F494084

General Info

Members Datasets Scaffolds Average Seq Length
1455 391 1454 179

Family's Representative Sequence

Representative Sequence 3300019188|Ga0184599_139676|Ga0184599_1396761
Length 178
Sequence MSRIGKKPIAIPKGVTVKIEGNTVLVQGPKGKLDTALPAGIKVEQKDGNIVAIRENDSQAAVHGLARALVNNAVEGVTKGWTRDLEIVGIGYRAEMKGKTVVFSLGYSHPIEYPLPTGVDAVVDPKQTKISLTGIDRQKVGQVAAEMRALRPPDPYKNKGVRYAGERLKKKVGKTGAK

Samples

Sample ID Description Type Environment
1 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
2 2884215851 Edaphobacter sp. 12200R-103 Isolate Rhizosphere
3 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
4 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
5 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
6 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
7 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
8 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
9 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
10 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
11 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
12 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
13 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
14 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
15 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
16 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
17 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
18 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
19 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
20 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
21 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
22 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
23 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
24 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
25 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
26 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
27 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
28 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
29 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
30 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
31 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
32 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
33 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
34 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
35 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
36 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
37 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
38 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
39 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
40 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
41 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
42 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
43 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
44 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
45 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
46 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
47 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
48 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
49 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
50 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
51 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
52 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
53 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
54 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
55 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
56 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
57 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
58 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
59 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
60 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
61 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
62 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
63 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
64 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
65 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
66 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
67 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
68 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
69 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
70 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
71 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
72 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
73 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
74 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
75 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
76 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
77 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
78 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
79 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
80 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
81 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
82 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
83 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
84 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
85 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
86 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
87 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
89 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
90 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
91 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
92 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
93 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
94 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
95 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
96 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
97 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
98 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
99 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
100 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
101 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
102 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
103 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
104 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
105 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
106 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
107 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
108 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
109 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
110 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
111 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
112 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
113 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
114 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
115 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
116 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
117 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
118 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
119 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
120 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
121 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
122 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
123 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
124 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
125 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
126 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
127 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
128 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
129 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
130 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
131 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
132 3300019188 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE2 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
133 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
134 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
135 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
136 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
137 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
138 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
139 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
140 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
141 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
142 3300022730 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU2 Metagenome Rhizosphere
143 3300023672 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
144 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
145 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
146 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
212 3300028023 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 Metagenome Rhizosphere
213 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
217 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
218 3300030836 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
219 3300030863 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
220 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
221 3300030886 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
222 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
223 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
224 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
225 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
226 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
227 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
228 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
229 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
230 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
231 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
232 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
233 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
234 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
235 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
236 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
237 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
238 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
239 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
240 3300032120 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
241 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
242 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
243 3300033544 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 Metagenome Unclassified
244 3300033545 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 Metagenome Unclassified
245 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
246 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
247 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
248 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
249 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
250 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
251 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
252 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
253 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
254 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
255 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
256 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
257 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
258 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
259 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
260 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
261 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
262 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
263 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
264 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
265 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
266 3300036457 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
267 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
268 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
269 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
270 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
271 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
272 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
273 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
274 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
275 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
276 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
277 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
278 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
279 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
280 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
281 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
282 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
283 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
284 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
285 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
286 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
287 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
288 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
289 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
290 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
291 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
292 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
293 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
294 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
295 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
296 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
297 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
298 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
299 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
300 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
301 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
302 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
303 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
304 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
305 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
306 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
307 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
308 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
309 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
310 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
311 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
312 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
313 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
314 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
315 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
316 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
317 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
318 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
319 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
320 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
321 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
322 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
323 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
324 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
325 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
326 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
327 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
328 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
329 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
330 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
331 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
332 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
333 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
334 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
335 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
336 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
337 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
338 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
339 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
340 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
341 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
342 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
343 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
344 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
345 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
346 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
347 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
348 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
349 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
350 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
351 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
352 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
353 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
354 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
355 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
356 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
357 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
358 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
359 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
360 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
361 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
362 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
363 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
364 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
365 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
366 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
367 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
368 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
369 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
370 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
371 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
372 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
373 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
374 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
375 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
376 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
377 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
378 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
379 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
380 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
381 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
382 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
383 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
384 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
385 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
386 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
387 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
388 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
389 3300059509 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
390 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
391 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.11
Metatranscriptomes 2.82
Isolates 0.07

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.34
Nodule 0
Rhizoplane 4.54
Rhizosphere 93.95
Stem 0
Stem Tuber 0
Unclassified 1.17

