0395898_0041866 3300037466 Bacteria 4522
1137 Ga0395898_0602115 3300037466 Bacteria 1042
1138 Ga0395905_0357397 3300037471 Bacteria 1353
1139 Ga0395905_0753845 3300037471 Unclassified 876
1140 Ga0395905_1300248 3300037471 Unclassified 631
1141 Ga0436364_0850081 3300037853 Bacteria 798
1142 Ga0395901_0002964 3300038443 Bacteria 17124
1143 Ga0395901_0064660 3300038443 Bacteria 3808
1144 Ga0395901_0173793 3300038443 Bacteria 2260
1145 Ga0395901_0437562 3300038443 Bacteria 1339
1146 Ga0436365_0345467 3300039437 Unclassified 755
1147 Ga0436363_1186420 3300039450 Unclassified 556
1148 Ga0436363_1236879 3300039450 Bacteria 675
1149 Ga0451789_1020370 3300041443 Unclassified 627
1150 Ga0451791_1864675 3300041451 Bacteria 610
1151 Ga0451793_0969996 3300041452 Bacteria 627
1152 Ga0451795_0375776 3300041456 Unclassified 525
1153 Ga0451802_0741526 3300041460 Unclassified 600
1154 Ga0451802_0769737 3300041460 Bacteria 616
1155 Ga0451802_1371756 3300041460 Bacteria 564
1156 Ga0451807_0068204 3300041486 Bacteria 1000
1157 Ga0451845_0545397 3300041501 Unclassified 990
1158 Ga0451849_0026473 3300041505 Unclassified 571
1159 Ga0451855_0802694 3300041511 Bacteria 542
1160 Ga0451853_0516564 3300041512 Unclassified 579
1161 Ga0451853_1896950 3300041512 Bacteria 860
1162 Ga0451853_1958043 3300041512 Unclassified 724
1163 Ga0451853_3591552 3300041512 Unclassified 602
1164 Ga0439448_0063421 3300042005 Bacteria 1224
1165 Ga0439448_0078090 3300042005 Unclassified 1109
1166 Ga0439451_039740 3300042009 Bacteria 945
1167 Ga0439451_067856 3300042009 Unclassified 714
1168 Ga0439454_003697 3300042011 Unclassified 1722
1169 Ga0439455_0005259 3300042012 Bacteria 2616
1170 Ga0439455_0209736 3300042012 Unclassified 565
1171 Ga0450905_061433 3300042142 Unclassified 628
1172 Ga0439458_0011685 3300042157 Bacteria 1965
1173 Ga0439458_0054144 3300042157 Bacteria 994
1174 Ga0439464_0082385 3300042439 Unclassified 962
1175 Ga0439440_0037206 3300042993 Bacteria 1174
1176 Ga0451576_0146081 3300045051 Bacteria 2466
1177 Ga0451576_0278466 3300045051 Bacteria 1749
1178 Ga0466967_0339308 3300045976 Bacteria 1453
1179 Ga0495592_0049064 3300046454 Unclassified 3138
1180 Ga0495592_0082388 3300046454 Bacteria 2325
1181 Ga0495603_0104836 3300046455 Unclassified 1650
1182 Ga0495603_0401225 3300046455 Unclassified 786
1183 Ga0495603_0407001 3300046455 Unclassified 780
1184 Ga0495590_0103909 3300046457 Unclassified 1011
1185 Ga0495629_0008333 3300046459 Bacteria 7622
1186 Ga0495629_0204547 3300046459 Bacteria 1364
1187 Ga0495629_0334860 3300046459 Bacteria 1034
1188 Ga0495629_0757639 3300046459 Bacteria 642
1189 Ga0495641_0062450 3300046461 Bacteria 1680
1190 Ga0495651_0122706 3300046462 Unclassified 1906
1191 Ga0495651_0371381 3300046462 Bacteria 940
1192 Ga0495651_0448787 3300046462 Bacteria 834
1193 Ga0495651_0511913 3300046462 Unclassified 767
1194 Ga0495651_0680814 3300046462 Unclassified 642
1195 Ga0495653_0360908 3300046463 Unclassified 932
1196 Ga0495653_0484627 3300046463 Unclassified 773
1197 Ga0495653_0679411 3300046463 Unclassified 627
1198 Ga0495580_0359881 3300046472 Unclassified 985
1199 Ga0495580_0597622 3300046472 Bacteria 729
1200 Ga0495580_0937449 3300046472 Unclassified 555
1201 Ga0495582_0314706 3300046473 Bacteria 900
1202 Ga0495605_0076983 3300046474 Bacteria 1566
1203 Ga0495639_0374997 3300046475 Unclassified 717
1204 Ga0495662_0056346 3300046476 Unclassified 1899
1205 Ga0495662_0342468 3300046476 Unclassified 735
1206 Ga0495664_0127274 3300046477 Bacteria 1541
1207 Ga0495664_0135201 3300046477 Bacteria 1494
1208 Ga0495594_0151606 3300046499 Bacteria 1316
1209 Ga0495607_0125264 3300046501 Bacteria 1344
1210 Ga0495608_0443139 3300046511 Unclassified 791
1211 Ga0495608_0454416 3300046511 Unclassified 779
1212 Ga0495608_0602489 3300046511 Unclassified 659
1213 Ga0495616_0311018 3300046513 Unclassified 663
1214 Ga0495618_0059321 3300046514 Bacteria 2425
1215 Ga0495618_0223091 3300046514 Unclassified 1188
1216 Ga0495618_0260021 3300046514 Bacteria 1087
1217 Ga0495628_0004287 3300046516 Bacteria 12686
1218 Ga0495628_0079826 3300046516 Unclassified 2544
1219 Ga0495630_0017678 3300046517 Bacteria 5227
1220 Ga0495630_0217786 3300046517 Unclassified 1457
1221 Ga0495630_1310000 3300046517 Unclassified 546
1222 Ga0495644_0096747 3300046523 Bacteria 1116
1223 Ga0495666_0122893 3300046526 Bacteria 1215
1224 Ga0495666_0492359 3300046526 Unclassified 548
1225 Ga0495642_0054188 3300046528 Bacteria 1654
1226 Ga0495652_0045601 3300046529 Bacteria 3767
1227 Ga0495652_0064185 3300046529 Unclassified 3089
1228 Ga0495665_0529948 3300046531 Unclassified 592
1229 Ga0495640_0027037 3300046533 Unclassified 4142
1230 Ga0495640_0354961 3300046533 Bacteria 904
1231 Ga0495640_0591582 3300046533 Bacteria 670
1232 Ga0495640_0776756 3300046533 Unclassified 572
1233 Ga0495586_0014140 3300046535 Bacteria 4240
1234 Ga0495586_0350618 3300046535 Bacteria 848
1235 Ga0495587_0004117 3300046536 Bacteria 9614
1236 Ga0495587_0101619 3300046536 Bacteria 1656
1237 Ga0495598_0000901 3300046537 Bacteria 5725
1238 Ga0495598_0012406 3300046537 Bacteria 2092
1239 Ga0495598_0016088 3300046537 Bacteria 1902
1240 Ga0495598_0029599 3300046537 Bacteria 1528
1241 Ga0495598_0148939 3300046537 Bacteria 815
1242 Ga0495621_0292057 3300046539 Bacteria 674
1243 Ga0495621_0438891 3300046539 Unclassified 558
1244 Ga0495645_0001076 3300046543 Bacteria 18525
1245 Ga0495645_0489335 3300046543 Unclassified 770
1246 Ga0495633_0290065 3300046558 Bacteria 744
1247 Ga0495667_0032250 3300046559 Bacteria 3513
1248 Ga0495667_0071324 3300046559 Bacteria 2266
1249 Ga0495668_0620313 3300046616 Unclassified 598
1250 Ga0495634_0131202 3300046642 Bacteria 1597
1251 Ga0495634_0355677 3300046642 Unclassified 876
1252 Ga0495611_0136393 3300046648 Bacteria 1146
1253 Ga0495635_0204821 3300046663 Bacteria 1337
1254 Ga0495635_0244606 3300046663 Bacteria 1210
1255 Ga0495635_0342139 3300046663 Unclassified 999
1256 Ga0495659_0280987 3300046664 Bacteria 699
1257 Ga0495659_0442193 3300046664 Bacteria 565
1258 Ga0495588_0189414 3300046674 Bacteria 1087
1259 Ga0495588_0212760 3300046674 Bacteria 1021
1260 Ga0495588_0650476 3300046674 Unclassified 552
1261 Ga0495657_0091838 3300046675 Bacteria 1946
1262 Ga0495657_0226063 3300046675 Bacteria 1133
1263 Ga0495599_0000317 3300046678 Bacteria 28802
1264 Ga0495623_0000811 3300046679 Bacteria 21045
1265 Ga0495646_0002940 3300046680 Bacteria 10561
1266 Ga0495646_0435121 3300046680 Unclassified 679
1267 Ga0495658_0145447 3300046683 Bacteria 1452
1268 Ga0495658_0209856 3300046683 Bacteria 1216
1269 Ga0495658_0460690 3300046683 Unclassified 812
1270 Ga0495658_0825100 3300046683 Unclassified 593
1271 Ga0495669_0032455 3300046684 Bacteria 2295
1272 Ga0495669_0039850 3300046684 Bacteria 2081
1273 Ga0495669_0178602 3300046684 Bacteria 1011
1274 Ga0495669_0478282 3300046684 Unclassified 605
1275 Ga0495669_0524567 3300046684 Unclassified 576
1276 Ga0495669_0610218 3300046684 Bacteria 531
1277 Ga0495613_0374245 3300046689 Unclassified 975
1278 Ga0495613_0381763 3300046689 Unclassified 963
1279 Ga0495613_0386688 3300046689 Bacteria 956
1280 Ga0495613_0463783 3300046689 Unclassified 857
1281 Ga0495624_0308077 3300046690 Bacteria 954
1282 Ga0495624_0508779 3300046690 Bacteria 720
1283 Ga0495624_0778555 3300046690 Unclassified 566
1284 Ga0495624_0894089 3300046690 Unclassified 523
1285 Ga0495624_0919858 3300046690 Unclassified 514
1286 Ga0495671_0555448 3300046692 Unclassified 547
1287 Ga0495600_0595268 3300046809 Unclassified 672
1288 Ga0495600_0807626 3300046809 Unclassified 558
1289 Ga0495581_0081281 3300047315 Bacteria 1876
1290 Ga0495604_0053697 3300047317 Bacteria 3112
1291 Ga0495604_0288710 3300047317 Bacteria 1105
1292 Ga0495604_0331125 3300047317 Bacteria 1016
1293 Ga0495604_0378222 3300047317 Unclassified 936
1294 Ga0495636_0151276 3300047318 Unclassified 1042
1295 Ga0495674_0195915 3300047319 Bacteria 1678
1296 Ga0495674_0400841 3300047319 Bacteria 1107
1297 Ga0495674_0599809 3300047319 Bacteria 872
1298 Ga0495674_0882155 3300047319 Unclassified 691
1299 Ga0495676_0261423 3300047321 Bacteria 1177
1300 Ga0495676_0315817 3300047321 Unclassified 1051
1301 Ga0495676_0394561 3300047321 Bacteria 919
1302 Ga0495680_0209613 3300047322 Bacteria 1395
1303 Ga0495675_0002584 3300047444 Bacteria 10850
1304 Ga0495675_0044543 3300047444 Unclassified 2826
1305 Ga0495679_120646 3300047446 Unclassified 717
1306 Ga0495685_086151 3300047447 Bacteria 1044
1307 Ga0495685_184777 3300047447 Bacteria 671
1308 Ga0495684_0029134 3300047471 Unclassified 4237
1309 Ga0495684_0064236 3300047471 Bacteria 2789
1310 Ga0495684_0218935 3300047471 Bacteria 1397
1311 Ga0495602_0109432 3300048088 Unclassified 2248
1312 Ga0495602_0121992 3300048088 Bacteria 2095
1313 Ga0495602_0593907 3300048088 Unclassified 762
1314 Ga0495602_0977255 3300048088 Bacteria 560
1315 Ga0495615_0317945 3300048090 Unclassified 508
1316 Ga0495626_0170422 3300048091 Unclassified 908
1317 Ga0496100_0146491 3300048903 Bacteria 1680
1318 Ga0496100_0253997 3300048903 Bacteria 1301
1319 Ga0496100_0998686 3300048903 Unclassified 658
1320 Ga0496101_0033960 3300048904 Bacteria 3602
1321 Ga0496101_0120036 3300048904 Bacteria 1987
1322 Ga0496101_0133843 3300048904 Unclassified 1884
1323 Ga0496101_0244550 3300048904 Bacteria 1397
1324 Ga0496101_0420246 3300048904 Bacteria 1054
1325 Ga0496101_0531947 3300048904 Bacteria 929
1326 Ga0496101_1119624 3300048904 Bacteria 618
1327 Ga0496102_0018921 3300048905 Bacteria 6059
1328 Ga0496102_0028763 3300048905 Bacteria 4968
1329 Ga0496102_0035336 3300048905 Bacteria 4498
1330 Ga0496102_0081398 3300048905 Bacteria 2985
1331 Ga0496102_0120716 3300048905 Bacteria 2448
1332 Ga0496102_0499163 3300048905 Unclassified 1139
1333 Ga0496102_0712924 3300048905 Bacteria 926
1334 Ga0496102_0809927 3300048905 Unclassified 859
1335 Ga0496103_0153708 3300048906 Unclassified 1474
1336 Ga0496103_0220069 3300048906 Bacteria 1221
1337 Ga0496103_0242836 3300048906 Bacteria 1159
1338 Ga0496103_0393747 3300048906 Bacteria 890
1339 Ga0496103_0773709 3300048906 Unclassified 606
1340 Ga0496104_0072184 3300048907 Bacteria 3282
1341 Ga0496104_0102699 3300048907 Bacteria 2738
1342 Ga0496104_0108532 3300048907 Bacteria 2660
1343 Ga0496104_0136889 3300048907 Bacteria 2353
1344 Ga0496104_0168761 3300048907 Bacteria 2099
1345 Ga0496104_0291714 3300048907 Unclassified 1544
1346 Ga0496104_0699020 3300048907 Unclassified 922
1347 Ga0496104_0909073 3300048907 Bacteria 785
1348 Ga0496104_1609662 3300048907 Unclassified 552
1349 Ga0496105_0014160 3300048908 Bacteria 6346
1350 Ga0496105_0044348 3300048908 Bacteria 3668
1351 Ga0496105_0201100 3300048908 Bacteria 1626
1352 Ga0496105_0228200 3300048908 Bacteria 1514
1353 Ga0496105_0424240 3300048908 Unclassified 1053
1354 Ga0496105_0495460 3300048908 Bacteria 960
1355 Ga0496105_1023973 3300048908 Bacteria 616
1356 Ga0496106_0003085 3300048909 Bacteria 12426
1357 Ga0496106_0181663 3300048909 Bacteria 1670
1358 Ga0496106_0243904 3300048909 Bacteria 1436
1359 Ga0496106_0669279 3300048909 Unclassified 829
1360 Ga0496106_1489843 3300048909 Unclassified 521
1361 Ga0496107_0018540 3300048910 Bacteria 4901
1362 Ga0496107_0057367 3300048910 Bacteria 2815
1363 Ga0496107_0515995 3300048910 Unclassified 886
1364 Ga0496107_0701611 3300048910 Bacteria 744
1365 Ga0496108_0074789 3300048911 Bacteria 2861
1366 Ga0496108_0227271 3300048911 Bacteria 1622
1367 Ga0496108_0278310 3300048911 Unclassified 1457
1368 Ga0496108_0289492 3300048911 Bacteria 1426
1369 Ga0496108_0385699 3300048911 Unclassified 1223
1370 Ga0496108_0647903 3300048911 Bacteria 918
1371 Ga0496108_0735373 3300048911 Unclassified 854
1372 Ga0496108_1474427 3300048911 Unclassified 567
1373 Ga0496109_0007242 3300048912 Bacteria 9381
1374 Ga0496109_0063355 3300048912 Bacteria 3382
1375 Ga0496109_0402868 3300048912 Bacteria 1292
1376 Ga0496109_0427849 3300048912 Bacteria 1251
1377 Ga0496109_0477618 3300048912 Unclassified 1177
1378 Ga0496109_0583767 3300048912 Unclassified 1053
1379 Ga0496109_0661893 3300048912 Bacteria 981
1380 Ga0496109_0664459 3300048912 Bacteria 979
1381 Ga0496109_1056448 3300048912 Bacteria 749
1382 Ga0496109_1264628 3300048912 Unclassified 674
1383 Ga0496110_0085553 3300048913 Bacteria 2814
1384 Ga0496110_0167148 3300048913 Bacteria 1995
1385 Ga0496110_0209266 3300048913 Bacteria 1773
1386 Ga0496110_0348670 3300048913 Bacteria 1349
1387 Ga0496110_0504270 3300048913 Bacteria 1102
1388 Ga0496110_0633012 3300048913 Bacteria 969
1389 Ga0496110_0957120 3300048913 Unclassified 763
1390 Ga0496111_0090259 3300048914 Bacteria 2245
1391 Ga0496111_0162316 3300048914 Unclassified 1659
1392 Ga0496111_0486546 3300048914 Bacteria 909
1393 Ga0496111_1002304 3300048914 Bacteria 598
1394 Ga0496112_0190669 3300048915 Unclassified 2012
1395 Ga0496112_0198324 3300048915 Bacteria 1967
1396 Ga0496112_0221378 3300048915 Bacteria 1848
1397 Ga0496112_0223765 3300048915 Unclassified 1837
1398 Ga0496112_0225271 3300048915 Bacteria 1830
1399 Ga0496112_0245973 3300048915 Bacteria 1740
1400 Ga0496112_0320945 3300048915 Unclassified 1493
1401 Ga0496112_0360815 3300048915 Bacteria 1395
1402 Ga0496112_0394307 3300048915 Unclassified 1324
1403 Ga0496112_0481075 3300048915 Bacteria 1178
1404 Ga0496112_0753857 3300048915 Bacteria 900
1405 Ga0496112_1117331 3300048915 Unclassified 706
1406 Ga0496113_0069914 3300048916 Bacteria 2667
