F493954

General Info

Members Datasets Scaffolds Average Seq Length
1437 478 2874 144

Family's Representative Sequence

Representative Sequence 3300025944|Ga0207661_10042438|Ga0207661_100424384
Length 137
Sequence MAANINRVVLVGNLTRDPELRHTPSGMAVCSLRIAVNTRRKDSTSGQWTEKPNYFDITVWGNQGESCAQYLSKGRPVAVDGRLEWREWDAQDGTKRQAVEIIADSVQFLGGRDQFVPAGASSGSDADFQGSDDDIPF

Samples

Sample ID Description Type Environment
1 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
29 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
30 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
31 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
32 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
33 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
34 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
35 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
36 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
37 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
38 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
39 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
40 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
41 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
42 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
43 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
44 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
45 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
46 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
47 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
48 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
49 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
50 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
51 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
52 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
53 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
54 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
55 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
56 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
57 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
58 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
59 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
60 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
61 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
62 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
63 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
64 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
65 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
66 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
67 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
68 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
69 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
70 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
71 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
72 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
73 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
74 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
75 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
76 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
77 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
78 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
79 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
80 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
81 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
82 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
83 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
84 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
85 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
86 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
87 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
88 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
89 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
90 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
91 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
92 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
93 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
94 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
95 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
96 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
97 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
98 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
99 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
100 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
101 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
102 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
103 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
104 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
105 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
106 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
107 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
108 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
109 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
110 3300012481 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.1.yng.040610 Metagenome Rhizosphere
111 3300012488 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.yng.030610 Metagenome Rhizosphere
112 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
113 3300012503 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R Metagenome Rhizosphere
114 3300012505 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 Metagenome Rhizosphere
115 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
116 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
117 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
118 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
119 3300013045 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
120 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
121 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
122 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
123 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
124 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
125 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
126 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
127 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
128 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
129 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
130 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
131 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
132 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
133 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
134 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
135 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
136 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
137 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
138 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
139 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
140 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
141 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
142 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
143 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
144 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
145 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
146 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
147 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
148 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
149 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
209 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
210 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
211 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
215 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
216 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
217 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
218 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
219 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
220 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
221 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
222 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
223 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
224 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
225 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
226 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
227 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
228 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
229 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
230 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
231 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
232 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
233 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
234 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
235 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
236 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
237 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
238 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
239 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
240 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
241 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
242 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
243 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
244 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
245 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
246 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
247 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
248 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
249 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
250 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
251 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
252 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
253 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
254 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
255 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
256 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
257 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
258 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
259 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
260 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
261 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
262 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
263 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
264 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
265 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
266 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
267 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
268 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
269 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
270 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
271 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
272 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
273 3300038699 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot26 Metagenome Rhizosphere
274 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
275 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
276 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
277 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
278 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
279 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
280 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
281 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
282 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
283 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
284 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
285 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
286 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
287 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
288 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
289 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
290 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
291 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
292 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
293 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
294 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
295 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
296 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
297 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
298 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
299 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
300 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
301 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
302 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
303 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
304 3300042119 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218L_E14_082316_1902 Metagenome Rhizosphere
305 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
306 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
307 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
308 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
309 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
310 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
311 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
312 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
313 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
314 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
315 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
316 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
317 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
318 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
319 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
320 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
321 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
322 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
323 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
324 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
325 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
326 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
327 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
328 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
329 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
330 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
331 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
332 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
333 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
334 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
335 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
336 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
337 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
338 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
339 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
340 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
341 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
342 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
343 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
344 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
345 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
346 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
347 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
348 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
349 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
350 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
351 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
352 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
353 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
354 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
355 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
356 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
357 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
358 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
359 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
360 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
361 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
362 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
363 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
364 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
365 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
366 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
367 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
368 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
369 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
370 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
371 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
372 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
373 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
374 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
375 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
376 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
377 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
378 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
379 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
380 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
381 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
382 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
383 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
384 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
385 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
386 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
387 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
388 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
389 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
390 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
391 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
392 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
393 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
394 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
395 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
396 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
397 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
398 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
399 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
400 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
401 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
402 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
403 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
404 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
405 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
406 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
407 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
408 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
409 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
410 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
411 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
412 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
413 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
414 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
415 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
416 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
417 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
418 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
419 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
420 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
421 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
422 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
423 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
424 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
425 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
426 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
427 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
428 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
429 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
430 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
431 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
432 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
433 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
434 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
435 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
436 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
437 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
438 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
439 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
440 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
441 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
442 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
443 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
444 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
445 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
446 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
447 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
448 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
449 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
450 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
451 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
452 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
453 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
454 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
455 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
456 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
457 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
458 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
459 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
460 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
461 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
462 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
463 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
464 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
465 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
466 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
467 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
468 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
469 3300059622 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 222R_AD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
470 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
471 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
472 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
473 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
474 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
475 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
476 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
477 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
478 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.08
Metatranscriptomes 2.92
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.21
Nodule 0
Rhizoplane 9.88
Rhizosphere 89.07
Stem 0
Stem Tuber 0
Unclassified 9.81