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MBSR1b_contig_8729389 2162886012 Bacteria 1015
2 JGI24736J21556_1018094 3300001904 Bacteria 1116
3 JGI24752J21851_1000484 3300001976 Bacteria 5323
4 JGI24747J21853_1000395 3300001978 Bacteria 2628
5 JGI24034J26672_10001629 3300002239 Bacteria 3004
6 JGI24751J29686_10001356 3300002459 Bacteria 5148
7 Ga0058859_11470862 3300004798 Bacteria 1955
8 Ga0058863_11802639 3300004799 Bacteria 966
9 Ga0058863_11938496 3300004799 Bacteria 1659
10 Ga0058861_10007822 3300004800 Bacteria 1800
11 Ga0058861_11624704 3300004800 Bacteria 1153
12 Ga0058861_11899665 3300004800 Bacteria 1637
13 Ga0058862_10002646 3300004803 Bacteria 2282
14 Ga0058862_10017147 3300004803 Bacteria 2061
15 Ga0058862_10197740 3300004803 Bacteria 5441
16 Ga0058862_12640743 3300004803 Bacteria 968
17 Ga0065712_10129019 3300005290 Bacteria 1572
18 Ga0065712_10366129 3300005290 Unclassified 769
19 Ga0065715_10095964 3300005293 Bacteria 3972
20 Ga0070658_10000766 3300005327 Bacteria 27565
21 Ga0070658_10012762 3300005327 Bacteria 6741
22 Ga0070658_10017988 3300005327 Bacteria 5653
23 Ga0070658_10050557 3300005327 Bacteria 3369
24 Ga0070658_10120566 3300005327 Bacteria 2179
25 Ga0070676_10004776 3300005328 Bacteria 7163
26 Ga0070676_10009197 3300005328 Bacteria 5341
27 Ga0070683_100011087 3300005329 Bacteria 7771
28 Ga0070683_100051474 3300005329 Bacteria 3813
29 Ga0070683_100053730 3300005329 Bacteria 3733
30 Ga0070683_100209124 3300005329 Bacteria 1853
31 Ga0070683_100234561 3300005329 Bacteria 1744
32 Ga0070683_100320932 3300005329 Bacteria 1474
33 Ga0070683_100362234 3300005329 Bacteria 1381
34 Ga0070683_100547916 3300005329 Bacteria 1106
35 Ga0070690_100000550 3300005330 Bacteria 18744
36 Ga0070690_100022065 3300005330 Bacteria 3893
37 Ga0070690_100100672 3300005330 Bacteria 1916
38 Ga0070670_100009055 3300005331 Bacteria 8505
39 Ga0070670_100015559 3300005331 Bacteria 6534
40 Ga0070670_100033183 3300005331 Bacteria 4447
41 Ga0070670_100765487 3300005331 Bacteria 871
42 Ga0070677_10066505 3300005333 Bacteria 1503
43 Ga0068869_100001846 3300005334 Bacteria 12731
44 Ga0068869_100012003 3300005334 Bacteria 5703
45 Ga0068869_100014372 3300005334 Bacteria 5286
46 Ga0068869_100414207 3300005334 Bacteria 1111
47 Ga0068869_100643640 3300005334 Bacteria 899
48 Ga0070666_10010107 3300005335 Bacteria 5893
49 Ga0070666_10010510 3300005335 Bacteria 5791
50 Ga0070666_10076210 3300005335 Bacteria 2287
51 Ga0070680_100014163 3300005336 Bacteria 6229
52 Ga0070680_100016919 3300005336 Bacteria 5741
53 Ga0070680_100087043 3300005336 Bacteria 2583
54 Ga0070680_100100834 3300005336 Bacteria 2397
55 Ga0070680_100148246 3300005336 Bacteria 1969
56 Ga0070680_100232677 3300005336 Bacteria 1556
57 Ga0070680_100478333 3300005336 Bacteria 1064
58 Ga0070680_100482949 3300005336 Bacteria 1059
59 Ga0070680_100590538 3300005336 Unclassified 953
60 Ga0070682_100060415 3300005337 Bacteria 2397
61 Ga0070682_100102107 3300005337 Bacteria 1895
62 Ga0068868_100002791 3300005338 Bacteria 12099
63 Ga0068868_100012462 3300005338 Bacteria 6217
64 Ga0068868_100018109 3300005338 Bacteria 5259
65 Ga0068868_100022874 3300005338 Bacteria 4724
66 Ga0068868_100161538 3300005338 Bacteria 1850
67 Ga0068868_100687367 3300005338 Bacteria 914
68 Ga0070660_100006039 3300005339 Bacteria 8373
69 Ga0070660_100006108 3300005339 Bacteria 8329
70 Ga0070660_100023782 3300005339 Bacteria 4541
71 Ga0070660_100034984 3300005339 Bacteria 3799
72 Ga0070660_100056691 3300005339 Bacteria 3032
73 Ga0070660_100067591 3300005339 Bacteria 2784
74 Ga0070660_100139461 3300005339 Bacteria 1944
75 Ga0070660_100376518 3300005339 Bacteria 1172
76 Ga0070689_101136649 3300005340 Bacteria 699
77 Ga0070687_100000493 3300005343 Bacteria 13161
78 Ga0070661_100013936 3300005344 Bacteria 5651
79 Ga0070661_100015069 3300005344 Bacteria 5454
80 Ga0070661_100018897 3300005344 Bacteria 4907
81 Ga0070661_100078274 3300005344 Bacteria 2439
82 Ga0070692_10443919 3300005345 Bacteria 829
83 Ga0070668_100053030 3300005347 Bacteria 3127
84 Ga0070669_100007500 3300005353 Bacteria 7813
85 Ga0070669_100772837 3300005353 Unclassified 815
86 Ga0070675_100004817 3300005354 Bacteria 10298
87 Ga0070675_100117492 3300005354 Bacteria 2257
88 Ga0070671_100001676 3300005355 Bacteria 16774
89 Ga0070671_100209166 3300005355 Unclassified 1655
90 Ga0070671_100260064 3300005355 Bacteria 1475
91 Ga0070671_100293611 3300005355 Unclassified 1383
92 Ga0070674_100005528 3300005356 Bacteria 7308
93 Ga0070674_100053133 3300005356 Bacteria 2796
94 Ga0070674_100492723 3300005356 Unclassified 1019
95 Ga0070673_100081477 3300005364 Bacteria 2625
96 Ga0070659_100001021 3300005366 Bacteria 20542
97 Ga0070659_100018144 3300005366 Bacteria 5307
98 Ga0070659_100023105 3300005366 Bacteria 4754
99 Ga0070659_100092652 3300005366 Bacteria 2423
100 Ga0070659_100176406 3300005366 Bacteria 1752
101 Ga0070659_100211498 3300005366 Bacteria 1598
102 Ga0070667_100066877 3300005367 Bacteria 3054
103 Ga0070667_100372529 3300005367 Bacteria 1296
104 Ga0070667_100783484 3300005367 Bacteria 885
105 Ga0070667_100870248 3300005367 Bacteria 838
106 Ga0070709_10002115 3300005434 Bacteria 10743
107 Ga0070709_10030364 3300005434 Bacteria 3242
108 Ga0070709_10046482 3300005434 Bacteria 2699
109 Ga0070709_10055745 3300005434 Bacteria 2497
110 Ga0070709_10084495 3300005434 Bacteria 2079
111 Ga0070709_10250979 3300005434 Bacteria 1275
112 Ga0070709_10351330 3300005434 Unclassified 1089
113 Ga0070709_10400458 3300005434 Bacteria 1025
114 Ga0070714_100000096 3300005435 Bacteria 74616
115 Ga0070714_100010335 3300005435 Bacteria 7376
116 Ga0070714_100016574 3300005435 Bacteria 5955
117 Ga0070714_100033628 3300005435 Bacteria 4288
118 Ga0070714_100080016 3300005435 Bacteria 2842
119 Ga0070714_100082338 3300005435 Bacteria 2803
120 Ga0070714_100101478 3300005435 Bacteria 2536
121 Ga0070714_100110415 3300005435 Bacteria 2434
122 Ga0070714_100120944 3300005435 Bacteria 2329
123 Ga0070714_100228319 3300005435 Unclassified 1714
124 Ga0070714_100235114 3300005435 Bacteria 1689
125 Ga0070714_100400800 3300005435 Bacteria 1297
126 Ga0070714_100473112 3300005435 Bacteria 1192
127 Ga0070714_100611143 3300005435 Bacteria 1047
128 Ga0070714_100690148 3300005435 Bacteria 985
129 Ga0070714_101265059 3300005435 Bacteria 720
130 Ga0070714_101435155 3300005435 Unclassified 674
131 Ga0070713_100000364 3300005436 Bacteria 29177
132 Ga0070713_100003189 3300005436 Bacteria 10795
133 Ga0070713_100007134 3300005436 Bacteria 7815
134 Ga0070713_100015219 3300005436 Bacteria 5738
135 Ga0070713_100017965 3300005436 Bacteria 5367
136 Ga0070713_100020716 3300005436 Bacteria 5046
137 Ga0070713_100024780 3300005436 Bacteria 4681
138 Ga0070713_100030235 3300005436 Bacteria 4300
139 Ga0070713_100136959 3300005436 Bacteria 2164
140 Ga0070713_100143177 3300005436 Bacteria 2119
141 Ga0070713_100260739 3300005436 Bacteria 1584
142 Ga0070713_100356365 3300005436 Bacteria 1358
143 Ga0070713_100462227 3300005436 Bacteria 1193
144 Ga0070713_100533954 3300005436 Bacteria 1109
145 Ga0070713_100670409 3300005436 Bacteria 989
146 Ga0070713_100954573 3300005436 Bacteria 826
147 Ga0070713_101168561 3300005436 Bacteria 744
148 Ga0070713_101299258 3300005436 Bacteria 705
149 Ga0070710_10017046 3300005437 Bacteria 3710
150 Ga0070710_10032096 3300005437 Bacteria 2842
151 Ga0070710_10055725 3300005437 Bacteria 2235
152 Ga0070710_10098676 3300005437 Unclassified 1736
153 Ga0070710_10228372 3300005437 Bacteria 1187
154 Ga0070710_10469371 3300005437 Bacteria 856
155 Ga0070701_10429658 3300005438 Unclassified 843
156 Ga0070711_100001361 3300005439 Bacteria 13347
157 Ga0070711_100014481 3300005439 Bacteria 4969
158 Ga0070711_100056999 3300005439 Bacteria 2703
159 Ga0070711_100208551 3300005439 Bacteria 1512
160 Ga0070711_100297395 3300005439 Bacteria 1282
161 Ga0070711_100348959 3300005439 Bacteria 1189
162 Ga0070711_100395256 3300005439 Bacteria 1121
163 Ga0070711_100814801 3300005439 Bacteria 792
164 Ga0070694_100102804 3300005444 Bacteria 2024
165 Ga0070708_100003510 3300005445 Bacteria 12276
166 Ga0070708_100003542 3300005445 Bacteria 12233
167 Ga0070708_100015435 3300005445 Bacteria 6309
168 Ga0070708_100024232 3300005445 Bacteria 5173
169 Ga0070708_100036854 3300005445 Bacteria 4266
170 Ga0070708_100174860 3300005445 Bacteria 2006
171 Ga0070708_100512043 3300005445 Bacteria 1132
172 Ga0070663_100012382 3300005455 Bacteria 5395
173 Ga0070663_100130159 3300005455 Bacteria 1910
174 Ga0070663_100130407 3300005455 Bacteria 1908
175 Ga0070678_100132369 3300005456 Unclassified 1983
176 Ga0070678_100153850 3300005456 Bacteria 1856
177 Ga0070678_100193822 3300005456 Unclassified 1672
178 Ga0070678_101090353 3300005456 Bacteria 737
179 Ga0070678_101304133 3300005456 Bacteria 676
180 Ga0070662_100005784 3300005457 Bacteria 7923
181 Ga0070662_100018068 3300005457 Bacteria 4765
182 Ga0070662_100221573 3300005457 Bacteria 1509
183 Ga0070662_100514727 3300005457 Bacteria 999
184 Ga0070662_101125506 3300005457 Unclassified 674
185 Ga0070681_10004001 3300005458 Bacteria 13903
186 Ga0070681_10029788 3300005458 Bacteria 5479
187 Ga0070681_10033193 3300005458 Bacteria 5181
188 Ga0070681_10109152 3300005458 Bacteria 2707
189 Ga0070681_10142642 3300005458 Bacteria 2325
190 Ga0070681_10218695 3300005458 Bacteria 1820
191 Ga0070681_10242348 3300005458 Bacteria 1716
192 Ga0070681_10276274 3300005458 Bacteria 1591
193 Ga0070681_10289397 3300005458 Bacteria 1548
194 Ga0070681_10328297 3300005458 Bacteria 1439
195 Ga0070681_10506412 3300005458 Bacteria 1121
196 Ga0070681_10635162 3300005458 Unclassified 982
197 Ga0070681_10650922 3300005458 Bacteria 968
198 Ga0070681_10693749 3300005458 Unclassified 934
199 Ga0068867_100032550 3300005459 Bacteria 3771
200 Ga0068867_100090268 3300005459 Bacteria 2324
201 Ga0068867_100282607 3300005459 Bacteria 1361
202 Ga0070685_10009457 3300005466 Bacteria 5038
203 Ga0070685_10044363 3300005466 Bacteria 2545
204 Ga0070706_100014580 3300005467 Bacteria 7262
205 Ga0070706_100111427 3300005467 Bacteria 2546
206 Ga0070706_100508310 3300005467 Bacteria 1121
207 Ga0070707_100005126 3300005468 Bacteria 12276
208 Ga0070707_100033790 3300005468 Bacteria 4876
209 Ga0070707_100034957 3300005468 Bacteria 4792
210 Ga0070707_100052820 3300005468 Bacteria 3896
211 Ga0070707_100122441 3300005468 Bacteria 2525
212 Ga0070698_100002449 3300005471 Bacteria 20472
213 Ga0070698_100169294 3300005471 Bacteria 2126
214 Ga0070699_100000441 3300005518 Bacteria 39851
215 Ga0070699_100089928 3300005518 Bacteria 2683
216 Ga0070699_100300225 3300005518 Bacteria 1441
217 Ga0070699_100741525 3300005518 Bacteria 898
218 Ga0070679_100031685 3300005530 Bacteria 5226
219 Ga0070679_100032907 3300005530 Bacteria 5131
220 Ga0070679_100052027 3300005530 Bacteria 4080
221 Ga0070679_100113302 3300005530 Bacteria 2698
222 Ga0070679_100119247 3300005530 Bacteria 2623
223 Ga0070679_100203013 3300005530 Bacteria 1947
224 Ga0070679_100272070 3300005530 Unclassified 1648
225 Ga0070679_100286244 3300005530 Bacteria 1600
226 Ga0070679_100287672 3300005530 Bacteria 1595
227 Ga0070679_100360046 3300005530 Bacteria 1402
228 Ga0070679_100374484 3300005530 Bacteria 1371
229 Ga0070679_100603606 3300005530 Bacteria 1041
230 Ga0070679_100752191 3300005530 Bacteria 917
231 Ga0070679_100898068 3300005530 Unclassified 829
232 Ga0070684_100001423 3300005535 Bacteria 17232
233 Ga0070684_100015104 3300005535 Bacteria 6277
234 Ga0070684_100181212 3300005535 Bacteria 1915
235 Ga0070684_100193717 3300005535 Bacteria 1850
236 Ga0070684_100293901 3300005535 Bacteria 1490
237 Ga0070684_100514838 3300005535 Bacteria 1109
238 Ga0070684_100853797 3300005535 Bacteria 852
239 Ga0070697_100000975 3300005536 Bacteria 21592
240 Ga0070697_100001451 3300005536 Bacteria 18044
241 Ga0070697_100005121 3300005536 Bacteria 10067
242 Ga0070697_100007786 3300005536 Bacteria 8337
243 Ga0070697_100033812 3300005536 Bacteria 4120
244 Ga0070697_100087566 3300005536 Bacteria 2571
245 Ga0070697_100124275 3300005536 Bacteria 2160
246 Ga0070697_100251367 3300005536 Bacteria 1512
247 Ga0068853_100000054 3300005539 Bacteria 80837
248 Ga0068853_100008308 3300005539 Bacteria 8336
249 Ga0068853_100020300 3300005539 Bacteria 5524
250 Ga0068853_100042814 3300005539 Bacteria 3873
251 Ga0068853_100045233 3300005539 Bacteria 3770
252 Ga0068853_100135035 3300005539 Bacteria 2211
253 Ga0068853_100211359 3300005539 Bacteria 1768
254 Ga0068853_100292360 3300005539 Bacteria 1504
255 Ga0068853_100947919 3300005539 Bacteria 827
256 Ga0070672_100040143 3300005543 Bacteria 3589
257 Ga0070672_100089051 3300005543 Bacteria 2486
258 Ga0070672_100162059 3300005543 Bacteria 1856
259 Ga0070686_100005280 3300005544 Bacteria 7141
260 Ga0070686_100033425 3300005544 Bacteria 3160
261 Ga0070695_100045508 3300005545 Bacteria 2797
262 Ga0070695_100142679 3300005545 Bacteria 1663
263 Ga0070696_100405015 3300005546 Bacteria 1068
264 Ga0070696_100753145 3300005546 Bacteria 798
265 Ga0070696_100885957 3300005546 Bacteria 739
266 Ga0070693_100020180 3300005547 Bacteria 3510
267 Ga0070693_100087684 3300005547 Bacteria 1869
268 Ga0070693_100463344 3300005547 Bacteria 892
269 Ga0070665_100008632 3300005548 Bacteria 10311
270 Ga0070665_100222047 3300005548 Bacteria 1890
271 Ga0070665_100521628 3300005548 Bacteria 1200
272 Ga0068855_100000913 3300005563 Bacteria 36693
273 Ga0068855_100003825 3300005563 Bacteria 18405
274 Ga0068855_100012883 3300005563 Bacteria 10089
275 Ga0068855_100025048 3300005563 Bacteria 7141
276 Ga0068855_100025561 3300005563 Bacteria 7062
277 Ga0068855_100058628 3300005563 Bacteria 4508
278 Ga0068855_100099026 3300005563 Bacteria 3358
279 Ga0068855_100100510 3300005563 Bacteria 3330
280 Ga0068855_100135517 3300005563 Bacteria 2810
281 Ga0068855_100157756 3300005563 Bacteria 2577
282 Ga0068855_100187271 3300005563 Bacteria 2337
283 Ga0068855_100376506 3300005563 Bacteria 1559
284 Ga0068855_100434419 3300005563 Bacteria 1435
285 Ga0068855_100501119 3300005563 Bacteria 1319
286 Ga0068855_100641090 3300005563 Bacteria 1142
287 Ga0068855_100962532 3300005563 Bacteria 898
288 Ga0070664_100045861 3300005564 Bacteria 3691
289 Ga0070664_100139633 3300005564 Bacteria 2133
290 Ga0070664_100796832 3300005564 Bacteria 883
291 Ga0068857_100001133 3300005577 Bacteria 20806
292 Ga0068857_100001398 3300005577 Bacteria 19047
293 Ga0068857_100051265 3300005577 Bacteria 3661
294 Ga0068857_100054467 3300005577 Bacteria 3549
295 Ga0068857_100103614 3300005577 Bacteria 2554
296 Ga0068857_100136567 3300005577 Bacteria 2214
297 Ga0068857_100862159 3300005577 Bacteria 867
298 Ga0068854_100000137 3300005578 Bacteria 50696
299 Ga0068854_100067796 3300005578 Bacteria 2600
300 Ga0068854_100080136 3300005578 Bacteria 2409
301 Ga0068854_100128644 3300005578 Bacteria 1931
302 Ga0068854_100166246 3300005578 Bacteria 1713
303 Ga0068854_100167185 3300005578 Bacteria 1708
304 Ga0068854_100251398 3300005578 Bacteria 1411
305 Ga0068856_100005938 3300005614 Bacteria 12020
306 Ga0068856_100014911 3300005614 Bacteria 7502
307 Ga0068856_100018924 3300005614 Bacteria 6680
308 Ga0068856_100046667 3300005614 Bacteria 4266
309 Ga0068856_100060929 3300005614 Bacteria 3728
310 Ga0068856_100213429 3300005614 Bacteria 1945
311 Ga0068856_100236052 3300005614 Bacteria 1844
312 Ga0068856_100917167 3300005614 Bacteria 895
313 Ga0070702_100038867 3300005615 Bacteria 2653
314 Ga0070702_100063632 3300005615 Bacteria 2155
315 Ga0068852_100001223 3300005616 Bacteria 17089
316 Ga0068852_100018187 3300005616 Bacteria 5533
317 Ga0068852_100049830 3300005616 Bacteria 3585
318 Ga0068852_100063282 3300005616 Bacteria 3221
319 Ga0068852_100138769 3300005616 Bacteria 2248
320 Ga0068852_101115916 3300005616 Unclassified 809
321 Ga0068852_101276326 3300005616 Bacteria 756
322 Ga0068859_100004997 3300005617 Bacteria 13466
323 Ga0068859_100025042 3300005617 Bacteria 5990
324 Ga0068859_100052886 3300005617 Bacteria 4084
325 Ga0068864_100008706 3300005618 Bacteria 8371
326 Ga0068864_100008789 3300005618 Bacteria 8328
327 Ga0068866_10030620 3300005718 Bacteria 2584
328 Ga0068866_10055552 3300005718 Bacteria 2034
329 Ga0068861_100006422 3300005719 Bacteria 8008
330 Ga0068861_100097045 3300005719 Bacteria 2337
331 Ga0068861_100399492 3300005719 Bacteria 1219
332 Ga0068851_10001352 3300005834 Bacteria 10700
333 Ga0068851_10015616 3300005834 Bacteria 3620
334 Ga0068851_10615958 3300005834 Unclassified 662
335 Ga0068863_100020550 3300005841 Bacteria 6312
336 Ga0068863_100042299 3300005841 Bacteria 4329
337 Ga0068863_100226430 3300005841 Unclassified 1802
338 Ga0068863_100666031 3300005841 Unclassified 1033
339 Ga0068863_100991268 3300005841 Unclassified 843
340 Ga0068858_100048766 3300005842 Bacteria 3922
341 Ga0068858_100059426 3300005842 Bacteria 3533
342 Ga0068858_100217624 3300005842 Bacteria 1808
343 Ga0068860_100018016 3300005843 Bacteria 6877
344 Ga0068860_100179004 3300005843 Bacteria 2049
345 Ga0068860_100426949 3300005843 Bacteria 1314
346 Ga0068862_100010568 3300005844 Bacteria 7629
347 Ga0068862_100027948 3300005844 Bacteria 4750
348 Ga0068862_100130298 3300005844 Bacteria 2224
349 Ga0068862_101122270 3300005844 Bacteria 782
350 Ga0081455_10511933 3300005937 Bacteria 803
351 Ga0070717_10002614 3300006028 Bacteria 12700
352 Ga0070717_10007864 3300006028 Bacteria 7938
353 Ga0070717_10011095 3300006028 Bacteria 6830
354 Ga0070717_10038572 3300006028 Bacteria 3884
355 Ga0070717_10074655 3300006028 Bacteria 2835
356 Ga0070717_10118628 3300006028 Bacteria 2264
357 Ga0070717_10167951 3300006028 Bacteria 1907
358 Ga0070717_10175169 3300006028 Bacteria 1867
359 Ga0070717_10237867 3300006028 Bacteria 1605
360 Ga0070717_10387159 3300006028 Bacteria 1254
361 Ga0070717_10419025 3300006028 Bacteria 1204
362 Ga0070717_10438801 3300006028 Bacteria 1176
363 Ga0070717_10737220 3300006028 Bacteria 896
364 Ga0070717_10797763 3300006028 Bacteria 859
365 Ga0070715_10090801 3300006163 Bacteria 1405
366 Ga0070715_10208246 3300006163 Bacteria 998
367 Ga0070716_100002371 3300006173 Bacteria 8670
368 Ga0070716_100005022 3300006173 Bacteria 6377
369 Ga0070716_100008488 3300006173 Bacteria 5097
370 Ga0070716_100011992 3300006173 Bacteria 4380
371 Ga0070716_100269896 3300006173 Bacteria 1168
372 Ga0070716_100295012 3300006173 Unclassified 1125
373 Ga0070716_100912795 3300006173 Unclassified 688
374 Ga0070712_100001135 3300006175 Bacteria 16046
375 Ga0070712_100003022 3300006175 Bacteria 10410
376 Ga0070712_100003121 3300006175 Bacteria 10220
377 Ga0070712_100014016 3300006175 Bacteria 5137
378 Ga0070712_100041417 3300006175 Bacteria 3163
379 Ga0070712_100042924 3300006175 Bacteria 3111
380 Ga0070712_100070979 3300006175 Bacteria 2490
381 Ga0070712_100084427 3300006175 Bacteria 2309
382 Ga0070712_100419504 3300006175 Bacteria 1109
383 Ga0070712_100458130 3300006175 Bacteria 1063
384 Ga0097621_100003981 3300006237 Bacteria 10236
385 Ga0097621_100093410 3300006237 Bacteria 2521
386 Ga0097621_100116387 3300006237 Bacteria 2264
387 Ga0097621_100126894 3300006237 Bacteria 2168
388 Ga0097621_100963700 3300006237 Bacteria 797
389 Ga0068871_100002434 3300006358 Bacteria 12720
390 Ga0068871_100014064 3300006358 Bacteria 5952
391 Ga0068871_100128640 3300006358 Bacteria 2145
392 Ga0068871_100432675 3300006358 Bacteria 1177
393 Ga0068871_100794156 3300006358 Bacteria 872
394 Ga0068871_101182818 3300006358 Bacteria 717
395 Ga0075428_100019323 3300006844 Bacteria 7541
396 Ga0075431_100234638 3300006847 Bacteria 1868
397 Ga0075433_10004383 3300006852 Bacteria 10975
398 Ga0075434_100000230 3300006871 Bacteria 38508
399 Ga0075434_100005131 3300006871 Bacteria 11896
400 Ga0075434_100250660 3300006871 Bacteria 1790
401 Ga0075434_100412285 3300006871 Bacteria 1372
402 Ga0068865_100092191 3300006881 Bacteria 2200
403 Ga0068865_100193160 3300006881 Bacteria 1576
404 Ga0075436_100016756 3300006914 Bacteria 5015
405 Ga0075436_100029891 3300006914 Bacteria 3748
406 Ga0075436_100061502 3300006914 Bacteria 2594
407 Ga0075436_100135393 3300006914 Bacteria 1729
408 Ga0075436_100764400 3300006914 Unclassified 718
409 Ga0097620_100004997 3300006931 Bacteria 13466
410 Ga0097620_100025042 3300006931 Bacteria 5990
411 Ga0097620_100052889 3300006931 Bacteria 4084
412 Ga0075435_100000389 3300007076 Bacteria 26853
413 Ga0075435_100058493 3300007076 Bacteria 3122
414 Ga0075435_100121043 3300007076 Bacteria 2184
415 Ga0099794_10214335 3300007265 Bacteria 988
416 Ga0099795_10062777 3300007788 Bacteria 1383
417 Ga0099795_10134806 3300007788 Unclassified 999
418 Ga0099795_10157451 3300007788 Bacteria 935
419 Ga0105251_10057870 3300009011 Bacteria 1831
420 Ga0105250_10023011 3300009092 Bacteria 2510
421 Ga0105240_10012027 3300009093 Bacteria 11997
422 Ga0105240_10034928 3300009093 Bacteria 6482
423 Ga0105240_10035504 3300009093 Bacteria 6424
424 Ga0105240_10047029 3300009093 Bacteria 5462
425 Ga0105240_10053543 3300009093 Bacteria 5065
426 Ga0105240_10100771 3300009093 Bacteria 3514
427 Ga0105240_10141119 3300009093 Bacteria 2880
428 Ga0105240_10238782 3300009093 Bacteria 2108
429 Ga0105240_10296893 3300009093 Bacteria 1850
430 Ga0105240_10302837 3300009093 Bacteria 1828
431 Ga0105240_10322817 3300009093 Bacteria 1759
432 Ga0105240_10358626 3300009093 Bacteria 1652
433 Ga0105245_10005029 3300009098 Bacteria 11625
434 Ga0105245_10056662 3300009098 Bacteria 3523
435 Ga0105245_10145384 3300009098 Bacteria 2237
436 Ga0105245_10435193 3300009098 Bacteria 1317
437 Ga0105245_10469030 3300009098 Bacteria 1270
438 Ga0105245_11498076 3300009098 Unclassified 725
439 Ga0105247_10365844 3300009101 Bacteria 1018
440 Ga0105247_10799288 3300009101 Unclassified 719
441 Ga0114129_11003135 3300009147 Bacteria 1051
442 Ga0114129_11603170 3300009147 Bacteria 797
443 Ga0105241_10128461 3300009174 Bacteria 2049
444 Ga0105241_10129316 3300009174 Bacteria 2043
445 Ga0105241_10236511 3300009174 Bacteria 1542
446 Ga0105241_10262765 3300009174 Bacteria 1467
447 Ga0105241_10316525 3300009174 Bacteria 1344
448 Ga0105241_10872127 3300009174 Bacteria 834
449 Ga0105242_10039591 3300009176 Bacteria 3795
450 Ga0105242_10714867 3300009176 Unclassified 982
451 Ga0105248_10012842 3300009177 Bacteria 9238
452 Ga0105248_10038960 3300009177 Bacteria 5321
453 Ga0105248_10173533 3300009177 Bacteria 2430
454 Ga0105248_10526138 3300009177 Bacteria 1334
455 Ga0105248_10583845 3300009177 Bacteria 1261
456 Ga0105237_10016610 3300009545 Bacteria 7645
457 Ga0105237_10054319 3300009545 Bacteria 4014
458 Ga0105237_10065790 3300009545 Bacteria 3620
459 Ga0105237_10107038 3300009545 Bacteria 2788
460 Ga0105237_10387538 3300009545 Bacteria 1402
461 Ga0105237_10561293 3300009545 Unclassified 1148
462 Ga0105237_10593947 3300009545 Bacteria 1114
463 Ga0105237_10621178 3300009545 Bacteria 1087
464 Ga0105237_11063168 3300009545 Unclassified 816
465 Ga0105238_10008485 3300009551 Bacteria 10286
466 Ga0105238_10010449 3300009551 Bacteria 9317
467 Ga0105238_10066071 3300009551 Bacteria 3618
468 Ga0105238_10126885 3300009551 Bacteria 2530
469 Ga0105238_10202672 3300009551 Bacteria 1960
470 Ga0105238_10298399 3300009551 Bacteria 1595
471 Ga0105238_10364765 3300009551 Bacteria 1434
472 Ga0105238_10417754 3300009551 Bacteria 1336
473 Ga0105238_11388050 3300009551 Bacteria 729
474 Ga0105249_10025713 3300009553 Bacteria 5302
475 Ga0099796_10029782 3300010159 Bacteria 1765
476 Ga0105239_10025912 3300010375 Bacteria 6457
477 Ga0105239_10048572 3300010375 Bacteria 4653
478 Ga0105239_10091452 3300010375 Bacteria 3358
479 Ga0105239_10154599 3300010375 Bacteria 2561
480 Ga0105239_10598446 3300010375 Bacteria 1258
481 Ga0105239_10687725 3300010375 Unclassified 1169
482 Ga0105239_11169263 3300010375 Bacteria 886