1407 Ga0496113_0102219 3300048916 Bacteria 2222
1408 Ga0496113_0322952 3300048916 Unclassified 1237
1409 Ga0496113_0565248 3300048916 Unclassified 912
1410 Ga0496113_0630181 3300048916 Unclassified 858
1411 Ga0496113_0916518 3300048916 Unclassified 693
1412 Ga0496113_1029711 3300048916 Unclassified 648
1413 Ga0496114_0012997 3300048917 Bacteria 6672
1414 Ga0496114_0035218 3300048917 Bacteria 4133
1415 Ga0496114_0115165 3300048917 Bacteria 2306
1416 Ga0496114_0533694 3300048917 Unclassified 1037
1417 Ga0496114_0582057 3300048917 Bacteria 988
1418 Ga0496114_0598799 3300048917 Bacteria 972
1419 Ga0496115_0002575 3300048918 Bacteria 13018
1420 Ga0496115_0004314 3300048918 Bacteria 10290
1421 Ga0496115_0009305 3300048918 Bacteria 7301
1422 Ga0496115_0026271 3300048918 Bacteria 4543
1423 Ga0496115_0128133 3300048918 Bacteria 2091
1424 Ga0496115_0177184 3300048918 Bacteria 1763
1425 Ga0496115_0294208 3300048918 Bacteria 1331
1426 Ga0496115_0387746 3300048918 Bacteria 1135
1427 Ga0496115_1437681 3300048918 Unclassified 508
1428 Ga0501068_0449667 3300049584 Unclassified 833
1429 Ga0501069_0570360 3300049585 Unclassified 678
1430 nmdc:mga05p37_135223_c1 3300050507 Bacteria 3024
1431 nmdc:mga05p37_2087035_c1 3300050507 Bacteria 532
1432 nmdc:mga05p37_2090916_c1 3300050507 Unclassified 531
1433 nmdc:mga05p37_35285_c2 3300050507 Bacteria 4319
1434 nmdc:mga05p37_473501_c1 3300050507 Bacteria 1444
1435 nmdc:mga06r32_971239_c1 3300050510 Bacteria 803
1436 nmdc:mga08y16_1099761_c1 3300050511 Unclassified 770
1437 nmdc:mga08y16_1770500_c1 3300050511 Unclassified 571
1438 nmdc:mga08y16_247448_c1 3300050511 Bacteria 1842
1439 nmdc:mga08y16_738675_c1 3300050511 Unclassified 981
1440 nmdc:mga08y16_811526_c1 3300050511 Unclassified 928
1441 nmdc:mga0n895_1162717_c1 3300050512 Unclassified 747
1442 nmdc:mga0n895_1466075_c1 3300050512 Unclassified 649
1443 nmdc:mga0n895_212360_c1 3300050512 Bacteria 1965
1444 nmdc:mga0n895_233774_c1 3300050512 Unclassified 1345
1445 nmdc:mga0n895_759064_c1 3300050512 Unclassified 962
1446 nmdc:mga0n895_784220_c1 3300050512 Bacteria 944
1447 nmdc:mga0n895_929477_c1 3300050512 Unclassified 854
1448 nmdc:mga0rr50_1203860_c1 3300050513 Bacteria 643
1449 nmdc:mga0rr50_383536_c1 3300050513 Bacteria 1185
1450 nmdc:mga08x19_266662_c1 3300050514 Unclassified 1184
1451 nmdc:mga08x19_28098_c1 3300050514 Bacteria 3521
1452 nmdc:mga08x19_520835_c1 3300050514 Unclassified 840
1453 nmdc:mga08x19_631307_c1 3300050514 Unclassified 759
1454 nmdc:mga0a205_1135164_c1 3300050515 Unclassified 629
1455 nmdc:mga0a205_415093_c1 3300050515 Unclassified 1208
1456 Ga0495601_0001921 3300053077 Bacteria 11624
1457 Ga0495601_0027550 3300053077 Unclassified 3514
1458 Ga0495601_0292224 3300053077 Bacteria 1062
1459 Ga0495612_0031116 3300053078 Unclassified 2151
1460 Ga0495655_0145261 3300053083 Unclassified 742
1461 Ga0495655_0362173 3300053083 Unclassified 509
1462 Ga0495595_0035542 3300053084 Bacteria 2257
1463 Ga0495595_0039367 3300053084 Unclassified 2156
1464 Ga0495595_0090399 3300053084 Bacteria 1468
1465 Ga0495595_0431575 3300053084 Unclassified 669
1466 Ga0495619_0083552 3300053085 Bacteria 2154
1467 Ga0495619_0164194 3300053085 Bacteria 1534
1468 Ga0495619_0259855 3300053085 Unclassified 1203
1469 Ga0495619_0272881 3300053085 Bacteria 1172
1470 Ga0500618_058191 3300053125 Unclassified 870
1471 Ga0500636_0323809 3300053177 Unclassified 748
1472 Ga0500657_161662 3300053728 Bacteria 811

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005290 Ga0065712_10597168 Ga0065712_105971682 59
2 3300005331 Ga0070670_100000833 Ga0070670_10000083327 59
3 3300005331 Ga0070670_100003742 Ga0070670_10000374219 59
4 3300005335 Ga0070666_10130584 Ga0070666_101305844 59
5 3300005335 Ga0070666_11014759 Ga0070666_110147592 59
6 3300005338 Ga0068868_100031931 Ga0068868_1000319316 59
7 3300005347 Ga0070668_100000403 Ga0070668_10000040329 59
8 3300005355 Ga0070671_100000283 Ga0070671_10000028337 59
9 3300005355 Ga0070671_100872664 Ga0070671_1008726643 59
10 3300005364 Ga0070673_100999699 Ga0070673_1009996992 59
11 3300005364 Ga0070673_102383003 Ga0070673_1023830031 59
12 3300005435 Ga0070714_100477608 Ga0070714_1004776082 59
13 3300005456 Ga0070678_101641204 Ga0070678_1016412042 59
14 3300005530 Ga0070679_101214875 Ga0070679_1012148752 59
15 3300005543 Ga0070672_101129499 Ga0070672_1011294992 59
16 3300005548 Ga0070665_100024438 Ga0070665_1000244389 59
17 3300005564 Ga0070664_100121453 Ga0070664_1001214533 59
18 3300005616 Ga0068852_100902141 Ga0068852_1009021412 59
19 3300005844 Ga0068862_100258378 Ga0068862_1002583783 59
20 3300006237 Ga0097621_100018403 Ga0097621_1000184035 59
21 3300006358 Ga0068871_100038389 Ga0068871_1000383893 59
22 3300006881 Ga0068865_100017414 Ga0068865_1000174147 59
23 3300006914 Ga0075436_100089519 Ga0075436_1000895193 59
24 3300006914 Ga0075436_100313760 Ga0075436_1003137602 59
25 3300025315 Ga0207697_10000010 Ga0207697_1000001059 59
26 3300025899 Ga0207642_10142597 Ga0207642_101425973 59
27 3300025901 Ga0207688_10007718 Ga0207688_1000771811 59
28 3300025903 Ga0207680_10094129 Ga0207680_100941294 59
29 3300025907 Ga0207645_10004432 Ga0207645_1000443210 59
30 3300025925 Ga0207650_10007428 Ga0207650_1000742810 59
31 3300025931 Ga0207644_10058479 Ga0207644_100584794 59
32 3300025936 Ga0207670_10246226 Ga0207670_102462261 59
33 3300025938 Ga0207704_10046539 Ga0207704_100465395 59
34 3300025940 Ga0207691_10000142 Ga0207691_1000014215 59
35 3300025960 Ga0207651_10007253 Ga0207651_100072532 59
36 3300025972 Ga0207668_10009836 Ga0207668_100098368 59
37 3300026142 Ga0207698_10435666 Ga0207698_104356663 59
38 3300028379 Ga0268266_10004179 Ga0268266_1000417910 59
39 3300039450 Ga0436363_1186420 Ga0436363_1186420_19_216 59
40 3300048904 Ga0496101_0531947 Ga0496101_0531947_11_208 59
41 3300005289 Ga0065704_10097735 Ga0065704_100977353 62
42 3300005435 Ga0070714_101950425 Ga0070714_1019504252 64
43 3300005445 Ga0070708_100958394 Ga0070708_1009583942 64
44 3300005471 Ga0070698_100225558 Ga0070698_1002255582 64
45 3300006871 Ga0075434_101015835 Ga0075434_1010158352 64
46 3300025910 Ga0207684_10000028 Ga0207684_1000002816 64
47 3300025922 Ga0207646_10005640 Ga0207646_100056406 64
48 3300025929 Ga0207664_11665513 Ga0207664_116655132 64
49 3300025936 Ga0207670_11168912 Ga0207670_111689123 64
50 3300037418 Ga0395900_1784311 Ga0395900_1784311_204_407 64
51 3300050512 nmdc:mga0n895_929477_c1 nmdc:mga0n895_929477_c1_473_670 64
52 3300005289 Ga0065704_10002652 Ga0065704_1000265214 65
53 3300005289 Ga0065704_10282058 Ga0065704_102820583 65
54 3300005289 Ga0065704_10306099 Ga0065704_103060991 65
55 3300005290 Ga0065712_10072999 Ga0065712_100729995 65
56 3300005290 Ga0065712_10121918 Ga0065712_101219185 65
57 3300005290 Ga0065712_10320047 Ga0065712_103200473 65
58 3300005293 Ga0065715_10024370 Ga0065715_100243704 65
59 3300005293 Ga0065715_10389010 Ga0065715_103890102 65
60 3300005293 Ga0065715_10884699 Ga0065715_108846992 65
61 3300005295 Ga0065707_10007089 Ga0065707_100070895 65
62 3300005295 Ga0065707_10470003 Ga0065707_104700032 65
63 3300005328 Ga0070676_10031330 Ga0070676_100313303 65
64 3300005328 Ga0070676_10441948 Ga0070676_104419482 65
65 3300005331 Ga0070670_100260744 Ga0070670_1002607443 65
66 3300005333 Ga0070677_10566592 Ga0070677_105665922 65
67 3300005334 Ga0068869_100412385 Ga0068869_1004123853 65
68 3300005335 Ga0070666_10037434 Ga0070666_100374343 65
69 3300005335 Ga0070666_10827198 Ga0070666_108271981 65
70 3300005338 Ga0068868_100059779 Ga0068868_1000597794 65
71 3300005338 Ga0068868_100201460 Ga0068868_1002014602 65
72 3300005339 Ga0070660_100408877 Ga0070660_1004088772 65
73 3300005340 Ga0070689_101513560 Ga0070689_1015135601 65
74 3300005343 Ga0070687_100711471 Ga0070687_1007114711 65
75 3300005344 Ga0070661_101207687 Ga0070661_1012076872 65
76 3300005344 Ga0070661_101588495 Ga0070661_1015884952 65
77 3300005347 Ga0070668_100004836 Ga0070668_1000048365 65
78 3300005347 Ga0070668_100519859 Ga0070668_1005198592 65
79 3300005353 Ga0070669_100064706 Ga0070669_1000647062 65
80 3300005354 Ga0070675_101142101 Ga0070675_1011421012 65
81 3300005354 Ga0070675_101652152 Ga0070675_1016521522 65
82 3300005355 Ga0070671_100149154 Ga0070671_1001491543 65
83 3300005355 Ga0070671_100198585 Ga0070671_1001985853 65
84 3300005356 Ga0070674_100000912 Ga0070674_10000091220 65
85 3300005356 Ga0070674_100341788 Ga0070674_1003417882 65
86 3300005364 Ga0070673_100017182 Ga0070673_1000171826 65
87 3300005364 Ga0070673_101564425 Ga0070673_1015644251 65
88 3300005367 Ga0070667_100773818 Ga0070667_1007738183 65
89 3300005434 Ga0070709_10042905 Ga0070709_100429053 65
90 3300005434 Ga0070709_10232892 Ga0070709_102328922 65
91 3300005434 Ga0070709_10238921 Ga0070709_102389212 65
92 3300005435 Ga0070714_100493973 Ga0070714_1004939732 65
93 3300005435 Ga0070714_100917821 Ga0070714_1009178211 65
94 3300005435 Ga0070714_100959005 Ga0070714_1009590053 65
95 3300005436 Ga0070713_100702222 Ga0070713_1007022222 65
96 3300005436 Ga0070713_101618955 Ga0070713_1016189551 65
97 3300005437 Ga0070710_10086739 Ga0070710_100867393 65
98 3300005437 Ga0070710_10998595 Ga0070710_109985952 65
99 3300005438 Ga0070701_10410151 Ga0070701_104101513 65
100 3300005439 Ga0070711_100005001 Ga0070711_1000050015 65
101 3300005439 Ga0070711_100647742 Ga0070711_1006477421 65
102 3300005440 Ga0070705_100035279 Ga0070705_1000352796 65
103 3300005455 Ga0070663_100528518 Ga0070663_1005285183 65
104 3300005455 Ga0070663_100896687 Ga0070663_1008966872 65
105 3300005456 Ga0070678_100399598 Ga0070678_1003995982 65
106 3300005456 Ga0070678_100699967 Ga0070678_1006999673 65
107 3300005457 Ga0070662_100037174 Ga0070662_1000371745 65
108 3300005457 Ga0070662_100099149 Ga0070662_1000991494 65
109 3300005457 Ga0070662_100579263 Ga0070662_1005792632 65
110 3300005458 Ga0070681_10964939 Ga0070681_109649392 65
111 3300005459 Ga0068867_100383797 Ga0068867_1003837973 65
112 3300005467 Ga0070706_100025982 Ga0070706_1000259824 65
113 3300005468 Ga0070707_100032046 Ga0070707_10003204610 65
114 3300005536 Ga0070697_100326741 Ga0070697_1003267412 65
115 3300005543 Ga0070672_100050273 Ga0070672_1000502734 65
116 3300005543 Ga0070672_101107711 Ga0070672_1011077111 65
117 3300005546 Ga0070696_100058415 Ga0070696_1000584156 65
118 3300005546 Ga0070696_101979962 Ga0070696_1019799621 65
119 3300005547 Ga0070693_100807177 Ga0070693_1008071771 65
120 3300005548 Ga0070665_101338704 Ga0070665_1013387042 65
121 3300005549 Ga0070704_100227148 Ga0070704_1002271483 65
122 3300005563 Ga0068855_102313345 Ga0068855_1023133452 65
123 3300005614 Ga0068856_100237795 Ga0068856_1002377953 65
124 3300005614 Ga0068856_102303089 Ga0068856_1023030891 65
125 3300005615 Ga0070702_100018870 Ga0070702_1000188702 65
126 3300005718 Ga0068866_10041728 Ga0068866_100417283 65
127 3300005719 Ga0068861_100173761 Ga0068861_1001737612 65
128 3300005843 Ga0068860_100174781 Ga0068860_1001747812 65
129 3300005844 Ga0068862_101842946 Ga0068862_1018429462 65
130 3300006163 Ga0070715_10100296 Ga0070715_101002963 65
131 3300006173 Ga0070716_100608707 Ga0070716_1006087073 65
132 3300006173 Ga0070716_101035850 Ga0070716_1010358502 65
133 3300006175 Ga0070712_100010939 Ga0070712_1000109399 65
134 3300006175 Ga0070712_100598006 Ga0070712_1005980063 65
135 3300006175 Ga0070712_101025854 Ga0070712_1010258541 65
136 3300006358 Ga0068871_101285743 Ga0068871_1012857432 65
137 3300006871 Ga0075434_101178183 Ga0075434_1011781832 65
138 3300006871 Ga0075434_101790846 Ga0075434_1017908462 65
139 3300006914 Ga0075436_100283948 Ga0075436_1002839482 65
140 3300007076 Ga0075435_100988217 Ga0075435_1009882173 65
141 3300007788 Ga0099795_10056361 Ga0099795_100563612 65
142 3300009101 Ga0105247_10223822 Ga0105247_102238223 65
143 3300009174 Ga0105241_11992440 Ga0105241_119924402 65
144 3300009176 Ga0105242_10229921 Ga0105242_102299212 65
145 3300009177 Ga0105248_11410730 Ga0105248_114107302 65
146 3300009553 Ga0105249_11320275 Ga0105249_113202751 65
147 3300010159 Ga0099796_10005301 Ga0099796_100053017 65
148 3300010375 Ga0105239_10292714 Ga0105239_102927143 65
149 3300011119 Ga0105246_10874569 Ga0105246_108745692 65
150 3300012488 Ga0157343_1016333 Ga0157343_10163333 65
151 3300012505 Ga0157339_1012990 Ga0157339_10129901 65
152 3300012506 Ga0157324_1023983 Ga0157324_10239832 65
153 3300012508 Ga0157315_1060043 Ga0157315_10600432 65
154 3300013100 Ga0157373_10698598 Ga0157373_106985981 65
155 3300013102 Ga0157371_10265362 Ga0157371_102653623 65
156 3300013102 Ga0157371_11321911 Ga0157371_113219112 65
157 3300013296 Ga0157374_10019745 Ga0157374_100197456 65
158 3300013296 Ga0157374_11011256 Ga0157374_110112562 65
159 3300013297 Ga0157378_10644156 Ga0157378_106441563 65
160 3300013297 Ga0157378_11552705 Ga0157378_115527052 65
161 3300013306 Ga0163162_10017445 Ga0163162_100174455 65
162 3300013306 Ga0163162_10300351 Ga0163162_103003512 65
163 3300013307 Ga0157372_10912415 Ga0157372_109124152 65
164 3300013308 Ga0157375_10136768 Ga0157375_101367685 65
165 3300013308 Ga0157375_10138523 Ga0157375_101385235 65
166 3300013308 Ga0157375_11011837 Ga0157375_110118373 65
167 3300014745 Ga0157377_10608791 Ga0157377_106087911 65
168 3300014745 Ga0157377_11466850 Ga0157377_114668502 65
169 3300014968 Ga0157379_10362342 Ga0157379_103623422 65
170 3300014969 Ga0157376_10064325 Ga0157376_100643253 65
171 3300014969 Ga0157376_10943728 Ga0157376_109437282 65