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207661_10042438 3300025944 Bacteria 3586
2 JGI25407J50210_10003347 3300003373 Bacteria 3823
3 JGI25407J50210_10011863 3300003373 Bacteria 2231
4 JGI25407J50210_10013973 3300003373 Bacteria 2067
5 Ga0058861_10075293 3300004800 Bacteria 1136
6 Ga0058861_11810407 3300004800 Bacteria 938
7 Ga0058862_10046701 3300004803 Bacteria 1773
8 Ga0070658_10105256 3300005327 Bacteria 2334
9 Ga0070658_10646176 3300005327 Bacteria 918
10 Ga0070658_10996356 3300005327 Bacteria 729
11 Ga0070676_10293772 3300005328 Bacteria 1099
12 Ga0070683_100001379 3300005329 Bacteria 18627
13 Ga0070683_100005013 3300005329 Bacteria 10989
14 Ga0070683_100037229 3300005329 Bacteria 4453
15 Ga0070683_100044833 3300005329 Bacteria 4080
16 Ga0070683_100241605 3300005329 Unclassified 1718
17 Ga0070683_100333756 3300005329 Bacteria 1444
18 Ga0070690_100121705 3300005330 Bacteria 1752
19 Ga0070690_100301729 3300005330 Bacteria 1149
20 Ga0070670_100049075 3300005331 Bacteria 3631
21 Ga0068869_100170346 3300005334 Bacteria 1701
22 Ga0068869_100267798 3300005334 Bacteria 1370
23 Ga0070680_100016898 3300005336 Bacteria 5743
24 Ga0070680_100128742 3300005336 Bacteria 2116
25 Ga0070682_100001120 3300005337 Bacteria 15323
26 Ga0070682_100169777 3300005337 Unclassified 1515
27 Ga0068868_100163557 3300005338 Bacteria 1839
28 Ga0068868_100258518 3300005338 Bacteria 1468
29 Ga0068868_100490425 3300005338 Bacteria 1075
30 Ga0070660_100104555 3300005339 Bacteria 2247
31 Ga0070660_100267490 3300005339 Bacteria 1397
32 Ga0070660_100822680 3300005339 Unclassified 782
33 Ga0070689_100037671 3300005340 Bacteria 3698
34 Ga0070689_100096247 3300005340 Bacteria 2340
35 Ga0070689_100241720 3300005340 Bacteria 1487
36 Ga0070689_100487859 3300005340 Unclassified 1053
37 Ga0070691_10364657 3300005341 Unclassified 806
38 Ga0070687_100140768 3300005343 Bacteria 1405
39 Ga0070687_100248623 3300005343 Bacteria 1104
40 Ga0070661_100016760 3300005344 Bacteria 5187
41 Ga0070661_100210300 3300005344 Bacteria 1489
42 Ga0070661_100255486 3300005344 Bacteria 1353
43 Ga0070661_100577397 3300005344 Unclassified 907
44 Ga0070668_100975774 3300005347 Unclassified 761
45 Ga0070669_100215976 3300005353 Bacteria 1515
46 Ga0070675_100602373 3300005354 Bacteria 996
47 Ga0070671_100137891 3300005355 Bacteria 2057
48 Ga0070671_100201298 3300005355 Bacteria 1688
49 Ga0070671_100418891 3300005355 Bacteria 1147
50 Ga0070674_100514522 3300005356 Bacteria 999
51 Ga0070674_100577638 3300005356 Bacteria 947
52 Ga0070673_100379501 3300005364 Unclassified 1260
53 Ga0070673_100894913 3300005364 Unclassified 823
54 Ga0070673_101445147 3300005364 Bacteria 648
55 Ga0070688_100004502 3300005365 Bacteria 7264
56 Ga0070659_100222305 3300005366 Unclassified 1559