483 Ga0105239_11837628 3300010375 Bacteria 702
484 Ga0105246_10002877 3300011119 Bacteria 10417
485 Ga0157316_1000632 3300012510 Unclassified 1916
486 Ga0157373_10001758 3300013100 Bacteria 16488
487 Ga0157373_10044661 3300013100 Bacteria 3163
488 Ga0157373_10078398 3300013100 Bacteria 2329
489 Ga0157373_10130215 3300013100 Bacteria 1769
490 Ga0157371_10002134 3300013102 Bacteria 19252
491 Ga0157371_10028935 3300013102 Bacteria 4011
492 Ga0157371_10067347 3300013102 Bacteria 2534
493 Ga0157371_10394722 3300013102 Bacteria 1012
494 Ga0157371_10548911 3300013102 Unclassified 856
495 Ga0157370_10011397 3300013104 Bacteria 9301
496 Ga0157370_10018903 3300013104 Bacteria 6929
497 Ga0157370_10067964 3300013104 Bacteria 3368
498 Ga0157370_10132934 3300013104 Bacteria 2320
499 Ga0157370_10139289 3300013104 Bacteria 2261
500 Ga0157370_10172973 3300013104 Bacteria 2007
501 Ga0157370_10182358 3300013104 Bacteria 1951
502 Ga0157370_10201993 3300013104 Bacteria 1844
503 Ga0157370_10221248 3300013104 Bacteria 1753
504 Ga0157370_10290790 3300013104 Bacteria 1509
505 Ga0157370_10338474 3300013104 Unclassified 1387
506 Ga0157370_10814191 3300013104 Bacteria 849
507 Ga0157370_10827233 3300013104 Bacteria 842
508 Ga0157369_10002709 3300013105 Bacteria 21141
509 Ga0157369_10007208 3300013105 Bacteria 12815
510 Ga0157369_10010526 3300013105 Bacteria 10530
511 Ga0157369_10019707 3300013105 Bacteria 7549
512 Ga0157369_10026263 3300013105 Bacteria 6461
513 Ga0157369_10034092 3300013105 Bacteria 5589
514 Ga0157369_10056103 3300013105 Bacteria 4251
515 Ga0157369_10061489 3300013105 Bacteria 4048
516 Ga0157369_10067149 3300013105 Bacteria 3857
517 Ga0157369_10080168 3300013105 Bacteria 3496
518 Ga0157369_10106753 3300013105 Bacteria 2980
519 Ga0157369_10132317 3300013105 Bacteria 2643
520 Ga0157369_10147068 3300013105 Bacteria 2491
521 Ga0157369_10227491 3300013105 Bacteria 1951
522 Ga0157369_10467087 3300013105 Bacteria 1306
523 Ga0157369_10581343 3300013105 Bacteria 1157
524 Ga0157369_10658438 3300013105 Bacteria 1080
525 Ga0157369_10663909 3300013105 Bacteria 1075
526 Ga0157369_10715850 3300013105 Bacteria 1031
527 Ga0157369_10881813 3300013105 Bacteria 918
528 Ga0157369_11347516 3300013105 Bacteria 727
529 Ga0157374_10002644 3300013296 Bacteria 15089
530 Ga0157374_10004729 3300013296 Bacteria 11421
531 Ga0157374_10012759 3300013296 Bacteria 7322
532 Ga0157374_10029721 3300013296 Bacteria 4954
533 Ga0157374_10098916 3300013296 Bacteria 2794
534 Ga0157374_10116889 3300013296 Bacteria 2570
535 Ga0157374_10191854 3300013296 Bacteria 1999
536 Ga0157374_10216762 3300013296 Bacteria 1877
537 Ga0157374_10271748 3300013296 Bacteria 1671
538 Ga0157374_10471434 3300013296 Bacteria 1258
539 Ga0157374_10548061 3300013296 Bacteria 1164
540 Ga0157374_10812712 3300013296 Bacteria 951
541 Ga0157378_10000411 3300013297 Bacteria 42281
542 Ga0157378_10007199 3300013297 Bacteria 9719
543 Ga0157378_10077880 3300013297 Bacteria 2989
544 Ga0157378_10081386 3300013297 Bacteria 2927
545 Ga0157378_10095497 3300013297 Bacteria 2708
546 Ga0163162_10004959 3300013306 Bacteria 12820
547 Ga0163162_10015114 3300013306 Bacteria 7537
548 Ga0163162_10102120 3300013306 Bacteria 2961
549 Ga0163162_10314903 3300013306 Bacteria 1698
550 Ga0163162_10896137 3300013306 Bacteria 1000
551 Ga0163162_11481496 3300013306 Bacteria 773
552 Ga0157372_10002154 3300013307 Bacteria 21421
553 Ga0157372_10003780 3300013307 Bacteria 16254
554 Ga0157372_10006080 3300013307 Bacteria 12828
555 Ga0157372_10006518 3300013307 Bacteria 12426
556 Ga0157372_10006630 3300013307 Bacteria 12325
557 Ga0157372_10009293 3300013307 Bacteria 10457
558 Ga0157372_10019768 3300013307 Bacteria 7258
559 Ga0157372_10026028 3300013307 Bacteria 6364
560 Ga0157372_10038610 3300013307 Bacteria 5269
561 Ga0157372_10044504 3300013307 Bacteria 4919
562 Ga0157372_10065258 3300013307 Bacteria 4087
563 Ga0157372_10091572 3300013307 Bacteria 3458
564 Ga0157372_10143192 3300013307 Bacteria 2756
565 Ga0157372_10175031 3300013307 Bacteria 2484
566 Ga0157372_10180231 3300013307 Bacteria 2445
567 Ga0157372_10234738 3300013307 Bacteria 2127
568 Ga0157372_10254737 3300013307 Bacteria 2038
569 Ga0157372_10391392 3300013307 Bacteria 1620
570 Ga0157372_10649390 3300013307 Bacteria 1229
571 Ga0157372_10855642 3300013307 Bacteria 1056
572 Ga0157375_10067349 3300013308 Bacteria 3577
573 Ga0157375_10383709 3300013308 Bacteria 1572
574 Ga0163163_10001073 3300014325 Bacteria 23224
575 Ga0163163_10019000 3300014325 Bacteria 6447
576 Ga0163163_10029803 3300014325 Bacteria 5251
577 Ga0163163_10079257 3300014325 Bacteria 3283
578 Ga0163163_10202428 3300014325 Bacteria 2034
579 Ga0163163_11661078 3300014325 Bacteria 700
580 Ga0157380_10385863 3300014326 Bacteria 1324
581 Ga0182008_10176853 3300014497 Unclassified 1079
582 Ga0157377_10000768 3300014745 Bacteria 13272
583 Ga0157377_10522907 3300014745 Bacteria 833
584 Ga0157379_10005366 3300014968 Bacteria 11017
585 Ga0157379_10127587 3300014968 Bacteria 2289
586 Ga0157379_10279496 3300014968 Bacteria 1519
587 Ga0157379_10374044 3300014968 Unclassified 1307
588 Ga0157376_10013365 3300014969 Bacteria 6123
589 Ga0157376_10036861 3300014969 Bacteria 3964
590 Ga0157376_10136499 3300014969 Bacteria 2195
591 Ga0157376_10278213 3300014969 Bacteria 1575
592 Ga0157376_10326768 3300014969 Bacteria 1460
593 Ga0157376_10329232 3300014969 Bacteria 1455
594 Ga0157376_10566170 3300014969 Bacteria 1126
595 Ga0182007_10007161 3300015262 Bacteria 4709
596 Ga0182007_10019430 3300015262 Bacteria 2443
597 Ga0163161_10001969 3300017792 Bacteria 14895
598 Ga0184599_139676 3300019188 Bacteria 948
599 Ga0197907_10188899 3300020069 Bacteria 1174
600 Ga0206356_11033402 3300020070 Bacteria 2359
601 Ga0206356_11150814 3300020070 Bacteria 2159
602 Ga0206356_11911989 3300020070 Bacteria 1271
603 Ga0206351_10594957 3300020077 Bacteria 1136
604 Ga0206351_10697094 3300020077 Bacteria 1256
605 Ga0206352_11017623 3300020078 Bacteria 818
606 Ga0154015_1458189 3300020610 Bacteria 2125
607 Ga0213873_10010893 3300021358 Bacteria 1930
608 Ga0213873_10045123 3300021358 Bacteria 1148
609 Ga0213872_10005926 3300021361 Bacteria 6203
610 Ga0213872_10036555 3300021361 Bacteria 2244
611 Ga0213872_10071028 3300021361 Bacteria 1569
612 Ga0213876_10059471 3300021384 Bacteria 2017
613 Ga0213871_10001697 3300021441 Bacteria 3802
614 Ga0224570_100075 3300022730 Bacteria 5599
615 Ga0247553_101308 3300023672 Bacteria 1051
616 Ga0224572_1010023 3300024225 Bacteria 1775
617 Ga0228598_1000213 3300024227 Bacteria 10848
618 Ga0228598_1000513 3300024227 Bacteria 8046
619 Ga0228598_1004557 3300024227 Bacteria 2933
620 Ga0228598_1023917 3300024227 Bacteria 1202
621 Ga0228598_1039992 3300024227 Bacteria 925
622 Ga0228598_1052680 3300024227 Bacteria 807
623 Ga0228598_1065210 3300024227 Bacteria 726
624 Ga0207697_10022130 3300025315 Bacteria 2605
625 Ga0207656_10062996 3300025321 Unclassified 1631
626 Ga0207656_10202725 3300025321 Bacteria 958
627 Ga0207682_10088512 3300025893 Bacteria 1339
628 Ga0207692_10010928 3300025898 Bacteria 3843
629 Ga0207692_10021825 3300025898 Bacteria 2936
630 Ga0207692_10022746 3300025898 Bacteria 2889
631 Ga0207692_10131491 3300025898 Bacteria 1414
632 Ga0207692_10183179 3300025898 Bacteria 1221
633 Ga0207692_10617727 3300025898 Bacteria 698
634 Ga0207692_10630005 3300025898 Bacteria 691
635 Ga0207692_10722914 3300025898 Bacteria 647
636 Ga0207642_10006053 3300025899 Bacteria 3998
637 Ga0207710_10040621 3300025900 Bacteria 2061
638 Ga0207688_10325519 3300025901 Bacteria 944
639 Ga0207680_10001756 3300025903 Bacteria 10229
640 Ga0207680_10408273 3300025903 Bacteria 960
641 Ga0207647_10001343 3300025904 Bacteria 18910
642 Ga0207647_10004892 3300025904 Bacteria 9886
643 Ga0207647_10010629 3300025904 Bacteria 6492
644 Ga0207647_10027808 3300025904 Bacteria 3683
645 Ga0207647_10045399 3300025904 Bacteria 2742
646 Ga0207685_10036068 3300025905 Unclassified 1810
647 Ga0207699_10001057 3300025906 Bacteria 13000
648 Ga0207699_10061772 3300025906 Bacteria 2256
649 Ga0207699_10061912 3300025906 Bacteria 2254
650 Ga0207699_10070896 3300025906 Bacteria 2129
651 Ga0207699_10115868 3300025906 Bacteria 1725
652 Ga0207699_10292669 3300025906 Bacteria 1135
653 Ga0207699_10301783 3300025906 Bacteria 1118
654 Ga0207699_10343944 3300025906 Bacteria 1051
655 Ga0207699_10465683 3300025906 Bacteria 909
656 Ga0207699_10559189 3300025906 Bacteria 830
657 Ga0207699_10625560 3300025906 Unclassified 785
658 Ga0207699_10714059 3300025906 Bacteria 734
659 Ga0207645_10001180 3300025907 Bacteria 21585
660 Ga0207643_10001067 3300025908 Bacteria 16207
661 Ga0207705_10000048 3300025909 Bacteria 171848
662 Ga0207705_10003420 3300025909 Bacteria 12069
663 Ga0207705_10010050 3300025909 Bacteria 6887
664 Ga0207705_10011122 3300025909 Bacteria 6526
665 Ga0207705_10026211 3300025909 Bacteria 4159
666 Ga0207705_10127864 3300025909 Bacteria 1889
667 Ga0207705_10659683 3300025909 Bacteria 813
668 Ga0207684_10001048 3300025910 Bacteria 30878
669 Ga0207684_10100158 3300025910 Bacteria 2476
670 Ga0207684_10140403 3300025910 Bacteria 2076
671 Ga0207684_10261602 3300025910 Bacteria 1493
672 Ga0207684_10341969 3300025910 Bacteria 1288
673 Ga0207654_10004384 3300025911 Bacteria 7113
674 Ga0207654_10046119 3300025911 Bacteria 2484
675 Ga0207654_10104320 3300025911 Bacteria 1752
676 Ga0207654_10154447 3300025911 Bacteria 1476
677 Ga0207654_10234524 3300025911 Bacteria 1223
678 Ga0207654_10883479 3300025911 Bacteria 648
679 Ga0207707_10003207 3300025912 Bacteria 14523
680 Ga0207707_10015255 3300025912 Bacteria 6690
681 Ga0207707_10021611 3300025912 Bacteria 5623
682 Ga0207707_10022616 3300025912 Bacteria 5497
683 Ga0207707_10157685 3300025912 Bacteria 1985
684 Ga0207707_10257589 3300025912 Bacteria 1514
685 Ga0207707_10486123 3300025912 Bacteria 1054
686 Ga0207707_10559289 3300025912 Bacteria 971
687 Ga0207707_10716203 3300025912 Bacteria 839
688 Ga0207707_10748556 3300025912 Bacteria 817
689 Ga0207707_10772216 3300025912 Unclassified 802
690 Ga0207707_10776279 3300025912 Bacteria 800
691 Ga0207707_10784393 3300025912 Bacteria 795
692 Ga0207707_11257682 3300025912 Bacteria 596
693 Ga0207695_10000354 3300025913 Bacteria 105275
694 Ga0207695_10008453 3300025913 Bacteria 12891
695 Ga0207695_10020062 3300025913 Bacteria 7670
696 Ga0207695_10061065 3300025913 Bacteria 3897
697 Ga0207695_10069308 3300025913 Bacteria 3609
698 Ga0207695_10103382 3300025913 Bacteria 2840
699 Ga0207695_10119085 3300025913 Bacteria 2611
700 Ga0207695_10162633 3300025913 Bacteria 2163
701 Ga0207695_10173594 3300025913 Bacteria 2079
702 Ga0207695_10324544 3300025913 Bacteria 1429
703 Ga0207695_10402171 3300025913 Bacteria 1254
704 Ga0207671_10047140 3300025914 Bacteria 3190
705 Ga0207671_10104506 3300025914 Bacteria 2148
706 Ga0207671_10157516 3300025914 Bacteria 1757
707 Ga0207671_10320620 3300025914 Bacteria 1226
708 Ga0207671_10332247 3300025914 Bacteria 1204
709 Ga0207671_10393269 3300025914 Bacteria 1102
710 Ga0207671_10409581 3300025914 Unclassified 1078
711 Ga0207693_10000026 3300025915 Bacteria 122717
712 Ga0207693_10001260 3300025915 Bacteria 22561
713 Ga0207693_10004232 3300025915 Bacteria 12174
714 Ga0207693_10010928 3300025915 Bacteria 7357
715 Ga0207693_10022595 3300025915 Bacteria 4997
716 Ga0207693_10024361 3300025915 Bacteria 4802
717 Ga0207693_10124058 3300025915 Bacteria 2029
718 Ga0207693_10295618 3300025915 Bacteria 1269
719 Ga0207693_10635181 3300025915 Bacteria 830
720 Ga0207663_10003762 3300025916 Bacteria 7481
721 Ga0207663_10010349 3300025916 Bacteria 4960
722 Ga0207663_10022519 3300025916 Bacteria 3603
723 Ga0207663_10038998 3300025916 Bacteria 2875
724 Ga0207663_10102146 3300025916 Bacteria 1928
725 Ga0207663_10108867 3300025916 Bacteria 1877
726 Ga0207663_10147982 3300025916 Bacteria 1644
727 Ga0207663_10513353 3300025916 Bacteria 932
728 Ga0207663_10809406 3300025916 Bacteria 746
729 Ga0207660_10042248 3300025917 Bacteria 3199
730 Ga0207660_10048721 3300025917 Bacteria 2999
731 Ga0207660_10124239 3300025917 Bacteria 1958
732 Ga0207660_10157369 3300025917 Bacteria 1750
733 Ga0207660_10167490 3300025917 Bacteria 1699
734 Ga0207660_10288652 3300025917 Bacteria 1304
735 Ga0207660_10356671 3300025917 Bacteria 1173
736 Ga0207660_10520687 3300025917 Bacteria 966
737 Ga0207660_10664913 3300025917 Bacteria 849
738 Ga0207662_10014118 3300025918 Bacteria 4474
739 Ga0207657_10000823 3300025919 Bacteria 32798
740 Ga0207657_10004069 3300025919 Bacteria 15518
741 Ga0207657_10006426 3300025919 Bacteria 12189
742 Ga0207657_10008913 3300025919 Bacteria 10142
743 Ga0207657_10030982 3300025919 Bacteria 4848
744 Ga0207657_10032755 3300025919 Bacteria 4691
745 Ga0207657_10034060 3300025919 Bacteria 4584
746 Ga0207657_10772354 3300025919 Bacteria 744
747 Ga0207649_10001087 3300025920 Bacteria 16517
748 Ga0207649_10007381 3300025920 Bacteria 5981
749 Ga0207649_10064871 3300025920 Bacteria 2310
750 Ga0207649_10192914 3300025920 Bacteria 1434
751 Ga0207649_10361651 3300025920 Unclassified 1077
752 Ga0207652_10006800 3300025921 Bacteria 9217
753 Ga0207652_10018101 3300025921 Bacteria 5776
754 Ga0207652_10029215 3300025921 Bacteria 4607
755 Ga0207652_10037568 3300025921 Bacteria 4099
756 Ga0207652_10043417 3300025921 Bacteria 3828
757 Ga0207652_10078648 3300025921 Bacteria 2880
758 Ga0207652_10117175 3300025921 Bacteria 2366
759 Ga0207652_10214304 3300025921 Bacteria 1734
760 Ga0207652_10275340 3300025921 Bacteria 1518
761 Ga0207652_10277036 3300025921 Bacteria 1513
762 Ga0207652_10367116 3300025921 Bacteria 1299
763 Ga0207652_10737817 3300025921 Unclassified 877
764 Ga0207652_10841930 3300025921 Bacteria 813
765 Ga0207652_10883182 3300025921 Unclassified 790
766 Ga0207652_11184148 3300025921 Unclassified 666
767 Ga0207646_10001230 3300025922 Bacteria 32163
768 Ga0207646_10048482 3300025922 Bacteria 3808
769 Ga0207646_10108960 3300025922 Bacteria 2485
770 Ga0207646_10131348 3300025922 Bacteria 2254
771 Ga0207646_10499856 3300025922 Bacteria 1096
772 Ga0207646_10877542 3300025922 Bacteria 796
773 Ga0207646_11208012 3300025922 Bacteria 663
774 Ga0207681_10009111 3300025923 Bacteria 6063
775 Ga0207694_10000718 3300025924 Bacteria 29747
776 Ga0207694_10012007 3300025924 Bacteria 6531
777 Ga0207694_10123061 3300025924 Bacteria 2073
778 Ga0207694_10124313 3300025924 Bacteria 2062
779 Ga0207694_10138742 3300025924 Bacteria 1954
780 Ga0207694_10422291 3300025924 Bacteria 1111
781 Ga0207650_10000152 3300025925 Bacteria 83134
782 Ga0207650_10011553 3300025925 Bacteria 6080
783 Ga0207650_10168792 3300025925 Bacteria 1738
784 Ga0207659_10003498 3300025926 Bacteria 9434
785 Ga0207687_10010238 3300025927 Bacteria 6126
786 Ga0207687_10032442 3300025927 Bacteria 3537
787 Ga0207687_10033504 3300025927 Bacteria 3485
788 Ga0207687_10299949 3300025927 Bacteria 1294
789 Ga0207687_10328047 3300025927 Unclassified 1241
790 Ga0207687_10702802 3300025927 Unclassified 858
791 Ga0207700_10003657 3300025928 Bacteria 8964
792 Ga0207700_10004902 3300025928 Bacteria 7952
793 Ga0207700_10004917 3300025928 Bacteria 7939
794 Ga0207700_10007967 3300025928 Bacteria 6524
795 Ga0207700_10014117 3300025928 Bacteria 5224
796 Ga0207700_10029324 3300025928 Bacteria 3881
797 Ga0207700_10044708 3300025928 Bacteria 3262
798 Ga0207700_10066919 3300025928 Bacteria 2747
799 Ga0207700_10098680 3300025928 Bacteria 2324
800 Ga0207700_10104195 3300025928 Bacteria 2269
801 Ga0207700_10223706 3300025928 Bacteria 1597
802 Ga0207700_10233600 3300025928 Bacteria 1564
803 Ga0207700_10243314 3300025928 Bacteria 1534
804 Ga0207700_10429566 3300025928 Bacteria 1161
805 Ga0207700_10433482 3300025928 Bacteria 1156
806 Ga0207700_10667836 3300025928 Bacteria 927
807 Ga0207700_10701653 3300025928 Bacteria 903
808 Ga0207700_10868688 3300025928 Unclassified 807
809 Ga0207664_10000087 3300025929 Bacteria 88607
810 Ga0207664_10001347 3300025929 Bacteria 16145
811 Ga0207664_10016919 3300025929 Bacteria 5333
812 Ga0207664_10031301 3300025929 Bacteria 4069
813 Ga0207664_10033569 3300025929 Bacteria 3943
814 Ga0207664_10048949 3300025929 Bacteria 3326
815 Ga0207664_10067012 3300025929 Bacteria 2879
816 Ga0207664_10080683 3300025929 Bacteria 2645
817 Ga0207664_10130918 3300025929 Bacteria 2112
818 Ga0207664_10160449 3300025929 Bacteria 1917
819 Ga0207664_10312791 3300025929 Bacteria 1384
820 Ga0207664_10351107 3300025929 Bacteria 1305
821 Ga0207664_10362962 3300025929 Bacteria 1283
822 Ga0207664_10511284 3300025929 Unclassified 1076
823 Ga0207664_10597368 3300025929 Bacteria 991
824 Ga0207664_11092752 3300025929 Bacteria 713
825 Ga0207664_11370650 3300025929 Unclassified 628
826 Ga0207644_10003335 3300025931 Bacteria 10358
827 Ga0207644_10018963 3300025931 Bacteria 4663
828 Ga0207644_10246619 3300025931 Bacteria 1424
829 Ga0207644_10783482 3300025931 Bacteria 797
830 Ga0207690_10007754 3300025932 Bacteria 6372
831 Ga0207690_10087591 3300025932 Bacteria 2191
832 Ga0207690_10164156 3300025932 Bacteria 1658
833 Ga0207690_10447898 3300025932 Bacteria 1037
834 Ga0207706_10000740 3300025933 Bacteria 34067
835 Ga0207706_10036070 3300025933 Bacteria 4393
836 Ga0207686_10058693 3300025934 Bacteria 2427
837 Ga0207686_10088097 3300025934 Bacteria 2043
838 Ga0207686_10500582 3300025934 Unclassified 943
839 Ga0207709_10234082 3300025935 Bacteria 1332
840 Ga0207670_10003610 3300025936 Bacteria 8207
841 Ga0207669_10019910 3300025937 Bacteria 3505
842 Ga0207704_10193692 3300025938 Bacteria 1481
843 Ga0207704_10221557 3300025938 Bacteria 1400
844 Ga0207704_10278889 3300025938 Bacteria 1269
845 Ga0207665_10002747 3300025939 Bacteria 11804
846 Ga0207665_10003202 3300025939 Bacteria 10970
847 Ga0207665_10029458 3300025939 Bacteria 3629
848 Ga0207665_10055867 3300025939 Bacteria 2664
849 Ga0207665_10091518 3300025939 Bacteria 2109
850 Ga0207665_10097056 3300025939 Bacteria 2051
851 Ga0207665_10113990 3300025939 Bacteria 1902
852 Ga0207665_10146703 3300025939 Bacteria 1686
853 Ga0207665_10207781 3300025939 Bacteria 1429
854 Ga0207665_10255135 3300025939 Bacteria 1297
855 Ga0207691_10000308 3300025940 Bacteria 48637
856 Ga0207711_10003068 3300025941 Bacteria 14584
857 Ga0207711_10079592 3300025941 Bacteria 2861
858 Ga0207711_10114604 3300025941 Bacteria 2401
859 Ga0207711_11246246 3300025941 Bacteria 685
860 Ga0207689_10000618 3300025942 Bacteria 33979
861 Ga0207689_10005608 3300025942 Bacteria 11183
862 Ga0207689_10013637 3300025942 Bacteria 6929
863 Ga0207689_10080568 3300025942 Bacteria 2676
864 Ga0207689_11126913 3300025942 Unclassified 661
865 Ga0207661_10005431 3300025944 Bacteria 8980
866 Ga0207661_10027213 3300025944 Bacteria 4366
867 Ga0207661_10093846 3300025944 Bacteria 2506
868 Ga0207661_10128605 3300025944 Bacteria 2166
869 Ga0207661_10220676 3300025944 Bacteria 1675
870 Ga0207661_10250896 3300025944 Bacteria 1573
871 Ga0207661_10272124 3300025944 Bacteria 1512
872 Ga0207679_10000298 3300025945 Bacteria 37205
873 Ga0207679_10020299 3300025945 Bacteria 4483
874 Ga0207679_10192600 3300025945 Bacteria 1697
875 Ga0207679_10240152 3300025945 Bacteria 1535
876 Ga0207679_10253420 3300025945 Bacteria 1497
877 Ga0207679_10381471 3300025945 Bacteria 1236
878 Ga0207667_10000647 3300025949 Bacteria 45083
879 Ga0207667_10008444 3300025949 Bacteria 12232
880 Ga0207667_10010059 3300025949 Bacteria 11087
881 Ga0207667_10012686 3300025949 Bacteria 9684
882 Ga0207667_10027233 3300025949 Bacteria 6227
883 Ga0207667_10052653 3300025949 Bacteria 4285
884 Ga0207667_10053868 3300025949 Bacteria 4232
885 Ga0207667_10055132 3300025949 Bacteria 4180
886 Ga0207667_10056921 3300025949 Bacteria 4105
887 Ga0207667_10063092 3300025949 Bacteria 3872
888 Ga0207667_10069452 3300025949 Bacteria 3667
889 Ga0207667_10125234 3300025949 Bacteria 2646
890 Ga0207667_10407681 3300025949 Bacteria 1384
891 Ga0207667_10851023 3300025949 Bacteria 906
892 Ga0207651_10003558 3300025960 Bacteria 7657
893 Ga0207651_10059300 3300025960 Bacteria 2650
894 Ga0207668_10003732 3300025972 Bacteria 8962
895 Ga0207640_10000023 3300025981 Bacteria 160979
896 Ga0207640_10006598 3300025981 Bacteria 6372
897 Ga0207640_10074705 3300025981 Bacteria 2295
898 Ga0207640_10152854 3300025981 Bacteria 1698
899 Ga0207640_10335980 3300025981 Bacteria 1208
900 Ga0207640_10350430 3300025981 Bacteria 1186
901 Ga0207658_10003391 3300025986 Bacteria 11277
902 Ga0207677_10004281 3300026023 Bacteria 7637
903 Ga0207677_10007921 3300026023 Bacteria 5908
904 Ga0207677_10156544 3300026023 Bacteria 1765
905 Ga0207677_10366347 3300026023 Bacteria 1212
906 Ga0207677_11363560 3300026023 Bacteria 652
907 Ga0207703_10003490 3300026035 Bacteria 13160
908 Ga0207703_10007555 3300026035 Bacteria 8621
909 Ga0207703_10040353 3300026035 Bacteria 3735
910 Ga0207703_10211859 3300026035 Bacteria 1728
911 Ga0207639_10000034 3300026041 Bacteria 154355
912 Ga0207639_10003445 3300026041 Bacteria 10647
913 Ga0207639_10014728 3300026041 Bacteria 5509
914 Ga0207639_10078850 3300026041 Bacteria 2601
915 Ga0207639_10350814 3300026041 Bacteria 1318
916 Ga0207639_11010044 3300026041 Bacteria 779
917 Ga0207678_10001665 3300026067 Bacteria 20379
918 Ga0207678_10003018 3300026067 Bacteria 15226
919 Ga0207678_10004699 3300026067 Bacteria 12252
920 Ga0207678_10009514 3300026067 Bacteria 8551
921 Ga0207678_10047402 3300026067 Bacteria 3716
922 Ga0207678_10096718 3300026067 Bacteria 2523
923 Ga0207678_10210609 3300026067 Bacteria 1663
924 Ga0207678_10216481 3300026067 Bacteria 1639
925 Ga0207702_10000089 3300026078 Bacteria 105440
926 Ga0207702_10003851 3300026078 Bacteria 13535
927 Ga0207702_10015006 3300026078 Bacteria 6425
928 Ga0207702_10020039 3300026078 Bacteria 5542
929 Ga0207702_10107599 3300026078 Unclassified 2473
930 Ga0207702_10151539 3300026078 Bacteria 2109
931 Ga0207702_10184697 3300026078 Bacteria 1922
932 Ga0207702_10188956 3300026078 Bacteria 1902
933 Ga0207702_10271313 3300026078 Bacteria 1600
934 Ga0207702_10353085 3300026078 Bacteria 1407
935 Ga0207702_10946076 3300026078 Unclassified 854
936 Ga0207702_11273516 3300026078 Bacteria 729
937 Ga0207702_11435462 3300026078 Unclassified 684
938 Ga0207641_10000052 3300026088 Bacteria 173672
939 Ga0207641_10020552 3300026088 Bacteria 5424
940 Ga0207641_10187417 3300026088 Bacteria 1899
941 Ga0207641_10190029 3300026088 Bacteria 1887
942 Ga0207641_10479022 3300026088 Bacteria 1206
943 Ga0207648_10003962 3300026089 Bacteria 15393
944 Ga0207648_10038306 3300026089 Bacteria 4219
945 Ga0207648_10136322 3300026089 Bacteria 2162
946 Ga0207648_10240044 3300026089 Bacteria 1613
947 Ga0207676_10000176 3300026095 Bacteria 56110
948 Ga0207676_10009926 3300026095 Bacteria 6771
949 Ga0207676_10012745 3300026095 Bacteria 6032
950 Ga0207674_10000532 3300026116 Bacteria 49916
951 Ga0207674_10000561 3300026116 Bacteria 48618
952 Ga0207674_10027883 3300026116 Bacteria 5966
953 Ga0207674_10043009 3300026116 Bacteria 4660
954 Ga0207674_10046610 3300026116 Bacteria 4450
955 Ga0207674_10078543 3300026116 Bacteria 3305
956 Ga0207674_10884004 3300026116 Bacteria 861
957 Ga0207675_100005443 3300026118 Bacteria 12201
958 Ga0207675_100257479 3300026118 Bacteria 1690
959 Ga0207675_100961520 3300026118 Unclassified 872
960 Ga0207683_10001978 3300026121 Bacteria 18120
961 Ga0207683_10138605 3300026121 Bacteria 2191
962 Ga0207683_10407481 3300026121 Bacteria 1251
963 Ga0207683_10497124 3300026121 Bacteria 1126
964 Ga0207698_10022723 3300026142 Bacteria 4367
965 Ga0207698_10028624 3300026142 Bacteria 3976
966 Ga0207698_10073933 3300026142 Bacteria 2716
967 Ga0207698_10091285 3300026142 Bacteria 2493
968 Ga0207698_10106129 3300026142 Bacteria 2342
969 Ga0207698_10246463 3300026142 Bacteria 1632
970 Ga0207698_11001562 3300026142 Bacteria 846