172 3300014969 Ga0157376_12876303 Ga0157376_128763032 65
173 3300017792 Ga0163161_10046543 Ga0163161_100465433 65
174 3300017792 Ga0163161_10125832 Ga0163161_101258324 65
175 3300025290 Ga0207673_1055722 Ga0207673_10557222 65
176 3300025315 Ga0207697_10000131 Ga0207697_1000013132 65
177 3300025315 Ga0207697_10000495 Ga0207697_1000049510 65
178 3300025315 Ga0207697_10229814 Ga0207697_102298142 65
179 3300025315 Ga0207697_10274420 Ga0207697_102744202 65
180 3300025893 Ga0207682_10024517 Ga0207682_100245172 65
181 3300025898 Ga0207692_10123175 Ga0207692_101231754 65
182 3300025899 Ga0207642_10073381 Ga0207642_100733813 65
183 3300025901 Ga0207688_10014566 Ga0207688_100145662 65
184 3300025903 Ga0207680_10921954 Ga0207680_109219542 65
185 3300025905 Ga0207685_10664344 Ga0207685_106643441 65
186 3300025906 Ga0207699_10020861 Ga0207699_100208612 65
187 3300025906 Ga0207699_11018544 Ga0207699_110185442 65
188 3300025907 Ga0207645_10004253 Ga0207645_100042537 65
189 3300025907 Ga0207645_10363541 Ga0207645_103635413 65
190 3300025910 Ga0207684_10422941 Ga0207684_104229411 65
191 3300025915 Ga0207693_10000889 Ga0207693_1000088925 65
192 3300025915 Ga0207693_10496489 Ga0207693_104964893 65
193 3300025916 Ga0207663_10002290 Ga0207663_1000229013 65
194 3300025916 Ga0207663_10135856 Ga0207663_101358565 65
195 3300025918 Ga0207662_10074228 Ga0207662_100742284 65
196 3300025919 Ga0207657_10860162 Ga0207657_108601623 65
197 3300025920 Ga0207649_10520278 Ga0207649_105202782 65
198 3300025921 Ga0207652_11202675 Ga0207652_112026751 65
199 3300025923 Ga0207681_10234539 Ga0207681_102345392 65
200 3300025923 Ga0207681_10655769 Ga0207681_106557692 65
201 3300025925 Ga0207650_10006836 Ga0207650_1000683611 65
202 3300025926 Ga0207659_10222696 Ga0207659_102226963 65
203 3300025926 Ga0207659_10225081 Ga0207659_102250813 65
204 3300025926 Ga0207659_10807541 Ga0207659_108075412 65
205 3300025928 Ga0207700_10185843 Ga0207700_101858435 65
206 3300025929 Ga0207664_11417441 Ga0207664_114174412 65
207 3300025931 Ga0207644_10033707 Ga0207644_100337074 65
208 3300025931 Ga0207644_10545561 Ga0207644_105455612 65
209 3300025933 Ga0207706_10070025 Ga0207706_100700257 65
210 3300025933 Ga0207706_10532738 Ga0207706_105327383 65
211 3300025937 Ga0207669_10007177 Ga0207669_100071773 65
212 3300025938 Ga0207704_10949398 Ga0207704_109493981 65
213 3300025939 Ga0207665_10046134 Ga0207665_100461343 65
214 3300025939 Ga0207665_10048049 Ga0207665_100480492 65
215 3300025939 Ga0207665_10192231 Ga0207665_101922313 65
216 3300025940 Ga0207691_10000247 Ga0207691_1000024714 65
217 3300025941 Ga0207711_11097234 Ga0207711_110972342 65
218 3300025949 Ga0207667_11436943 Ga0207667_114369432 65
219 3300025960 Ga0207651_10098725 Ga0207651_100987253 65
220 3300025961 Ga0207712_10873704 Ga0207712_108737042 65
221 3300025972 Ga0207668_10079305 Ga0207668_100793056 65
222 3300025972 Ga0207668_12007131 Ga0207668_120071312 65
223 3300025986 Ga0207658_10336677 Ga0207658_103366771 65
224 3300026023 Ga0207677_10091729 Ga0207677_100917293 65
225 3300026023 Ga0207677_10433420 Ga0207677_104334203 65
226 3300026023 Ga0207677_10733847 Ga0207677_107338472 65
227 3300026035 Ga0207703_10203169 Ga0207703_102031693 65
228 3300026078 Ga0207702_11133263 Ga0207702_111332631 65
229 3300026118 Ga0207675_100094187 Ga0207675_1000941877 65
230 3300026121 Ga0207683_10006977 Ga0207683_100069774 65
231 3300026121 Ga0207683_10008842 Ga0207683_100088427 65
232 3300026121 Ga0207683_10887783 Ga0207683_108877832 65
233 3300028379 Ga0268266_10787947 Ga0268266_107879472 65
234 3300028380 Ga0268265_11672712 Ga0268265_116727122 65
235 3300028381 Ga0268264_10458954 Ga0268264_104589542 65
236 3300035083 Ga0373926_0467032 Ga0373926_0467032_188_385 65
237 3300035089 Ga0373944_0030278 Ga0373944_0030278_970_1167 65
238 3300035092 Ga0373952_0131002 Ga0373952_0131002_47_244 65
239 3300035116 Ga0373945_0017219 Ga0373945_0017219_920_1117 65
240 3300035170 Ga0373943_0005531 Ga0373943_0005531_160_357 65
241 3300035170 Ga0373943_0220985 Ga0373943_0220985_793_990 65
242 3300035170 Ga0373943_0237915 Ga0373943_0237915_29_226 65
243 3300035170 Ga0373943_0355223 Ga0373943_0355223_600_797 65
244 3300035171 Ga0373946_0043328 Ga0373946_0043328_958_1155 65
245 3300035171 Ga0373946_0226075 Ga0373946_0226075_340_537 65
246 3300035207 Ga0373942_0045221 Ga0373942_0045221_953_1150 65
247 3300035691 Ga0373931_0027301 Ga0373931_0027301_1204_1401 65
248 3300035691 Ga0373931_0062699 Ga0373931_0062699_1174_1371 65
249 3300035692 Ga0373935_0100133 Ga0373935_0100133_1267_1464 65
250 3300035692 Ga0373935_0459287 Ga0373935_0459287_278_475 65
251 3300035695 Ga0373927_0031651 Ga0373927_0031651_277_474 65
252 3300035695 Ga0373927_0125798 Ga0373927_0125798_105_302 65
253 3300035695 Ga0373927_0202058 Ga0373927_0202058_978_1175 65
254 3300035725 Ga0373947_0107458 Ga0373947_0107458_322_519 65
255 3300035725 Ga0373947_0113974 Ga0373947_0113974_702_899 65
256 3300037068 Ga0373925_0337231 Ga0373925_0337231_593_790 65
257 3300037068 Ga0373925_0992707 Ga0373925_0992707_210_407 65
258 3300037312 Ga0395899_0141540 Ga0395899_0141540_1194_1391 65
259 3300037418 Ga0395900_0014812 Ga0395900_0014812_212_409 65
260 3300037466 Ga0395898_0041866 Ga0395898_0041866_2461_2658 65
261 3300038443 Ga0395901_0173793 Ga0395901_0173793_1910_2107 65
262 3300046472 Ga0495580_0597622 Ga0495580_0597622_443_640 65
263 3300046472 Ga0495580_0937449 Ga0495580_0937449_110_307 65
264 3300046513 Ga0495616_0311018 Ga0495616_0311018_380_577 65
265 3300046528 Ga0495642_0054188 Ga0495642_0054188_914_1111 65
266 3300046537 Ga0495598_0000901 Ga0495598_0000901_1379_1576 65
267 3300046558 Ga0495633_0290065 Ga0495633_0290065_64_261 65
268 3300046664 Ga0495659_0280987 Ga0495659_0280987_465_662 65
269 3300046684 Ga0495669_0032455 Ga0495669_0032455_1966_2163 65
270 3300047446 Ga0495679_120646 Ga0495679_120646_477_674 65
271 3300047447 Ga0495685_184777 Ga0495685_184777_447_644 65
272 3300048903 Ga0496100_0146491 Ga0496100_0146491_1311_1508 65
273 3300048904 Ga0496101_0133843 Ga0496101_0133843_926_1123 65
274 3300048905 Ga0496102_0018921 Ga0496102_0018921_4128_4325 65
275 3300048905 Ga0496102_0499163 Ga0496102_0499163_336_533 65
276 3300048906 Ga0496103_0153708 Ga0496103_0153708_1182_1379 65
277 3300048906 Ga0496103_0773709 Ga0496103_0773709_373_570 65
278 3300048907 Ga0496104_0072184 Ga0496104_0072184_826_1023 65
279 3300048907 Ga0496104_0291714 Ga0496104_0291714_322_519 65
280 3300048907 Ga0496104_0909073 Ga0496104_0909073_217_414 65
281 3300048908 Ga0496105_0044348 Ga0496105_0044348_3437_3634 65
282 3300048908 Ga0496105_0495460 Ga0496105_0495460_712_909 65
283 3300048909 Ga0496106_0003085 Ga0496106_0003085_10665_10862 65
284 3300048909 Ga0496106_0243904 Ga0496106_0243904_148_345 65
285 3300048910 Ga0496107_0018540 Ga0496107_0018540_3863_4060 65
286 3300048910 Ga0496107_0057367 Ga0496107_0057367_1202_1399 65
287 3300048911 Ga0496108_0074789 Ga0496108_0074789_1663_1860 65
288 3300048911 Ga0496108_0278310 Ga0496108_0278310_585_782 65
289 3300048911 Ga0496108_0647903 Ga0496108_0647903_313_510 65
290 3300048912 Ga0496109_0477618 Ga0496109_0477618_414_611 65
291 3300048912 Ga0496109_0664459 Ga0496109_0664459_666_863 65
292 3300048912 Ga0496109_1056448 Ga0496109_1056448_301_498 65
293 3300048913 Ga0496110_0209266 Ga0496110_0209266_422_619 65
294 3300048913 Ga0496110_0633012 Ga0496110_0633012_720_917 65
295 3300048914 Ga0496111_0090259 Ga0496111_0090259_1502_1699 65
296 3300048914 Ga0496111_0486546 Ga0496111_0486546_470_667 65
297 3300048915 Ga0496112_0198324 Ga0496112_0198324_839_1036 65
298 3300048915 Ga0496112_0225271 Ga0496112_0225271_1209_1406 65
299 3300048915 Ga0496112_0481075 Ga0496112_0481075_239_436 65
300 3300048915 Ga0496112_0753857 Ga0496112_0753857_507_704 65
301 3300048916 Ga0496113_0322952 Ga0496113_0322952_151_348 65
302 3300048918 Ga0496115_0009305 Ga0496115_0009305_6122_6319 65
303 3300048918 Ga0496115_0177184 Ga0496115_0177184_574_771 65
304 3300050512 nmdc:mga0n895_784220_c1 nmdc:mga0n895_784220_c1_727_924 65
305 3300050514 nmdc:mga08x19_266662_c1 nmdc:mga08x19_266662_c1_861_1058 65
306 3300053083 Ga0495655_0362173 Ga0495655_0362173_179_376 65
307 3300003203 JGI25406J46586_10000001 JGI25406J46586_10000001193 66
308 3300003203 JGI25406J46586_10000007 JGI25406J46586_1000000781 66
309 3300005293 Ga0065715_10067002 Ga0065715_100670022 66
310 3300005440 Ga0070705_101002997 Ga0070705_1010029972 66
311 3300005445 Ga0070708_100109539 Ga0070708_1001095393 66
312 3300005536 Ga0070697_100420599 Ga0070697_1004205992 66
313 3300005985 Ga0081539_10000014 Ga0081539_10000014299 66
314 2044078001 ZMR_F548DK201AME5Z ZMR_573220 67
315 2162886007 SwRhRL2b_contig_2037418 SwRhRL2b_0980.00007230 67
316 2162886007 SwRhRL2b_contig_3078803 SwRhRL2b_0907.00008390 67
317 2162886007 SwRhRL2b_contig_3458674 SwRhRL2b_0395.00003350 67
318 3300002126 JGI24035J26624_1000389 JGI24035J26624_10003897 67
319 3300002244 JGI24742J22300_10028513 JGI24742J22300_100285132 67
320 3300005277 Ga0065716_1018288 Ga0065716_10182881 67
321 3300005288 Ga0065714_10128472 Ga0065714_101284724 67
322 3300005289 Ga0065704_10048094 Ga0065704_100480942 67
323 3300005289 Ga0065704_10557056 Ga0065704_105570561 67
324 3300005289 Ga0065704_10850442 Ga0065704_108504422 67
325 3300005290 Ga0065712_10015466 Ga0065712_100154663 67
326 3300005290 Ga0065712_10092159 Ga0065712_100921594 67
327 3300005290 Ga0065712_10122169 Ga0065712_101221695 67
328 3300005290 Ga0065712_10143777 Ga0065712_101437774 67
329 3300005290 Ga0065712_10255670 Ga0065712_102556702 67
330 3300005290 Ga0065712_10366731 Ga0065712_103667312 67
331 3300005290 Ga0065712_10386138 Ga0065712_103861382 67
332 3300005290 Ga0065712_10558980 Ga0065712_105589801 67
333 3300005293 Ga0065715_10005591 Ga0065715_100055915 67
334 3300005293 Ga0065715_10006003 Ga0065715_100060035 67
335 3300005293 Ga0065715_10114421 Ga0065715_101144214 67
336 3300005293 Ga0065715_10121633 Ga0065715_101216335 67
337 3300005293 Ga0065715_10132257 Ga0065715_101322572 67
338 3300005293 Ga0065715_10288996 Ga0065715_102889962 67
339 3300005293 Ga0065715_10375137 Ga0065715_103751372 67
340 3300005293 Ga0065715_10663438 Ga0065715_106634382 67
341 3300005295 Ga0065707_10011219 Ga0065707_100112194 67
342 3300005295 Ga0065707_11009080 Ga0065707_110090802 67
343 3300005327 Ga0070658_10132680 Ga0070658_101326804 67
344 3300005327 Ga0070658_11720638 Ga0070658_117206382 67
345 3300005328 Ga0070676_10023068 Ga0070676_100230685 67
346 3300005328 Ga0070676_10023857 Ga0070676_100238577 67
347 3300005328 Ga0070676_10032758 Ga0070676_100327582 67
348 3300005328 Ga0070676_10328254 Ga0070676_103282542 67
349 3300005328 Ga0070676_10356560 Ga0070676_103565602 67
350 3300005328 Ga0070676_10446245 Ga0070676_104462453 67
351 3300005328 Ga0070676_10526310 Ga0070676_105263101 67
352 3300005329 Ga0070683_100014620 Ga0070683_1000146203 67
353 3300005329 Ga0070683_100054847 Ga0070683_1000548473 67
354 3300005329 Ga0070683_100200119 Ga0070683_1002001194 67
355 3300005329 Ga0070683_100221173 Ga0070683_1002211734 67
356 3300005329 Ga0070683_101010997 Ga0070683_1010109972 67
357 3300005329 Ga0070683_101271548 Ga0070683_1012715482 67
358 3300005330 Ga0070690_100187280 Ga0070690_1001872803 67
359 3300005330 Ga0070690_100295354 Ga0070690_1002953543 67
360 3300005330 Ga0070690_100556303 Ga0070690_1005563032 67
361 3300005331 Ga0070670_100068156 Ga0070670_1000681565 67
362 3300005331 Ga0070670_100414170 Ga0070670_1004141703 67
363 3300005331 Ga0070670_100586363 Ga0070670_1005863632 67
364 3300005331 Ga0070670_100926530 Ga0070670_1009265302 67
365 3300005334 Ga0068869_101792838 Ga0068869_1017928382 67
366 3300005335 Ga0070666_10002056 Ga0070666_100020564 67
367 3300005335 Ga0070666_10436454 Ga0070666_104364542 67
368 3300005337 Ga0070682_100289295 Ga0070682_1002892953 67
369 3300005337 Ga0070682_101382440 Ga0070682_1013824401 67
370 3300005338 Ga0068868_100082469 Ga0068868_1000824695 67
371 3300005338 Ga0068868_100097448 Ga0068868_1000974485 67
372 3300005338 Ga0068868_100333449 Ga0068868_1003334493 67
373 3300005338 Ga0068868_100523091 Ga0068868_1005230912 67
374 3300005338 Ga0068868_101144047 Ga0068868_1011440472 67
375 3300005339 Ga0070660_100989587 Ga0070660_1009895872 67
376 3300005339 Ga0070660_101370569 Ga0070660_1013705692 67
377 3300005340 Ga0070689_100009585 Ga0070689_1000095855 67
378 3300005340 Ga0070689_100083277 Ga0070689_1000832775 67
379 3300005340 Ga0070689_100161584 Ga0070689_1001615842 67
380 3300005340 Ga0070689_100308993 Ga0070689_1003089934 67
381 3300005340 Ga0070689_102155027 Ga0070689_1021550271 67
382 3300005343 Ga0070687_100000382 Ga0070687_10000038213 67
383 3300005343 Ga0070687_100216105 Ga0070687_1002161052 67
384 3300005343 Ga0070687_100806730 Ga0070687_1008067302 67
385 3300005344 Ga0070661_100081299 Ga0070661_1000812995 67
386 3300005344 Ga0070661_100120618 Ga0070661_1001206183 67
387 3300005344 Ga0070661_100930326 Ga0070661_1009303262 67
388 3300005345 Ga0070692_11164096 Ga0070692_111640962 67
389 3300005347 Ga0070668_100056885 Ga0070668_1000568857 67
390 3300005347 Ga0070668_100120521 Ga0070668_1001205213 67
391 3300005347 Ga0070668_100379489 Ga0070668_1003794892 67
392 3300005353 Ga0070669_100002011 Ga0070669_10000201117 67
393 3300005353 Ga0070669_100006097 Ga0070669_1000060973 67
394 3300005353 Ga0070669_100049923 Ga0070669_1000499234 67
395 3300005353 Ga0070669_100080338 Ga0070669_1000803383 67
396 3300005353 Ga0070669_100746041 Ga0070669_1007460412 67
397 3300005353 Ga0070669_101543803 Ga0070669_1015438032 67
398 3300005354 Ga0070675_100004678 Ga0070675_10000467814 67
399 3300005354 Ga0070675_100063526 Ga0070675_1000635265 67
400 3300005354 Ga0070675_100087471 Ga0070675_1000874713 67
401 3300005354 Ga0070675_100182810 Ga0070675_1001828103 67
402 3300005354 Ga0070675_100277633 Ga0070675_1002776333 67
403 3300005354 Ga0070675_100376792 Ga0070675_1003767922 67
404 3300005354 Ga0070675_100638029 Ga0070675_1006380292 67
405 3300005355 Ga0070671_100011495 Ga0070671_1000114954 67
406 3300005355 Ga0070671_100042031 Ga0070671_1000420312 67
407 3300005355 Ga0070671_100054306 Ga0070671_1000543068 67
408 3300005355 Ga0070671_100187094 Ga0070671_1001870945 67
409 3300005355 Ga0070671_100731117 Ga0070671_1007311171 67
410 3300005355 Ga0070671_101666516 Ga0070671_1016665161 67
411 3300005355 Ga0070671_101823379 Ga0070671_1018233792 67
412 3300005355 Ga0070671_101827865 Ga0070671_1018278652 67
413 3300005356 Ga0070674_100007500 Ga0070674_1000075009 67
414 3300005356 Ga0070674_100064029 Ga0070674_1000640294 67
415 3300005356 Ga0070674_100297400 Ga0070674_1002974003 67
416 3300005356 Ga0070674_100414870 Ga0070674_1004148703 67
417 3300005364 Ga0070673_100008141 Ga0070673_10000814111 67
418 3300005364 Ga0070673_100159647 Ga0070673_1001596475 67
419 3300005364 Ga0070673_100235191 Ga0070673_1002351913 67
420 3300005364 Ga0070673_102403155 Ga0070673_1024031552 67
421 3300005365 Ga0070688_100000733 Ga0070688_10000073310 67
422 3300005365 Ga0070688_100001414 Ga0070688_10000141411 67
423 3300005365 Ga0070688_100139371 Ga0070688_1001393712 67
424 3300005365 Ga0070688_100347104 Ga0070688_1003471042 67
425 3300005366 Ga0070659_100002483 Ga0070659_10000248312 67
426 3300005366 Ga0070659_100051342 Ga0070659_1000513422 67
427 3300005366 Ga0070659_100326979 Ga0070659_1003269792 67
428 3300005366 Ga0070659_100591895 Ga0070659_1005918952 67
429 3300005366 Ga0070659_100648570 Ga0070659_1006485702 67
430 3300005366 Ga0070659_100774997 Ga0070659_1007749971 67
431 3300005367 Ga0070667_100004665 Ga0070667_10000466510 67
432 3300005367 Ga0070667_100103912 Ga0070667_1001039122 67
433 3300005367 Ga0070667_100196145 Ga0070667_1001961453 67
434 3300005367 Ga0070667_100392191 Ga0070667_1003921912 67
435 3300005367 Ga0070667_100408504 Ga0070667_1004085042 67
436 3300005367 Ga0070667_100565364 Ga0070667_1005653642 67
437 3300005406 Ga0070703_10152115 Ga0070703_101521152 67
438 3300005406 Ga0070703_10376251 Ga0070703_103762512 67
439 3300005434 Ga0070709_10026650 Ga0070709_100266506 67
440 3300005434 Ga0070709_10630820 Ga0070709_106308202 67
441 3300005434 Ga0070709_10852976 Ga0070709_108529762 67
442 3300005434 Ga0070709_11054064 Ga0070709_110540641 67
443 3300005434 Ga0070709_11313628 Ga0070709_113136281 67
444 3300005434 Ga0070709_11469253 Ga0070709_114692532 67
445 3300005435 Ga0070714_100054897 Ga0070714_1000548972 67
446 3300005435 Ga0070714_100961468 Ga0070714_1009614682 67
447 3300005435 Ga0070714_101213946 Ga0070714_1012139462 67
448 3300005435 Ga0070714_102051069 Ga0070714_1020510691 67
449 3300005435 Ga0070714_102423308 Ga0070714_1024233081 67
450 3300005436 Ga0070713_100019600 Ga0070713_1000196003 67
451 3300005436 Ga0070713_100040250 Ga0070713_1000402508 67
452 3300005436 Ga0070713_100219364 Ga0070713_1002193645 67
453 3300005437 Ga0070710_10079151 Ga0070710_100791514 67
454 3300005437 Ga0070710_10136630 Ga0070710_101366303 67
455 3300005437 Ga0070710_10505510 Ga0070710_105055102 67
456 3300005437 Ga0070710_11322454 Ga0070710_113224542 67
457 3300005438 Ga0070701_10288547 Ga0070701_102885471 67
458 3300005439 Ga0070711_100078511 Ga0070711_1000785116 67
459 3300005439 Ga0070711_100098324 Ga0070711_1000983242 67
460 3300005439 Ga0070711_100120740 Ga0070711_1001207405 67
461 3300005439 Ga0070711_100530968 Ga0070711_1005309682 67
462 3300005439 Ga0070711_100718031 Ga0070711_1007180312 67
463 3300005439 Ga0070711_101022999 Ga0070711_1010229992 67
464 3300005439 Ga0070711_101968767 Ga0070711_1019687671 67
465 3300005439 Ga0070711_102000964 Ga0070711_1020009641 67
466 3300005440 Ga0070705_100098129 Ga0070705_1000981292 67
467 3300005440 Ga0070705_100176112 Ga0070705_1001761122 67
468 3300005440 Ga0070705_100300175 Ga0070705_1003001753 67
469 3300005440 Ga0070705_100332086 Ga0070705_1003320863 67
470 3300005441 Ga0070700_100003660 Ga0070700_1000036604 67
471 3300005441 Ga0070700_100458768 Ga0070700_1004587682 67
472 3300005444 Ga0070694_100047799 Ga0070694_1000477995 67
473 3300005444 Ga0070694_100206737 Ga0070694_1002067371 67
474 3300005445 Ga0070708_100003581 Ga0070708_1000035817 67
475 3300005445 Ga0070708_100057410 Ga0070708_1000574108 67
476 3300005445 Ga0070708_100071203 Ga0070708_1000712033 67
477 3300005445 Ga0070708_100094148 Ga0070708_1000941486 67
478 3300005445 Ga0070708_100147839 Ga0070708_1001478393 67
479 3300005445 Ga0070708_100204579 Ga0070708_1002045793 67
480 3300005445 Ga0070708_100372965 Ga0070708_1003729651 67
481 3300005445 Ga0070708_100469463 Ga0070708_1004694632 67
482 3300005445 Ga0070708_100700962 Ga0070708_1007009622 67
483 3300005445 Ga0070708_100856679 Ga0070708_1008566792 67
484 3300005445 Ga0070708_101967356 Ga0070708_1019673561 67
485 3300005455 Ga0070663_100524402 Ga0070663_1005244021 67
486 3300005455 Ga0070663_100714757 Ga0070663_1007147572 67
487 3300005456 Ga0070678_100192276 Ga0070678_1001922763 67
488 3300005456 Ga0070678_100346738 Ga0070678_1003467383 67
489 3300005456 Ga0070678_100585095 Ga0070678_1005850952 67
490 3300005457 Ga0070662_100007763 Ga0070662_10000776312 67
491 3300005457 Ga0070662_100016152 Ga0070662_1000161525 67
492 3300005457 Ga0070662_100095014 Ga0070662_1000950144 67
493 3300005457 Ga0070662_100240971 Ga0070662_1002409714 67
494 3300005457 Ga0070662_100365989 Ga0070662_1003659893 67
495 3300005457 Ga0070662_100586305 Ga0070662_1005863052 67
496 3300005457 Ga0070662_101544927 Ga0070662_1015449272 67
497 3300005457 Ga0070662_101696171 Ga0070662_1016961711 67
498 3300005458 Ga0070681_10687646 Ga0070681_106876462 67
499 3300005459 Ga0068867_100212037 Ga0068867_1002120372 67
500 3300005459 Ga0068867_100489945 Ga0068867_1004899453 67
501 3300005459 Ga0068867_100834244 Ga0068867_1008342441 67
502 3300005466 Ga0070685_10028429 Ga0070685_100284293 67
503 3300005466 Ga0070685_10405925 Ga0070685_104059252 67
504 3300005466 Ga0070685_11030439 Ga0070685_110304392 67
505 3300005467 Ga0070706_100020444 Ga0070706_10002044410 67
506 3300005467 Ga0070706_100020521 Ga0070706_10002052111 67
507 3300005467 Ga0070706_100078781 Ga0070706_1000787815 67
508 3300005467 Ga0070706_100193232 Ga0070706_1001932323 67
509 3300005467 Ga0070706_100283190 Ga0070706_1002831902 67
510 3300005467 Ga0070706_100461289 Ga0070706_1004612892 67
511 3300005467 Ga0070706_100594887 Ga0070706_1005948873 67
512 3300005467 Ga0070706_100790315 Ga0070706_1007903153 67
513 3300005467 Ga0070706_100939008 Ga0070706_1009390082 67
514 3300005468 Ga0070707_100016188 Ga0070707_10001618811 67
515 3300005468 Ga0070707_100030502 Ga0070707_1000305029 67
516 3300005468 Ga0070707_100039193 Ga0070707_1000391931 67
517 3300005468 Ga0070707_100226431 Ga0070707_1002264312 67
518 3300005468 Ga0070707_100311609 Ga0070707_1003116093 67
519 3300005468 Ga0070707_100454279 Ga0070707_1004542792 67
520 3300005468 Ga0070707_100564921 Ga0070707_1005649213 67
521 3300005468 Ga0070707_100753710 Ga0070707_1007537103 67
522 3300005468 Ga0070707_101140792 Ga0070707_1011407922 67
523 3300005468 Ga0070707_101276289 Ga0070707_1012762891 67
524 3300005468 Ga0070707_101300077 Ga0070707_1013000772 67
525 3300005471 Ga0070698_100001836 Ga0070698_10000183620 67
526 3300005471 Ga0070698_100032196 Ga0070698_1000321969 67
527 3300005471 Ga0070698_100086365 Ga0070698_1000863655 67
528 3300005471 Ga0070698_100368308 Ga0070698_1003683082 67
529 3300005471 Ga0070698_100584666 Ga0070698_1005846663 67
530 3300005518 Ga0070699_100027581 Ga0070699_1000275817 67
531 3300005518 Ga0070699_100171466 Ga0070699_1001714665 67
532 3300005518 Ga0070699_100291268 Ga0070699_1002912682 67
533 3300005518 Ga0070699_100307974 Ga0070699_1003079744 67
534 3300005518 Ga0070699_101112176 Ga0070699_1011121762 67
535 3300005518 Ga0070699_101327060 Ga0070699_1013270602 67
536 3300005518 Ga0070699_101775268 Ga0070699_1017752682 67
537 3300005518 Ga0070699_102098553 Ga0070699_1020985532 67
538 3300005530 Ga0070679_100399447 Ga0070679_1003994472 67
539 3300005530 Ga0070679_100949578 Ga0070679_1009495782 67
540 3300005530 Ga0070679_101287559 Ga0070679_1012875592 67
541 3300005535 Ga0070684_100001312 Ga0070684_1000013122 67
542 3300005535 Ga0070684_100029216 Ga0070684_1000292163 67
543 3300005535 Ga0070684_100188477 Ga0070684_1001884773 67
544 3300005535 Ga0070684_100440346 Ga0070684_1004403463 67
545 3300005536 Ga0070697_100002201 Ga0070697_1000022017 67
546 3300005536 Ga0070697_100002768 Ga0070697_10000276812 67
547 3300005536 Ga0070697_100045287 Ga0070697_1000452872 67
548 3300005536 Ga0070697_100113122 Ga0070697_1001131223 67
549 3300005536 Ga0070697_100242433 Ga0070697_1002424332 67
550 3300005536 Ga0070697_100245790 Ga0070697_1002457901 67
551 3300005536 Ga0070697_100329225 Ga0070697_1003292253 67
552 3300005536 Ga0070697_100423823 Ga0070697_1004238232 67
553 3300005536 Ga0070697_100483148 Ga0070697_1004831482 67
554 3300005536 Ga0070697_101352537 Ga0070697_1013525371 67
555 3300005536 Ga0070697_101574173 Ga0070697_1015741732 67
556 3300005536 Ga0070697_101625032 Ga0070697_1016250321 67
557 3300005536 Ga0070697_101780141 Ga0070697_1017801412 67
558 3300005536 Ga0070697_101906263 Ga0070697_1019062632 67
559 3300005536 Ga0070697_102007451 Ga0070697_1020074512 67
560 3300005539 Ga0068853_100107206 Ga0068853_1001072062 67
561 3300005543 Ga0070672_100000353 Ga0070672_10000035327 67
562 3300005543 Ga0070672_100004247 Ga0070672_10000424716 67
563 3300005543 Ga0070672_100254174 Ga0070672_1002541743 67
564 3300005543 Ga0070672_100280675 Ga0070672_1002806753 67
565 3300005543 Ga0070672_100484203 Ga0070672_1004842033 67
566 3300005543 Ga0070672_100574021 Ga0070672_1005740213 67
567 3300005543 Ga0070672_102163394 Ga0070672_1021633942 67
568 3300005544 Ga0070686_100601766 Ga0070686_1006017661 67
569 3300005544 Ga0070686_100876519 Ga0070686_1008765192 67
570 3300005546 Ga0070696_101129055 Ga0070696_1011290552 67
571 3300005548 Ga0070665_100008787 Ga0070665_10000878712 67
572 3300005548 Ga0070665_100070912 Ga0070665_1000709129 67
573 3300005548 Ga0070665_100145325 Ga0070665_1001453254 67
574 3300005548 Ga0070665_100147588 Ga0070665_1001475886 67
575 3300005548 Ga0070665_100484511 Ga0070665_1004845113 67
576 3300005548 Ga0070665_100753700 Ga0070665_1007537002 67
577 3300005549 Ga0070704_100517147 Ga0070704_1005171472 67
578 3300005549 Ga0070704_102075988 Ga0070704_1020759882 67
579 3300005564 Ga0070664_100311564 Ga0070664_1003115642 67
580 3300005564 Ga0070664_100598245 Ga0070664_1005982452 67
581 3300005564 Ga0070664_100687425 Ga0070664_1006874253 67
582 3300005564 Ga0070664_101435616 Ga0070664_1014356161 67
583 3300005577 Ga0068857_101242883 Ga0068857_1012428832 67
584 3300005614 Ga0068856_100062548 Ga0068856_1000625482 67
585 3300005614 Ga0068856_100402187 Ga0068856_1004021874 67
586 3300005614 Ga0068856_101616404 Ga0068856_1016164042 67
587 3300005615 Ga0070702_100470434 Ga0070702_1004704341 67
588 3300005615 Ga0070702_100720088 Ga0070702_1007200882 67
589 3300005616 Ga0068852_100383840 Ga0068852_1003838403 67
590 3300005616 Ga0068852_102776274 Ga0068852_1027762741 67
591 3300005617 Ga0068859_100326644 Ga0068859_1003266442 67
592 3300005718 Ga0068866_10099689 Ga0068866_100996894 67
593 3300005718 Ga0068866_10170873 Ga0068866_101708731 67
594 3300005718 Ga0068866_10258928 Ga0068866_102589283 67
595 3300005718 Ga0068866_10440135 Ga0068866_104401353 67
596 3300005719 Ga0068861_100549046 Ga0068861_1005490462 67
597 3300005719 Ga0068861_102070470 Ga0068861_1020704702 67
598 3300005834 Ga0068851_10407291 Ga0068851_104072912 67
599 3300005841 Ga0068863_100007967 Ga0068863_10000796711 67
600 3300005841 Ga0068863_100722959 Ga0068863_1007229592 67
601 3300005842 Ga0068858_100168633 Ga0068858_1001686333 67
602 3300005842 Ga0068858_100283900 Ga0068858_1002839002 67
603 3300005842 Ga0068858_100347541 Ga0068858_1003475414 67
604 3300005842 Ga0068858_102379344 Ga0068858_1023793442 67
605 3300005843 Ga0068860_100010603 Ga0068860_1000106037 67
606 3300005843 Ga0068860_100244584 Ga0068860_1002445844 67
607 3300005843 Ga0068860_100806876 Ga0068860_1008068762 67
608 3300005843 Ga0068860_101101196 Ga0068860_1011011963 67
609 3300005843 Ga0068860_101420721 Ga0068860_1014207212 67
610 3300005843 Ga0068860_102157230 Ga0068860_1021572302 67
611 3300005844 Ga0068862_100008330 Ga0068862_1000083302 67
612 3300005844 Ga0068862_100180595 Ga0068862_1001805952 67
613 3300005844 Ga0068862_101487649 Ga0068862_1014876492 67
614 3300005937 Ga0081455_10000328 Ga0081455_1000032844 67
615 3300005937 Ga0081455_10001697 Ga0081455_100016974 67
616 3300005937 Ga0081455_10021927 Ga0081455_1002192710 67
617 3300005937 Ga0081455_10031292 Ga0081455_100312923 67
618 3300005937 Ga0081455_10040030 Ga0081455_100400305 67
619 3300005937 Ga0081455_10040051 Ga0081455_100400515 67
620 3300005937 Ga0081455_10151731 Ga0081455_101517314 67