971 Ga0207698_11333394 3300026142 Bacteria 732
972 Ga0265356_1000279 3300028017 Bacteria 9531
973 Ga0265357_1030644 3300028023 Unclassified 614
974 Ga0268266_10001266 3300028379 Bacteria 30870
975 Ga0268266_10007930 3300028379 Bacteria 9500
976 Ga0268266_10016988 3300028379 Bacteria 6216
977 Ga0268266_10167538 3300028379 Bacteria 1992
978 Ga0268266_10222281 3300028379 Bacteria 1736
979 Ga0268266_10516704 3300028379 Bacteria 1141
980 Ga0268265_10008088 3300028380 Bacteria 7106
981 Ga0268265_10044241 3300028380 Bacteria 3315
982 Ga0268264_10005269 3300028381 Bacteria 10950
983 Ga0268264_10032165 3300028381 Bacteria 4304
984 Ga0268264_10096016 3300028381 Bacteria 2566
985 Ga0265338_10002857 3300028800 Bacteria 25250
986 Ga0265338_10006873 3300028800 Bacteria 14325
987 Ga0265338_10034000 3300028800 Bacteria 4937
988 Ga0265338_10187655 3300028800 Bacteria 1570
989 Ga0265338_10245571 3300028800 Bacteria 1323
990 Ga0265338_10292794 3300028800 Bacteria 1186
991 Ga0265338_10516512 3300028800 Unclassified 839
992 Ga0265762_1000677 3300030760 Bacteria 5998
993 Ga0265762_1001564 3300030760 Bacteria 4163
994 Ga0265762_1004830 3300030760 Bacteria 2413
995 Ga0265762_1008888 3300030760 Bacteria 1789
996 Ga0265762_1020576 3300030760 Bacteria 1214
997 Ga0265767_100325 3300030836 Bacteria 1942
998 Ga0265766_1000256 3300030863 Bacteria 2181
999 Ga0265765_1013810 3300030879 Unclassified 926
1000 Ga0265772_103459 3300030886 Bacteria 654
1001 Ga0265760_10000694 3300031090 Bacteria 9605
1002 Ga0265760_10004716 3300031090 Bacteria 3905
1003 Ga0265760_10008145 3300031090 Bacteria 2995
1004 Ga0265760_10008596 3300031090 Bacteria 2916
1005 Ga0265760_10044123 3300031090 Bacteria 1334
1006 Ga0265760_10111409 3300031090 Unclassified 872
1007 Ga0265330_10006073 3300031235 Bacteria 5983
1008 Ga0265330_10089825 3300031235 Bacteria 1319
1009 Ga0265330_10228195 3300031235 Unclassified 785
1010 Ga0265330_10298257 3300031235 Bacteria 679
1011 Ga0265332_10042089 3300031238 Bacteria 1975
1012 Ga0265332_10160382 3300031238 Bacteria 940
1013 Ga0265328_10014015 3300031239 Bacteria 3163
1014 Ga0265325_10023495 3300031241 Bacteria 3364
1015 Ga0265340_10070349 3300031247 Bacteria 1660
1016 Ga0265340_10157001 3300031247 Bacteria 1035
1017 Ga0265340_10195677 3300031247 Bacteria 910
1018 Ga0265340_10197484 3300031247 Bacteria 905
1019 Ga0265339_10002352 3300031249 Bacteria 13585
1020 Ga0265339_10019630 3300031249 Bacteria 3965
1021 Ga0265339_10049757 3300031249 Bacteria 2294
1022 Ga0265339_10065474 3300031249 Bacteria 1948
1023 Ga0265339_10130879 3300031249 Unclassified 1283
1024 Ga0265331_10054664 3300031250 Bacteria 1901
1025 Ga0265316_10011341 3300031344 Bacteria 8048
1026 Ga0265316_10012614 3300031344 Bacteria 7566
1027 Ga0265316_10051596 3300031344 Bacteria 3230
1028 Ga0265316_10126703 3300031344 Bacteria 1925
1029 Ga0265316_10473326 3300031344 Bacteria 897
1030 Ga0265316_10982600 3300031344 Bacteria 588
1031 Ga0265313_10265926 3300031595 Bacteria 696
1032 Ga0265314_10003075 3300031711 Bacteria 16448
1033 Ga0265314_10013145 3300031711 Bacteria 6707
1034 Ga0265314_10205068 3300031711 Bacteria 1162
1035 Ga0307405_10305206 3300031731 Bacteria 1209
1036 Ga0307410_10009896 3300031852 Bacteria 5375
1037 Ga0307406_10107374 3300031901 Bacteria 1914
1038 Ga0307412_10411234 3300031911 Bacteria 1104
1039 Ga0307409_100214313 3300031995 Bacteria 1733
1040 Ga0307409_100232918 3300031995 Unclassified 1671
1041 Ga0307416_100028546 3300032002 Bacteria 4151
1042 Ga0307411_10104293 3300032005 Bacteria 2013
1043 Ga0307411_10300349 3300032005 Bacteria 1287
1044 Ga0316053_100087 3300032120 Bacteria 2942
1045 Ga0307415_100343177 3300032126 Bacteria 1254
1046 Ga0307415_100509927 3300032126 Unclassified 1053
1047 Ga0307510_10085914 3300033180 Bacteria 3020
1048 Ga0307510_10089104 3300033180 Bacteria 2940
1049 Ga0307510_10091701 3300033180 Bacteria 2879
1050 Ga0316215_1000711 3300033544 Bacteria 3416
1051 Ga0316214_1006727 3300033545 Bacteria 1524
1052 Ga0316212_1013783 3300033547 Bacteria 1147
1053 Ga0373926_0024543 3300035083 Bacteria 2100
1054 Ga0373926_0051445 3300035083 Bacteria 1486
1055 Ga0373926_0159278 3300035083 Bacteria 861
1056 Ga0373944_0015252 3300035089 Bacteria 2154
1057 Ga0373923_0009501 3300035111 Bacteria 3511
1058 Ga0373923_0039386 3300035111 Bacteria 1940
1059 Ga0373923_0261467 3300035111 Bacteria 812
1060 Ga0373936_0002329 3300035113 Bacteria 7114
1061 Ga0373936_0029559 3300035113 Bacteria 2157
1062 Ga0373936_0049771 3300035113 Unclassified 1693
1063 Ga0373945_0035480 3300035116 Bacteria 1782
1064 Ga0373945_0064816 3300035116 Unclassified 1370
1065 Ga0373953_0004886 3300035117 Bacteria 4312
1066 Ga0373954_0033288 3300035118 Bacteria 2384
1067 Ga0373956_0039976 3300035119 Bacteria 2079
1068 Ga0373956_0080700 3300035119 Bacteria 1492
1069 Ga0373957_0002069 3300035120 Bacteria 5626
1070 Ga0373957_0024514 3300035120 Bacteria 2167
1071 Ga0373960_0019347 3300035121 Bacteria 1788
1072 Ga0373943_0007759 3300035170 Bacteria 4819
1073 Ga0373943_0063513 3300035170 Bacteria 1851
1074 Ga0373946_0007410 3300035171 Bacteria 4011
1075 Ga0373955_0065548 3300035172 Bacteria 2016
1076 Ga0373924_0000242 3300035410 Bacteria 16693
1077 Ga0373924_0010177 3300035410 Bacteria 3462
1078 Ga0373924_0013446 3300035410 Bacteria 3076
1079 Ga0373931_0016212 3300035691 Bacteria 3665
1080 Ga0373931_0036963 3300035691 Bacteria 2548
1081 Ga0373931_0387390 3300035691 Bacteria 882
1082 Ga0373935_0008518 3300035692 Bacteria 6138
1083 Ga0373935_0038747 3300035692 Bacteria 2985
1084 Ga0373935_0109231 3300035692 Bacteria 1834
1085 Ga0373935_0129368 3300035692 Bacteria 1695
1086 Ga0373935_0221867 3300035692 Bacteria 1313
1087 Ga0373935_0673986 3300035692 Unclassified 759
1088 Ga0373935_0957268 3300035692 Unclassified 635
1089 Ga0373927_0000747 3300035695 Bacteria 24845
1090 Ga0373927_0028973 3300035695 Bacteria 3609
1091 Ga0373927_0058541 3300035695 Bacteria 2492
1092 Ga0373927_0275915 3300035695 Bacteria 1106
1093 Ga0373933_0007220 3300035724 Bacteria 6056
1094 Ga0373933_0208806 3300035724 Bacteria 1251
1095 Ga0373933_0318460 3300035724 Bacteria 1008
1096 Ga0373947_0004951 3300035725 Bacteria 7791
1097 Ga0373947_0020057 3300035725 Bacteria 3858
1098 Ga0373947_0031701 3300035725 Bacteria 3112
1099 Ga0373947_0144026 3300035725 Bacteria 1530
1100 Ga0373937_0000317 3300036401 Bacteria 45743
1101 Ga0373937_0033955 3300036401 Bacteria 4638
1102 Ga0373937_0080212 3300036401 Bacteria 3017
1103 Ga0373937_0194406 3300036401 Bacteria 1907
1104 Ga0373937_0237142 3300036401 Bacteria 1718
1105 Ga0373937_0325988 3300036401 Bacteria 1453
1106 Ga0373937_1295066 3300036401 Bacteria 677
1107 Ga0373937_1575029 3300036401 Bacteria 604
1108 Ga0265778_000084 3300036457 Bacteria 5781
1109 Ga0265778_037399 3300036457 Unclassified 641
1110 Ga0373925_0003717 3300037068 Bacteria 11714
1111 Ga0373925_0016522 3300037068 Bacteria 5347
1112 Ga0373925_0053657 3300037068 Bacteria 3014
1113 Ga0373925_0117328 3300037068 Bacteria 2062
1114 Ga0373925_0155109 3300037068 Bacteria 1800
1115 Ga0373925_0205941 3300037068 Bacteria 1566
1116 Ga0373925_0387262 3300037068 Unclassified 1139
1117 Ga0373925_0961808 3300037068 Unclassified 703
1118 Ga0395900_0472883 3300037418 Bacteria 1207
1119 Ga0395900_1080223 3300037418 Bacteria 720
1120 Ga0395898_0159495 3300037466 Bacteria 2157
1121 Ga0395898_0286274 3300037466 Bacteria 1572
1122 Ga0395905_0030235 3300037471 Bacteria 5106
1123 Ga0395905_0469481 3300037471 Bacteria 1157
1124 Ga0395901_0309556 3300038443 Bacteria 1636
1125 Ga0395901_0607629 3300038443 Bacteria 1102
1126 Ga0436365_1570757 3300039437 Bacteria 2443
1127 Ga0436365_1579359 3300039437 Bacteria 3411
1128 Ga0436365_1743054 3300039437 Bacteria 1248
1129 Ga0436360_0367909 3300039438 Bacteria 3590
1130 Ga0436360_0790368 3300039438 Bacteria 1322
1131 Ga0436360_1254708 3300039438 Bacteria 3185
1132 Ga0436360_1271565 3300039438 Unclassified 1304
1133 Ga0436361_0270740 3300039447 Bacteria 8649
1134 Ga0436361_0359969 3300039447 Bacteria 1407
1135 Ga0436361_0574782 3300039447 Bacteria 2137
1136 Ga0436361_0720823 3300039447 Bacteria 1343
1137 Ga0436361_0824839 3300039447 Bacteria 4602
1138 Ga0436361_1136307 3300039447 Bacteria 584
1139 Ga0436363_1519336 3300039450 Bacteria 3260
1140 Ga0436363_1565028 3300039450 Bacteria 3464
1141 Ga0436363_1588661 3300039450 Bacteria 1089
1142 Ga0436362_0607968 3300039453 Bacteria 3219
1143 Ga0436362_0777293 3300039453 Bacteria 4321
1144 Ga0451839_0272954 3300041496 Unclassified 688
1145 Ga0439448_0009042 3300042005 Bacteria 2930
1146 Ga0451577_0000523 3300042876 Bacteria 63915
1147 Ga0453683_0066176 3300044673 Bacteria 2259
1148 Ga0466966_0538712 3300044684 Unclassified 702
1149 Ga0466961_0069645 3300044693 Unclassified 2233
1150 Ga0466961_0079115 3300044693 Unclassified 2082
1151 Ga0466963_0030210 3300044694 Bacteria 3494
1152 Ga0466963_0207365 3300044694 Bacteria 1371
1153 Ga0466963_0280660 3300044694 Unclassified 1171
1154 Ga0466963_0349464 3300044694 Bacteria 1041
1155 Ga0453684_0000951 3300044712 Bacteria 95417
1156 Ga0466968_0084554 3300044735 Unclassified 1399
1157 Ga0466957_0000324 3300044842 Bacteria 23180
1158 Ga0466957_0451004 3300044842 Bacteria 886
1159 Ga0466957_0571086 3300044842 Bacteria 790
1160 Ga0466959_0024892 3300045049 Bacteria 4433
1161 Ga0466959_0176220 3300045049 Bacteria 1498
1162 Ga0466959_0468418 3300045049 Bacteria 853
1163 Ga0451576_0010556 3300045051 Bacteria 10579
1164 Ga0466958_0070851 3300045836 Bacteria 2134
1165 Ga0466958_0268966 3300045836 Bacteria 1092
1166 Ga0466958_0363610 3300045836 Bacteria 932
1167 Ga0466958_0534813 3300045836 Bacteria 761
1168 Ga0466967_0004406 3300045976 Bacteria 9486
1169 Ga0466967_0011957 3300045976 Bacteria 6613
1170 Ga0466967_0054201 3300045976 Bacteria 3527
1171 Ga0466967_0081086 3300045976 Bacteria 2930
1172 Ga0466967_0261674 3300045976 Bacteria 1655
1173 Ga0466967_0270579 3300045976 Bacteria 1628
1174 Ga0466967_0331510 3300045976 Bacteria 1470
1175 Ga0466967_0375223 3300045976 Bacteria 1380
1176 Ga0466967_0549255 3300045976 Bacteria 1137
1177 Ga0466967_0929641 3300045976 Bacteria 865
1178 Ga0495617_158061 3300046452 Bacteria 719
1179 Ga0495592_0087856 3300046454 Bacteria 2235
1180 Ga0495592_0398090 3300046454 Unclassified 873
1181 Ga0495603_0047588 3300046455 Bacteria 2553
1182 Ga0495603_0072297 3300046455 Bacteria 2026
1183 Ga0495603_0325396 3300046455 Unclassified 882
1184 Ga0495603_0572585 3300046455 Bacteria 647
1185 Ga0495629_0016750 3300046459 Bacteria 5260
1186 Ga0495629_0114399 3300046459 Bacteria 1880
1187 Ga0495629_0520583 3300046459 Bacteria 800
1188 Ga0495651_0134346 3300046462 Bacteria 1802
1189 Ga0495651_0182806 3300046462 Bacteria 1483
1190 Ga0495653_0002196 3300046463 Bacteria 15433
1191 Ga0495653_0144725 3300046463 Bacteria 1667
1192 Ga0495653_0229100 3300046463 Bacteria 1245
1193 Ga0495653_0241095 3300046463 Bacteria 1205
1194 Ga0495653_0340632 3300046463 Bacteria 967
1195 Ga0495650_0000010 3300046471 Bacteria 645599
1196 Ga0495650_0001875 3300046471 Bacteria 18731
1197 Ga0495580_0001845 3300046472 Bacteria 18638
1198 Ga0495580_0005545 3300046472 Bacteria 10406
1199 Ga0495580_0006027 3300046472 Bacteria 9927
1200 Ga0495580_0024607 3300046472 Bacteria 4405
1201 Ga0495580_0039298 3300046472 Bacteria 3385
1202 Ga0495580_0072920 3300046472 Bacteria 2397
1203 Ga0495580_0075926 3300046472 Bacteria 2344
1204 Ga0495580_0079775 3300046472 Bacteria 2282
1205 Ga0495580_0082308 3300046472 Bacteria 2243
1206 Ga0495580_0116291 3300046472 Unclassified 1857
1207 Ga0495580_0126485 3300046472 Bacteria 1774
1208 Ga0495580_0174650 3300046472 Bacteria 1484
1209 Ga0495580_0180860 3300046472 Bacteria 1456
1210 Ga0495580_0186695 3300046472 Unclassified 1431
1211 Ga0495580_0203231 3300046472 Bacteria 1364
1212 Ga0495580_0238109 3300046472 Bacteria 1248
1213 Ga0495580_0290242 3300046472 Unclassified 1115
1214 Ga0495580_0301832 3300046472 Bacteria 1090
1215 Ga0495580_0336392 3300046472 Bacteria 1024
1216 Ga0495580_0347402 3300046472 Unclassified 1005
1217 Ga0495580_0514028 3300046472 Bacteria 798
1218 Ga0495580_0780822 3300046472 Bacteria 620
1219 Ga0495582_0004179 3300046473 Bacteria 8118
1220 Ga0495582_0008570 3300046473 Bacteria 5638
1221 Ga0495582_0079499 3300046473 Bacteria 1820
1222 Ga0495582_0184668 3300046473 Bacteria 1189
1223 Ga0495582_0259319 3300046473 Bacteria 997
1224 Ga0495639_0001964 3300046475 Bacteria 9120
1225 Ga0495639_0138843 3300046475 Bacteria 1167
1226 Ga0495662_0000747 3300046476 Bacteria 15591
1227 Ga0495662_0364358 3300046476 Bacteria 710
1228 Ga0495664_0031016 3300046477 Bacteria 3132
1229 Ga0495664_0057831 3300046477 Bacteria 2307
1230 Ga0495664_0060539 3300046477 Bacteria 2254
1231 Ga0495664_0219680 3300046477 Bacteria 1150
1232 Ga0495664_0412229 3300046477 Bacteria 811
1233 Ga0495584_0084776 3300046491 Bacteria 1596
1234 Ga0495585_0078960 3300046492 Bacteria 1785
1235 Ga0495594_0005255 3300046499 Bacteria 6657
1236 Ga0495594_0032431 3300046499 Bacteria 2836
1237 Ga0495594_0038320 3300046499 Bacteria 2617
1238 Ga0495594_0060220 3300046499 Bacteria 2099
1239 Ga0495594_0065441 3300046499 Bacteria 2016
1240 Ga0495594_0583590 3300046499 Bacteria 634
1241 Ga0495596_0063445 3300046500 Bacteria 1437
1242 Ga0495583_0135574 3300046506 Bacteria 1028
1243 Ga0495606_0011222 3300046507 Bacteria 7332
1244 Ga0495618_0061530 3300046514 Bacteria 2382
1245 Ga0495628_0125396 3300046516 Bacteria 1968
1246 Ga0495628_0132429 3300046516 Bacteria 1906
1247 Ga0495630_0137008 3300046517 Bacteria 1860
1248 Ga0495630_0228720 3300046517 Bacteria 1421
1249 Ga0495630_0242461 3300046517 Bacteria 1377
1250 Ga0495630_0248624 3300046517 Bacteria 1358
1251 Ga0495631_0091955 3300046518 Bacteria 1306
1252 Ga0495644_0000777 3300046523 Bacteria 13129
1253 Ga0495648_0208757 3300046524 Bacteria 972
1254 Ga0495666_0000949 3300046526 Bacteria 13647
1255 Ga0495642_0026806 3300046528 Bacteria 2291
1256 Ga0495642_0104767 3300046528 Bacteria 1206
1257 Ga0495642_0105010 3300046528 Bacteria 1205
1258 Ga0495652_0010348 3300046529 Bacteria 8451
1259 Ga0495652_0055557 3300046529 Bacteria 3367
1260 Ga0495665_0003007 3300046531 Bacteria 9111
1261 Ga0495665_0006456 3300046531 Bacteria 6332
1262 Ga0495665_0016955 3300046531 Bacteria 3919
1263 Ga0495665_0087931 3300046531 Bacteria 1633
1264 Ga0495665_0120542 3300046531 Unclassified 1374
1265 Ga0495665_0326498 3300046531 Unclassified 783
1266 Ga0495640_0018326 3300046533 Bacteria 5196
1267 Ga0495586_0003386 3300046535 Bacteria 8551
1268 Ga0495586_0024739 3300046535 Bacteria 3212
1269 Ga0495586_0099941 3300046535 Bacteria 1609
1270 Ga0495587_0039049 3300046536 Bacteria 2844
1271 Ga0495587_0075587 3300046536 Bacteria 1956
1272 Ga0495609_0025275 3300046538 Bacteria 2724
1273 Ga0495645_0006005 3300046543 Bacteria 8397
1274 Ga0495645_0008101 3300046543 Bacteria 7323
1275 Ga0495645_0047042 3300046543 Bacteria 3144
1276 Ga0495645_0049454 3300046543 Bacteria 3062
1277 Ga0495645_0404811 3300046543 Bacteria 869
1278 Ga0495667_0003070 3300046559 Bacteria 11203
1279 Ga0495667_0388693 3300046559 Bacteria 879
1280 Ga0495667_0587439 3300046559 Bacteria 694
1281 Ga0495656_0047779 3300046615 Bacteria 1816
1282 Ga0495668_0017443 3300046616 Bacteria 4164
1283 Ga0495668_0104556 3300046616 Bacteria 1549
1284 Ga0495634_0001003 3300046642 Bacteria 26591
1285 Ga0495625_0062943 3300046660 Bacteria 2621
1286 Ga0495625_0092175 3300046660 Bacteria 2094
1287 Ga0495635_0007598 3300046663 Bacteria 7562
1288 Ga0495635_0094433 3300046663 Bacteria 2045
1289 Ga0495635_0124719 3300046663 Bacteria 1756
1290 Ga0495635_0214888 3300046663 Unclassified 1302
1291 Ga0495635_0436405 3300046663 Bacteria 867
1292 Ga0495659_0019767 3300046664 Bacteria 2255
1293 Ga0495661_0009905 3300046665 Bacteria 6520
1294 Ga0495657_0277833 3300046675 Bacteria 1003
1295 Ga0495657_0524605 3300046675 Unclassified 689
1296 Ga0495599_0026214 3300046678 Bacteria 3652
1297 Ga0495599_0452446 3300046678 Bacteria 760
1298 Ga0495623_0023977 3300046679 Bacteria 3937
1299 Ga0495623_0072756 3300046679 Bacteria 2137
1300 Ga0495623_0262076 3300046679 Bacteria 968
1301 Ga0495623_0412109 3300046679 Unclassified 725
1302 Ga0495646_0012115 3300046680 Bacteria 5483
1303 Ga0495647_0131461 3300046681 Unclassified 1061
1304 Ga0495647_0193089 3300046681 Bacteria 890
1305 Ga0495658_0037741 3300046683 Bacteria 2672
1306 Ga0495658_0701449 3300046683 Bacteria 648
1307 Ga0495669_0000955 3300046684 Bacteria 12075
1308 Ga0495669_0032096 3300046684 Bacteria 2307
1309 Ga0495669_0062300 3300046684 Unclassified 1690
1310 Ga0495669_0092240 3300046684 Bacteria 1399
1311 Ga0495613_0012294 3300046689 Bacteria 6357
1312 Ga0495613_0208905 3300046689 Bacteria 1373
1313 Ga0495624_0003012 3300046690 Bacteria 12609
1314 Ga0495649_0131427 3300046694 Bacteria 1321
1315 Ga0495600_0003517 3300046809 Bacteria 9206
1316 Ga0495600_0105220 3300046809 Bacteria 1839
1317 Ga0495600_0653006 3300046809 Bacteria 636
1318 Ga0495581_0000275 3300047315 Bacteria 24951
1319 Ga0495581_0042427 3300047315 Bacteria 2633
1320 Ga0495581_0130830 3300047315 Bacteria 1462
1321 Ga0495581_0212753 3300047315 Bacteria 1130
1322 Ga0495604_0005020 3300047317 Bacteria 10473
1323 Ga0495604_0100899 3300047317 Bacteria 2121
1324 Ga0495604_0255138 3300047317 Bacteria 1194
1325 Ga0495674_0013768 3300047319 Bacteria 7593
1326 Ga0495674_0022106 3300047319 Bacteria 5870
1327 Ga0495674_0057042 3300047319 Bacteria 3419
1328 Ga0495674_0776063 3300047319 Bacteria 747
1329 Ga0495672_0005628 3300047320 Bacteria 9887
1330 Ga0495676_0007390 3300047321 Bacteria 10083
1331 Ga0495675_0049792 3300047444 Bacteria 2662
1332 Ga0495675_0065940 3300047444 Bacteria 2289
1333 Ga0495677_0013342 3300047445 Bacteria 2990
1334 Ga0495684_0009955 3300047471 Bacteria 7343
1335 Ga0495684_0120432 3300047471 Bacteria 1977
1336 Ga0495684_0128364 3300047471 Bacteria 1906
1337 Ga0495684_0201797 3300047471 Bacteria 1466
1338 Ga0495686_0002881 3300047472 Bacteria 15450
1339 Ga0495686_0175203 3300047472 Bacteria 1246
1340 Ga0495593_0067833 3300047673 Bacteria 1857
1341 Ga0495593_0068202 3300047673 Bacteria 1851
1342 Ga0495593_0092577 3300047673 Bacteria 1556
1343 Ga0495593_0093717 3300047673 Bacteria 1545
1344 Ga0495602_0158730 3300048088 Bacteria 1768
1345 Ga0495602_0286930 3300048088 Bacteria 1210
1346 Ga0495602_0909119 3300048088 Unclassified 585
1347 Ga0495614_0004587 3300048089 Bacteria 6220
1348 Ga0495614_0011701 3300048089 Bacteria 3858
1349 Ga0495614_0084201 3300048089 Bacteria 1379
1350 Ga0495614_0477673 3300048089 Bacteria 592
1351 Ga0496101_0132436 3300048904 Bacteria 1894
1352 Ga0496101_0175694 3300048904 Bacteria 1647
1353 Ga0496101_0334586 3300048904 Bacteria 1189
1354 Ga0496102_0024941 3300048905 Bacteria 5319
1355 Ga0496102_0050572 3300048905 Bacteria 3784
1356 Ga0496102_0140377 3300048905 Unclassified 2265
1357 Ga0496102_0414437 3300048905 Bacteria 1265
1358 Ga0496102_0542524 3300048905 Bacteria 1086
1359 Ga0496102_0775051 3300048905 Unclassified 882
1360 Ga0496103_0006549 3300048906 Bacteria 6948
1361 Ga0496103_0014605 3300048906 Bacteria 4666
1362 Ga0496103_0129966 3300048906 Bacteria 1608
1363 Ga0496104_0108384 3300048907 Bacteria 2662
1364 Ga0496104_0120150 3300048907 Bacteria 2523
1365 Ga0496104_0153093 3300048907 Bacteria 2213
1366 Ga0496104_0232501 3300048907 Bacteria 1755
1367 Ga0496104_0281141 3300048907 Unclassified 1577
1368 Ga0496104_0319617 3300048907 Bacteria 1465
1369 Ga0496104_0405726 3300048907 Unclassified 1275
1370 Ga0496104_0461671 3300048907 Bacteria 1181
1371 Ga0496105_0001128 3300048908 Bacteria 18606
1372 Ga0496105_0035043 3300048908 Bacteria 4130
1373 Ga0496105_0347552 3300048908 Bacteria 1185
1374 Ga0496105_1098031 3300048908 Unclassified 591
1375 Ga0496106_0193085 3300048909 Bacteria 1619
1376 Ga0496107_0051715 3300048910 Bacteria 2964
1377 Ga0496108_0000242 3300048911 Bacteria 48793
1378 Ga0496108_0050272 3300048911 Bacteria 3489
1379 Ga0496108_0426059 3300048911 Bacteria 1159
1380 Ga0496109_0000120 3300048912 Bacteria 81828
1381 Ga0496109_0065523 3300048912 Bacteria 3326
1382 Ga0496109_0141665 3300048912 Bacteria 2248
1383 Ga0496109_0419455 3300048912 Bacteria 1264
1384 Ga0496109_0896582 3300048912 Bacteria 825
1385 Ga0496110_0000795 3300048913 Bacteria 22036
1386 Ga0496110_0180758 3300048913 Bacteria 1915
1387 Ga0496110_0209108 3300048913 Unclassified 1774
1388 Ga0496110_0216448 3300048913 Bacteria 1742
1389 Ga0496110_0323984 3300048913 Bacteria 1404
1390 Ga0496111_0164923 3300048914 Bacteria 1645
1391 Ga0496111_0228096 3300048914 Bacteria 1383
1392 Ga0496111_0573621 3300048914 Unclassified 827
1393 Ga0496112_0000198 3300048915 Bacteria 39413
1394 Ga0496112_0000784 3300048915 Bacteria 22427
1395 Ga0496112_0003360 3300048915 Bacteria 13207
1396 Ga0496112_0006971 3300048915 Bacteria 9976
1397 Ga0496112_0011423 3300048915 Bacteria 8109
1398 Ga0496112_0023010 3300048915 Bacteria 5946
1399 Ga0496112_0048084 3300048915 Bacteria 4184
1400 Ga0496112_0064736 3300048915 Bacteria 3608
1401 Ga0496112_0086077 3300048915 Bacteria 3110
1402 Ga0496112_0239147 3300048915 Bacteria 1769
1403 Ga0496112_0436714 3300048915 Bacteria 1247
1404 Ga0496112_0447875 3300048915 Bacteria 1229
1405 Ga0496112_0520295 3300048915 Bacteria 1124
1406 Ga0496112_0835722 3300048915 Bacteria 845
1407 Ga0496112_1165528 3300048915 Unclassified 688
1408 Ga0496113_0000111 3300048916 Bacteria 35094
1409 Ga0496113_0189401 3300048916 Bacteria 1633
1410 Ga0496113_0199752 3300048916 Bacteria 1589
1411 Ga0496113_0781478 3300048916 Bacteria 759
1412 Ga0496114_0340843 3300048917 Bacteria 1325
1413 Ga0496115_0046543 3300048918 Bacteria 3467
1414 Ga0496115_0178537 3300048918 Bacteria 1756
1415 Ga0496115_0458651 3300048918 Unclassified 1028
1416 Ga0496115_0522808 3300048918 Bacteria 951
1417 Ga0496126_0000209 3300048929 Bacteria 131440
1418 Ga0496126_0003148 3300048929 Bacteria 21270
1419 Ga0501036_0355705 3300049572 Bacteria 1223
1420 Ga0501047_0014539 3300049581 Bacteria 7487
1421 Ga0501067_0174949 3300049583 Bacteria 1195
1422 Ga0501070_0042215 3300049586 Bacteria 3799
1423 Ga0501070_0123554 3300049586 Bacteria 2139
1424 Ga0501073_0046644 3300049589 Bacteria 3046
1425 Ga0501080_0154241 3300049742 Bacteria 2122
1426 nmdc:mga05p37_1174556_c1 3300050507 Bacteria 796
1427 nmdc:mga05p37_250988_c1 3300050507 Bacteria 2122
1428 nmdc:mga06r32_1301579_c1 3300050510 Bacteria 671
1429 nmdc:mga0n895_133428_c1 3300050512 Bacteria 2509
1430 nmdc:mga0n895_142028_c1 3300050512 Bacteria 2430
1431 nmdc:mga0n895_344_c1 3300050512 Bacteria 31117
1432 nmdc:mga0n895_409067_c1 3300050512 Bacteria 1372
1433 nmdc:mga0rr50_38765_c1 3300050513 Bacteria 3451
1434 nmdc:mga0rr50_83273_c1 3300050513 Bacteria 2473
1435 nmdc:mga0rr50_872_c1 3300050513 Bacteria 16295
1436 nmdc:mga08x19_14635_c1 3300050514 Bacteria 4762
1437 nmdc:mga08x19_176467_c1 3300050514 Bacteria 1457
1438 nmdc:mga08x19_186747_c1 3300050514 Bacteria 1417
1439 nmdc:mga08x19_33261_c1 3300050514 Bacteria 3254
1440 nmdc:mga08x19_3391_c1 3300050514 Bacteria 9503
1441 nmdc:mga08x19_37717_c1 3300050514 Bacteria 3069
1442 nmdc:mga08x19_417946_c2 3300050514 Bacteria 644
1443 nmdc:mga0a205_7367_c1 3300050515 Bacteria 9965
1444 Ga0495601_0071156 3300053077 Bacteria 2221
1445 Ga0495619_0114669 3300053085 Bacteria 1844
1446 Ga0495619_0260909 3300053085 Unclassified 1201
1447 Ga0500651_0000049 3300053093 Bacteria 83361
1448 Ga0500595_000014 3300053119 Bacteria 247996
1449 Ga0500595_024202 3300053119 Bacteria 2122
1450 Ga0500590_140956 3300053148 Bacteria 1102
1451 Ga0500661_002505 3300055283 Bacteria 3466
1452 Ga0587089_012762 3300059509 Bacteria 1078
1453 Ga0587091_140328 3300059511 Bacteria 605
1454 Ga0587109_017608 3300059624 Unclassified 1239