621 3300005937 Ga0081455_10170692 Ga0081455_101706923 67
622 3300005937 Ga0081455_10884439 Ga0081455_108844391 67
623 3300005937 Ga0081455_10887284 Ga0081455_108872842 67
624 3300005981 Ga0081538_10334323 Ga0081538_103343231 67
625 3300005983 Ga0081540_1000036 Ga0081540_100003636 67
626 3300005983 Ga0081540_1032359 Ga0081540_10323594 67
627 3300005983 Ga0081540_1041372 Ga0081540_10413724 67
628 3300005983 Ga0081540_1053610 Ga0081540_10536102 67
629 3300005983 Ga0081540_1075382 Ga0081540_10753822 67
630 3300005985 Ga0081539_10157760 Ga0081539_101577603 67
631 3300006028 Ga0070717_10028090 Ga0070717_100280909 67
632 3300006028 Ga0070717_10030233 Ga0070717_100302335 67
633 3300006028 Ga0070717_10067091 Ga0070717_100670916 67
634 3300006028 Ga0070717_10297754 Ga0070717_102977543 67
635 3300006028 Ga0070717_10495388 Ga0070717_104953882 67
636 3300006028 Ga0070717_10708003 Ga0070717_107080032 67
637 3300006163 Ga0070715_10020578 Ga0070715_100205785 67
638 3300006163 Ga0070715_10036615 Ga0070715_100366155 67
639 3300006163 Ga0070715_10178518 Ga0070715_101785184 67
640 3300006163 Ga0070715_10242314 Ga0070715_102423142 67
641 3300006163 Ga0070715_11000156 Ga0070715_110001562 67
642 3300006173 Ga0070716_100063071 Ga0070716_1000630713 67
643 3300006173 Ga0070716_100094785 Ga0070716_1000947855 67
644 3300006173 Ga0070716_100668291 Ga0070716_1006682912 67
645 3300006173 Ga0070716_100888438 Ga0070716_1008884382 67
646 3300006173 Ga0070716_101537437 Ga0070716_1015374372 67
647 3300006175 Ga0070712_100023808 Ga0070712_1000238086 67
648 3300006175 Ga0070712_100052822 Ga0070712_1000528222 67
649 3300006175 Ga0070712_100095268 Ga0070712_1000952685 67
650 3300006175 Ga0070712_100123126 Ga0070712_1001231263 67
651 3300006175 Ga0070712_100151058 Ga0070712_1001510583 67
652 3300006175 Ga0070712_100273381 Ga0070712_1002733811 67
653 3300006175 Ga0070712_100472181 Ga0070712_1004721812 67
654 3300006175 Ga0070712_100547686 Ga0070712_1005476862 67
655 3300006175 Ga0070712_100568278 Ga0070712_1005682782 67
656 3300006175 Ga0070712_100584958 Ga0070712_1005849582 67
657 3300006175 Ga0070712_100609873 Ga0070712_1006098733 67
658 3300006175 Ga0070712_101037364 Ga0070712_1010373643 67
659 3300006175 Ga0070712_101141531 Ga0070712_1011415312 67
660 3300006175 Ga0070712_101295793 Ga0070712_1012957932 67
661 3300006175 Ga0070712_101918852 Ga0070712_1019188522 67
662 3300006175 Ga0070712_101962750 Ga0070712_1019627501 67
663 3300006237 Ga0097621_100014055 Ga0097621_1000140557 67
664 3300006237 Ga0097621_100040994 Ga0097621_1000409947 67
665 3300006237 Ga0097621_100318606 Ga0097621_1003186064 67
666 3300006237 Ga0097621_100815610 Ga0097621_1008156102 67
667 3300006237 Ga0097621_101322106 Ga0097621_1013221062 67
668 3300006237 Ga0097621_102254817 Ga0097621_1022548171 67
669 3300006358 Ga0068871_100096963 Ga0068871_1000969632 67
670 3300006358 Ga0068871_100138801 Ga0068871_1001388013 67
671 3300006358 Ga0068871_100191878 Ga0068871_1001918785 67
672 3300006358 Ga0068871_100424331 Ga0068871_1004243313 67
673 3300006358 Ga0068871_101234300 Ga0068871_1012343002 67
674 3300006358 Ga0068871_101867525 Ga0068871_1018675252 67
675 3300006844 Ga0075428_100095839 Ga0075428_1000958398 67
676 3300006844 Ga0075428_100416463 Ga0075428_1004164633 67
677 3300006847 Ga0075431_100816203 Ga0075431_1008162032 67
678 3300006852 Ga0075433_10756944 Ga0075433_107569442 67
679 3300006871 Ga0075434_100255607 Ga0075434_1002556072 67
680 3300006871 Ga0075434_100738231 Ga0075434_1007382313 67
681 3300006881 Ga0068865_100079884 Ga0068865_1000798845 67
682 3300006881 Ga0068865_100343715 Ga0068865_1003437152 67
683 3300006881 Ga0068865_100477358 Ga0068865_1004773583 67
684 3300006881 Ga0068865_100531144 Ga0068865_1005311443 67
685 3300006881 Ga0068865_100713279 Ga0068865_1007132792 67
686 3300006881 Ga0068865_101858950 Ga0068865_1018589502 67
687 3300006914 Ga0075436_100257488 Ga0075436_1002574883 67
688 3300006914 Ga0075436_100633678 Ga0075436_1006336782 67
689 3300006931 Ga0097620_100326689 Ga0097620_1003266892 67
690 3300007076 Ga0075435_101892357 Ga0075435_1018923572 67
691 3300007076 Ga0075435_101969206 Ga0075435_1019692062 67
692 3300007265 Ga0099794_10020565 Ga0099794_100205653 67
693 3300007265 Ga0099794_10145936 Ga0099794_101459361 67
694 3300007265 Ga0099794_10325814 Ga0099794_103258142 67
695 3300007788 Ga0099795_10021968 Ga0099795_100219681 67
696 3300009093 Ga0105240_10636431 Ga0105240_106364314 67
697 3300009093 Ga0105240_10784265 Ga0105240_107842652 67
698 3300009093 Ga0105240_11038689 Ga0105240_110386892 67
699 3300009093 Ga0105240_12244662 Ga0105240_122446622 67
700 3300009094 Ga0111539_10676556 Ga0111539_106765562 67
701 3300009094 Ga0111539_10865884 Ga0111539_108658843 67
702 3300009094 Ga0111539_11300927 Ga0111539_113009272 67
703 3300009094 Ga0111539_12853814 Ga0111539_128538142 67
704 3300009098 Ga0105245_10006614 Ga0105245_100066145 67
705 3300009098 Ga0105245_10030852 Ga0105245_100308525 67
706 3300009098 Ga0105245_10124129 Ga0105245_101241293 67
707 3300009098 Ga0105245_10192863 Ga0105245_101928635 67
708 3300009098 Ga0105245_10726772 Ga0105245_107267722 67
709 3300009098 Ga0105245_11078215 Ga0105245_110782152 67
710 3300009098 Ga0105245_11740269 Ga0105245_117402692 67
711 3300009098 Ga0105245_12552963 Ga0105245_125529632 67
712 3300009147 Ga0114129_10003445 Ga0114129_1000344524 67
713 3300009147 Ga0114129_10071980 Ga0114129_100719807 67
714 3300009147 Ga0114129_10218235 Ga0114129_102182355 67
715 3300009147 Ga0114129_11432233 Ga0114129_114322333 67
716 3300009148 Ga0105243_10272788 Ga0105243_102727882 67
717 3300009148 Ga0105243_11229588 Ga0105243_112295882 67
718 3300009148 Ga0105243_11380156 Ga0105243_113801563 67
719 3300009174 Ga0105241_11846708 Ga0105241_118467082 67
720 3300009176 Ga0105242_10043482 Ga0105242_100434828 67
721 3300009176 Ga0105242_10328839 Ga0105242_103288393 67
722 3300009176 Ga0105242_10549724 Ga0105242_105497243 67
723 3300009176 Ga0105242_10996553 Ga0105242_109965533 67
724 3300009177 Ga0105248_11169531 Ga0105248_111695313 67
725 3300009177 Ga0105248_11193886 Ga0105248_111938862 67
726 3300009177 Ga0105248_12002321 Ga0105248_120023212 67
727 3300009545 Ga0105237_10444563 Ga0105237_104445633 67
728 3300009545 Ga0105237_10528861 Ga0105237_105288613 67
729 3300009545 Ga0105237_10820507 Ga0105237_108205073 67
730 3300009553 Ga0105249_10011097 Ga0105249_1001109713 67
731 3300009553 Ga0105249_10470133 Ga0105249_104701333 67
732 3300009553 Ga0105249_10544884 Ga0105249_105448842 67
733 3300009553 Ga0105249_11853859 Ga0105249_118538592 67
734 3300009553 Ga0105249_13178574 Ga0105249_131785742 67
735 3300009553 Ga0105249_13388451 Ga0105249_133884511 67
736 3300010159 Ga0099796_10061942 Ga0099796_100619422 67
737 3300010159 Ga0099796_10094571 Ga0099796_100945713 67
738 3300010159 Ga0099796_10346725 Ga0099796_103467251 67
739 3300010375 Ga0105239_10070002 Ga0105239_100700022 67
740 3300010375 Ga0105239_10225186 Ga0105239_102251862 67
741 3300010375 Ga0105239_10518088 Ga0105239_105180882 67
742 3300010375 Ga0105239_10823425 Ga0105239_108234252 67
743 3300010375 Ga0105239_10991354 Ga0105239_109913542 67
744 3300010375 Ga0105239_12290191 Ga0105239_122901912 67
745 3300011119 Ga0105246_10459510 Ga0105246_104595102 67
746 3300012476 Ga0157344_1016044 Ga0157344_10160442 67
747 3300012508 Ga0157315_1041195 Ga0157315_10411951 67
748 3300013100 Ga0157373_10396341 Ga0157373_103963413 67
749 3300013102 Ga0157371_10550303 Ga0157371_105503032 67
750 3300013102 Ga0157371_11002497 Ga0157371_110024972 67
751 3300013104 Ga0157370_10322896 Ga0157370_103228963 67
752 3300013105 Ga0157369_10117876 Ga0157369_101178764 67
753 3300013296 Ga0157374_10001473 Ga0157374_1000147313 67
754 3300013296 Ga0157374_10005577 Ga0157374_1000557710 67
755 3300013296 Ga0157374_10033688 Ga0157374_100336883 67
756 3300013296 Ga0157374_10094662 Ga0157374_100946625 67
757 3300013296 Ga0157374_10103065 Ga0157374_101030652 67
758 3300013296 Ga0157374_10120813 Ga0157374_101208131 67
759 3300013296 Ga0157374_10130202 Ga0157374_101302023 67
760 3300013296 Ga0157374_10222850 Ga0157374_102228505 67
761 3300013296 Ga0157374_10549440 Ga0157374_105494403 67
762 3300013296 Ga0157374_10566828 Ga0157374_105668282 67
763 3300013296 Ga0157374_11551143 Ga0157374_115511432 67
764 3300013296 Ga0157374_11573636 Ga0157374_115736362 67
765 3300013296 Ga0157374_12237170 Ga0157374_122371702 67
766 3300013296 Ga0157374_12818952 Ga0157374_128189522 67
767 3300013297 Ga0157378_10005509 Ga0157378_1000550916 67
768 3300013297 Ga0157378_10009019 Ga0157378_1000901913 67
769 3300013297 Ga0157378_10009704 Ga0157378_100097045 67
770 3300013297 Ga0157378_10026553 Ga0157378_1002655311 67
771 3300013297 Ga0157378_10041332 Ga0157378_100413327 67
772 3300013297 Ga0157378_10066060 Ga0157378_100660603 67
773 3300013297 Ga0157378_10141935 Ga0157378_101419354 67
774 3300013297 Ga0157378_10190256 Ga0157378_101902563 67
775 3300013297 Ga0157378_10237043 Ga0157378_102370434 67
776 3300013297 Ga0157378_10292746 Ga0157378_102927462 67
777 3300013297 Ga0157378_10338887 Ga0157378_103388873 67
778 3300013297 Ga0157378_10350425 Ga0157378_103504253 67
779 3300013297 Ga0157378_10668405 Ga0157378_106684052 67
780 3300013297 Ga0157378_10758292 Ga0157378_107582923 67
781 3300013297 Ga0157378_10853698 Ga0157378_108536983 67
782 3300013297 Ga0157378_10891673 Ga0157378_108916732 67
783 3300013297 Ga0157378_11168955 Ga0157378_111689552 67
784 3300013297 Ga0157378_11849135 Ga0157378_118491351 67
785 3300013306 Ga0163162_10003249 Ga0163162_1000324919 67
786 3300013306 Ga0163162_10014121 Ga0163162_1001412110 67
787 3300013306 Ga0163162_10105792 Ga0163162_101057923 67
788 3300013306 Ga0163162_10118628 Ga0163162_101186284 67
789 3300013306 Ga0163162_10609774 Ga0163162_106097742 67
790 3300013306 Ga0163162_10824833 Ga0163162_108248333 67
791 3300013306 Ga0163162_11278146 Ga0163162_112781462 67
792 3300013306 Ga0163162_11548759 Ga0163162_115487592 67
793 3300013306 Ga0163162_12295981 Ga0163162_122959812 67
794 3300013306 Ga0163162_12699018 Ga0163162_126990182 67
795 3300013306 Ga0163162_12904674 Ga0163162_129046742 67
796 3300013307 Ga0157372_10037163 Ga0157372_100371637 67
797 3300013307 Ga0157372_10135936 Ga0157372_101359365 67
798 3300013307 Ga0157372_10198123 Ga0157372_101981232 67
799 3300013307 Ga0157372_10553780 Ga0157372_105537802 67
800 3300013307 Ga0157372_11456901 Ga0157372_114569012 67
801 3300013308 Ga0157375_10000287 Ga0157375_1000028720 67
802 3300013308 Ga0157375_10001868 Ga0157375_1000186813 67
803 3300013308 Ga0157375_10007782 Ga0157375_1000778211 67
804 3300013308 Ga0157375_10449240 Ga0157375_104492403 67
805 3300013308 Ga0157375_10708632 Ga0157375_107086322 67
806 3300013308 Ga0157375_10998323 Ga0157375_109983232 67
807 3300013308 Ga0157375_11529705 Ga0157375_115297052 67
808 3300013308 Ga0157375_11890947 Ga0157375_118909472 67
809 3300014325 Ga0163163_10175148 Ga0163163_101751483 67
810 3300014325 Ga0163163_11302229 Ga0163163_113022292 67
811 3300014325 Ga0163163_11869470 Ga0163163_118694702 67
812 3300014325 Ga0163163_13233606 Ga0163163_132336062 67
813 3300014745 Ga0157377_10190634 Ga0157377_101906343 67
814 3300014745 Ga0157377_10234421 Ga0157377_102344213 67
815 3300014745 Ga0157377_10334221 Ga0157377_103342212 67
816 3300014745 Ga0157377_10872791 Ga0157377_108727912 67
817 3300014968 Ga0157379_10005647 Ga0157379_1000564712 67
818 3300014968 Ga0157379_10178685 Ga0157379_101786852 67
819 3300014968 Ga0157379_11131810 Ga0157379_111318102 67
820 3300014968 Ga0157379_11295907 Ga0157379_112959072 67
821 3300014969 Ga0157376_10009509 Ga0157376_1000950910 67
822 3300014969 Ga0157376_10300272 Ga0157376_103002723 67
823 3300014969 Ga0157376_10332488 Ga0157376_103324883 67
824 3300014969 Ga0157376_10378555 Ga0157376_103785553 67
825 3300014969 Ga0157376_10950725 Ga0157376_109507252 67
826 3300014969 Ga0157376_11935218 Ga0157376_119352182 67
827 3300014969 Ga0157376_12107002 Ga0157376_121070022 67
828 3300015261 Ga0182006_1152729 Ga0182006_11527292 67
829 3300015265 Ga0182005_1017656 Ga0182005_10176564 67
830 3300017792 Ga0163161_10570979 Ga0163161_105709793 67
831 3300017792 Ga0163161_10710536 Ga0163161_107105362 67
832 3300017792 Ga0163161_11078881 Ga0163161_110788812 67
833 3300021388 Ga0213875_10310544 Ga0213875_103105442 67
834 3300025271 Ga0207666_1005260 Ga0207666_10052602 67
835 3300025271 Ga0207666_1008686 Ga0207666_10086862 67
836 3300025290 Ga0207673_1000205 Ga0207673_100020512 67
837 3300025290 Ga0207673_1000900 Ga0207673_10009003 67
838 3300025290 Ga0207673_1005925 Ga0207673_10059253 67
839 3300025290 Ga0207673_1006109 Ga0207673_10061093 67
840 3300025290 Ga0207673_1028027 Ga0207673_10280272 67
841 3300025315 Ga0207697_10002230 Ga0207697_100022304 67
842 3300025315 Ga0207697_10002322 Ga0207697_1000232216 67
843 3300025315 Ga0207697_10021301 Ga0207697_100213013 67
844 3300025315 Ga0207697_10042806 Ga0207697_100428065 67
845 3300025315 Ga0207697_10062383 Ga0207697_100623833 67
846 3300025315 Ga0207697_10110706 Ga0207697_101107062 67
847 3300025315 Ga0207697_10209187 Ga0207697_102091871 67
848 3300025315 Ga0207697_10302285 Ga0207697_103022852 67
849 3300025315 Ga0207697_10374245 Ga0207697_103742452 67
850 3300025315 Ga0207697_10460044 Ga0207697_104600442 67
851 3300025315 Ga0207697_10487975 Ga0207697_104879751 67
852 3300025885 Ga0207653_10001694 Ga0207653_100016944 67
853 3300025898 Ga0207692_10115326 Ga0207692_101153263 67
854 3300025898 Ga0207692_10472491 Ga0207692_104724912 67
855 3300025898 Ga0207692_10796278 Ga0207692_107962781 67
856 3300025898 Ga0207692_11018310 Ga0207692_110183102 67
857 3300025899 Ga0207642_10626882 Ga0207642_106268822 67
858 3300025901 Ga0207688_10023688 Ga0207688_100236886 67
859 3300025901 Ga0207688_10245931 Ga0207688_102459312 67
860 3300025901 Ga0207688_10591109 Ga0207688_105911092 67
861 3300025903 Ga0207680_10025390 Ga0207680_100253902 67
862 3300025903 Ga0207680_10212819 Ga0207680_102128191 67
863 3300025904 Ga0207647_10022311 Ga0207647_100223115 67
864 3300025904 Ga0207647_10616614 Ga0207647_106166142 67
865 3300025904 Ga0207647_10725049 Ga0207647_107250492 67
866 3300025905 Ga0207685_10003968 Ga0207685_100039682 67
867 3300025905 Ga0207685_10079697 Ga0207685_100796972 67
868 3300025905 Ga0207685_10530412 Ga0207685_105304122 67
869 3300025905 Ga0207685_10607541 Ga0207685_106075412 67
870 3300025906 Ga0207699_10008911 Ga0207699_100089113 67
871 3300025906 Ga0207699_10099551 Ga0207699_100995513 67
872 3300025906 Ga0207699_10406362 Ga0207699_104063621 67
873 3300025906 Ga0207699_10761832 Ga0207699_107618322 67
874 3300025906 Ga0207699_10989558 Ga0207699_109895582 67
875 3300025907 Ga0207645_10001786 Ga0207645_1000178616 67
876 3300025907 Ga0207645_10002762 Ga0207645_1000276211 67
877 3300025907 Ga0207645_10133103 Ga0207645_101331035 67
878 3300025907 Ga0207645_10245051 Ga0207645_102450513 67
879 3300025907 Ga0207645_10252534 Ga0207645_102525342 67
880 3300025907 Ga0207645_10457105 Ga0207645_104571052 67
881 3300025910 Ga0207684_10003766 Ga0207684_100037665 67
882 3300025910 Ga0207684_10008671 Ga0207684_1000867112 67
883 3300025910 Ga0207684_10011143 Ga0207684_100111434 67
884 3300025910 Ga0207684_10042797 Ga0207684_100427973 67
885 3300025910 Ga0207684_10059810 Ga0207684_100598103 67
886 3300025910 Ga0207684_10068412 Ga0207684_100684126 67
887 3300025910 Ga0207684_10105479 Ga0207684_101054795 67
888 3300025910 Ga0207684_10348575 Ga0207684_103485753 67
889 3300025910 Ga0207684_10408111 Ga0207684_104081113 67
890 3300025910 Ga0207684_10451794 Ga0207684_104517943 67
891 3300025910 Ga0207684_10577943 Ga0207684_105779433 67
892 3300025910 Ga0207684_10756763 Ga0207684_107567632 67
893 3300025910 Ga0207684_11493755 Ga0207684_114937552 67
894 3300025912 Ga0207707_10308527 Ga0207707_103085272 67
895 3300025912 Ga0207707_10561492 Ga0207707_105614923 67
896 3300025914 Ga0207671_10363757 Ga0207671_103637572 67
897 3300025914 Ga0207671_10448470 Ga0207671_104484702 67
898 3300025915 Ga0207693_10006942 Ga0207693_1000694210 67
899 3300025915 Ga0207693_10019110 Ga0207693_100191107 67
900 3300025915 Ga0207693_10021211 Ga0207693_100212113 67
901 3300025915 Ga0207693_10032567 Ga0207693_100325675 67
902 3300025915 Ga0207693_10035010 Ga0207693_100350109 67
903 3300025915 Ga0207693_10090298 Ga0207693_100902986 67
904 3300025915 Ga0207693_10278653 Ga0207693_102786534 67
905 3300025915 Ga0207693_10393342 Ga0207693_103933422 67
906 3300025915 Ga0207693_10490403 Ga0207693_104904033 67
907 3300025915 Ga0207693_10593130 Ga0207693_105931303 67
908 3300025916 Ga0207663_10396420 Ga0207663_103964202 67
909 3300025916 Ga0207663_10472442 Ga0207663_104724422 67
910 3300025916 Ga0207663_10519887 Ga0207663_105198873 67
911 3300025916 Ga0207663_10581841 Ga0207663_105818412 67
912 3300025916 Ga0207663_10633405 Ga0207663_106334052 67
913 3300025916 Ga0207663_11321577 Ga0207663_113215772 67
914 3300025916 Ga0207663_11622674 Ga0207663_116226742 67
915 3300025917 Ga0207660_10167820 Ga0207660_101678202 67
916 3300025918 Ga0207662_10000699 Ga0207662_1000069913 67
917 3300025918 Ga0207662_10010494 Ga0207662_100104947 67
918 3300025918 Ga0207662_10080381 Ga0207662_100803814 67
919 3300025918 Ga0207662_10309233 Ga0207662_103092332 67
920 3300025918 Ga0207662_10325515 Ga0207662_103255154 67
921 3300025919 Ga0207657_10214387 Ga0207657_102143873 67
922 3300025920 Ga0207649_10043554 Ga0207649_100435545 67
923 3300025920 Ga0207649_10333051 Ga0207649_103330513 67
924 3300025920 Ga0207649_10489834 Ga0207649_104898342 67
925 3300025920 Ga0207649_10605067 Ga0207649_106050672 67
926 3300025921 Ga0207652_10485669 Ga0207652_104856693 67
927 3300025921 Ga0207652_10712104 Ga0207652_107121042 67
928 3300025922 Ga0207646_10000191 Ga0207646_1000019124 67
929 3300025922 Ga0207646_10009621 Ga0207646_1000962117 67
930 3300025922 Ga0207646_10010143 Ga0207646_100101438 67
931 3300025922 Ga0207646_10028198 Ga0207646_100281984 67
932 3300025922 Ga0207646_10051798 Ga0207646_100517984 67
933 3300025922 Ga0207646_10085456 Ga0207646_100854565 67
934 3300025922 Ga0207646_10121006 Ga0207646_101210064 67
935 3300025922 Ga0207646_10171540 Ga0207646_101715406 67
936 3300025922 Ga0207646_10207391 Ga0207646_102073913 67
937 3300025922 Ga0207646_10260717 Ga0207646_102607174 67
938 3300025922 Ga0207646_10308099 Ga0207646_103080992 67
939 3300025922 Ga0207646_10413113 Ga0207646_104131132 67
940 3300025922 Ga0207646_11037387 Ga0207646_110373871 67
941 3300025922 Ga0207646_11083370 Ga0207646_110833701 67
942 3300025922 Ga0207646_11189447 Ga0207646_111894472 67
943 3300025922 Ga0207646_11657266 Ga0207646_116572662 67
944 3300025922 Ga0207646_11713471 Ga0207646_117134712 67
945 3300025922 Ga0207646_11731199 Ga0207646_117311992 67
946 3300025923 Ga0207681_10004055 Ga0207681_100040552 67
947 3300025923 Ga0207681_10088623 Ga0207681_100886234 67
948 3300025923 Ga0207681_10116369 Ga0207681_101163693 67
949 3300025923 Ga0207681_10441433 Ga0207681_104414332 67
950 3300025923 Ga0207681_10856794 Ga0207681_108567941 67
951 3300025923 Ga0207681_11184317 Ga0207681_111843172 67
952 3300025923 Ga0207681_11224475 Ga0207681_112244752 67
953 3300025925 Ga0207650_10093277 Ga0207650_100932771 67
954 3300025925 Ga0207650_10319489 Ga0207650_103194892 67
955 3300025925 Ga0207650_10346946 Ga0207650_103469463 67
956 3300025925 Ga0207650_10427224 Ga0207650_104272244 67
957 3300025925 Ga0207650_11540295 Ga0207650_115402953 67
958 3300025926 Ga0207659_10003512 Ga0207659_1000351211 67
959 3300025926 Ga0207659_10049761 Ga0207659_100497618 67
960 3300025926 Ga0207659_10053684 Ga0207659_100536844 67
961 3300025926 Ga0207659_10067573 Ga0207659_100675733 67
962 3300025926 Ga0207659_10127931 Ga0207659_101279314 67
963 3300025926 Ga0207659_10179125 Ga0207659_101791253 67
964 3300025927 Ga0207687_10095481 Ga0207687_100954811 67
965 3300025927 Ga0207687_10694367 Ga0207687_106943672 67
966 3300025927 Ga0207687_11162978 Ga0207687_111629782 67
967 3300025927 Ga0207687_11337954 Ga0207687_113379541 67
968 3300025927 Ga0207687_11504157 Ga0207687_115041572 67
969 3300025927 Ga0207687_11664935 Ga0207687_116649352 67
970 3300025928 Ga0207700_10003893 Ga0207700_1000389312 67
971 3300025928 Ga0207700_10069264 Ga0207700_100692646 67
972 3300025928 Ga0207700_10087236 Ga0207700_100872367 67
973 3300025928 Ga0207700_10156867 Ga0207700_101568675 67
974 3300025928 Ga0207700_10725583 Ga0207700_107255832 67
975 3300025929 Ga0207664_10112083 Ga0207664_101120835 67
976 3300025929 Ga0207664_10122505 Ga0207664_101225053 67
977 3300025929 Ga0207664_10142540 Ga0207664_101425403 67
978 3300025929 Ga0207664_10681007 Ga0207664_106810073 67
979 3300025929 Ga0207664_10697046 Ga0207664_106970461 67
980 3300025929 Ga0207664_11810705 Ga0207664_118107052 67
981 3300025931 Ga0207644_10196648 Ga0207644_101966482 67
982 3300025931 Ga0207644_10254840 Ga0207644_102548402 67
983 3300025931 Ga0207644_10344956 Ga0207644_103449563 67
984 3300025931 Ga0207644_10692706 Ga0207644_106927062 67
985 3300025931 Ga0207644_11813834 Ga0207644_118138341 67
986 3300025932 Ga0207690_10075123 Ga0207690_100751233 67
987 3300025932 Ga0207690_10098203 Ga0207690_100982034 67
988 3300025932 Ga0207690_10182904 Ga0207690_101829042 67
989 3300025932 Ga0207690_11019648 Ga0207690_110196482 67
990 3300025933 Ga0207706_10008197 Ga0207706_1000819716 67
991 3300025933 Ga0207706_10130216 Ga0207706_101302162 67
992 3300025933 Ga0207706_10216094 Ga0207706_102160943 67
993 3300025933 Ga0207706_10252504 Ga0207706_102525044 67
994 3300025933 Ga0207706_10397992 Ga0207706_103979923 67
995 3300025933 Ga0207706_10554217 Ga0207706_105542172 67
996 3300025933 Ga0207706_11016521 Ga0207706_110165212 67
997 3300025934 Ga0207686_10157569 Ga0207686_101575693 67
998 3300025934 Ga0207686_11520114 Ga0207686_115201142 67
999 3300025934 Ga0207686_11644433 Ga0207686_116444332 67
1000 3300025935 Ga0207709_10405195 Ga0207709_104051952 67
1001 3300025935 Ga0207709_10620733 Ga0207709_106207333 67
1002 3300025936 Ga0207670_10020026 Ga0207670_100200265 67
1003 3300025936 Ga0207670_10186652 Ga0207670_101866522 67
1004 3300025936 Ga0207670_10787345 Ga0207670_107873453 67
1005 3300025937 Ga0207669_10011026 Ga0207669_100110263 67
1006 3300025937 Ga0207669_10194696 Ga0207669_101946963 67
1007 3300025938 Ga0207704_10336220 Ga0207704_103362203 67
1008 3300025938 Ga0207704_10483166 Ga0207704_104831663 67
1009 3300025938 Ga0207704_10655411 Ga0207704_106554112 67
1010 3300025938 Ga0207704_11051630 Ga0207704_110516302 67
1011 3300025938 Ga0207704_11655212 Ga0207704_116552122 67
1012 3300025939 Ga0207665_10023457 Ga0207665_100234573 67
1013 3300025939 Ga0207665_10026852 Ga0207665_100268523 67
1014 3300025939 Ga0207665_10054073 Ga0207665_100540734 67
1015 3300025939 Ga0207665_10204530 Ga0207665_102045303 67
1016 3300025939 Ga0207665_10232318 Ga0207665_102323182 67
1017 3300025939 Ga0207665_10451432 Ga0207665_104514323 67
1018 3300025939 Ga0207665_10552833 Ga0207665_105528331 67
1019 3300025939 Ga0207665_10841249 Ga0207665_108412492 67
1020 3300025940 Ga0207691_10037047 Ga0207691_100370475 67
1021 3300025940 Ga0207691_10151876 Ga0207691_101518762 67
1022 3300025940 Ga0207691_11415241 Ga0207691_114152412 67
1023 3300025942 Ga0207689_10086541 Ga0207689_100865412 67
1024 3300025942 Ga0207689_10111933 Ga0207689_101119333 67
1025 3300025942 Ga0207689_11087503 Ga0207689_110875032 67
1026 3300025944 Ga0207661_10035276 Ga0207661_100352762 67
1027 3300025944 Ga0207661_10393064 Ga0207661_103930642 67
1028 3300025944 Ga0207661_10452819 Ga0207661_104528192 67
1029 3300025944 Ga0207661_11031626 Ga0207661_110316262 67
1030 3300025945 Ga0207679_10094203 Ga0207679_100942035 67
1031 3300025945 Ga0207679_10401318 Ga0207679_104013184 67
1032 3300025945 Ga0207679_10418466 Ga0207679_104184663 67
1033 3300025945 Ga0207679_10673068 Ga0207679_106730683 67
1034 3300025960 Ga0207651_10059097 Ga0207651_100590973 67
1035 3300025960 Ga0207651_10081121 Ga0207651_100811212 67
1036 3300025960 Ga0207651_10277686 Ga0207651_102776862 67
1037 3300025960 Ga0207651_10296423 Ga0207651_102964232 67
1038 3300025960 Ga0207651_11566462 Ga0207651_115664622 67
1039 3300025961 Ga0207712_10010310 Ga0207712_1001031011 67
1040 3300025961 Ga0207712_10860402 Ga0207712_108604023 67
1041 3300025972 Ga0207668_10052709 Ga0207668_100527091 67
1042 3300025972 Ga0207668_10110386 Ga0207668_101103862 67
1043 3300025972 Ga0207668_10116809 Ga0207668_101168092 67
1044 3300025981 Ga0207640_10198487 Ga0207640_101984872 67
1045 3300025981 Ga0207640_10777008 Ga0207640_107770081 67
1046 3300025981 Ga0207640_11992280 Ga0207640_119922801 67
1047 3300025986 Ga0207658_10036520 Ga0207658_100365206 67
1048 3300025986 Ga0207658_10043698 Ga0207658_100436984 67
1049 3300025986 Ga0207658_10076513 Ga0207658_100765136 67
1050 3300026023 Ga0207677_10032534 Ga0207677_100325343 67
1051 3300026023 Ga0207677_10433542 Ga0207677_104335423 67
1052 3300026023 Ga0207677_10563597 Ga0207677_105635972 67
1053 3300026023 Ga0207677_10695856 Ga0207677_106958562 67
1054 3300026023 Ga0207677_10848651 Ga0207677_108486513 67
1055 3300026023 Ga0207677_11383214 Ga0207677_113832142 67
1056 3300026023 Ga0207677_11497088 Ga0207677_114970881 67
1057 3300026035 Ga0207703_10003624 Ga0207703_1000362425 67
1058 3300026035 Ga0207703_10549854 Ga0207703_105498542 67
1059 3300026035 Ga0207703_10900518 Ga0207703_109005182 67
1060 3300026035 Ga0207703_11952313 Ga0207703_119523131 67
1061 3300026041 Ga0207639_11033099 Ga0207639_110330992 67
1062 3300026067 Ga0207678_10020455 Ga0207678_1002045511 67
1063 3300026067 Ga0207678_10234839 Ga0207678_102348392 67
1064 3300026067 Ga0207678_10529024 Ga0207678_105290242 67
1065 3300026067 Ga0207678_11209444 Ga0207678_112094442 67
1066 3300026075 Ga0207708_10030364 Ga0207708_100303643 67
1067 3300026075 Ga0207708_10521317 Ga0207708_105213172 67
1068 3300026075 Ga0207708_10644573 Ga0207708_106445732 67
1069 3300026078 Ga0207702_10255395 Ga0207702_102553952 67
1070 3300026078 Ga0207702_10937471 Ga0207702_109374713 67
1071 3300026078 Ga0207702_11455685 Ga0207702_114556851 67
1072 3300026078 Ga0207702_12099462 Ga0207702_120994622 67
1073 3300026088 Ga0207641_10022387 Ga0207641_1002238711 67
1074 3300026088 Ga0207641_10717521 Ga0207641_107175212 67
1075 3300026088 Ga0207641_11141571 Ga0207641_111415712 67
1076 3300026088 Ga0207641_11206454 Ga0207641_112064541 67
1077 3300026089 Ga0207648_10108555 Ga0207648_101085556 67
1078 3300026089 Ga0207648_10302676 Ga0207648_103026763 67
1079 3300026089 Ga0207648_10708852 Ga0207648_107088521 67
1080 3300026095 Ga0207676_10895426 Ga0207676_108954263 67
1081 3300026116 Ga0207674_10342675 Ga0207674_103426753 67
1082 3300026116 Ga0207674_10995977 Ga0207674_109959772 67
1083 3300026118 Ga0207675_100066854 Ga0207675_1000668543 67
1084 3300026118 Ga0207675_100085155 Ga0207675_1000851556 67