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025901 Ga0207688_10325519 Ga0207688_103255192 145
2 3300006847 Ga0075431_100234638 Ga0075431_1002346384 156
3 3300050510 nmdc:mga06r32_1301579_c1 nmdc:mga06r32_1301579_c1_15_572 156
4 3300007788 Ga0099795_10134806 Ga0099795_101348062 160
5 3300006844 Ga0075428_100019323 Ga0075428_1000193236 161
6 3300004799 Ga0058863_11802639 Ga0058863_118026391 162
7 3300004803 Ga0058862_10017147 Ga0058862_100171474 162
8 3300005458 Ga0070681_10506412 Ga0070681_105064122 162
9 3300005563 Ga0068855_100962532 Ga0068855_1009625322 162
10 3300009174 Ga0105241_10872127 Ga0105241_108721272 162
11 3300013105 Ga0157369_10080168 Ga0157369_100801681 162
12 3300025912 Ga0207707_10776279 Ga0207707_107762791 162
13 3300025917 Ga0207660_10167490 Ga0207660_101674902 162
14 3300025921 Ga0207652_10367116 Ga0207652_103671161 162
15 3300048918 Ga0496115_0458651 Ga0496115_0458651_297_836 162
16 3300005444 Ga0070694_100102804 Ga0070694_1001028042 165
17 3300005545 Ga0070695_100142679 Ga0070695_1001426793 165
18 3300009093 Ga0105240_10238782 Ga0105240_102387824 169
19 3300014745 Ga0157377_10522907 Ga0157377_105229072 169
20 3300013105 Ga0157369_10106753 Ga0157369_101067532 171
21 3300031250 Ga0265331_10054664 Ga0265331_100546642 172
22 3300031344 Ga0265316_10473326 Ga0265316_104733261 172
23 3300031711 Ga0265314_10205068 Ga0265314_102050682 172
24 3300035083 Ga0373926_0159278 Ga0373926_0159278_274_813 172
25 3300035113 Ga0373936_0029559 Ga0373936_0029559_1196_1735 172
26 3300036401 Ga0373937_0325988 Ga0373937_0325988_360_899 172
27 3300037068 Ga0373925_0155109 Ga0373925_0155109_853_1392 172
28 3300046477 Ga0495664_0057831 Ga0495664_0057831_884_1423 172
29 3300046517 Ga0495630_0137008 Ga0495630_0137008_165_704 172
30 3300046543 Ga0495645_0049454 Ga0495645_0049454_1404_1943 172
31 3300046615 Ga0495656_0047779 Ga0495656_0047779_269_808 172
32 3300046664 Ga0495659_0019767 Ga0495659_0019767_1664_2203 172
33 3300047319 Ga0495674_0013768 Ga0495674_0013768_35_574 172
34 3300053077 Ga0495601_0071156 Ga0495601_0071156_125_664 172
35 3300053085 Ga0495619_0114669 Ga0495619_0114669_1153_1692 172
36 3300005536 Ga0070697_100007786 Ga0070697_1000077865 173
37 3300009147 Ga0114129_11003135 Ga0114129_110031352 173
38 3300045976 Ga0466967_0011957 Ga0466967_0011957_1979_2518 173
39 3300050507 nmdc:mga05p37_250988_c1 nmdc:mga05p37_250988_c1_143_682 173
40 3300006173 Ga0070716_100295012 Ga0070716_1002950121 174
41 3300025939 Ga0207665_10091518 Ga0207665_100915184 174
42 3300031249 Ga0265339_10065474 Ga0265339_100654743 174
43 3300044693 Ga0466961_0079115 Ga0466961_0079115_1333_1872 174
44 3300045836 Ga0466958_0070851 Ga0466958_0070851_1484_2023 174
45 3300045976 Ga0466967_0081086 Ga0466967_0081086_1141_1680 174
46 iso_pu_bacteria 2884215851 2884219644 175
47 3300005536 Ga0070697_100033812 Ga0070697_1000338126 176
48 3300005546 Ga0070696_100405015 Ga0070696_1004050152 177
49 3300019188 Ga0184599_139676 Ga0184599_1396761 178
50 3300022730 Ga0224570_100075 Ga0224570_1000756 178
51 3300023672 Ga0247553_101308 Ga0247553_1013082 178
52 3300024227 Ga0228598_1000513 Ga0228598_100051311 178
53 3300028017 Ga0265356_1000279 Ga0265356_100027911 178
54 3300030760 Ga0265762_1000677 Ga0265762_10006772 178
55 3300030886 Ga0265772_103459 Ga0265772_1034591 178
56 3300031090 Ga0265760_10000694 Ga0265760_1000069410 178
57 3300032120 Ga0316053_100087 Ga0316053_1000871 178
58 2162886012 MBSR1b_contig_8729389 MBSR1b_0918.00004910 179
59 3300001904 JGI24736J21556_1018094 JGI24736J21556_10180941 179
60 3300001976 JGI24752J21851_1000484 JGI24752J21851_10004844 179
61 3300001978 JGI24747J21853_1000395 JGI24747J21853_10003956 179
62 3300002239 JGI24034J26672_10001629 JGI24034J26672_100016296 179
63 3300002459 JGI24751J29686_10001356 JGI24751J29686_100013568 179
64 3300004798 Ga0058859_11470862 Ga0058859_114708623 179
65 3300004799 Ga0058863_11938496 Ga0058863_119384962 179
66 3300004800 Ga0058861_10007822 Ga0058861_100078221 179
67 3300004800 Ga0058861_11624704 Ga0058861_116247042 179
68 3300004800 Ga0058861_11899665 Ga0058861_118996652 179
69 3300004803 Ga0058862_10002646 Ga0058862_100026463 179
70 3300004803 Ga0058862_10197740 Ga0058862_101977408 179
71 3300004803 Ga0058862_12640743 Ga0058862_126407432 179
72 3300005290 Ga0065712_10129019 Ga0065712_101290192 179
73 3300005290 Ga0065712_10366129 Ga0065712_103661291 179
74 3300005293 Ga0065715_10095964 Ga0065715_100959649 179
75 3300005327 Ga0070658_10000766 Ga0070658_1000076613 179
76 3300005327 Ga0070658_10012762 Ga0070658_100127625 179
77 3300005327 Ga0070658_10017988 Ga0070658_100179884 179
78 3300005327 Ga0070658_10050557 Ga0070658_100505574 179
79 3300005327 Ga0070658_10120566 Ga0070658_101205661 179
80 3300005328 Ga0070676_10004776 Ga0070676_100047762 179
81 3300005328 Ga0070676_10009197 Ga0070676_100091974 179
82 3300005329 Ga0070683_100011087 Ga0070683_1000110876 179
83 3300005329 Ga0070683_100051474 Ga0070683_1000514744 179
84 3300005329 Ga0070683_100053730 Ga0070683_1000537307 179
85 3300005329 Ga0070683_100209124 Ga0070683_1002091242 179
86 3300005329 Ga0070683_100234561 Ga0070683_1002345612 179
87 3300005329 Ga0070683_100320932 Ga0070683_1003209322 179
88 3300005329 Ga0070683_100362234 Ga0070683_1003622342 179
89 3300005329 Ga0070683_100547916 Ga0070683_1005479162 179
90 3300005330 Ga0070690_100000550 Ga0070690_10000055018 179
91 3300005330 Ga0070690_100022065 Ga0070690_1000220653 179
92 3300005330 Ga0070690_100100672 Ga0070690_1001006721 179
93 3300005331 Ga0070670_100009055 Ga0070670_1000090558 179
94 3300005331 Ga0070670_100015559 Ga0070670_1000155596 179
95 3300005331 Ga0070670_100033183 Ga0070670_1000331836 179
96 3300005331 Ga0070670_100765487 Ga0070670_1007654871 179
97 3300005333 Ga0070677_10066505 Ga0070677_100665052 179
98 3300005334 Ga0068869_100001846 Ga0068869_10000184615 179
99 3300005334 Ga0068869_100012003 Ga0068869_1000120034 179
100 3300005334 Ga0068869_100014372 Ga0068869_1000143725 179
101 3300005334 Ga0068869_100414207 Ga0068869_1004142072 179
102 3300005334 Ga0068869_100643640 Ga0068869_1006436401 179
103 3300005335 Ga0070666_10010107 Ga0070666_100101074 179
104 3300005335 Ga0070666_10010510 Ga0070666_100105106 179
105 3300005335 Ga0070666_10076210 Ga0070666_100762104 179
106 3300005336 Ga0070680_100014163 Ga0070680_1000141639 179
107 3300005336 Ga0070680_100016919 Ga0070680_1000169192 179
108 3300005336 Ga0070680_100087043 Ga0070680_1000870433 179
109 3300005336 Ga0070680_100100834 Ga0070680_1001008342 179
110 3300005336 Ga0070680_100148246 Ga0070680_1001482461 179
111 3300005336 Ga0070680_100232677 Ga0070680_1002326773 179
112 3300005336 Ga0070680_100478333 Ga0070680_1004783331 179
113 3300005336 Ga0070680_100482949 Ga0070680_1004829491 179
114 3300005336 Ga0070680_100590538 Ga0070680_1005905381 179
115 3300005337 Ga0070682_100060415 Ga0070682_1000604155 179
116 3300005337 Ga0070682_100102107 Ga0070682_1001021073 179
117 3300005338 Ga0068868_100002791 Ga0068868_1000027918 179
118 3300005338 Ga0068868_100012462 Ga0068868_10001246212 179
119 3300005338 Ga0068868_100018109 Ga0068868_1000181099 179
120 3300005338 Ga0068868_100022874 Ga0068868_1000228742 179
121 3300005338 Ga0068868_100161538 Ga0068868_1001615382 179
122 3300005338 Ga0068868_100687367 Ga0068868_1006873672 179
123 3300005339 Ga0070660_100006039 Ga0070660_10000603915 179
124 3300005339 Ga0070660_100006108 Ga0070660_10000610815 179
125 3300005339 Ga0070660_100023782 Ga0070660_1000237822 179
126 3300005339 Ga0070660_100034984 Ga0070660_1000349843 179
127 3300005339 Ga0070660_100056691 Ga0070660_1000566911 179
128 3300005339 Ga0070660_100067591 Ga0070660_1000675913 179
129 3300005339 Ga0070660_100139461 Ga0070660_1001394614 179
130 3300005339 Ga0070660_100376518 Ga0070660_1003765182 179
131 3300005340 Ga0070689_101136649 Ga0070689_1011366491 179
132 3300005343 Ga0070687_100000493 Ga0070687_1000004933 179
133 3300005344 Ga0070661_100013936 Ga0070661_10001393610 179
134 3300005344 Ga0070661_100015069 Ga0070661_1000150698 179
135 3300005344 Ga0070661_100018897 Ga0070661_1000188973 179
136 3300005344 Ga0070661_100078274 Ga0070661_1000782744 179
137 3300005345 Ga0070692_10443919 Ga0070692_104439191 179
138 3300005347 Ga0070668_100053030 Ga0070668_1000530305 179
139 3300005353 Ga0070669_100007500 Ga0070669_1000075009 179
140 3300005353 Ga0070669_100772837 Ga0070669_1007728371 179
141 3300005354 Ga0070675_100004817 Ga0070675_1000048176 179
142 3300005354 Ga0070675_100117492 Ga0070675_1001174923 179
143 3300005355 Ga0070671_100001676 Ga0070671_10000167620 179
144 3300005355 Ga0070671_100209166 Ga0070671_1002091664 179
145 3300005355 Ga0070671_100260064 Ga0070671_1002600643 179
146 3300005355 Ga0070671_100293611 Ga0070671_1002936113 179
147 3300005356 Ga0070674_100005528 Ga0070674_1000055283 179
148 3300005356 Ga0070674_100053133 Ga0070674_1000531331 179
149 3300005356 Ga0070674_100492723 Ga0070674_1004927231 179
150 3300005364 Ga0070673_100081477 Ga0070673_1000814773 179
151 3300005366 Ga0070659_100001021 Ga0070659_10000102117 179
152 3300005366 Ga0070659_100018144 Ga0070659_1000181447 179
153 3300005366 Ga0070659_100023105 Ga0070659_1000231051 179
154 3300005366 Ga0070659_100092652 Ga0070659_1000926524 179
155 3300005366 Ga0070659_100176406 Ga0070659_1001764063 179
156 3300005366 Ga0070659_100211498 Ga0070659_1002114983 179
157 3300005367 Ga0070667_100066877 Ga0070667_1000668775 179
158 3300005367 Ga0070667_100372529 Ga0070667_1003725293 179
159 3300005367 Ga0070667_100783484 Ga0070667_1007834841 179
160 3300005367 Ga0070667_100870248 Ga0070667_1008702482 179
161 3300005434 Ga0070709_10002115 Ga0070709_100021157 179
162 3300005434 Ga0070709_10030364 Ga0070709_100303642 179
163 3300005434 Ga0070709_10046482 Ga0070709_100464825 179
164 3300005434 Ga0070709_10055745 Ga0070709_100557454 179
165 3300005434 Ga0070709_10084495 Ga0070709_100844953 179
166 3300005434 Ga0070709_10250979 Ga0070709_102509792 179
167 3300005434 Ga0070709_10351330 Ga0070709_103513301 179
168 3300005434 Ga0070709_10400458 Ga0070709_104004581 179
169 3300005435 Ga0070714_100000096 Ga0070714_10000009667 179
170 3300005435 Ga0070714_100010335 Ga0070714_1000103359 179
171 3300005435 Ga0070714_100016574 Ga0070714_1000165743 179
172 3300005435 Ga0070714_100033628 Ga0070714_1000336286 179
173 3300005435 Ga0070714_100080016 Ga0070714_1000800164 179
174 3300005435 Ga0070714_100082338 Ga0070714_1000823383 179
175 3300005435 Ga0070714_100101478 Ga0070714_1001014783 179
176 3300005435 Ga0070714_100110415 Ga0070714_1001104155 179
177 3300005435 Ga0070714_100120944 Ga0070714_1001209445 179
178 3300005435 Ga0070714_100228319 Ga0070714_1002283192 179
179 3300005435 Ga0070714_100235114 Ga0070714_1002351143 179
180 3300005435 Ga0070714_100400800 Ga0070714_1004008002 179
181 3300005435 Ga0070714_100473112 Ga0070714_1004731122 179
182 3300005435 Ga0070714_100611143 Ga0070714_1006111432 179
183 3300005435 Ga0070714_100690148 Ga0070714_1006901482 179
184 3300005435 Ga0070714_101265059 Ga0070714_1012650591 179
185 3300005435 Ga0070714_101435155 Ga0070714_1014351551 179
186 3300005436 Ga0070713_100000364 Ga0070713_10000036429 179
187 3300005436 Ga0070713_100003189 Ga0070713_10000318918 179
188 3300005436 Ga0070713_100007134 Ga0070713_10000713410 179
189 3300005436 Ga0070713_100015219 Ga0070713_1000152196 179
190 3300005436 Ga0070713_100017965 Ga0070713_1000179659 179
191 3300005436 Ga0070713_100020716 Ga0070713_1000207165 179
192 3300005436 Ga0070713_100024780 Ga0070713_1000247802 179
193 3300005436 Ga0070713_100030235 Ga0070713_1000302356 179
194 3300005436 Ga0070713_100136959 Ga0070713_1001369593 179
195 3300005436 Ga0070713_100143177 Ga0070713_1001431771 179
196 3300005436 Ga0070713_100260739 Ga0070713_1002607393 179
197 3300005436 Ga0070713_100356365 Ga0070713_1003563651 179
198 3300005436 Ga0070713_100462227 Ga0070713_1004622271 179
199 3300005436 Ga0070713_100533954 Ga0070713_1005339541 179
200 3300005436 Ga0070713_100670409 Ga0070713_1006704092 179
201 3300005436 Ga0070713_100954573 Ga0070713_1009545731 179
202 3300005436 Ga0070713_101168561 Ga0070713_1011685611 179
203 3300005436 Ga0070713_101299258 Ga0070713_1012992581 179
204 3300005437 Ga0070710_10017046 Ga0070710_100170463 179
205 3300005437 Ga0070710_10032096 Ga0070710_100320965 179
206 3300005437 Ga0070710_10055725 Ga0070710_100557253 179
207 3300005437 Ga0070710_10098676 Ga0070710_100986762 179
208 3300005437 Ga0070710_10228372 Ga0070710_102283721 179
209 3300005437 Ga0070710_10469371 Ga0070710_104693711 179
210 3300005438 Ga0070701_10429658 Ga0070701_104296581 179
211 3300005439 Ga0070711_100001361 Ga0070711_1000013617 179
212 3300005439 Ga0070711_100014481 Ga0070711_1000144812 179
213 3300005439 Ga0070711_100056999 Ga0070711_1000569992 179
214 3300005439 Ga0070711_100208551 Ga0070711_1002085513 179
215 3300005439 Ga0070711_100297395 Ga0070711_1002973952 179
216 3300005439 Ga0070711_100348959 Ga0070711_1003489592 179
217 3300005439 Ga0070711_100395256 Ga0070711_1003952562 179
218 3300005439 Ga0070711_100814801 Ga0070711_1008148011 179
219 3300005445 Ga0070708_100003510 Ga0070708_1000035106 179
220 3300005445 Ga0070708_100003542 Ga0070708_10000354213 179
221 3300005445 Ga0070708_100015435 Ga0070708_1000154357 179
222 3300005445 Ga0070708_100024232 Ga0070708_10002423210 179
223 3300005445 Ga0070708_100036854 Ga0070708_1000368545 179
224 3300005445 Ga0070708_100174860 Ga0070708_1001748603 179
225 3300005445 Ga0070708_100512043 Ga0070708_1005120432 179
226 3300005455 Ga0070663_100012382 Ga0070663_1000123826 179
227 3300005455 Ga0070663_100130159 Ga0070663_1001301592 179
228 3300005455 Ga0070663_100130407 Ga0070663_1001304073 179
229 3300005456 Ga0070678_100132369 Ga0070678_1001323691 179
230 3300005456 Ga0070678_100153850 Ga0070678_1001538502 179
231 3300005456 Ga0070678_100193822 Ga0070678_1001938224 179
232 3300005456 Ga0070678_101090353 Ga0070678_1010903531 179
233 3300005456 Ga0070678_101304133 Ga0070678_1013041331 179
234 3300005457 Ga0070662_100005784 Ga0070662_10000578412 179
235 3300005457 Ga0070662_100018068 Ga0070662_1000180685 179
236 3300005457 Ga0070662_100221573 Ga0070662_1002215732 179
237 3300005457 Ga0070662_100514727 Ga0070662_1005147271 179
238 3300005457 Ga0070662_101125506 Ga0070662_1011255061 179
239 3300005458 Ga0070681_10004001 Ga0070681_1000400118 179
240 3300005458 Ga0070681_10029788 Ga0070681_100297883 179
241 3300005458 Ga0070681_10033193 Ga0070681_100331935 179
242 3300005458 Ga0070681_10109152 Ga0070681_101091525 179
243 3300005458 Ga0070681_10142642 Ga0070681_101426422 179
244 3300005458 Ga0070681_10218695 Ga0070681_102186952 179
245 3300005458 Ga0070681_10242348 Ga0070681_102423481 179
246 3300005458 Ga0070681_10276274 Ga0070681_102762743 179
247 3300005458 Ga0070681_10289397 Ga0070681_102893971 179
248 3300005458 Ga0070681_10328297 Ga0070681_103282972 179
249 3300005458 Ga0070681_10635162 Ga0070681_106351622 179
250 3300005458 Ga0070681_10650922 Ga0070681_106509221 179
251 3300005458 Ga0070681_10693749 Ga0070681_106937491 179
252 3300005459 Ga0068867_100032550 Ga0068867_1000325503 179
253 3300005459 Ga0068867_100090268 Ga0068867_1000902684 179
254 3300005459 Ga0068867_100282607 Ga0068867_1002826072 179
255 3300005466 Ga0070685_10009457 Ga0070685_100094571 179
256 3300005466 Ga0070685_10044363 Ga0070685_100443635 179
257 3300005467 Ga0070706_100014580 Ga0070706_1000145804 179
258 3300005467 Ga0070706_100111427 Ga0070706_1001114273 179
259 3300005467 Ga0070706_100508310 Ga0070706_1005083101 179
260 3300005468 Ga0070707_100005126 Ga0070707_1000051266 179
261 3300005468 Ga0070707_100033790 Ga0070707_1000337902 179
262 3300005468 Ga0070707_100034957 Ga0070707_1000349573 179
263 3300005468 Ga0070707_100052820 Ga0070707_1000528201 179
264 3300005468 Ga0070707_100122441 Ga0070707_1001224415 179
265 3300005471 Ga0070698_100002449 Ga0070698_10000244918 179
266 3300005471 Ga0070698_100169294 Ga0070698_1001692944 179
267 3300005518 Ga0070699_100000441 Ga0070699_10000044113 179
268 3300005518 Ga0070699_100089928 Ga0070699_1000899282 179
269 3300005518 Ga0070699_100300225 Ga0070699_1003002252 179
270 3300005518 Ga0070699_100741525 Ga0070699_1007415252 179
271 3300005530 Ga0070679_100031685 Ga0070679_1000316852 179
272 3300005530 Ga0070679_100032907 Ga0070679_1000329077 179
273 3300005530 Ga0070679_100052027 Ga0070679_1000520272 179
274 3300005530 Ga0070679_100113302 Ga0070679_1001133025 179
275 3300005530 Ga0070679_100119247 Ga0070679_1001192472 179
276 3300005530 Ga0070679_100203013 Ga0070679_1002030134 179
277 3300005530 Ga0070679_100272070 Ga0070679_1002720704 179
278 3300005530 Ga0070679_100286244 Ga0070679_1002862442 179
279 3300005530 Ga0070679_100287672 Ga0070679_1002876721 179
280 3300005530 Ga0070679_100360046 Ga0070679_1003600461 179
281 3300005530 Ga0070679_100374484 Ga0070679_1003744842 179
282 3300005530 Ga0070679_100603606 Ga0070679_1006036062 179
283 3300005530 Ga0070679_100752191 Ga0070679_1007521911 179
284 3300005530 Ga0070679_100898068 Ga0070679_1008980682 179
285 3300005535 Ga0070684_100001423 Ga0070684_1000014236 179
286 3300005535 Ga0070684_100015104 Ga0070684_1000151049 179
287 3300005535 Ga0070684_100181212 Ga0070684_1001812122 179
288 3300005535 Ga0070684_100193717 Ga0070684_1001937172 179
289 3300005535 Ga0070684_100293901 Ga0070684_1002939012 179
290 3300005535 Ga0070684_100514838 Ga0070684_1005148382 179
291 3300005535 Ga0070684_100853797 Ga0070684_1008537971 179
292 3300005536 Ga0070697_100000975 Ga0070697_10000097517 179
293 3300005536 Ga0070697_100001451 Ga0070697_10000145116 179
294 3300005536 Ga0070697_100005121 Ga0070697_10000512111 179
295 3300005536 Ga0070697_100087566 Ga0070697_1000875665 179
296 3300005536 Ga0070697_100124275 Ga0070697_1001242753 179
297 3300005536 Ga0070697_100251367 Ga0070697_1002513673 179
298 3300005539 Ga0068853_100000054 Ga0068853_10000005418 179
299 3300005539 Ga0068853_100008308 Ga0068853_1000083086 179
300 3300005539 Ga0068853_100020300 Ga0068853_1000203008 179
301 3300005539 Ga0068853_100042814 Ga0068853_1000428142 179
302 3300005539 Ga0068853_100045233 Ga0068853_1000452332 179
303 3300005539 Ga0068853_100135035 Ga0068853_1001350354 179
304 3300005539 Ga0068853_100211359 Ga0068853_1002113592 179
305 3300005539 Ga0068853_100292360 Ga0068853_1002923602 179
306 3300005539 Ga0068853_100947919 Ga0068853_1009479191 179
307 3300005543 Ga0070672_100040143 Ga0070672_1000401436 179
308 3300005543 Ga0070672_100089051 Ga0070672_1000890516 179
309 3300005543 Ga0070672_100162059 Ga0070672_1001620592 179
310 3300005544 Ga0070686_100005280 Ga0070686_1000052804 179
311 3300005544 Ga0070686_100033425 Ga0070686_1000334252 179
312 3300005545 Ga0070695_100045508 Ga0070695_1000455085 179
313 3300005546 Ga0070696_100753145 Ga0070696_1007531451 179
314 3300005546 Ga0070696_100885957 Ga0070696_1008859571 179
315 3300005547 Ga0070693_100020180 Ga0070693_1000201807 179
316 3300005547 Ga0070693_100087684 Ga0070693_1000876843 179
317 3300005547 Ga0070693_100463344 Ga0070693_1004633441 179
318 3300005548 Ga0070665_100008632 Ga0070665_10000863212 179
319 3300005548 Ga0070665_100222047 Ga0070665_1002220472 179
320 3300005548 Ga0070665_100521628 Ga0070665_1005216282 179
321 3300005563 Ga0068855_100000913 Ga0068855_10000091331 179
322 3300005563 Ga0068855_100003825 Ga0068855_10000382513 179
323 3300005563 Ga0068855_100012883 Ga0068855_10001288315 179
324 3300005563 Ga0068855_100025048 Ga0068855_1000250484 179
325 3300005563 Ga0068855_100025561 Ga0068855_1000255617 179
326 3300005563 Ga0068855_100058628 Ga0068855_1000586282 179
327 3300005563 Ga0068855_100099026 Ga0068855_1000990263 179
328 3300005563 Ga0068855_100100510 Ga0068855_1001005104 179
329 3300005563 Ga0068855_100135517 Ga0068855_1001355172 179
330 3300005563 Ga0068855_100157756 Ga0068855_1001577563 179
331 3300005563 Ga0068855_100187271 Ga0068855_1001872712 179
332 3300005563 Ga0068855_100376506 Ga0068855_1003765061 179
333 3300005563 Ga0068855_100434419 Ga0068855_1004344192 179
334 3300005563 Ga0068855_100501119 Ga0068855_1005011192 179
335 3300005563 Ga0068855_100641090 Ga0068855_1006410901 179
336 3300005564 Ga0070664_100045861 Ga0070664_1000458615 179
337 3300005564 Ga0070664_100139633 Ga0070664_1001396333 179
338 3300005564 Ga0070664_100796832 Ga0070664_1007968321 179
339 3300005577 Ga0068857_100001133 Ga0068857_10000113310 179
340 3300005577 Ga0068857_100001398 Ga0068857_1000013986 179
341 3300005577 Ga0068857_100051265 Ga0068857_1000512658 179
342 3300005577 Ga0068857_100054467 Ga0068857_1000544673 179
343 3300005577 Ga0068857_100103614 Ga0068857_1001036142 179
344 3300005577 Ga0068857_100136567 Ga0068857_1001365672 179
345 3300005577 Ga0068857_100862159 Ga0068857_1008621592 179
346 3300005578 Ga0068854_100000137 Ga0068854_10000013742 179
347 3300005578 Ga0068854_100067796 Ga0068854_1000677965 179
348 3300005578 Ga0068854_100080136 Ga0068854_1000801362 179
349 3300005578 Ga0068854_100128644 Ga0068854_1001286442 179
350 3300005578 Ga0068854_100166246 Ga0068854_1001662462 179
351 3300005578 Ga0068854_100167185 Ga0068854_1001671852 179
352 3300005578 Ga0068854_100251398 Ga0068854_1002513981 179
353 3300005614 Ga0068856_100005938 Ga0068856_10000593819 179
354 3300005614 Ga0068856_100014911 Ga0068856_10001491112 179
355 3300005614 Ga0068856_100018924 Ga0068856_10001892413 179
356 3300005614 Ga0068856_100046667 Ga0068856_1000466679 179
357 3300005614 Ga0068856_100060929 Ga0068856_1000609296 179
358 3300005614 Ga0068856_100213429 Ga0068856_1002134293 179
359 3300005614 Ga0068856_100236052 Ga0068856_1002360524 179
360 3300005614 Ga0068856_100917167 Ga0068856_1009171671 179
361 3300005615 Ga0070702_100038867 Ga0070702_1000388674 179
362 3300005615 Ga0070702_100063632 Ga0070702_1000636323 179
363 3300005616 Ga0068852_100001223 Ga0068852_10000122314 179
364 3300005616 Ga0068852_100018187 Ga0068852_1000181876 179
365 3300005616 Ga0068852_100049830 Ga0068852_1000498302 179
366 3300005616 Ga0068852_100063282 Ga0068852_1000632826 179
367 3300005616 Ga0068852_100138769 Ga0068852_1001387694 179
368 3300005616 Ga0068852_101115916 Ga0068852_1011159161 179
369 3300005616 Ga0068852_101276326 Ga0068852_1012763261 179
370 3300005617 Ga0068859_100004997 Ga0068859_1000049978 179
371 3300005617 Ga0068859_100025042 Ga0068859_1000250427 179
372 3300005617 Ga0068859_100052886 Ga0068859_1000528866 179
373 3300005618 Ga0068864_100008706 Ga0068864_10000870611 179
374 3300005618 Ga0068864_100008789 Ga0068864_1000087897 179
375 3300005718 Ga0068866_10030620 Ga0068866_100306205 179
376 3300005718 Ga0068866_10055552 Ga0068866_100555522 179
377 3300005719 Ga0068861_100006422 Ga0068861_1000064228 179
378 3300005719 Ga0068861_100097045 Ga0068861_1000970452 179
379 3300005719 Ga0068861_100399492 Ga0068861_1003994922 179
380 3300005834 Ga0068851_10001352 Ga0068851_1000135213 179
381 3300005834 Ga0068851_10015616 Ga0068851_100156167 179
382 3300005834 Ga0068851_10615958 Ga0068851_106159581 179
383 3300005841 Ga0068863_100020550 Ga0068863_1000205508 179
384 3300005841 Ga0068863_100042299 Ga0068863_1000422999 179
385 3300005841 Ga0068863_100226430 Ga0068863_1002264304 179
386 3300005841 Ga0068863_100666031 Ga0068863_1006660312 179
387 3300005841 Ga0068863_100991268 Ga0068863_1009912681 179
388 3300005842 Ga0068858_100048766 Ga0068858_1000487662 179
389 3300005842 Ga0068858_100059426 Ga0068858_1000594264 179
390 3300005842 Ga0068858_100217624 Ga0068858_1002176241 179
391 3300005843 Ga0068860_100018016 Ga0068860_1000180169 179
392 3300005843 Ga0068860_100179004 Ga0068860_1001790041 179
393 3300005843 Ga0068860_100426949 Ga0068860_1004269493 179
394 3300005844 Ga0068862_100010568 Ga0068862_10001056812 179
395 3300005844 Ga0068862_100027948 Ga0068862_1000279483 179
396 3300005844 Ga0068862_100130298 Ga0068862_1001302982 179
397 3300005844 Ga0068862_101122270 Ga0068862_1011222701 179
398 3300005937 Ga0081455_10511933 Ga0081455_105119332 179
399 3300006028 Ga0070717_10002614 Ga0070717_100026148 179
400 3300006028 Ga0070717_10007864 Ga0070717_100078643 179
401 3300006028 Ga0070717_10011095 Ga0070717_1001109512 179
402 3300006028 Ga0070717_10038572 Ga0070717_100385722 179
403 3300006028 Ga0070717_10074655 Ga0070717_100746553 179
404 3300006028 Ga0070717_10118628 Ga0070717_101186285 179
405 3300006028 Ga0070717_10167951 Ga0070717_101679511 179
406 3300006028 Ga0070717_10175169 Ga0070717_101751692 179
407 3300006028 Ga0070717_10237867 Ga0070717_102378672 179
408 3300006028 Ga0070717_10387159 Ga0070717_103871593 179
409 3300006028 Ga0070717_10419025 Ga0070717_104190251 179
410 3300006028 Ga0070717_10438801 Ga0070717_104388011 179
411 3300006028 Ga0070717_10737220 Ga0070717_107372201 179
412 3300006028 Ga0070717_10797763 Ga0070717_107977631 179
413 3300006163 Ga0070715_10090801 Ga0070715_100908012 179
414 3300006163 Ga0070715_10208246 Ga0070715_102082461 179
415 3300006173 Ga0070716_100002371 Ga0070716_10000237113 179
416 3300006173 Ga0070716_100005022 Ga0070716_1000050229 179
417 3300006173 Ga0070716_100008488 Ga0070716_1000084886 179
418 3300006173 Ga0070716_100011992 Ga0070716_1000119928 179
419 3300006173 Ga0070716_100269896 Ga0070716_1002698962 179
420 3300006173 Ga0070716_100912795 Ga0070716_1009127951 179
421 3300006175 Ga0070712_100001135 Ga0070712_10000113517 179
422 3300006175 Ga0070712_100003022 Ga0070712_1000030223 179
423 3300006175 Ga0070712_100003121 Ga0070712_10000312118 179
424 3300006175 Ga0070712_100014016 Ga0070712_1000140167 179
425 3300006175 Ga0070712_100041417 Ga0070712_1000414175 179
426 3300006175 Ga0070712_100042924 Ga0070712_1000429245 179
427 3300006175 Ga0070712_100070979 Ga0070712_1000709794 179
428 3300006175 Ga0070712_100084427 Ga0070712_1000844273 179
429 3300006175 Ga0070712_100419504 Ga0070712_1004195042 179
430 3300006175 Ga0070712_100458130 Ga0070712_1004581302 179
431 3300006237 Ga0097621_100003981 Ga0097621_1000039817 179
432 3300006237 Ga0097621_100093410 Ga0097621_1000934102 179
433 3300006237 Ga0097621_100116387 Ga0097621_1001163874 179
434 3300006237 Ga0097621_100126894 Ga0097621_1001268944 179
435 3300006237 Ga0097621_100963700 Ga0097621_1009637002 179
436 3300006358 Ga0068871_100002434 Ga0068871_1000024347 179
437 3300006358 Ga0068871_100014064 Ga0068871_10001406411 179
438 3300006358 Ga0068871_100128640 Ga0068871_1001286404 179
439 3300006358 Ga0068871_100432675 Ga0068871_1004326752 179
440 3300006358 Ga0068871_100794156 Ga0068871_1007941561 179
441 3300006358 Ga0068871_101182818 Ga0068871_1011828181 179
442 3300006852 Ga0075433_10004383 Ga0075433_1000438312 179
443 3300006871 Ga0075434_100000230 Ga0075434_10000023017 179
444 3300006871 Ga0075434_100005131 Ga0075434_1000051313 179
445 3300006871 Ga0075434_100250660 Ga0075434_1002506602 179
446 3300006871 Ga0075434_100412285 Ga0075434_1004122852 179
447 3300006881 Ga0068865_100092191 Ga0068865_1000921914 179
448 3300006881 Ga0068865_100193160 Ga0068865_1001931602 179
449 3300006914 Ga0075436_100016756 Ga0075436_1000167564 179
450 3300006914 Ga0075436_100029891 Ga0075436_1000298915 179
451 3300006914 Ga0075436_100061502 Ga0075436_1000615024 179
452 3300006914 Ga0075436_100135393 Ga0075436_1001353932 179
453 3300006914 Ga0075436_100764400 Ga0075436_1007644001 179
454 3300006931 Ga0097620_100004997 Ga0097620_1000049978 179
455 3300006931 Ga0097620_100025042 Ga0097620_1000250427 179
456 3300006931 Ga0097620_100052889 Ga0097620_1000528896 179
457 3300007076 Ga0075435_100000389 Ga0075435_10000038917 179
458 3300007076 Ga0075435_100058493 Ga0075435_1000584933 179
459 3300007076 Ga0075435_100121043 Ga0075435_1001210433 179
460 3300007265 Ga0099794_10214335 Ga0099794_102143352 179
461 3300007788 Ga0099795_10062777 Ga0099795_100627772 179
462 3300007788 Ga0099795_10157451 Ga0099795_101574511 179
463 3300009011 Ga0105251_10057870 Ga0105251_100578703 179
464 3300009092 Ga0105250_10023011 Ga0105250_100230111 179
465 3300009093 Ga0105240_10012027 Ga0105240_100120278 179
466 3300009093 Ga0105240_10034928 Ga0105240_100349286 179
467 3300009093 Ga0105240_10035504 Ga0105240_100355047 179
468 3300009093 Ga0105240_10047029 Ga0105240_100470296 179
469 3300009093 Ga0105240_10053543 Ga0105240_100535435 179
470 3300009093 Ga0105240_10100771 Ga0105240_101007712 179
471 3300009093 Ga0105240_10141119 Ga0105240_101411195 179
472 3300009093 Ga0105240_10296893 Ga0105240_102968931 179
473 3300009093 Ga0105240_10302837 Ga0105240_103028371 179
474 3300009093 Ga0105240_10322817 Ga0105240_103228172 179
475 3300009093 Ga0105240_10358626 Ga0105240_103586262 179
476 3300009098 Ga0105245_10005029 Ga0105245_1000502914 179
477 3300009098 Ga0105245_10056662 Ga0105245_100566626 179
478 3300009098 Ga0105245_10145384 Ga0105245_101453842 179
479 3300009098 Ga0105245_10435193 Ga0105245_104351932 179
480 3300009098 Ga0105245_10469030 Ga0105245_104690302 179
481 3300009098 Ga0105245_11498076 Ga0105245_114980761 179
482 3300009101 Ga0105247_10365844 Ga0105247_103658441 179
483 3300009101 Ga0105247_10799288 Ga0105247_107992881 179
484 3300009147 Ga0114129_11603170 Ga0114129_116031701 179
485 3300009174 Ga0105241_10128461 Ga0105241_101284613 179
486 3300009174 Ga0105241_10129316 Ga0105241_101293162 179
487 3300009174 Ga0105241_10236511 Ga0105241_102365112 179
488 3300009174 Ga0105241_10262765 Ga0105241_102627653 179
489 3300009174 Ga0105241_10316525 Ga0105241_103165253 179
490 3300009176 Ga0105242_10039591 Ga0105242_100395914 179
491 3300009176 Ga0105242_10714867 Ga0105242_107148671 179
492 3300009177 Ga0105248_10012842 Ga0105248_1001284211 179
493 3300009177 Ga0105248_10038960 Ga0105248_100389605 179