1085 3300026118 Ga0207675_100551996 Ga0207675_1005519963 67
1086 3300026118 Ga0207675_101879321 Ga0207675_1018793212 67
1087 3300026121 Ga0207683_10015583 Ga0207683_1001558311 67
1088 3300026121 Ga0207683_10089065 Ga0207683_100890653 67
1089 3300026121 Ga0207683_10428382 Ga0207683_104283822 67
1090 3300026121 Ga0207683_10433660 Ga0207683_104336602 67
1091 3300026121 Ga0207683_11438819 Ga0207683_114388191 67
1092 3300026142 Ga0207698_11609693 Ga0207698_116096931 67
1093 3300026142 Ga0207698_11896038 Ga0207698_118960382 67
1094 3300027424 Ga0209984_1014198 Ga0209984_10141982 67
1095 3300027614 Ga0209970_1035731 Ga0209970_10357313 67
1096 3300027617 Ga0210002_1069008 Ga0210002_10690082 67
1097 3300027876 Ga0209974_10002731 Ga0209974_100027315 67
1098 3300027876 Ga0209974_10165190 Ga0209974_101651901 67
1099 3300027876 Ga0209974_10175797 Ga0209974_101757971 67
1100 3300027907 Ga0207428_10537082 Ga0207428_105370822 67
1101 3300028379 Ga0268266_10026994 Ga0268266_100269944 67
1102 3300028379 Ga0268266_10194689 Ga0268266_101946894 67
1103 3300028379 Ga0268266_10391086 Ga0268266_103910862 67
1104 3300028379 Ga0268266_10395399 Ga0268266_103953991 67
1105 3300028379 Ga0268266_10488001 Ga0268266_104880013 67
1106 3300028380 Ga0268265_10198884 Ga0268265_101988844 67
1107 3300028380 Ga0268265_10831073 Ga0268265_108310732 67
1108 3300028380 Ga0268265_10971562 Ga0268265_109715623 67
1109 3300028381 Ga0268264_10029276 Ga0268264_100292767 67
1110 3300028381 Ga0268264_10236756 Ga0268264_102367562 67
1111 3300028381 Ga0268264_10697174 Ga0268264_106971742 67
1112 3300028381 Ga0268264_11102608 Ga0268264_111026082 67
1113 3300028381 Ga0268264_11969376 Ga0268264_119693761 67
1114 3300031456 Ga0307513_10023335 Ga0307513_1002333511 67
1115 3300035083 Ga0373926_0071067 Ga0373926_0071067_500_703 67
1116 3300035086 Ga0373934_0458744 Ga0373934_0458744_46_249 67
1117 3300035111 Ga0373923_0370181 Ga0373923_0370181_306_527 67
1118 3300035112 Ga0373932_0144460 Ga0373932_0144460_389_595 67
1119 3300035113 Ga0373936_0063141 Ga0373936_0063141_931_1134 67
1120 3300035113 Ga0373936_0089102 Ga0373936_0089102_604_807 67
1121 3300035114 Ga0373939_0144169 Ga0373939_0144169_369_575 67
1122 3300035114 Ga0373939_0199620 Ga0373939_0199620_32_238 67
1123 3300035115 Ga0373941_0275716 Ga0373941_0275716_448_651 67
1124 3300035116 Ga0373945_0049243 Ga0373945_0049243_546_749 67
1125 3300035116 Ga0373945_0227619 Ga0373945_0227619_496_699 67
1126 3300035116 Ga0373945_0309808 Ga0373945_0309808_72_275 67
1127 3300035117 Ga0373953_0246233 Ga0373953_0246233_403_606 67
1128 3300035117 Ga0373953_0264792 Ga0373953_0264792_464_691 67
1129 3300035118 Ga0373954_0144032 Ga0373954_0144032_66_269 67
1130 3300035118 Ga0373954_0263820 Ga0373954_0263820_568_771 67
1131 3300035119 Ga0373956_0096615 Ga0373956_0096615_43_270 67
1132 3300035119 Ga0373956_0513677 Ga0373956_0513677_313_516 67
1133 3300035120 Ga0373957_0043978 Ga0373957_0043978_961_1164 67
1134 3300035121 Ga0373960_0186212 Ga0373960_0186212_312_518 67
1135 3300035170 Ga0373943_0075146 Ga0373943_0075146_1393_1596 67
1136 3300035170 Ga0373943_0130170 Ga0373943_0130170_21_224 67
1137 3300035170 Ga0373943_0146425 Ga0373943_0146425_278_481 67
1138 3300035170 Ga0373943_0319387 Ga0373943_0319387_58_276 67
1139 3300035170 Ga0373943_0436808 Ga0373943_0436808_416_619 67
1140 3300035171 Ga0373946_0014471 Ga0373946_0014471_604_807 67
1141 3300035171 Ga0373946_0103567 Ga0373946_0103567_531_749 67
1142 3300035171 Ga0373946_0167595 Ga0373946_0167595_724_927 67
1143 3300035171 Ga0373946_0325878 Ga0373946_0325878_121_324 67
1144 3300035172 Ga0373955_0133643 Ga0373955_0133643_956_1183 67
1145 3300035172 Ga0373955_0248788 Ga0373955_0248788_766_969 67
1146 3300035241 Ga0373961_0190229 Ga0373961_0190229_332_538 67
1147 3300035410 Ga0373924_0014324 Ga0373924_0014324_981_1208 67
1148 3300035410 Ga0373924_0202054 Ga0373924_0202054_53_256 67
1149 3300035692 Ga0373935_0034641 Ga0373935_0034641_1396_1599 67
1150 3300035692 Ga0373935_0334591 Ga0373935_0334591_612_830 67
1151 3300035692 Ga0373935_0725297 Ga0373935_0725297_304_507 67
1152 3300035695 Ga0373927_0010910 Ga0373927_0010910_4877_5080 67
1153 3300035695 Ga0373927_0040560 Ga0373927_0040560_1673_1876 67
1154 3300035695 Ga0373927_0266811 Ga0373927_0266811_268_471 67
1155 3300035724 Ga0373933_0088778 Ga0373933_0088778_443_670 67
1156 3300035724 Ga0373933_0394291 Ga0373933_0394291_454_657 67
1157 3300035724 Ga0373933_0687695 Ga0373933_0687695_400_603 67
1158 3300035725 Ga0373947_0031650 Ga0373947_0031650_1330_1533 67
1159 3300035725 Ga0373947_0036106 Ga0373947_0036106_2127_2330 67
1160 3300035725 Ga0373947_0044039 Ga0373947_0044039_510_728 67
1161 3300035725 Ga0373947_0107417 Ga0373947_0107417_737_940 67
1162 3300035725 Ga0373947_0195825 Ga0373947_0195825_182_385 67
1163 3300035725 Ga0373947_0225808 Ga0373947_0225808_714_917 67
1164 3300035725 Ga0373947_0475836 Ga0373947_0475836_597_800 67
1165 3300036401 Ga0373937_0007935 Ga0373937_0007935_525_728 67
1166 3300036401 Ga0373937_0065643 Ga0373937_0065643_747_950 67
1167 3300036401 Ga0373937_0195834 Ga0373937_0195834_100_327 67
1168 3300036401 Ga0373937_0420927 Ga0373937_0420927_79_300 67
1169 3300037068 Ga0373925_0034819 Ga0373925_0034819_2134_2337 67
1170 3300037068 Ga0373925_0040917 Ga0373925_0040917_3172_3390 67
1171 3300037068 Ga0373925_0065822 Ga0373925_0065822_1210_1413 67
1172 3300037068 Ga0373925_0068631 Ga0373925_0068631_214_417 67
1173 3300037068 Ga0373925_0160554 Ga0373925_0160554_724_927 67
1174 3300037068 Ga0373925_0176068 Ga0373925_0176068_563_766 67
1175 3300037068 Ga0373925_0180445 Ga0373925_0180445_764_991 67
1176 3300037068 Ga0373925_0259036 Ga0373925_0259036_1048_1251 67
1177 3300037068 Ga0373925_0774564 Ga0373925_0774564_40_258 67
1178 3300037068 Ga0373925_0831281 Ga0373925_0831281_142_378 67
1179 3300037312 Ga0395899_0047074 Ga0395899_0047074_1506_1709 67
1180 3300037312 Ga0395899_0633035 Ga0395899_0633035_52_255 67
1181 3300037418 Ga0395900_0008031 Ga0395900_0008031_4868_5071 67
1182 3300037418 Ga0395900_0111523 Ga0395900_0111523_781_984 67
1183 3300037418 Ga0395900_0706607 Ga0395900_0706607_493_696 67
1184 3300037418 Ga0395900_0759771 Ga0395900_0759771_611_814 67
1185 3300037466 Ga0395898_0002044 Ga0395898_0002044_20964_21167 67
1186 3300037466 Ga0395898_0602115 Ga0395898_0602115_772_975 67
1187 3300037471 Ga0395905_0357397 Ga0395905_0357397_252_455 67
1188 3300037471 Ga0395905_0753845 Ga0395905_0753845_301_504 67
1189 3300037471 Ga0395905_1300248 Ga0395905_1300248_165_368 67
1190 3300037853 Ga0436364_0850081 Ga0436364_0850081_335_541 67
1191 3300038443 Ga0395901_0002964 Ga0395901_0002964_13667_13870 67
1192 3300038443 Ga0395901_0064660 Ga0395901_0064660_1894_2097 67
1193 3300038443 Ga0395901_0437562 Ga0395901_0437562_337_540 67
1194 3300039437 Ga0436365_0345467 Ga0436365_0345467_464_670 67
1195 3300039450 Ga0436363_1236879 Ga0436363_1236879_366_602 67
1196 3300041443 Ga0451789_1020370 Ga0451789_1020370_323_526 67
1197 3300041451 Ga0451791_1864675 Ga0451791_1864675_141_344 67
1198 3300041452 Ga0451793_0969996 Ga0451793_0969996_64_267 67
1199 3300041456 Ga0451795_0375776 Ga0451795_0375776_280_483 67
1200 3300041460 Ga0451802_0741526 Ga0451802_0741526_318_521 67
1201 3300041460 Ga0451802_0769737 Ga0451802_0769737_285_503 67
1202 3300041460 Ga0451802_1371756 Ga0451802_1371756_131_334 67
1203 3300041486 Ga0451807_0068204 Ga0451807_0068204_182_385 67
1204 3300041501 Ga0451845_0545397 Ga0451845_0545397_112_315 67
1205 3300041505 Ga0451849_0026473 Ga0451849_0026473_180_383 67
1206 3300041511 Ga0451855_0802694 Ga0451855_0802694_301_504 67
1207 3300041512 Ga0451853_0516564 Ga0451853_0516564_94_297 67
1208 3300041512 Ga0451853_1896950 Ga0451853_1896950_610_813 67
1209 3300041512 Ga0451853_1958043 Ga0451853_1958043_429_632 67
1210 3300041512 Ga0451853_3591552 Ga0451853_3591552_263_466 67
1211 3300042005 Ga0439448_0063421 Ga0439448_0063421_704_907 67
1212 3300042005 Ga0439448_0078090 Ga0439448_0078090_480_683 67
1213 3300042009 Ga0439451_039740 Ga0439451_039740_460_663 67
1214 3300042009 Ga0439451_067856 Ga0439451_067856_429_632 67
1215 3300042011 Ga0439454_003697 Ga0439454_003697_275_478 67
1216 3300042012 Ga0439455_0005259 Ga0439455_0005259_2293_2496 67
1217 3300042012 Ga0439455_0209736 Ga0439455_0209736_328_531 67
1218 3300042142 Ga0450905_061433 Ga0450905_061433_11_214 67
1219 3300042157 Ga0439458_0011685 Ga0439458_0011685_755_958 67
1220 3300042157 Ga0439458_0054144 Ga0439458_0054144_504_707 67
1221 3300042439 Ga0439464_0082385 Ga0439464_0082385_442_645 67
1222 3300042993 Ga0439440_0037206 Ga0439440_0037206_91_294 67
1223 3300045051 Ga0451576_0146081 Ga0451576_0146081_1960_2163 67
1224 3300045051 Ga0451576_0278466 Ga0451576_0278466_1195_1398 67
1225 3300045976 Ga0466967_0339308 Ga0466967_0339308_104_316 67
1226 3300046454 Ga0495592_0049064 Ga0495592_0049064_486_689 67
1227 3300046454 Ga0495592_0082388 Ga0495592_0082388_803_1030 67
1228 3300046455 Ga0495603_0104836 Ga0495603_0104836_709_912 67
1229 3300046455 Ga0495603_0401225 Ga0495603_0401225_423_626 67
1230 3300046455 Ga0495603_0407001 Ga0495603_0407001_500_703 67
1231 3300046457 Ga0495590_0103909 Ga0495590_0103909_455_658 67
1232 3300046459 Ga0495629_0008333 Ga0495629_0008333_3621_3824 67
1233 3300046459 Ga0495629_0204547 Ga0495629_0204547_496_699 67
1234 3300046459 Ga0495629_0334860 Ga0495629_0334860_79_297 67
1235 3300046459 Ga0495629_0757639 Ga0495629_0757639_158_376 67
1236 3300046461 Ga0495641_0062450 Ga0495641_0062450_271_474 67
1237 3300046462 Ga0495651_0122706 Ga0495651_0122706_1202_1429 67
1238 3300046462 Ga0495651_0371381 Ga0495651_0371381_659_865 67
1239 3300046462 Ga0495651_0448787 Ga0495651_0448787_280_492 67
1240 3300046462 Ga0495651_0511913 Ga0495651_0511913_467_670 67
1241 3300046462 Ga0495651_0680814 Ga0495651_0680814_223_426 67
1242 3300046463 Ga0495653_0360908 Ga0495653_0360908_543_746 67
1243 3300046463 Ga0495653_0484627 Ga0495653_0484627_448_651 67
1244 3300046463 Ga0495653_0679411 Ga0495653_0679411_139_342 67
1245 3300046472 Ga0495580_0359881 Ga0495580_0359881_385_588 67
1246 3300046473 Ga0495582_0314706 Ga0495582_0314706_568_771 67
1247 3300046474 Ga0495605_0076983 Ga0495605_0076983_56_259 67
1248 3300046475 Ga0495639_0374997 Ga0495639_0374997_289_492 67
1249 3300046476 Ga0495662_0056346 Ga0495662_0056346_1645_1848 67
1250 3300046476 Ga0495662_0342468 Ga0495662_0342468_434_637 67
1251 3300046477 Ga0495664_0127274 Ga0495664_0127274_864_1067 67
1252 3300046477 Ga0495664_0135201 Ga0495664_0135201_958_1185 67
1253 3300046499 Ga0495594_0151606 Ga0495594_0151606_339_542 67
1254 3300046501 Ga0495607_0125264 Ga0495607_0125264_119_325 67
1255 3300046511 Ga0495608_0443139 Ga0495608_0443139_341_568 67
1256 3300046511 Ga0495608_0454416 Ga0495608_0454416_216_419 67
1257 3300046511 Ga0495608_0602489 Ga0495608_0602489_216_419 67
1258 3300046514 Ga0495618_0059321 Ga0495618_0059321_540_743 67
1259 3300046514 Ga0495618_0223091 Ga0495618_0223091_43_246 67
1260 3300046514 Ga0495618_0260021 Ga0495618_0260021_758_985 67
1261 3300046516 Ga0495628_0004287 Ga0495628_0004287_10983_11186 67
1262 3300046516 Ga0495628_0079826 Ga0495628_0079826_2110_2337 67
1263 3300046517 Ga0495630_0017678 Ga0495630_0017678_4164_4391 67
1264 3300046517 Ga0495630_0217786 Ga0495630_0217786_22_225 67
1265 3300046517 Ga0495630_1310000 Ga0495630_1310000_82_285 67
1266 3300046523 Ga0495644_0096747 Ga0495644_0096747_226_429 67
1267 3300046526 Ga0495666_0122893 Ga0495666_0122893_908_1111 67
1268 3300046526 Ga0495666_0492359 Ga0495666_0492359_265_468 67
1269 3300046529 Ga0495652_0045601 Ga0495652_0045601_933_1136 67
1270 3300046529 Ga0495652_0064185 Ga0495652_0064185_2056_2283 67
1271 3300046531 Ga0495665_0529948 Ga0495665_0529948_299_502 67
1272 3300046533 Ga0495640_0027037 Ga0495640_0027037_1935_2162 67
1273 3300046533 Ga0495640_0354961 Ga0495640_0354961_102_305 67
1274 3300046533 Ga0495640_0591582 Ga0495640_0591582_216_419 67
1275 3300046533 Ga0495640_0776756 Ga0495640_0776756_228_431 67
1276 3300046535 Ga0495586_0014140 Ga0495586_0014140_1828_2031 67
1277 3300046535 Ga0495586_0350618 Ga0495586_0350618_11_214 67
1278 3300046536 Ga0495587_0004117 Ga0495587_0004117_7990_8193 67
1279 3300046536 Ga0495587_0101619 Ga0495587_0101619_937_1164 67
1280 3300046537 Ga0495598_0012406 Ga0495598_0012406_232_450 67
1281 3300046537 Ga0495598_0016088 Ga0495598_0016088_266_472 67
1282 3300046537 Ga0495598_0029599 Ga0495598_0029599_872_1075 67
1283 3300046537 Ga0495598_0148939 Ga0495598_0148939_343_546 67
1284 3300046539 Ga0495621_0292057 Ga0495621_0292057_371_589 67
1285 3300046539 Ga0495621_0438891 Ga0495621_0438891_100_303 67
1286 3300046543 Ga0495645_0001076 Ga0495645_0001076_2560_2763 67
1287 3300046543 Ga0495645_0489335 Ga0495645_0489335_345_572 67
1288 3300046559 Ga0495667_0032250 Ga0495667_0032250_1624_1827 67
1289 3300046559 Ga0495667_0071324 Ga0495667_0071324_1641_1844 67
1290 3300046616 Ga0495668_0620313 Ga0495668_0620313_296_499 67
1291 3300046642 Ga0495634_0131202 Ga0495634_0131202_906_1109 67
1292 3300046642 Ga0495634_0355677 Ga0495634_0355677_295_522 67
1293 3300046648 Ga0495611_0136393 Ga0495611_0136393_411_614 67
1294 3300046663 Ga0495635_0204821 Ga0495635_0204821_731_934 67
1295 3300046663 Ga0495635_0244606 Ga0495635_0244606_918_1124 67
1296 3300046663 Ga0495635_0342139 Ga0495635_0342139_93_320 67
1297 3300046664 Ga0495659_0442193 Ga0495659_0442193_266_484 67
1298 3300046674 Ga0495588_0189414 Ga0495588_0189414_185_388 67
1299 3300046674 Ga0495588_0212760 Ga0495588_0212760_147_350 67
1300 3300046674 Ga0495588_0650476 Ga0495588_0650476_179_382 67
1301 3300046675 Ga0495657_0091838 Ga0495657_0091838_965_1168 67
1302 3300046675 Ga0495657_0226063 Ga0495657_0226063_231_434 67
1303 3300046678 Ga0495599_0000317 Ga0495599_0000317_11820_12023 67
1304 3300046679 Ga0495623_0000811 Ga0495623_0000811_14283_14486 67
1305 3300046680 Ga0495646_0002940 Ga0495646_0002940_5381_5584 67
1306 3300046680 Ga0495646_0435121 Ga0495646_0435121_36_263 67
1307 3300046683 Ga0495658_0145447 Ga0495658_0145447_426_632 67
1308 3300046683 Ga0495658_0209856 Ga0495658_0209856_331_534 67
1309 3300046683 Ga0495658_0460690 Ga0495658_0460690_48_251 67
1310 3300046683 Ga0495658_0825100 Ga0495658_0825100_103_306 67
1311 3300046684 Ga0495669_0039850 Ga0495669_0039850_1649_1876 67
1312 3300046684 Ga0495669_0178602 Ga0495669_0178602_703_909 67
1313 3300046684 Ga0495669_0478282 Ga0495669_0478282_213_416 67
1314 3300046684 Ga0495669_0524567 Ga0495669_0524567_107_310 67
1315 3300046684 Ga0495669_0610218 Ga0495669_0610218_38_244 67
1316 3300046689 Ga0495613_0374245 Ga0495613_0374245_258_461 67
1317 3300046689 Ga0495613_0381763 Ga0495613_0381763_514_717 67
1318 3300046689 Ga0495613_0386688 Ga0495613_0386688_699_917 67
1319 3300046689 Ga0495613_0463783 Ga0495613_0463783_199_426 67
1320 3300046690 Ga0495624_0308077 Ga0495624_0308077_232_435 67
1321 3300046690 Ga0495624_0508779 Ga0495624_0508779_381_587 67
1322 3300046690 Ga0495624_0778555 Ga0495624_0778555_230_433 67
1323 3300046690 Ga0495624_0894089 Ga0495624_0894089_31_249 67
1324 3300046690 Ga0495624_0919858 Ga0495624_0919858_119_322 67
1325 3300046692 Ga0495671_0555448 Ga0495671_0555448_218_421 67
1326 3300046809 Ga0495600_0595268 Ga0495600_0595268_451_654 67
1327 3300046809 Ga0495600_0807626 Ga0495600_0807626_127_330 67
1328 3300047315 Ga0495581_0081281 Ga0495581_0081281_1308_1511 67
1329 3300047317 Ga0495604_0053697 Ga0495604_0053697_2732_2935 67
1330 3300047317 Ga0495604_0288710 Ga0495604_0288710_772_975 67
1331 3300047317 Ga0495604_0331125 Ga0495604_0331125_427_639 67
1332 3300047317 Ga0495604_0378222 Ga0495604_0378222_500_727 67
1333 3300047318 Ga0495636_0151276 Ga0495636_0151276_337_540 67
1334 3300047319 Ga0495674_0195915 Ga0495674_0195915_1046_1258 67
1335 3300047319 Ga0495674_0400841 Ga0495674_0400841_166_369 67
1336 3300047319 Ga0495674_0599809 Ga0495674_0599809_494_697 67
1337 3300047319 Ga0495674_0882155 Ga0495674_0882155_296_523 67
1338 3300047321 Ga0495676_0261423 Ga0495676_0261423_682_885 67
1339 3300047321 Ga0495676_0315817 Ga0495676_0315817_362_565 67
1340 3300047321 Ga0495676_0394561 Ga0495676_0394561_254_457 67
1341 3300047322 Ga0495680_0209613 Ga0495680_0209613_400_603 67
1342 3300047444 Ga0495675_0002584 Ga0495675_0002584_9184_9411 67
1343 3300047444 Ga0495675_0044543 Ga0495675_0044543_192_395 67
1344 3300047447 Ga0495685_086151 Ga0495685_086151_707_910 67
1345 3300047471 Ga0495684_0029134 Ga0495684_0029134_1951_2178 67
1346 3300047471 Ga0495684_0064236 Ga0495684_0064236_968_1171 67
1347 3300047471 Ga0495684_0218935 Ga0495684_0218935_80_286 67
1348 3300048088 Ga0495602_0109432 Ga0495602_0109432_1690_1917 67
1349 3300048088 Ga0495602_0121992 Ga0495602_0121992_392_595 67
1350 3300048088 Ga0495602_0593907 Ga0495602_0593907_234_437 67
1351 3300048088 Ga0495602_0977255 Ga0495602_0977255_162_365 67
1352 3300048090 Ga0495615_0317945 Ga0495615_0317945_223_441 67
1353 3300048091 Ga0495626_0170422 Ga0495626_0170422_318_521 67
1354 3300048903 Ga0496100_0253997 Ga0496100_0253997_762_965 67
1355 3300048903 Ga0496100_0998686 Ga0496100_0998686_337_540 67
1356 3300048904 Ga0496101_0033960 Ga0496101_0033960_866_1069 67
1357 3300048904 Ga0496101_0120036 Ga0496101_0120036_1582_1785 67
1358 3300048904 Ga0496101_0244550 Ga0496101_0244550_946_1149 67
1359 3300048904 Ga0496101_0420246 Ga0496101_0420246_175_378 67
1360 3300048904 Ga0496101_1119624 Ga0496101_1119624_271_474 67
1361 3300048905 Ga0496102_0028763 Ga0496102_0028763_4111_4314 67
1362 3300048905 Ga0496102_0035336 Ga0496102_0035336_2246_2449 67
1363 3300048905 Ga0496102_0081398 Ga0496102_0081398_1750_1953 67
1364 3300048905 Ga0496102_0120716 Ga0496102_0120716_915_1118 67
1365 3300048905 Ga0496102_0712924 Ga0496102_0712924_347_550 67
1366 3300048905 Ga0496102_0809927 Ga0496102_0809927_221_424 67
1367 3300048906 Ga0496103_0220069 Ga0496103_0220069_876_1079 67
1368 3300048906 Ga0496103_0242836 Ga0496103_0242836_452_655 67
1369 3300048906 Ga0496103_0393747 Ga0496103_0393747_285_488 67
1370 3300048907 Ga0496104_0102699 Ga0496104_0102699_1840_2043 67
1371 3300048907 Ga0496104_0108532 Ga0496104_0108532_1448_1660 67
1372 3300048907 Ga0496104_0136889 Ga0496104_0136889_1307_1510 67
1373 3300048907 Ga0496104_0168761 Ga0496104_0168761_1816_2037 67
1374 3300048907 Ga0496104_0699020 Ga0496104_0699020_610_813 67
1375 3300048907 Ga0496104_1609662 Ga0496104_1609662_305_508 67
1376 3300048908 Ga0496105_0014160 Ga0496105_0014160_1728_1931 67
1377 3300048908 Ga0496105_0201100 Ga0496105_0201100_463_666 67
1378 3300048908 Ga0496105_0228200 Ga0496105_0228200_380_583 67
1379 3300048908 Ga0496105_0424240 Ga0496105_0424240_529_732 67
1380 3300048908 Ga0496105_1023973 Ga0496105_1023973_380_586 67
1381 3300048909 Ga0496106_0181663 Ga0496106_0181663_870_1073 67
1382 3300048909 Ga0496106_0669279 Ga0496106_0669279_226_429 67
1383 3300048909 Ga0496106_1489843 Ga0496106_1489843_41_262 67
1384 3300048910 Ga0496107_0515995 Ga0496107_0515995_238_441 67
1385 3300048910 Ga0496107_0701611 Ga0496107_0701611_264_467 67
1386 3300048911 Ga0496108_0227271 Ga0496108_0227271_529_735 67
1387 3300048911 Ga0496108_0289492 Ga0496108_0289492_1006_1209 67
1388 3300048911 Ga0496108_0385699 Ga0496108_0385699_891_1094 67
1389 3300048911 Ga0496108_0735373 Ga0496108_0735373_448_651 67
1390 3300048911 Ga0496108_1474427 Ga0496108_1474427_71_277 67
1391 3300048912 Ga0496109_0007242 Ga0496109_0007242_8689_8892 67
1392 3300048912 Ga0496109_0063355 Ga0496109_0063355_2138_2341 67
1393 3300048912 Ga0496109_0402868 Ga0496109_0402868_125_328 67
1394 3300048912 Ga0496109_0427849 Ga0496109_0427849_967_1170 67
1395 3300048912 Ga0496109_0583767 Ga0496109_0583767_292_513 67
1396 3300048912 Ga0496109_0661893 Ga0496109_0661893_566_772 67
1397 3300048912 Ga0496109_1264628 Ga0496109_1264628_77_280 67
1398 3300048913 Ga0496110_0085553 Ga0496110_0085553_1610_1813 67
1399 3300048913 Ga0496110_0167148 Ga0496110_0167148_1116_1337 67
1400 3300048913 Ga0496110_0348670 Ga0496110_0348670_379_582 67
1401 3300048913 Ga0496110_0504270 Ga0496110_0504270_268_471 67
1402 3300048913 Ga0496110_0957120 Ga0496110_0957120_330_533 67
1403 3300048914 Ga0496111_0162316 Ga0496111_0162316_1240_1443 67
1404 3300048914 Ga0496111_1002304 Ga0496111_1002304_145_348 67
1405 3300048915 Ga0496112_0190669 Ga0496112_0190669_1472_1675 67
1406 3300048915 Ga0496112_0221378 Ga0496112_0221378_673_894 67
1407 3300048915 Ga0496112_0223765 Ga0496112_0223765_559_762 67
1408 3300048915 Ga0496112_0245973 Ga0496112_0245973_1206_1409 67
1409 3300048915 Ga0496112_0320945 Ga0496112_0320945_973_1176 67
1410 3300048915 Ga0496112_0360815 Ga0496112_0360815_777_980 67
1411 3300048915 Ga0496112_0394307 Ga0496112_0394307_1022_1225 67
1412 3300048915 Ga0496112_1117331 Ga0496112_1117331_160_363 67
1413 3300048916 Ga0496113_0069914 Ga0496113_0069914_19_222 67
1414 3300048916 Ga0496113_0102219 Ga0496113_0102219_1689_1892 67
1415 3300048916 Ga0496113_0565248 Ga0496113_0565248_136_357 67
1416 3300048916 Ga0496113_0630181 Ga0496113_0630181_639_842 67
1417 3300048916 Ga0496113_0916518 Ga0496113_0916518_38_241 67
1418 3300048916 Ga0496113_1029711 Ga0496113_1029711_200_403 67
1419 3300048917 Ga0496114_0012997 Ga0496114_0012997_4107_4319 67
1420 3300048917 Ga0496114_0035218 Ga0496114_0035218_697_900 67
1421 3300048917 Ga0496114_0115165 Ga0496114_0115165_1374_1577 67
1422 3300048917 Ga0496114_0533694 Ga0496114_0533694_591_812 67
1423 3300048917 Ga0496114_0582057 Ga0496114_0582057_252_455 67
1424 3300048917 Ga0496114_0598799 Ga0496114_0598799_264_467 67
1425 3300048918 Ga0496115_0002575 Ga0496115_0002575_7794_7997 67
1426 3300048918 Ga0496115_0004314 Ga0496115_0004314_5976_6188 67
1427 3300048918 Ga0496115_0026271 Ga0496115_0026271_1931_2134 67
1428 3300048918 Ga0496115_0128133 Ga0496115_0128133_1460_1663 67
1429 3300048918 Ga0496115_0294208 Ga0496115_0294208_865_1068 67
1430 3300048918 Ga0496115_0387746 Ga0496115_0387746_650_853 67
1431 3300048918 Ga0496115_1437681 Ga0496115_1437681_80_283 67
1432 3300049584 Ga0501068_0449667 Ga0501068_0449667_47_250 67
1433 3300049585 Ga0501069_0570360 Ga0501069_0570360_346_549 67
1434 3300050507 nmdc:mga05p37_135223_c1 nmdc:mga05p37_135223_c1_80_283 67
1435 3300050507 nmdc:mga05p37_2087035_c1 nmdc:mga05p37_2087035_c1_13_216 67
1436 3300050507 nmdc:mga05p37_2090916_c1 nmdc:mga05p37_2090916_c1_265_468 67
1437 3300050507 nmdc:mga05p37_35285_c2 nmdc:mga05p37_35285_c2_3526_3729 67
1438 3300050507 nmdc:mga05p37_473501_c1 nmdc:mga05p37_473501_c1_935_1141 67
1439 3300050510 nmdc:mga06r32_971239_c1 nmdc:mga06r32_971239_c1_408_614 67
1440 3300050511 nmdc:mga08y16_1099761_c1 nmdc:mga08y16_1099761_c1_301_504 67
1441 3300050511 nmdc:mga08y16_1770500_c1 nmdc:mga08y16_1770500_c1_352_555 67
1442 3300050511 nmdc:mga08y16_247448_c1 nmdc:mga08y16_247448_c1_397_603 67
1443 3300050511 nmdc:mga08y16_738675_c1 nmdc:mga08y16_738675_c1_249_452 67
1444 3300050511 nmdc:mga08y16_811526_c1 nmdc:mga08y16_811526_c1_180_383 67
1445 3300050512 nmdc:mga0n895_1162717_c1 nmdc:mga0n895_1162717_c1_425_628 67
1446 3300050512 nmdc:mga0n895_1466075_c1 nmdc:mga0n895_1466075_c1_238_441 67
1447 3300050512 nmdc:mga0n895_212360_c1 nmdc:mga0n895_212360_c1_127_330 67
1448 3300050512 nmdc:mga0n895_233774_c1 nmdc:mga0n895_233774_c1_864_1067 67
1449 3300050512 nmdc:mga0n895_759064_c1 nmdc:mga0n895_759064_c1_562_765 67
1450 3300050513 nmdc:mga0rr50_1203860_c1 nmdc:mga0rr50_1203860_c1_301_504 67
1451 3300050513 nmdc:mga0rr50_383536_c1 nmdc:mga0rr50_383536_c1_936_1139 67
1452 3300050514 nmdc:mga08x19_28098_c1 nmdc:mga08x19_28098_c1_421_654 67
1453 3300050514 nmdc:mga08x19_520835_c1 nmdc:mga08x19_520835_c1_373_606 67
1454 3300050514 nmdc:mga08x19_631307_c1 nmdc:mga08x19_631307_c1_294_497 67
1455 3300050515 nmdc:mga0a205_1135164_c1 nmdc:mga0a205_1135164_c1_294_497 67
1456 3300050515 nmdc:mga0a205_415093_c1 nmdc:mga0a205_415093_c1_137_340 67
1457 3300053077 Ga0495601_0001921 Ga0495601_0001921_4752_4955 67
1458 3300053077 Ga0495601_0027550 Ga0495601_0027550_1989_2216 67
1459 3300053077 Ga0495601_0292224 Ga0495601_0292224_295_498 67
1460 3300053078 Ga0495612_0031116 Ga0495612_0031116_52_255 67
1461 3300053083 Ga0495655_0145261 Ga0495655_0145261_182_385 67
1462 3300053084 Ga0495595_0035542 Ga0495595_0035542_1489_1716 67
1463 3300053084 Ga0495595_0039367 Ga0495595_0039367_1455_1658 67
1464 3300053084 Ga0495595_0090399 Ga0495595_0090399_798_1001 67
1465 3300053084 Ga0495595_0431575 Ga0495595_0431575_295_498 67
1466 3300053085 Ga0495619_0083552 Ga0495619_0083552_1483_1710 67
1467 3300053085 Ga0495619_0164194 Ga0495619_0164194_372_575 67
1468 3300053085 Ga0495619_0259855 Ga0495619_0259855_408_611 67
1469 3300053085 Ga0495619_0272881 Ga0495619_0272881_184_387 67
1470 3300053125 Ga0500618_058191 Ga0500618_058191_176_379 67
1471 3300053177 Ga0500636_0323809 Ga0500636_0323809_169_372 67
1472 3300053728 Ga0500657_161662 Ga0500657_161662_214_417 67

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00831

Ribosomal_L29

Ribosomal L29 protein

6

62

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
6qul-assembly1.cif.gz_Z structure of a bacterial 50s ribosomal subunit in complex with the novel quinoxolidinone antibiotic cadazolid 0.9809 2 60
7nww-assembly1.cif.gz_X cspa-27 cotranslational folding intermediate 1 0.9806 2 60
5o60-assembly1.cif.gz_Z structure of the 50s large ribosomal subunit from mycobacterium smegmatis 0.9783 1 61
6fxc-assembly1.cif.gz_AW the cryo-em structure of hibernating 100s ribosome dimer from pathogenic staphylococcus aureus 0.9776 2 65
8a57-assembly1.cif.gz_2 cryo-em structure of hflxr bound to the listeria monocytogenes 50s ribosomal subunit. 0.9776 4 60
ID Description Score Start End Superfamily
4wf9V00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.9724 9 65 1.10.287.310
1vq5V00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.9596 1 60 1.10.287.310
4hubV00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.9582 1 60 1.10.287.310
3cclV00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.9582 1 60 1.10.287.310
1jj2U00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.9581 1 60 1.10.287.310
ID Description Score Start End GO Terms
AF-A0A554LL71-F1-model_v4 Large ribosomal subunit protein uL29 1.002 3 64 GO:0003735
GO:0005840
GO:0006412
GO:1990904
AF-A0A7C5YCB5-F1-model_v4 Large ribosomal subunit protein uL29 0.9962 3 61 GO:0003735
GO:0006412
GO:0022625
AF-A0A849J2I1-F1-model_v4 Large ribosomal subunit protein uL29 0.9958 1 60 GO:0003735
GO:0006412
GO:0022625
AF-A0A1F7U7H3-F1-model_v4 Large ribosomal subunit protein uL29 0.9954 2 66 GO:0003735
GO:0005840
GO:0006412
GO:1990904
AF-A0A7V3XB59-F1-model_v4 Large ribosomal subunit protein uL29 0.9934 1 65 GO:0003735
GO:0006412
GO:0022625

Feature Viewer

pLDDT pTM Quality
91.8 0.76 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map