494 3300009177 Ga0105248_10173533 Ga0105248_101735334 179
495 3300009177 Ga0105248_10526138 Ga0105248_105261382 179
496 3300009177 Ga0105248_10583845 Ga0105248_105838452 179
497 3300009545 Ga0105237_10016610 Ga0105237_1001661011 179
498 3300009545 Ga0105237_10054319 Ga0105237_100543195 179
499 3300009545 Ga0105237_10065790 Ga0105237_100657904 179
500 3300009545 Ga0105237_10107038 Ga0105237_101070384 179
501 3300009545 Ga0105237_10387538 Ga0105237_103875381 179
502 3300009545 Ga0105237_10561293 Ga0105237_105612931 179
503 3300009545 Ga0105237_10593947 Ga0105237_105939473 179
504 3300009545 Ga0105237_10621178 Ga0105237_106211782 179
505 3300009545 Ga0105237_11063168 Ga0105237_110631682 179
506 3300009551 Ga0105238_10008485 Ga0105238_100084859 179
507 3300009551 Ga0105238_10010449 Ga0105238_1001044912 179
508 3300009551 Ga0105238_10066071 Ga0105238_100660714 179
509 3300009551 Ga0105238_10126885 Ga0105238_101268855 179
510 3300009551 Ga0105238_10202672 Ga0105238_102026721 179
511 3300009551 Ga0105238_10298399 Ga0105238_102983993 179
512 3300009551 Ga0105238_10364765 Ga0105238_103647652 179
513 3300009551 Ga0105238_10417754 Ga0105238_104177543 179
514 3300009551 Ga0105238_11388050 Ga0105238_113880501 179
515 3300009553 Ga0105249_10025713 Ga0105249_100257132 179
516 3300010159 Ga0099796_10029782 Ga0099796_100297821 179
517 3300010375 Ga0105239_10025912 Ga0105239_100259124 179
518 3300010375 Ga0105239_10048572 Ga0105239_100485721 179
519 3300010375 Ga0105239_10091452 Ga0105239_100914523 179
520 3300010375 Ga0105239_10154599 Ga0105239_101545995 179
521 3300010375 Ga0105239_10598446 Ga0105239_105984462 179
522 3300010375 Ga0105239_10687725 Ga0105239_106877252 179
523 3300010375 Ga0105239_11169263 Ga0105239_111692631 179
524 3300010375 Ga0105239_11837628 Ga0105239_118376281 179
525 3300011119 Ga0105246_10002877 Ga0105246_1000287710 179
526 3300012510 Ga0157316_1000632 Ga0157316_10006324 179
527 3300013100 Ga0157373_10001758 Ga0157373_1000175818 179
528 3300013100 Ga0157373_10044661 Ga0157373_100446614 179
529 3300013100 Ga0157373_10078398 Ga0157373_100783983 179
530 3300013100 Ga0157373_10130215 Ga0157373_101302152 179
531 3300013102 Ga0157371_10002134 Ga0157371_1000213415 179
532 3300013102 Ga0157371_10028935 Ga0157371_100289354 179
533 3300013102 Ga0157371_10067347 Ga0157371_100673473 179
534 3300013102 Ga0157371_10394722 Ga0157371_103947221 179
535 3300013102 Ga0157371_10548911 Ga0157371_105489111 179
536 3300013104 Ga0157370_10011397 Ga0157370_100113976 179
537 3300013104 Ga0157370_10018903 Ga0157370_100189032 179
538 3300013104 Ga0157370_10067964 Ga0157370_100679643 179
539 3300013104 Ga0157370_10132934 Ga0157370_101329342 179
540 3300013104 Ga0157370_10139289 Ga0157370_101392895 179
541 3300013104 Ga0157370_10172973 Ga0157370_101729732 179
542 3300013104 Ga0157370_10182358 Ga0157370_101823584 179
543 3300013104 Ga0157370_10201993 Ga0157370_102019933 179
544 3300013104 Ga0157370_10221248 Ga0157370_102212482 179
545 3300013104 Ga0157370_10290790 Ga0157370_102907901 179
546 3300013104 Ga0157370_10338474 Ga0157370_103384742 179
547 3300013104 Ga0157370_10814191 Ga0157370_108141911 179
548 3300013104 Ga0157370_10827233 Ga0157370_108272331 179
549 3300013105 Ga0157369_10002709 Ga0157369_1000270914 179
550 3300013105 Ga0157369_10007208 Ga0157369_100072087 179
551 3300013105 Ga0157369_10010526 Ga0157369_100105267 179
552 3300013105 Ga0157369_10019707 Ga0157369_1001970711 179
553 3300013105 Ga0157369_10026263 Ga0157369_100262637 179
554 3300013105 Ga0157369_10034092 Ga0157369_100340924 179
555 3300013105 Ga0157369_10056103 Ga0157369_100561039 179
556 3300013105 Ga0157369_10061489 Ga0157369_100614893 179
557 3300013105 Ga0157369_10067149 Ga0157369_100671492 179
558 3300013105 Ga0157369_10132317 Ga0157369_101323172 179
559 3300013105 Ga0157369_10147068 Ga0157369_101470681 179
560 3300013105 Ga0157369_10227491 Ga0157369_102274912 179
561 3300013105 Ga0157369_10467087 Ga0157369_104670872 179
562 3300013105 Ga0157369_10581343 Ga0157369_105813432 179
563 3300013105 Ga0157369_10658438 Ga0157369_106584381 179
564 3300013105 Ga0157369_10663909 Ga0157369_106639092 179
565 3300013105 Ga0157369_10715850 Ga0157369_107158502 179
566 3300013105 Ga0157369_10881813 Ga0157369_108818131 179
567 3300013105 Ga0157369_11347516 Ga0157369_113475162 179
568 3300013296 Ga0157374_10002644 Ga0157374_100026447 179
569 3300013296 Ga0157374_10004729 Ga0157374_1000472916 179
570 3300013296 Ga0157374_10012759 Ga0157374_100127597 179
571 3300013296 Ga0157374_10029721 Ga0157374_100297215 179
572 3300013296 Ga0157374_10098916 Ga0157374_100989163 179
573 3300013296 Ga0157374_10116889 Ga0157374_101168893 179
574 3300013296 Ga0157374_10191854 Ga0157374_101918543 179
575 3300013296 Ga0157374_10216762 Ga0157374_102167622 179
576 3300013296 Ga0157374_10271748 Ga0157374_102717484 179
577 3300013296 Ga0157374_10471434 Ga0157374_104714342 179
578 3300013296 Ga0157374_10548061 Ga0157374_105480612 179
579 3300013296 Ga0157374_10812712 Ga0157374_108127122 179
580 3300013297 Ga0157378_10000411 Ga0157378_1000041138 179
581 3300013297 Ga0157378_10007199 Ga0157378_1000719917 179
582 3300013297 Ga0157378_10077880 Ga0157378_100778803 179
583 3300013297 Ga0157378_10081386 Ga0157378_100813865 179
584 3300013297 Ga0157378_10095497 Ga0157378_100954972 179
585 3300013306 Ga0163162_10004959 Ga0163162_1000495918 179
586 3300013306 Ga0163162_10015114 Ga0163162_1001511410 179
587 3300013306 Ga0163162_10102120 Ga0163162_101021206 179
588 3300013306 Ga0163162_10314903 Ga0163162_103149032 179
589 3300013306 Ga0163162_10896137 Ga0163162_108961372 179
590 3300013306 Ga0163162_11481496 Ga0163162_114814961 179
591 3300013307 Ga0157372_10002154 Ga0157372_1000215416 179
592 3300013307 Ga0157372_10003780 Ga0157372_1000378011 179
593 3300013307 Ga0157372_10006080 Ga0157372_100060807 179
594 3300013307 Ga0157372_10006518 Ga0157372_1000651812 179
595 3300013307 Ga0157372_10006630 Ga0157372_1000663018 179
596 3300013307 Ga0157372_10009293 Ga0157372_1000929311 179
597 3300013307 Ga0157372_10019768 Ga0157372_100197684 179
598 3300013307 Ga0157372_10026028 Ga0157372_100260285 179
599 3300013307 Ga0157372_10038610 Ga0157372_100386102 179
600 3300013307 Ga0157372_10044504 Ga0157372_100445044 179
601 3300013307 Ga0157372_10065258 Ga0157372_100652587 179
602 3300013307 Ga0157372_10091572 Ga0157372_100915724 179
603 3300013307 Ga0157372_10143192 Ga0157372_101431922 179
604 3300013307 Ga0157372_10175031 Ga0157372_101750314 179
605 3300013307 Ga0157372_10180231 Ga0157372_101802315 179
606 3300013307 Ga0157372_10234738 Ga0157372_102347382 179
607 3300013307 Ga0157372_10254737 Ga0157372_102547373 179
608 3300013307 Ga0157372_10391392 Ga0157372_103913922 179
609 3300013307 Ga0157372_10649390 Ga0157372_106493902 179
610 3300013307 Ga0157372_10855642 Ga0157372_108556422 179
611 3300013308 Ga0157375_10067349 Ga0157375_100673491 179
612 3300013308 Ga0157375_10383709 Ga0157375_103837092 179
613 3300014325 Ga0163163_10001073 Ga0163163_1000107318 179
614 3300014325 Ga0163163_10019000 Ga0163163_100190005 179
615 3300014325 Ga0163163_10029803 Ga0163163_100298036 179
616 3300014325 Ga0163163_10079257 Ga0163163_100792573 179
617 3300014325 Ga0163163_10202428 Ga0163163_102024282 179
618 3300014325 Ga0163163_11661078 Ga0163163_116610782 179
619 3300014326 Ga0157380_10385863 Ga0157380_103858632 179
620 3300014497 Ga0182008_10176853 Ga0182008_101768532 179
621 3300014745 Ga0157377_10000768 Ga0157377_1000076814 179
622 3300014968 Ga0157379_10005366 Ga0157379_100053669 179
623 3300014968 Ga0157379_10127587 Ga0157379_101275874 179
624 3300014968 Ga0157379_10279496 Ga0157379_102794961 179
625 3300014968 Ga0157379_10374044 Ga0157379_103740442 179
626 3300014969 Ga0157376_10013365 Ga0157376_100133655 179
627 3300014969 Ga0157376_10036861 Ga0157376_100368619 179
628 3300014969 Ga0157376_10136499 Ga0157376_101364993 179
629 3300014969 Ga0157376_10278213 Ga0157376_102782133 179
630 3300014969 Ga0157376_10326768 Ga0157376_103267682 179
631 3300014969 Ga0157376_10329232 Ga0157376_103292322 179
632 3300014969 Ga0157376_10566170 Ga0157376_105661703 179
633 3300015262 Ga0182007_10007161 Ga0182007_1000716110 179
634 3300015262 Ga0182007_10019430 Ga0182007_100194304 179
635 3300017792 Ga0163161_10001969 Ga0163161_1000196917 179
636 3300020069 Ga0197907_10188899 Ga0197907_101888992 179
637 3300020070 Ga0206356_11033402 Ga0206356_110334022 179
638 3300020070 Ga0206356_11150814 Ga0206356_111508144 179
639 3300020070 Ga0206356_11911989 Ga0206356_119119891 179
640 3300020077 Ga0206351_10594957 Ga0206351_105949571 179
641 3300020077 Ga0206351_10697094 Ga0206351_106970942 179
642 3300020078 Ga0206352_11017623 Ga0206352_110176231 179
643 3300020610 Ga0154015_1458189 Ga0154015_14581893 179
644 3300021358 Ga0213873_10010893 Ga0213873_100108932 179
645 3300021358 Ga0213873_10045123 Ga0213873_100451231 179
646 3300021361 Ga0213872_10005926 Ga0213872_100059266 179
647 3300021361 Ga0213872_10036555 Ga0213872_100365553 179
648 3300021361 Ga0213872_10071028 Ga0213872_100710283 179
649 3300021384 Ga0213876_10059471 Ga0213876_100594713 179
650 3300021441 Ga0213871_10001697 Ga0213871_100016976 179
651 3300024225 Ga0224572_1010023 Ga0224572_10100232 179
652 3300024227 Ga0228598_1000213 Ga0228598_10002136 179
653 3300024227 Ga0228598_1004557 Ga0228598_10045575 179
654 3300024227 Ga0228598_1023917 Ga0228598_10239172 179
655 3300024227 Ga0228598_1039992 Ga0228598_10399921 179
656 3300024227 Ga0228598_1052680 Ga0228598_10526802 179
657 3300024227 Ga0228598_1065210 Ga0228598_10652101 179
658 3300025315 Ga0207697_10022130 Ga0207697_100221302 179
659 3300025321 Ga0207656_10062996 Ga0207656_100629962 179
660 3300025321 Ga0207656_10202725 Ga0207656_102027252 179
661 3300025893 Ga0207682_10088512 Ga0207682_100885122 179
662 3300025898 Ga0207692_10010928 Ga0207692_100109283 179
663 3300025898 Ga0207692_10021825 Ga0207692_100218252 179
664 3300025898 Ga0207692_10022746 Ga0207692_100227461 179
665 3300025898 Ga0207692_10131491 Ga0207692_101314912 179
666 3300025898 Ga0207692_10183179 Ga0207692_101831791 179
667 3300025898 Ga0207692_10617727 Ga0207692_106177271 179
668 3300025898 Ga0207692_10630005 Ga0207692_106300051 179
669 3300025898 Ga0207692_10722914 Ga0207692_107229141 179
670 3300025899 Ga0207642_10006053 Ga0207642_100060531 179
671 3300025900 Ga0207710_10040621 Ga0207710_100406212 179
672 3300025903 Ga0207680_10001756 Ga0207680_100017569 179
673 3300025903 Ga0207680_10408273 Ga0207680_104082732 179
674 3300025904 Ga0207647_10001343 Ga0207647_100013437 179
675 3300025904 Ga0207647_10004892 Ga0207647_100048923 179
676 3300025904 Ga0207647_10010629 Ga0207647_100106295 179
677 3300025904 Ga0207647_10027808 Ga0207647_100278085 179
678 3300025904 Ga0207647_10045399 Ga0207647_100453995 179
679 3300025905 Ga0207685_10036068 Ga0207685_100360682 179
680 3300025906 Ga0207699_10001057 Ga0207699_100010576 179
681 3300025906 Ga0207699_10061772 Ga0207699_100617722 179
682 3300025906 Ga0207699_10061912 Ga0207699_100619122 179
683 3300025906 Ga0207699_10070896 Ga0207699_100708964 179
684 3300025906 Ga0207699_10115868 Ga0207699_101158682 179
685 3300025906 Ga0207699_10292669 Ga0207699_102926692 179
686 3300025906 Ga0207699_10301783 Ga0207699_103017831 179
687 3300025906 Ga0207699_10343944 Ga0207699_103439442 179
688 3300025906 Ga0207699_10465683 Ga0207699_104656832 179
689 3300025906 Ga0207699_10559189 Ga0207699_105591891 179
690 3300025906 Ga0207699_10625560 Ga0207699_106255601 179
691 3300025906 Ga0207699_10714059 Ga0207699_107140592 179
692 3300025907 Ga0207645_10001180 Ga0207645_1000118017 179
693 3300025908 Ga0207643_10001067 Ga0207643_1000106714 179
694 3300025909 Ga0207705_10000048 Ga0207705_10000048154 179
695 3300025909 Ga0207705_10003420 Ga0207705_100034202 179
696 3300025909 Ga0207705_10010050 Ga0207705_100100509 179
697 3300025909 Ga0207705_10011122 Ga0207705_100111224 179
698 3300025909 Ga0207705_10026211 Ga0207705_100262116 179
699 3300025909 Ga0207705_10127864 Ga0207705_101278641 179
700 3300025909 Ga0207705_10659683 Ga0207705_106596831 179
701 3300025910 Ga0207684_10001048 Ga0207684_1000104816 179
702 3300025910 Ga0207684_10100158 Ga0207684_101001584 179
703 3300025910 Ga0207684_10140403 Ga0207684_101404032 179
704 3300025910 Ga0207684_10261602 Ga0207684_102616021 179
705 3300025910 Ga0207684_10341969 Ga0207684_103419692 179
706 3300025911 Ga0207654_10004384 Ga0207654_100043848 179
707 3300025911 Ga0207654_10046119 Ga0207654_100461194 179
708 3300025911 Ga0207654_10104320 Ga0207654_101043202 179
709 3300025911 Ga0207654_10154447 Ga0207654_101544472 179
710 3300025911 Ga0207654_10234524 Ga0207654_102345242 179
711 3300025911 Ga0207654_10883479 Ga0207654_108834791 179
712 3300025912 Ga0207707_10003207 Ga0207707_1000320720 179
713 3300025912 Ga0207707_10015255 Ga0207707_100152558 179
714 3300025912 Ga0207707_10021611 Ga0207707_100216111 179
715 3300025912 Ga0207707_10022616 Ga0207707_1002261610 179
716 3300025912 Ga0207707_10157685 Ga0207707_101576853 179
717 3300025912 Ga0207707_10257589 Ga0207707_102575892 179
718 3300025912 Ga0207707_10486123 Ga0207707_104861232 179
719 3300025912 Ga0207707_10559289 Ga0207707_105592891 179
720 3300025912 Ga0207707_10716203 Ga0207707_107162032 179
721 3300025912 Ga0207707_10748556 Ga0207707_107485562 179
722 3300025912 Ga0207707_10772216 Ga0207707_107722161 179
723 3300025912 Ga0207707_10784393 Ga0207707_107843931 179
724 3300025912 Ga0207707_11257682 Ga0207707_112576821 179
725 3300025913 Ga0207695_10000354 Ga0207695_1000035493 179
726 3300025913 Ga0207695_10008453 Ga0207695_1000845310 179
727 3300025913 Ga0207695_10020062 Ga0207695_1002006211 179
728 3300025913 Ga0207695_10061065 Ga0207695_100610655 179
729 3300025913 Ga0207695_10069308 Ga0207695_100693086 179
730 3300025913 Ga0207695_10103382 Ga0207695_101033822 179
731 3300025913 Ga0207695_10119085 Ga0207695_101190851 179
732 3300025913 Ga0207695_10162633 Ga0207695_101626331 179
733 3300025913 Ga0207695_10173594 Ga0207695_101735944 179
734 3300025913 Ga0207695_10324544 Ga0207695_103245443 179
735 3300025913 Ga0207695_10402171 Ga0207695_104021713 179
736 3300025914 Ga0207671_10047140 Ga0207671_100471403 179
737 3300025914 Ga0207671_10104506 Ga0207671_101045065 179
738 3300025914 Ga0207671_10157516 Ga0207671_101575164 179
739 3300025914 Ga0207671_10320620 Ga0207671_103206203 179
740 3300025914 Ga0207671_10332247 Ga0207671_103322472 179
741 3300025914 Ga0207671_10393269 Ga0207671_103932692 179
742 3300025914 Ga0207671_10409581 Ga0207671_104095811 179
743 3300025915 Ga0207693_10000026 Ga0207693_1000002677 179
744 3300025915 Ga0207693_10001260 Ga0207693_1000126018 179
745 3300025915 Ga0207693_10004232 Ga0207693_1000423212 179
746 3300025915 Ga0207693_10010928 Ga0207693_1001092810 179
747 3300025915 Ga0207693_10022595 Ga0207693_100225956 179
748 3300025915 Ga0207693_10024361 Ga0207693_100243613 179
749 3300025915 Ga0207693_10124058 Ga0207693_101240581 179
750 3300025915 Ga0207693_10295618 Ga0207693_102956182 179
751 3300025915 Ga0207693_10635181 Ga0207693_106351811 179
752 3300025916 Ga0207663_10003762 Ga0207663_1000376211 179
753 3300025916 Ga0207663_10010349 Ga0207663_100103499 179
754 3300025916 Ga0207663_10022519 Ga0207663_100225196 179
755 3300025916 Ga0207663_10038998 Ga0207663_100389985 179
756 3300025916 Ga0207663_10102146 Ga0207663_101021464 179
757 3300025916 Ga0207663_10108867 Ga0207663_101088673 179
758 3300025916 Ga0207663_10147982 Ga0207663_101479823 179
759 3300025916 Ga0207663_10513353 Ga0207663_105133532 179
760 3300025916 Ga0207663_10809406 Ga0207663_108094061 179
761 3300025917 Ga0207660_10042248 Ga0207660_100422486 179
762 3300025917 Ga0207660_10048721 Ga0207660_100487215 179
763 3300025917 Ga0207660_10124239 Ga0207660_101242392 179
764 3300025917 Ga0207660_10157369 Ga0207660_101573693 179
765 3300025917 Ga0207660_10288652 Ga0207660_102886522 179
766 3300025917 Ga0207660_10356671 Ga0207660_103566711 179
767 3300025917 Ga0207660_10520687 Ga0207660_105206871 179
768 3300025917 Ga0207660_10664913 Ga0207660_106649131 179
769 3300025918 Ga0207662_10014118 Ga0207662_100141183 179
770 3300025919 Ga0207657_10000823 Ga0207657_100008232 179
771 3300025919 Ga0207657_10004069 Ga0207657_1000406918 179
772 3300025919 Ga0207657_10006426 Ga0207657_100064269 179
773 3300025919 Ga0207657_10008913 Ga0207657_100089136 179
774 3300025919 Ga0207657_10030982 Ga0207657_1003098210 179
775 3300025919 Ga0207657_10032755 Ga0207657_100327554 179
776 3300025919 Ga0207657_10034060 Ga0207657_100340606 179
777 3300025919 Ga0207657_10772354 Ga0207657_107723541 179
778 3300025920 Ga0207649_10001087 Ga0207649_1000108718 179
779 3300025920 Ga0207649_10007381 Ga0207649_100073819 179
780 3300025920 Ga0207649_10064871 Ga0207649_100648712 179
781 3300025920 Ga0207649_10192914 Ga0207649_101929143 179
782 3300025920 Ga0207649_10361651 Ga0207649_103616512 179
783 3300025921 Ga0207652_10006800 Ga0207652_100068005 179
784 3300025921 Ga0207652_10018101 Ga0207652_1001810111 179
785 3300025921 Ga0207652_10029215 Ga0207652_100292156 179
786 3300025921 Ga0207652_10037568 Ga0207652_100375686 179
787 3300025921 Ga0207652_10043417 Ga0207652_100434176 179
788 3300025921 Ga0207652_10078648 Ga0207652_100786485 179
789 3300025921 Ga0207652_10117175 Ga0207652_101171752 179
790 3300025921 Ga0207652_10214304 Ga0207652_102143042 179
791 3300025921 Ga0207652_10275340 Ga0207652_102753403 179
792 3300025921 Ga0207652_10277036 Ga0207652_102770362 179
793 3300025921 Ga0207652_10737817 Ga0207652_107378172 179
794 3300025921 Ga0207652_10841930 Ga0207652_108419301 179
795 3300025921 Ga0207652_10883182 Ga0207652_108831821 179
796 3300025921 Ga0207652_11184148 Ga0207652_111841481 179
797 3300025922 Ga0207646_10001230 Ga0207646_1000123018 179
798 3300025922 Ga0207646_10048482 Ga0207646_100484822 179
799 3300025922 Ga0207646_10108960 Ga0207646_101089602 179
800 3300025922 Ga0207646_10131348 Ga0207646_101313483 179
801 3300025922 Ga0207646_10499856 Ga0207646_104998562 179
802 3300025922 Ga0207646_10877542 Ga0207646_108775421 179
803 3300025922 Ga0207646_11208012 Ga0207646_112080121 179
804 3300025923 Ga0207681_10009111 Ga0207681_100091116 179
805 3300025924 Ga0207694_10000718 Ga0207694_1000071814 179
806 3300025924 Ga0207694_10012007 Ga0207694_100120073 179
807 3300025924 Ga0207694_10123061 Ga0207694_101230611 179
808 3300025924 Ga0207694_10124313 Ga0207694_101243133 179
809 3300025924 Ga0207694_10138742 Ga0207694_101387423 179
810 3300025924 Ga0207694_10422291 Ga0207694_104222911 179
811 3300025925 Ga0207650_10000152 Ga0207650_1000015263 179
812 3300025925 Ga0207650_10011553 Ga0207650_100115537 179
813 3300025925 Ga0207650_10168792 Ga0207650_101687922 179
814 3300025926 Ga0207659_10003498 Ga0207659_100034988 179
815 3300025927 Ga0207687_10010238 Ga0207687_100102386 179
816 3300025927 Ga0207687_10032442 Ga0207687_100324424 179
817 3300025927 Ga0207687_10033504 Ga0207687_100335046 179
818 3300025927 Ga0207687_10299949 Ga0207687_102999491 179
819 3300025927 Ga0207687_10328047 Ga0207687_103280472 179
820 3300025927 Ga0207687_10702802 Ga0207687_107028021 179
821 3300025928 Ga0207700_10003657 Ga0207700_100036574 179
822 3300025928 Ga0207700_10004902 Ga0207700_1000490213 179
823 3300025928 Ga0207700_10004917 Ga0207700_100049173 179
824 3300025928 Ga0207700_10007967 Ga0207700_1000796712 179
825 3300025928 Ga0207700_10014117 Ga0207700_100141175 179
826 3300025928 Ga0207700_10029324 Ga0207700_100293243 179
827 3300025928 Ga0207700_10044708 Ga0207700_100447082 179
828 3300025928 Ga0207700_10066919 Ga0207700_100669192 179
829 3300025928 Ga0207700_10098680 Ga0207700_100986805 179
830 3300025928 Ga0207700_10104195 Ga0207700_101041954 179
831 3300025928 Ga0207700_10223706 Ga0207700_102237062 179
832 3300025928 Ga0207700_10233600 Ga0207700_102336001 179
833 3300025928 Ga0207700_10243314 Ga0207700_102433142 179
834 3300025928 Ga0207700_10429566 Ga0207700_104295662 179
835 3300025928 Ga0207700_10433482 Ga0207700_104334822 179
836 3300025928 Ga0207700_10667836 Ga0207700_106678361 179
837 3300025928 Ga0207700_10701653 Ga0207700_107016532 179
838 3300025928 Ga0207700_10868688 Ga0207700_108686881 179
839 3300025929 Ga0207664_10000087 Ga0207664_1000008776 179
840 3300025929 Ga0207664_10001347 Ga0207664_100013478 179
841 3300025929 Ga0207664_10016919 Ga0207664_100169197 179
842 3300025929 Ga0207664_10031301 Ga0207664_100313011 179
843 3300025929 Ga0207664_10033569 Ga0207664_100335696 179
844 3300025929 Ga0207664_10048949 Ga0207664_100489494 179
845 3300025929 Ga0207664_10067012 Ga0207664_100670123 179
846 3300025929 Ga0207664_10080683 Ga0207664_100806833 179
847 3300025929 Ga0207664_10130918 Ga0207664_101309182 179
848 3300025929 Ga0207664_10160449 Ga0207664_101604492 179
849 3300025929 Ga0207664_10312791 Ga0207664_103127912 179
850 3300025929 Ga0207664_10351107 Ga0207664_103511072 179
851 3300025929 Ga0207664_10362962 Ga0207664_103629622 179
852 3300025929 Ga0207664_10511284 Ga0207664_105112841 179
853 3300025929 Ga0207664_10597368 Ga0207664_105973681 179
854 3300025929 Ga0207664_11092752 Ga0207664_110927521 179
855 3300025929 Ga0207664_11370650 Ga0207664_113706501 179
856 3300025931 Ga0207644_10003335 Ga0207644_100033359 179
857 3300025931 Ga0207644_10018963 Ga0207644_1001896310 179
858 3300025931 Ga0207644_10246619 Ga0207644_102466191 179
859 3300025931 Ga0207644_10783482 Ga0207644_107834821 179
860 3300025932 Ga0207690_10007754 Ga0207690_100077546 179
861 3300025932 Ga0207690_10087591 Ga0207690_100875912 179
862 3300025932 Ga0207690_10164156 Ga0207690_101641563 179
863 3300025932 Ga0207690_10447898 Ga0207690_104478982 179
864 3300025933 Ga0207706_10000740 Ga0207706_1000074018 179
865 3300025933 Ga0207706_10036070 Ga0207706_100360709 179
866 3300025934 Ga0207686_10058693 Ga0207686_100586932 179
867 3300025934 Ga0207686_10088097 Ga0207686_100880975 179
868 3300025934 Ga0207686_10500582 Ga0207686_105005821 179
869 3300025935 Ga0207709_10234082 Ga0207709_102340822 179
870 3300025936 Ga0207670_10003610 Ga0207670_1000361011 179
871 3300025937 Ga0207669_10019910 Ga0207669_100199102 179
872 3300025938 Ga0207704_10193692 Ga0207704_101936922 179
873 3300025938 Ga0207704_10221557 Ga0207704_102215572 179
874 3300025938 Ga0207704_10278889 Ga0207704_102788893 179
875 3300025939 Ga0207665_10002747 Ga0207665_100027478 179
876 3300025939 Ga0207665_10003202 Ga0207665_1000320217 179
877 3300025939 Ga0207665_10029458 Ga0207665_100294585 179
878 3300025939 Ga0207665_10055867 Ga0207665_100558674 179
879 3300025939 Ga0207665_10097056 Ga0207665_100970563 179
880 3300025939 Ga0207665_10113990 Ga0207665_101139902 179
881 3300025939 Ga0207665_10146703 Ga0207665_101467032 179
882 3300025939 Ga0207665_10207781 Ga0207665_102077813 179
883 3300025939 Ga0207665_10255135 Ga0207665_102551352 179
884 3300025940 Ga0207691_10000308 Ga0207691_1000030838 179
885 3300025941 Ga0207711_10003068 Ga0207711_1000306814 179
886 3300025941 Ga0207711_10079592 Ga0207711_100795924 179
887 3300025941 Ga0207711_10114604 Ga0207711_101146044 179
888 3300025941 Ga0207711_11246246 Ga0207711_112462461 179
889 3300025942 Ga0207689_10000618 Ga0207689_1000061818 179
890 3300025942 Ga0207689_10005608 Ga0207689_1000560815 179
891 3300025942 Ga0207689_10013637 Ga0207689_1001363710 179
892 3300025942 Ga0207689_10080568 Ga0207689_100805683 179
893 3300025942 Ga0207689_11126913 Ga0207689_111269131 179
894 3300025944 Ga0207661_10005431 Ga0207661_1000543117 179
895 3300025944 Ga0207661_10027213 Ga0207661_100272135 179
896 3300025944 Ga0207661_10093846 Ga0207661_100938463 179
897 3300025944 Ga0207661_10128605 Ga0207661_101286052 179
898 3300025944 Ga0207661_10220676 Ga0207661_102206762 179
899 3300025944 Ga0207661_10250896 Ga0207661_102508961 179
900 3300025944 Ga0207661_10272124 Ga0207661_102721242 179
901 3300025945 Ga0207679_10000298 Ga0207679_1000029818 179
902 3300025945 Ga0207679_10020299 Ga0207679_100202992 179
903 3300025945 Ga0207679_10192600 Ga0207679_101926002 179
904 3300025945 Ga0207679_10240152 Ga0207679_102401523 179
905 3300025945 Ga0207679_10253420 Ga0207679_102534203 179
906 3300025945 Ga0207679_10381471 Ga0207679_103814712 179
907 3300025949 Ga0207667_10000647 Ga0207667_1000064737 179
908 3300025949 Ga0207667_10008444 Ga0207667_1000844415 179
909 3300025949 Ga0207667_10010059 Ga0207667_1001005915 179
910 3300025949 Ga0207667_10012686 Ga0207667_100126863 179
911 3300025949 Ga0207667_10027233 Ga0207667_100272332 179
912 3300025949 Ga0207667_10052653 Ga0207667_100526539 179
913 3300025949 Ga0207667_10053868 Ga0207667_100538683 179
914 3300025949 Ga0207667_10055132 Ga0207667_100551325 179
915 3300025949 Ga0207667_10056921 Ga0207667_100569212 179
916 3300025949 Ga0207667_10063092 Ga0207667_100630927 179
917 3300025949 Ga0207667_10069452 Ga0207667_100694522 179
918 3300025949 Ga0207667_10125234 Ga0207667_101252342 179
919 3300025949 Ga0207667_10407681 Ga0207667_104076812 179
920 3300025949 Ga0207667_10851023 Ga0207667_108510231 179
921 3300025960 Ga0207651_10003558 Ga0207651_1000355810 179
922 3300025960 Ga0207651_10059300 Ga0207651_100593002 179
923 3300025972 Ga0207668_10003732 Ga0207668_1000373217 179
924 3300025981 Ga0207640_10000023 Ga0207640_1000002318 179
925 3300025981 Ga0207640_10006598 Ga0207640_100065985 179
926 3300025981 Ga0207640_10074705 Ga0207640_100747054 179
927 3300025981 Ga0207640_10152854 Ga0207640_101528542 179
928 3300025981 Ga0207640_10335980 Ga0207640_103359802 179
929 3300025981 Ga0207640_10350430 Ga0207640_103504302 179
930 3300025986 Ga0207658_10003391 Ga0207658_1000339113 179
931 3300026023 Ga0207677_10004281 Ga0207677_1000428112 179
932 3300026023 Ga0207677_10007921 Ga0207677_100079216 179
933 3300026023 Ga0207677_10156544 Ga0207677_101565443 179
934 3300026023 Ga0207677_10366347 Ga0207677_103663472 179
935 3300026023 Ga0207677_11363560 Ga0207677_113635601 179
936 3300026035 Ga0207703_10003490 Ga0207703_100034909 179
937 3300026035 Ga0207703_10007555 Ga0207703_100075558 179
938 3300026035 Ga0207703_10040353 Ga0207703_100403532 179
939 3300026035 Ga0207703_10211859 Ga0207703_102118594 179
940 3300026041 Ga0207639_10000034 Ga0207639_1000003475 179
941 3300026041 Ga0207639_10003445 Ga0207639_1000344512 179
942 3300026041 Ga0207639_10014728 Ga0207639_100147287 179
943 3300026041 Ga0207639_10078850 Ga0207639_100788504 179
944 3300026041 Ga0207639_10350814 Ga0207639_103508143 179
945 3300026041 Ga0207639_11010044 Ga0207639_110100441 179
946 3300026067 Ga0207678_10001665 Ga0207678_100016652 179
947 3300026067 Ga0207678_10003018 Ga0207678_1000301812 179
948 3300026067 Ga0207678_10004699 Ga0207678_100046992 179
949 3300026067 Ga0207678_10009514 Ga0207678_1000951411 179
950 3300026067 Ga0207678_10047402 Ga0207678_100474026 179
951 3300026067 Ga0207678_10096718 Ga0207678_100967185 179
952 3300026067 Ga0207678_10210609 Ga0207678_102106092 179
953 3300026067 Ga0207678_10216481 Ga0207678_102164812 179
954 3300026078 Ga0207702_10000089 Ga0207702_1000008998 179
955 3300026078 Ga0207702_10003851 Ga0207702_1000385112 179
956 3300026078 Ga0207702_10015006 Ga0207702_100150069 179
957 3300026078 Ga0207702_10020039 Ga0207702_100200394 179
958 3300026078 Ga0207702_10107599 Ga0207702_101075994 179
959 3300026078 Ga0207702_10151539 Ga0207702_101515392 179
960 3300026078 Ga0207702_10184697 Ga0207702_101846972 179
961 3300026078 Ga0207702_10188956 Ga0207702_101889561 179
962 3300026078 Ga0207702_10271313 Ga0207702_102713132 179
963 3300026078 Ga0207702_10353085 Ga0207702_103530851 179
964 3300026078 Ga0207702_10946076 Ga0207702_109460762 179
965 3300026078 Ga0207702_11273516 Ga0207702_112735161 179
966 3300026078 Ga0207702_11435462 Ga0207702_114354621 179
967 3300026088 Ga0207641_10000052 Ga0207641_1000005217 179
968 3300026088 Ga0207641_10020552 Ga0207641_100205528 179
969 3300026088 Ga0207641_10187417 Ga0207641_101874172 179
970 3300026088 Ga0207641_10190029 Ga0207641_101900294 179
971 3300026088 Ga0207641_10479022 Ga0207641_104790221 179
972 3300026089 Ga0207648_10003962 Ga0207648_1000396218 179
973 3300026089 Ga0207648_10038306 Ga0207648_100383068 179
974 3300026089 Ga0207648_10136322 Ga0207648_101363223 179
975 3300026089 Ga0207648_10240044 Ga0207648_102400442 179
976 3300026095 Ga0207676_10000176 Ga0207676_1000017644 179
977 3300026095 Ga0207676_10009926 Ga0207676_100099264 179
978 3300026095 Ga0207676_10012745 Ga0207676_100127456 179
979 3300026116 Ga0207674_10000532 Ga0207674_1000053218 179
980 3300026116 Ga0207674_10000561 Ga0207674_1000056138 179
981 3300026116 Ga0207674_10027883 Ga0207674_100278836 179
982 3300026116 Ga0207674_10043009 Ga0207674_1004300910 179
983 3300026116 Ga0207674_10046610 Ga0207674_100466106 179
984 3300026116 Ga0207674_10078543 Ga0207674_100785431 179
985 3300026116 Ga0207674_10884004 Ga0207674_108840041 179
986 3300026118 Ga0207675_100005443 Ga0207675_10000544314 179
987 3300026118 Ga0207675_100257479 Ga0207675_1002574792 179
988 3300026118 Ga0207675_100961520 Ga0207675_1009615202 179
989 3300026121 Ga0207683_10001978 Ga0207683_1000197815 179
990 3300026121 Ga0207683_10138605 Ga0207683_101386053 179
991 3300026121 Ga0207683_10407481 Ga0207683_104074812 179
992 3300026121 Ga0207683_10497124 Ga0207683_104971241 179
993 3300026142 Ga0207698_10022723 Ga0207698_100227239 179
994 3300026142 Ga0207698_10028624 Ga0207698_100286242 179
995 3300026142 Ga0207698_10073933 Ga0207698_100739332 179
996 3300026142 Ga0207698_10091285 Ga0207698_100912852 179
997 3300026142 Ga0207698_10106129 Ga0207698_101061294 179
998 3300026142 Ga0207698_10246463 Ga0207698_102464633 179
999 3300026142 Ga0207698_11001562 Ga0207698_110015621 179
1000 3300026142 Ga0207698_11333394 Ga0207698_113333941 179
1001 3300028023 Ga0265357_1030644 Ga0265357_10306441 179
1002 3300028379 Ga0268266_10001266 Ga0268266_1000126629 179
1003 3300028379 Ga0268266_10007930 Ga0268266_100079306 179
1004 3300028379 Ga0268266_10016988 Ga0268266_100169888 179
1005 3300028379 Ga0268266_10167538 Ga0268266_101675384 179
1006 3300028379 Ga0268266_10222281 Ga0268266_102222812 179
1007 3300028379 Ga0268266_10516704 Ga0268266_105167042 179
1008 3300028380 Ga0268265_10008088 Ga0268265_100080885 179
1009 3300028380 Ga0268265_10044241 Ga0268265_100442416 179
1010 3300028381 Ga0268264_10005269 Ga0268264_100052699 179
1011 3300028381 Ga0268264_10032165 Ga0268264_100321657 179
1012 3300028381 Ga0268264_10096016 Ga0268264_100960165 179
1013 3300028800 Ga0265338_10002857 Ga0265338_1000285717 179
1014 3300028800 Ga0265338_10006873 Ga0265338_1000687317 179
1015 3300028800 Ga0265338_10034000 Ga0265338_1003400010 179
1016 3300028800 Ga0265338_10187655 Ga0265338_101876553 179
1017 3300028800 Ga0265338_10245571 Ga0265338_102455713 179
1018 3300028800 Ga0265338_10292794 Ga0265338_102927942 179
1019 3300028800 Ga0265338_10516512 Ga0265338_105165122 179
1020 3300030760 Ga0265762_1001564 Ga0265762_10015642 179
1021 3300030760 Ga0265762_1004830 Ga0265762_10048301 179
1022 3300030760 Ga0265762_1008888 Ga0265762_10088882 179
1023 3300030760 Ga0265762_1020576 Ga0265762_10205763 179
1024 3300030836 Ga0265767_100325 Ga0265767_1003253 179
1025 3300030863 Ga0265766_1000256 Ga0265766_10002561 179
1026 3300030879 Ga0265765_1013810 Ga0265765_10138101 179
1027 3300031090 Ga0265760_10004716 Ga0265760_100047164 179
1028 3300031090 Ga0265760_10008145 Ga0265760_100081453 179
1029 3300031090 Ga0265760_10008596 Ga0265760_100085963 179
1030 3300031090 Ga0265760_10044123 Ga0265760_100441233 179
1031 3300031090 Ga0265760_10111409 Ga0265760_101114092 179
1032 3300031235 Ga0265330_10006073 Ga0265330_100060734 179
1033 3300031235 Ga0265330_10089825 Ga0265330_100898252 179
1034 3300031235 Ga0265330_10228195 Ga0265330_102281951 179
1035 3300031235 Ga0265330_10298257 Ga0265330_102982571 179
1036 3300031238 Ga0265332_10042089 Ga0265332_100420894 179
1037 3300031238 Ga0265332_10160382 Ga0265332_101603821 179
1038 3300031239 Ga0265328_10014015 Ga0265328_100140154 179
1039 3300031241 Ga0265325_10023495 Ga0265325_100234951 179
1040 3300031247 Ga0265340_10070349 Ga0265340_100703493 179
1041 3300031247 Ga0265340_10157001 Ga0265340_101570011 179
1042 3300031247 Ga0265340_10195677 Ga0265340_101956771 179
1043 3300031247 Ga0265340_10197484 Ga0265340_101974842 179
1044 3300031249 Ga0265339_10002352 Ga0265339_1000235218 179
1045 3300031249 Ga0265339_10019630 Ga0265339_100196302 179
1046 3300031249 Ga0265339_10049757 Ga0265339_100497572 179
1047 3300031249 Ga0265339_10130879 Ga0265339_101308792 179
1048 3300031344 Ga0265316_10011341 Ga0265316_1001134111 179
1049 3300031344 Ga0265316_10012614 Ga0265316_1001261412 179
1050 3300031344 Ga0265316_10051596 Ga0265316_100515966 179
1051 3300031344 Ga0265316_10126703 Ga0265316_101267032 179
1052 3300031344 Ga0265316_10982600 Ga0265316_109826001 179
1053 3300031595 Ga0265313_10265926 Ga0265313_102659261 179
1054 3300031711 Ga0265314_10003075 Ga0265314_1000307511 179
1055 3300031711 Ga0265314_10013145 Ga0265314_100131456 179
1056 3300031731 Ga0307405_10305206 Ga0307405_103052062 179
1057 3300031852 Ga0307410_10009896 Ga0307410_100098968 179
1058 3300031901 Ga0307406_10107374 Ga0307406_101073742 179
1059 3300031911 Ga0307412_10411234 Ga0307412_104112341 179
1060 3300031995 Ga0307409_100214313 Ga0307409_1002143134 179
1061 3300031995 Ga0307409_100232918 Ga0307409_1002329183 179
1062 3300032002 Ga0307416_100028546 Ga0307416_1000285463 179
1063 3300032005 Ga0307411_10104293 Ga0307411_101042933 179
1064 3300032005 Ga0307411_10300349 Ga0307411_103003492 179
1065 3300032126 Ga0307415_100343177 Ga0307415_1003431771 179
1066 3300032126 Ga0307415_100509927 Ga0307415_1005099272 179
1067 3300033180 Ga0307510_10085914 Ga0307510_100859146 179
1068 3300033180 Ga0307510_10089104 Ga0307510_100891043 179
1069 3300033180 Ga0307510_10091701 Ga0307510_100917014 179
1070 3300033544 Ga0316215_1000711 Ga0316215_10007116 179
1071 3300033545 Ga0316214_1006727 Ga0316214_10067272 179
1072 3300033547 Ga0316212_1013783 Ga0316212_10137832 179
1073 3300035083 Ga0373926_0024543 Ga0373926_0024543_849_1388 179
1074 3300035083 Ga0373926_0051445 Ga0373926_0051445_209_748 179
1075 3300035089 Ga0373944_0015252 Ga0373944_0015252_578_1117 179
1076 3300035111 Ga0373923_0009501 Ga0373923_0009501_550_1089 179
1077 3300035111 Ga0373923_0039386 Ga0373923_0039386_32_571 179
1078 3300035111 Ga0373923_0261467 Ga0373923_0261467_28_567 179
1079 3300035113 Ga0373936_0002329 Ga0373936_0002329_4273_4812 179
1080 3300035113 Ga0373936_0049771 Ga0373936_0049771_615_1154 179
1081 3300035116 Ga0373945_0035480 Ga0373945_0035480_434_973 179
1082 3300035116 Ga0373945_0064816 Ga0373945_0064816_80_619 179
1083 3300035117 Ga0373953_0004886 Ga0373953_0004886_2360_2899 179
1084 3300035118 Ga0373954_0033288 Ga0373954_0033288_1513_2052 179
1085 3300035119 Ga0373956_0039976 Ga0373956_0039976_1227_1766 179
1086 3300035119 Ga0373956_0080700 Ga0373956_0080700_201_740 179
1087 3300035120 Ga0373957_0002069 Ga0373957_0002069_933_1472 179
1088 3300035120 Ga0373957_0024514 Ga0373957_0024514_1285_1824 179
1089 3300035121 Ga0373960_0019347 Ga0373960_0019347_433_972 179
1090 3300035170 Ga0373943_0007759 Ga0373943_0007759_3909_4448 179
1091 3300035170 Ga0373943_0063513 Ga0373943_0063513_400_939 179
1092 3300035171 Ga0373946_0007410 Ga0373946_0007410_2476_3015 179
1093 3300035172 Ga0373955_0065548 Ga0373955_0065548_927_1466 179
1094 3300035410 Ga0373924_0000242 Ga0373924_0000242_9297_9836 179
1095 3300035410 Ga0373924_0010177 Ga0373924_0010177_2604_3143 179
1096 3300035410 Ga0373924_0013446 Ga0373924_0013446_2311_2850 179
1097 3300035691 Ga0373931_0016212 Ga0373931_0016212_91_630 179
1098 3300035691 Ga0373931_0036963 Ga0373931_0036963_532_1071 179
1099 3300035691 Ga0373931_0387390 Ga0373931_0387390_223_762 179
1100 3300035692 Ga0373935_0008518 Ga0373935_0008518_5315_5854 179
1101 3300035692 Ga0373935_0038747 Ga0373935_0038747_2069_2608 179
1102 3300035692 Ga0373935_0109231 Ga0373935_0109231_914_1453 179
1103 3300035692 Ga0373935_0129368 Ga0373935_0129368_628_1167 179
1104 3300035692 Ga0373935_0221867 Ga0373935_0221867_467_1006 179
1105 3300035692 Ga0373935_0673986 Ga0373935_0673986_99_638 179
1106 3300035692 Ga0373935_0957268 Ga0373935_0957268_19_558 179
1107 3300035695 Ga0373927_0000747 Ga0373927_0000747_22986_23525 179
1108 3300035695 Ga0373927_0028973 Ga0373927_0028973_2016_2555 179
1109 3300035695 Ga0373927_0058541 Ga0373927_0058541_1507_2046 179
1110 3300035695 Ga0373927_0275915 Ga0373927_0275915_469_1008 179
1111 3300035724 Ga0373933_0007220 Ga0373933_0007220_2281_2820 179
1112 3300035724 Ga0373933_0208806 Ga0373933_0208806_186_725 179
1113 3300035724 Ga0373933_0318460 Ga0373933_0318460_394_933 179
1114 3300035725 Ga0373947_0004951 Ga0373947_0004951_1855_2394 179
1115 3300035725 Ga0373947_0020057 Ga0373947_0020057_144_683 179
1116 3300035725 Ga0373947_0031701 Ga0373947_0031701_817_1356 179
1117 3300035725 Ga0373947_0144026 Ga0373947_0144026_591_1130 179
1118 3300036401 Ga0373937_0000317 Ga0373937_0000317_22213_22752 179
1119 3300036401 Ga0373937_0033955 Ga0373937_0033955_249_788 179
1120 3300036401 Ga0373937_0080212 Ga0373937_0080212_45_584 179
1121 3300036401 Ga0373937_0194406 Ga0373937_0194406_203_742 179
1122 3300036401 Ga0373937_0237142 Ga0373937_0237142_481_1020 179
1123 3300036401 Ga0373937_1295066 Ga0373937_1295066_19_558 179
1124 3300036401 Ga0373937_1575029 Ga0373937_1575029_50_589 179
1125 3300036457 Ga0265778_000084 Ga0265778_000084_1103_1642 179
1126 3300036457 Ga0265778_037399 Ga0265778_037399_84_623 179
1127 3300037068 Ga0373925_0003717 Ga0373925_0003717_6416_6955 179
1128 3300037068 Ga0373925_0016522 Ga0373925_0016522_3488_4027 179
1129 3300037068 Ga0373925_0053657 Ga0373925_0053657_1996_2535 179
1130 3300037068 Ga0373925_0117328 Ga0373925_0117328_1028_1567 179
1131 3300037068 Ga0373925_0205941 Ga0373925_0205941_444_983 179
1132 3300037068 Ga0373925_0387262 Ga0373925_0387262_348_887 179
1133 3300037068 Ga0373925_0961808 Ga0373925_0961808_109_648 179
1134 3300037418 Ga0395900_0472883 Ga0395900_0472883_576_1115 179
1135 3300037418 Ga0395900_1080223 Ga0395900_1080223_37_576 179
1136 3300037466 Ga0395898_0159495 Ga0395898_0159495_732_1271 179
1137 3300037466 Ga0395898_0286274 Ga0395898_0286274_533_1072 179
1138 3300037471 Ga0395905_0030235 Ga0395905_0030235_4127_4666 179
1139 3300037471 Ga0395905_0469481 Ga0395905_0469481_195_734 179
1140 3300038443 Ga0395901_0309556 Ga0395901_0309556_150_689 179
1141 3300038443 Ga0395901_0607629 Ga0395901_0607629_205_744 179
1142 3300039437 Ga0436365_1570757 Ga0436365_1570757_688_1227 179
1143 3300039437 Ga0436365_1579359 Ga0436365_1579359_583_1122 179
1144 3300039437 Ga0436365_1743054 Ga0436365_1743054_514_1053 179
1145 3300039438 Ga0436360_0367909 Ga0436360_0367909_1484_2023 179
1146 3300039438 Ga0436360_0790368 Ga0436360_0790368_345_884 179
1147 3300039438 Ga0436360_1254708 Ga0436360_1254708_703_1242 179
1148 3300039438 Ga0436360_1271565 Ga0436360_1271565_588_1127 179
1149 3300039447 Ga0436361_0270740 Ga0436361_0270740_2039_2578 179
1150 3300039447 Ga0436361_0359969 Ga0436361_0359969_835_1374 179
1151 3300039447 Ga0436361_0574782 Ga0436361_0574782_907_1446 179
1152 3300039447 Ga0436361_0720823 Ga0436361_0720823_545_1084 179
1153 3300039447 Ga0436361_0824839 Ga0436361_0824839_753_1292 179
1154 3300039447 Ga0436361_1136307 Ga0436361_1136307_29_568 179
1155 3300039450 Ga0436363_1519336 Ga0436363_1519336_1964_2503 179
1156 3300039450 Ga0436363_1565028 Ga0436363_1565028_1731_2339 179
1157 3300039450 Ga0436363_1588661 Ga0436363_1588661_305_844 179
1158 3300039453 Ga0436362_0607968 Ga0436362_0607968_1500_2039 179
1159 3300039453 Ga0436362_0777293 Ga0436362_0777293_3706_4245 179
1160 3300041496 Ga0451839_0272954 Ga0451839_0272954_83_622 179
1161 3300042005 Ga0439448_0009042 Ga0439448_0009042_1652_2197 179
1162 3300042876 Ga0451577_0000523 Ga0451577_0000523_24_563 179
1163 3300044673 Ga0453683_0066176 Ga0453683_0066176_1236_1775 179
1164 3300044684 Ga0466966_0538712 Ga0466966_0538712_139_678 179
1165 3300044693 Ga0466961_0069645 Ga0466961_0069645_1267_1806 179
1166 3300044694 Ga0466963_0030210 Ga0466963_0030210_1255_1794 179
1167 3300044694 Ga0466963_0207365 Ga0466963_0207365_504_1043 179
1168 3300044694 Ga0466963_0280660 Ga0466963_0280660_199_738 179
1169 3300044694 Ga0466963_0349464 Ga0466963_0349464_249_788 179
1170 3300044712 Ga0453684_0000951 Ga0453684_0000951_86091_86630 179
1171 3300044735 Ga0466968_0084554 Ga0466968_0084554_579_1118 179
1172 3300044842 Ga0466957_0000324 Ga0466957_0000324_9128_9667 179
1173 3300044842 Ga0466957_0451004 Ga0466957_0451004_98_637 179
1174 3300044842 Ga0466957_0571086 Ga0466957_0571086_97_636 179
1175 3300045049 Ga0466959_0024892 Ga0466959_0024892_3645_4184 179
1176 3300045049 Ga0466959_0176220 Ga0466959_0176220_319_858 179
1177 3300045049 Ga0466959_0468418 Ga0466959_0468418_119_658 179
1178 3300045051 Ga0451576_0010556 Ga0451576_0010556_1124_1663 179
1179 3300045836 Ga0466958_0268966 Ga0466958_0268966_416_955 179
1180 3300045836 Ga0466958_0363610 Ga0466958_0363610_226_765 179
1181 3300045836 Ga0466958_0534813 Ga0466958_0534813_50_589 179
1182 3300045976 Ga0466967_0004406 Ga0466967_0004406_3203_3778 179
1183 3300045976 Ga0466967_0054201 Ga0466967_0054201_1947_2486 179
1184 3300045976 Ga0466967_0261674 Ga0466967_0261674_993_1532 179
1185 3300045976 Ga0466967_0270579 Ga0466967_0270579_466_1005 179
1186 3300045976 Ga0466967_0331510 Ga0466967_0331510_791_1330 179
1187 3300045976 Ga0466967_0375223 Ga0466967_0375223_653_1192 179
1188 3300045976 Ga0466967_0549255 Ga0466967_0549255_535_1074 179
1189 3300045976 Ga0466967_0929641 Ga0466967_0929641_18_557 179
1190 3300046452 Ga0495617_158061 Ga0495617_158061_160_699 179
1191 3300046454 Ga0495592_0087856 Ga0495592_0087856_1169_1708 179
1192 3300046454 Ga0495592_0398090 Ga0495592_0398090_135_674 179
1193 3300046455 Ga0495603_0047588 Ga0495603_0047588_323_862 179
1194 3300046455 Ga0495603_0072297 Ga0495603_0072297_1109_1648 179
1195 3300046455 Ga0495603_0325396 Ga0495603_0325396_295_834 179
1196 3300046455 Ga0495603_0572585 Ga0495603_0572585_85_624 179
1197 3300046459 Ga0495629_0016750 Ga0495629_0016750_4092_4631 179
1198 3300046459 Ga0495629_0114399 Ga0495629_0114399_479_1018 179
1199 3300046459 Ga0495629_0520583 Ga0495629_0520583_142_681 179
1200 3300046462 Ga0495651_0134346 Ga0495651_0134346_1024_1563 179
1201 3300046462 Ga0495651_0182806 Ga0495651_0182806_522_1061 179
1202 3300046463 Ga0495653_0002196 Ga0495653_0002196_11243_11782 179
1203 3300046463 Ga0495653_0144725 Ga0495653_0144725_957_1496 179
1204 3300046463 Ga0495653_0229100 Ga0495653_0229100_570_1109 179
1205 3300046463 Ga0495653_0241095 Ga0495653_0241095_185_724 179
1206 3300046463 Ga0495653_0340632 Ga0495653_0340632_67_606 179
1207 3300046471 Ga0495650_0000010 Ga0495650_0000010_636489_637028 179
1208 3300046471 Ga0495650_0001875 Ga0495650_0001875_9530_10069 179
1209 3300046472 Ga0495580_0001845 Ga0495580_0001845_9078_9617 179
1210 3300046472 Ga0495580_0005545 Ga0495580_0005545_7195_7734 179
1211 3300046472 Ga0495580_0006027 Ga0495580_0006027_2540_3079 179
1212 3300046472 Ga0495580_0024607 Ga0495580_0024607_3842_4381 179
1213 3300046472 Ga0495580_0039298 Ga0495580_0039298_1360_1899 179
1214 3300046472 Ga0495580_0072920 Ga0495580_0072920_1349_1888 179
1215 3300046472 Ga0495580_0075926 Ga0495580_0075926_162_701 179
1216 3300046472 Ga0495580_0079775 Ga0495580_0079775_22_561 179
1217 3300046472 Ga0495580_0082308 Ga0495580_0082308_1369_1908 179
1218 3300046472 Ga0495580_0116291 Ga0495580_0116291_298_837 179
1219 3300046472 Ga0495580_0126485 Ga0495580_0126485_524_1063 179
1220 3300046472 Ga0495580_0174650 Ga0495580_0174650_922_1461 179
1221 3300046472 Ga0495580_0180860 Ga0495580_0180860_223_762 179
1222 3300046472 Ga0495580_0186695 Ga0495580_0186695_743_1282 179
1223 3300046472 Ga0495580_0203231 Ga0495580_0203231_804_1343 179
1224 3300046472 Ga0495580_0238109 Ga0495580_0238109_126_665 179
1225 3300046472 Ga0495580_0290242 Ga0495580_0290242_557_1096 179
1226 3300046472 Ga0495580_0301832 Ga0495580_0301832_98_637 179
1227 3300046472 Ga0495580_0336392 Ga0495580_0336392_187_726 179
1228 3300046472 Ga0495580_0347402 Ga0495580_0347402_141_680 179
1229 3300046472 Ga0495580_0514028 Ga0495580_0514028_200_739 179
1230 3300046472 Ga0495580_0780822 Ga0495580_0780822_12_551 179
1231 3300046473 Ga0495582_0004179 Ga0495582_0004179_5405_5944 179
1232 3300046473 Ga0495582_0008570 Ga0495582_0008570_714_1253 179
1233 3300046473 Ga0495582_0079499 Ga0495582_0079499_1111_1650 179
1234 3300046473 Ga0495582_0184668 Ga0495582_0184668_54_593 179
1235 3300046473 Ga0495582_0259319 Ga0495582_0259319_354_893 179
1236 3300046475 Ga0495639_0001964 Ga0495639_0001964_887_1426 179
1237 3300046475 Ga0495639_0138843 Ga0495639_0138843_159_698 179
1238 3300046476 Ga0495662_0000747 Ga0495662_0000747_13620_14159 179
1239 3300046476 Ga0495662_0364358 Ga0495662_0364358_108_647 179
1240 3300046477 Ga0495664_0031016 Ga0495664_0031016_719_1258 179
1241 3300046477 Ga0495664_0060539 Ga0495664_0060539_690_1229 179
1242 3300046477 Ga0495664_0219680 Ga0495664_0219680_466_1011 179
1243 3300046477 Ga0495664_0412229 Ga0495664_0412229_133_771 179
1244 3300046491 Ga0495584_0084776 Ga0495584_0084776_1028_1567 179
1245 3300046492 Ga0495585_0078960 Ga0495585_0078960_432_977 179
1246 3300046499 Ga0495594_0005255 Ga0495594_0005255_5866_6405 179
1247 3300046499 Ga0495594_0032431 Ga0495594_0032431_298_837 179
1248 3300046499 Ga0495594_0038320 Ga0495594_0038320_1491_2030 179
1249 3300046499 Ga0495594_0060220 Ga0495594_0060220_715_1254 179
1250 3300046499 Ga0495594_0065441 Ga0495594_0065441_1365_1904 179
1251 3300046499 Ga0495594_0583590 Ga0495594_0583590_64_609 179
1252 3300046500 Ga0495596_0063445 Ga0495596_0063445_266_805 179
1253 3300046506 Ga0495583_0135574 Ga0495583_0135574_367_906 179
1254 3300046507 Ga0495606_0011222 Ga0495606_0011222_1841_2380 179
1255 3300046514 Ga0495618_0061530 Ga0495618_0061530_1156_1695 179
1256 3300046516 Ga0495628_0125396 Ga0495628_0125396_491_1030 179
1257 3300046516 Ga0495628_0132429 Ga0495628_0132429_108_647 179
1258 3300046517 Ga0495630_0228720 Ga0495630_0228720_273_812 179
1259 3300046517 Ga0495630_0242461 Ga0495630_0242461_826_1365 179
1260 3300046517 Ga0495630_0248624 Ga0495630_0248624_472_1011 179
1261 3300046518 Ga0495631_0091955 Ga0495631_0091955_50_589 179
1262 3300046523 Ga0495644_0000777 Ga0495644_0000777_5168_5707 179
1263 3300046524 Ga0495648_0208757 Ga0495648_0208757_106_645 179
1264 3300046526 Ga0495666_0000949 Ga0495666_0000949_12901_13440 179
1265 3300046528 Ga0495642_0026806 Ga0495642_0026806_688_1227 179
1266 3300046528 Ga0495642_0104767 Ga0495642_0104767_313_852 179
1267 3300046528 Ga0495642_0105010 Ga0495642_0105010_311_850 179
1268 3300046529 Ga0495652_0010348 Ga0495652_0010348_3502_4041 179
1269 3300046529 Ga0495652_0055557 Ga0495652_0055557_674_1312 179
1270 3300046531 Ga0495665_0003007 Ga0495665_0003007_8555_9094 179
1271 3300046531 Ga0495665_0006456 Ga0495665_0006456_21_560 179
1272 3300046531 Ga0495665_0016955 Ga0495665_0016955_2747_3286 179
1273 3300046531 Ga0495665_0087931 Ga0495665_0087931_1008_1547 179
1274 3300046531 Ga0495665_0120542 Ga0495665_0120542_785_1324 179
1275 3300046531 Ga0495665_0326498 Ga0495665_0326498_152_691 179
1276 3300046533 Ga0495640_0018326 Ga0495640_0018326_719_1258 179
1277 3300046535 Ga0495586_0003386 Ga0495586_0003386_3386_3925 179
1278 3300046535 Ga0495586_0024739 Ga0495586_0024739_1348_1887 179
1279 3300046535 Ga0495586_0099941 Ga0495586_0099941_940_1479 179
1280 3300046536 Ga0495587_0039049 Ga0495587_0039049_866_1405 179
1281 3300046536 Ga0495587_0075587 Ga0495587_0075587_211_750 179
1282 3300046538 Ga0495609_0025275 Ga0495609_0025275_1912_2451 179
1283 3300046543 Ga0495645_0006005 Ga0495645_0006005_6404_6949 179
1284 3300046543 Ga0495645_0008101 Ga0495645_0008101_5866_6405 179
1285 3300046543 Ga0495645_0047042 Ga0495645_0047042_926_1465 179
1286 3300046543 Ga0495645_0404811 Ga0495645_0404811_274_813 179
1287 3300046559 Ga0495667_0003070 Ga0495667_0003070_952_1491 179
1288 3300046559 Ga0495667_0388693 Ga0495667_0388693_238_777 179
1289 3300046559 Ga0495667_0587439 Ga0495667_0587439_98_637 179
1290 3300046616 Ga0495668_0017443 Ga0495668_0017443_1002_1541 179
1291 3300046616 Ga0495668_0104556 Ga0495668_0104556_47_586 179
1292 3300046642 Ga0495634_0001003 Ga0495634_0001003_16328_16867 179
1293 3300046660 Ga0495625_0062943 Ga0495625_0062943_400_939 179
1294 3300046660 Ga0495625_0092175 Ga0495625_0092175_574_1113 179
1295 3300046663 Ga0495635_0007598 Ga0495635_0007598_4320_4859 179
1296 3300046663 Ga0495635_0094433 Ga0495635_0094433_11_550 179
1297 3300046663 Ga0495635_0124719 Ga0495635_0124719_726_1265 179
1298 3300046663 Ga0495635_0214888 Ga0495635_0214888_492_1031 179
1299 3300046663 Ga0495635_0436405 Ga0495635_0436405_207_746 179
1300 3300046665 Ga0495661_0009905 Ga0495661_0009905_1686_2225 179
1301 3300046675 Ga0495657_0277833 Ga0495657_0277833_411_950 179
1302 3300046675 Ga0495657_0524605 Ga0495657_0524605_96_635 179
1303 3300046678 Ga0495599_0026214 Ga0495599_0026214_2489_3028 179
1304 3300046678 Ga0495599_0452446 Ga0495599_0452446_80_625 179
1305 3300046679 Ga0495623_0023977 Ga0495623_0023977_3108_3647 179
1306 3300046679 Ga0495623_0072756 Ga0495623_0072756_852_1391 179
1307 3300046679 Ga0495623_0262076 Ga0495623_0262076_391_930 179
1308 3300046679 Ga0495623_0412109 Ga0495623_0412109_85_624 179
1309 3300046680 Ga0495646_0012115 Ga0495646_0012115_1006_1545 179
1310 3300046681 Ga0495647_0131461 Ga0495647_0131461_28_567 179
1311 3300046681 Ga0495647_0193089 Ga0495647_0193089_109_648 179
1312 3300046683 Ga0495658_0037741 Ga0495658_0037741_805_1344 179
1313 3300046683 Ga0495658_0701449 Ga0495658_0701449_88_627 179
1314 3300046684 Ga0495669_0000955 Ga0495669_0000955_3012_3551 179
1315 3300046684 Ga0495669_0032096 Ga0495669_0032096_730_1269 179
1316 3300046684 Ga0495669_0062300 Ga0495669_0062300_807_1346 179
1317 3300046684 Ga0495669_0092240 Ga0495669_0092240_149_688 179
1318 3300046689 Ga0495613_0012294 Ga0495613_0012294_3504_4043 179
1319 3300046689 Ga0495613_0208905 Ga0495613_0208905_37_576 179
1320 3300046690 Ga0495624_0003012 Ga0495624_0003012_8913_9452 179
1321 3300046694 Ga0495649_0131427 Ga0495649_0131427_389_928 179
1322 3300046809 Ga0495600_0003517 Ga0495600_0003517_2555_3094 179
1323 3300046809 Ga0495600_0105220 Ga0495600_0105220_1273_1812 179
1324 3300046809 Ga0495600_0653006 Ga0495600_0653006_17_556 179
1325 3300047315 Ga0495581_0000275 Ga0495581_0000275_8059_8598 179
1326 3300047315 Ga0495581_0042427 Ga0495581_0042427_1433_1972 179
1327 3300047315 Ga0495581_0130830 Ga0495581_0130830_786_1325 179
1328 3300047315 Ga0495581_0212753 Ga0495581_0212753_475_1014 179
1329 3300047317 Ga0495604_0005020 Ga0495604_0005020_9216_9755 179
1330 3300047317 Ga0495604_0100899 Ga0495604_0100899_1062_1601 179
1331 3300047317 Ga0495604_0255138 Ga0495604_0255138_185_823 179
1332 3300047319 Ga0495674_0022106 Ga0495674_0022106_4326_4865 179
1333 3300047319 Ga0495674_0057042 Ga0495674_0057042_842_1381 179
1334 3300047319 Ga0495674_0776063 Ga0495674_0776063_189_728 179
1335 3300047320 Ga0495672_0005628 Ga0495672_0005628_611_1150 179
1336 3300047321 Ga0495676_0007390 Ga0495676_0007390_6027_6566 179
1337 3300047444 Ga0495675_0049792 Ga0495675_0049792_1482_2021 179
1338 3300047444 Ga0495675_0065940 Ga0495675_0065940_134_673 179
1339 3300047445 Ga0495677_0013342 Ga0495677_0013342_1236_1775 179
1340 3300047471 Ga0495684_0009955 Ga0495684_0009955_3325_3864 179
1341 3300047471 Ga0495684_0120432 Ga0495684_0120432_1231_1770 179
1342 3300047471 Ga0495684_0128364 Ga0495684_0128364_1278_1817 179
1343 3300047471 Ga0495684_0201797 Ga0495684_0201797_125_664 179
1344 3300047472 Ga0495686_0002881 Ga0495686_0002881_5055_5594 179
1345 3300047472 Ga0495686_0175203 Ga0495686_0175203_289_828 179
1346 3300047673 Ga0495593_0067833 Ga0495593_0067833_743_1282 179
1347 3300047673 Ga0495593_0068202 Ga0495593_0068202_300_839 179
1348 3300047673 Ga0495593_0092577 Ga0495593_0092577_85_624 179
1349 3300047673 Ga0495593_0093717 Ga0495593_0093717_236_775 179
1350 3300048088 Ga0495602_0158730 Ga0495602_0158730_718_1257 179
1351 3300048088 Ga0495602_0286930 Ga0495602_0286930_474_1013 179
1352 3300048088 Ga0495602_0909119 Ga0495602_0909119_26_565 179
1353 3300048089 Ga0495614_0004587 Ga0495614_0004587_2157_2696 179
1354 3300048089 Ga0495614_0011701 Ga0495614_0011701_261_800 179
1355 3300048089 Ga0495614_0084201 Ga0495614_0084201_645_1184 179
1356 3300048089 Ga0495614_0477673 Ga0495614_0477673_25_564 179
1357 3300048904 Ga0496101_0132436 Ga0496101_0132436_1095_1634 179
1358 3300048904 Ga0496101_0175694 Ga0496101_0175694_1006_1545 179
1359 3300048904 Ga0496101_0334586 Ga0496101_0334586_185_823 179
1360 3300048905 Ga0496102_0024941 Ga0496102_0024941_3954_4493 179
1361 3300048905 Ga0496102_0050572 Ga0496102_0050572_1801_2340 179
1362 3300048905 Ga0496102_0140377 Ga0496102_0140377_1619_2158 179
1363 3300048905 Ga0496102_0414437 Ga0496102_0414437_485_1024 179
1364 3300048905 Ga0496102_0542524 Ga0496102_0542524_95_634 179
1365 3300048905 Ga0496102_0775051 Ga0496102_0775051_303_842 179
1366 3300048906 Ga0496103_0006549 Ga0496103_0006549_4605_5144 179
1367 3300048906 Ga0496103_0014605 Ga0496103_0014605_3096_3692 179
1368 3300048906 Ga0496103_0129966 Ga0496103_0129966_467_1006 179
1369 3300048907 Ga0496104_0108384 Ga0496104_0108384_1556_2095 179
1370 3300048907 Ga0496104_0120150 Ga0496104_0120150_893_1432 179
1371 3300048907 Ga0496104_0153093 Ga0496104_0153093_113_652 179
1372 3300048907 Ga0496104_0232501 Ga0496104_0232501_50_589 179
1373 3300048907 Ga0496104_0281141 Ga0496104_0281141_609_1148 179
1374 3300048907 Ga0496104_0319617 Ga0496104_0319617_41_580 179
1375 3300048907 Ga0496104_0405726 Ga0496104_0405726_575_1114 179
1376 3300048907 Ga0496104_0461671 Ga0496104_0461671_556_1095 179
1377 3300048908 Ga0496105_0001128 Ga0496105_0001128_6158_6697 179
1378 3300048908 Ga0496105_0035043 Ga0496105_0035043_2141_2779 179
1379 3300048908 Ga0496105_0347552 Ga0496105_0347552_114_653 179
1380 3300048908 Ga0496105_1098031 Ga0496105_1098031_25_564 179
1381 3300048909 Ga0496106_0193085 Ga0496106_0193085_675_1214 179
1382 3300048910 Ga0496107_0051715 Ga0496107_0051715_1860_2399 179
1383 3300048911 Ga0496108_0000242 Ga0496108_0000242_8445_8984 179
1384 3300048911 Ga0496108_0050272 Ga0496108_0050272_42_581 179
1385 3300048911 Ga0496108_0426059 Ga0496108_0426059_305_844 179
1386 3300048912 Ga0496109_0000120 Ga0496109_0000120_7070_7609 179
1387 3300048912 Ga0496109_0065523 Ga0496109_0065523_2678_3217 179
1388 3300048912 Ga0496109_0141665 Ga0496109_0141665_1547_2086 179
1389 3300048912 Ga0496109_0419455 Ga0496109_0419455_163_702 179
1390 3300048912 Ga0496109_0896582 Ga0496109_0896582_79_618 179
1391 3300048913 Ga0496110_0000795 Ga0496110_0000795_8306_8845 179
1392 3300048913 Ga0496110_0180758 Ga0496110_0180758_375_914 179
1393 3300048913 Ga0496110_0209108 Ga0496110_0209108_690_1229 179
1394 3300048913 Ga0496110_0216448 Ga0496110_0216448_359_898 179
1395 3300048913 Ga0496110_0323984 Ga0496110_0323984_501_1040 179
1396 3300048914 Ga0496111_0164923 Ga0496111_0164923_58_597 179
1397 3300048914 Ga0496111_0228096 Ga0496111_0228096_728_1267 179
1398 3300048914 Ga0496111_0573621 Ga0496111_0573621_62_601 179
1399 3300048915 Ga0496112_0000198 Ga0496112_0000198_29562_30101 179
1400 3300048915 Ga0496112_0000784 Ga0496112_0000784_7213_7752 179
1401 3300048915 Ga0496112_0003360 Ga0496112_0003360_8932_9471 179
1402 3300048915 Ga0496112_0006971 Ga0496112_0006971_1040_1579 179
1403 3300048915 Ga0496112_0011423 Ga0496112_0011423_4547_5086 179
1404 3300048915 Ga0496112_0023010 Ga0496112_0023010_4734_5273 179
1405 3300048915 Ga0496112_0048084 Ga0496112_0048084_875_1414 179
1406 3300048915 Ga0496112_0064736 Ga0496112_0064736_569_1108 179
1407 3300048915 Ga0496112_0086077 Ga0496112_0086077_1575_2114 179
1408 3300048915 Ga0496112_0239147 Ga0496112_0239147_861_1400 179
1409 3300048915 Ga0496112_0436714 Ga0496112_0436714_218_757 179
1410 3300048915 Ga0496112_0447875 Ga0496112_0447875_51_590 179
1411 3300048915 Ga0496112_0520295 Ga0496112_0520295_43_582 179
1412 3300048915 Ga0496112_0835722 Ga0496112_0835722_81_620 179
1413 3300048915 Ga0496112_1165528 Ga0496112_1165528_60_599 179
1414 3300048916 Ga0496113_0000111 Ga0496113_0000111_26283_26822 179
1415 3300048916 Ga0496113_0189401 Ga0496113_0189401_35_574 179
1416 3300048916 Ga0496113_0199752 Ga0496113_0199752_746_1285 179
1417 3300048916 Ga0496113_0781478 Ga0496113_0781478_192_731 179
1418 3300048917 Ga0496114_0340843 Ga0496114_0340843_561_1199 179
1419 3300048918 Ga0496115_0046543 Ga0496115_0046543_902_1441 179
1420 3300048918 Ga0496115_0178537 Ga0496115_0178537_232_771 179
1421 3300048918 Ga0496115_0522808 Ga0496115_0522808_102_641 179
1422 3300048929 Ga0496126_0000209 Ga0496126_0000209_122235_122780 179
1423 3300048929 Ga0496126_0003148 Ga0496126_0003148_15056_15595 179
1424 3300049572 Ga0501036_0355705 Ga0501036_0355705_166_705 179
1425 3300049581 Ga0501047_0014539 Ga0501047_0014539_482_1021 179
1426 3300049583 Ga0501067_0174949 Ga0501067_0174949_86_625 179
1427 3300049586 Ga0501070_0042215 Ga0501070_0042215_2151_2690 179
1428 3300049586 Ga0501070_0123554 Ga0501070_0123554_1142_1681 179
1429 3300049589 Ga0501073_0046644 Ga0501073_0046644_1392_1931 179
1430 3300049742 Ga0501080_0154241 Ga0501080_0154241_1080_1619 179
1431 3300050507 nmdc:mga05p37_1174556_c1 nmdc:mga05p37_1174556_c1_231_770 179
1432 3300050512 nmdc:mga0n895_133428_c1 nmdc:mga0n895_133428_c1_1711_2250 179
1433 3300050512 nmdc:mga0n895_142028_c1 nmdc:mga0n895_142028_c1_1329_1868 179
1434 3300050512 nmdc:mga0n895_344_c1 nmdc:mga0n895_344_c1_5525_6064 179
1435 3300050512 nmdc:mga0n895_409067_c1 nmdc:mga0n895_409067_c1_248_787 179
1436 3300050513 nmdc:mga0rr50_38765_c1 nmdc:mga0rr50_38765_c1_2591_3130 179
1437 3300050513 nmdc:mga0rr50_83273_c1 nmdc:mga0rr50_83273_c1_45_584 179
1438 3300050513 nmdc:mga0rr50_872_c1 nmdc:mga0rr50_872_c1_7637_8176 179
1439 3300050514 nmdc:mga08x19_14635_c1 nmdc:mga08x19_14635_c1_3328_3867 179
1440 3300050514 nmdc:mga08x19_176467_c1 nmdc:mga08x19_176467_c1_536_1075 179
1441 3300050514 nmdc:mga08x19_186747_c1 nmdc:mga08x19_186747_c1_539_1078 179
1442 3300050514 nmdc:mga08x19_33261_c1 nmdc:mga08x19_33261_c1_1120_1659 179
1443 3300050514 nmdc:mga08x19_3391_c1 nmdc:mga08x19_3391_c1_1806_2345 179
1444 3300050514 nmdc:mga08x19_37717_c1 nmdc:mga08x19_37717_c1_185_724 179
1445 3300050514 nmdc:mga08x19_417946_c2 nmdc:mga08x19_417946_c2_90_629 179
1446 3300050515 nmdc:mga0a205_7367_c1 nmdc:mga0a205_7367_c1_5418_5957 179
1447 3300053085 Ga0495619_0260909 Ga0495619_0260909_404_943 179
1448 3300053093 Ga0500651_0000049 Ga0500651_0000049_8593_9132 179
1449 3300053119 Ga0500595_000014 Ga0500595_000014_8579_9118 179
1450 3300053119 Ga0500595_024202 Ga0500595_024202_413_952 179
1451 3300053148 Ga0500590_140956 Ga0500590_140956_504_1043 179
1452 3300055283 Ga0500661_002505 Ga0500661_002505_1046_1585 179
1453 3300059509 Ga0587089_012762 Ga0587089_012762_358_897 179
1454 3300059511 Ga0587091_140328 Ga0587091_140328_42_581 179
1455 3300059624 Ga0587109_017608 Ga0587109_017608_410_949 179

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00347

Ribosomal_L6

Ribosomal protein L6

88

164

0.98

PF00347

Ribosomal_L6

Ribosomal protein L6

11

80

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
5li0-assembly1.cif.gz_H 70s ribosome from staphylococcus aureus 0.9411 9 170
5dm7-assembly1.cif.gz_E crystal structure of the 50s ribosomal subunit from deinococcus radiodurans in complex with hygromycin a 0.9378 5 174
8cgv-assembly1.cif.gz_g tiamulin bound to the 50s subunit 0.9377 2 172
6ppk-assembly1.cif.gz_G rbga+45srbga complex 0.9376 57 167
8ceu-assembly1.cif.gz_g retapamulin and capreomycin bound to the 50s subunit 0.9374 2 172
ID Description Score Start End Superfamily
af_O21037_77_170_3.90.930.12 Alpha Beta;Alpha-Beta Complex;Outer Surface Protein A; domain 3;Ribosomal protein L6 0.9673 81 170 3.90.930.12
2awbG02 Alpha Beta;Alpha-Beta Complex;Outer Surface Protein A; domain 3;Ribosomal protein L6 0.9523 81 170 3.90.930.12
3knmH02 Alpha Beta;Alpha-Beta Complex;Outer Surface Protein A; domain 3;Ribosomal protein L6 0.9469 81 168 3.90.930.12
1vw4F02 Alpha Beta;Alpha-Beta Complex;Outer Surface Protein A; domain 3;Ribosomal protein L6 0.9406 81 170 3.90.930.12
3knmH02 Alpha Beta;Alpha-Beta Complex;Outer Surface Protein A; domain 3;Ribosomal protein L6 0.9364 81 168 3.90.930.12
ID Description Score Start End GO Terms
AF-A0A1F2RTS1-F1-model_v4 50S ribosomal protein L6 0.9871 16 147 GO:0002181
GO:0003735
GO:0019843
GO:0022625
AF-A0A1F4PS04-F1-model_v4 50S ribosomal protein L6 0.9712 61 174 GO:0002181
GO:0003735
GO:0019843
GO:0022625
AF-A0A1F2RTS1-F1-model_v4 50S ribosomal protein L6 0.965 16 147 GO:0002181
GO:0003735
GO:0019843
GO:0022625
AF-A0A0H4TBB0-F1-model_v4 50S ribosomal protein L6 0.9627 1 155 GO:0002181
GO:0003735
GO:0019843
GO:0022625
AF-A0A358FVP3-F1-model_v4 50S ribosomal protein L6 0.9622 77 161 GO:0002181
GO:0003735
GO:0019843
GO:0022625

Feature Viewer

pLDDT pTM Quality
85.34 0.77 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map