57 Ga0070659_101074117 3300005366 Bacteria 709
58 Ga0070667_100010579 3300005367 Bacteria 7617
59 Ga0070667_100610295 3300005367 Bacteria 1006
60 Ga0070703_10006333 3300005406 Bacteria 3317
61 Ga0070703_10013655 3300005406 Bacteria 2309
62 Ga0070703_10015940 3300005406 Bacteria 2154
63 Ga0070709_10074329 3300005434 Bacteria 2202
64 Ga0070709_10112566 3300005434 Bacteria 1832
65 Ga0070709_10115793 3300005434 Bacteria 1808
66 Ga0070709_10119257 3300005434 Bacteria 1785
67 Ga0070709_10336019 3300005434 Bacteria 1112
68 Ga0070709_10526075 3300005434 Unclassified 902
69 Ga0070714_100098687 3300005435 Bacteria 2570
70 Ga0070714_100131822 3300005435 Bacteria 2234
71 Ga0070714_100135402 3300005435 Bacteria 2205
72 Ga0070714_100185055 3300005435 Bacteria 1897
73 Ga0070714_100554624 3300005435 Bacteria 1100
74 Ga0070714_100794724 3300005435 Bacteria 916
75 Ga0070714_101065556 3300005435 Bacteria 787
76 Ga0070713_100009354 3300005436 Bacteria 7008
77 Ga0070713_100117684 3300005436 Bacteria 2326
78 Ga0070713_100342452 3300005436 Bacteria 1385
79 Ga0070710_10008661 3300005437 Bacteria 4956
80 Ga0070710_10013881 3300005437 Bacteria 4044
81 Ga0070710_10015912 3300005437 Unclassified 3815
82 Ga0070710_10053122 3300005437 Bacteria 2281
83 Ga0070710_10243178 3300005437 Unclassified 1154
84 Ga0070710_10304204 3300005437 Unclassified 1041
85 Ga0070710_10369129 3300005437 Bacteria 954
86 Ga0070710_10391138 3300005437 Bacteria 930
87 Ga0070701_10012076 3300005438 Bacteria 3882
88 Ga0070701_10294474 3300005438 Bacteria 996
89 Ga0070711_100014628 3300005439 Bacteria 4946
90 Ga0070711_100030732 3300005439 Bacteria 3559
91 Ga0070711_100043560 3300005439 Bacteria 3040
92 Ga0070711_100196860 3300005439 Bacteria 1552
93 Ga0070711_100288057 3300005439 Bacteria 1302
94 Ga0070711_100355449 3300005439 Bacteria 1179
95 Ga0070711_100369955 3300005439 Unclassified 1156
96 Ga0070711_100589877 3300005439 Bacteria 926
97 Ga0070705_100010056 3300005440 Bacteria 4726
98 Ga0070705_100256947 3300005440 Bacteria 1230
99 Ga0070705_100271398 3300005440 Bacteria 1201
100 Ga0070705_101172379 3300005440 Bacteria 632
101 Ga0070705_101338758 3300005440 Unclassified 595
102 Ga0070700_100021368 3300005441 Bacteria 3761
103 Ga0070694_100116597 3300005444 Bacteria 1910
104 Ga0070694_100146848 3300005444 Bacteria 1718
105 Ga0070708_100032536 3300005445 Unclassified 4525
106 Ga0070708_100308065 3300005445 Bacteria 1491
107 Ga0070708_100352794 3300005445 Bacteria 1386
108 Ga0070708_100672842 3300005445 Bacteria 975
109 Ga0070708_101551238 3300005445 Bacteria 617
110 Ga0070678_100082013 3300005456 Bacteria 2447
111 Ga0070678_100097624 3300005456 Bacteria 2269
112 Ga0070678_100098306 3300005456 Bacteria 2263
113 Ga0070678_100252065 3300005456 Bacteria 1480
114 Ga0070678_100347824 3300005456 Bacteria 1274
115 Ga0070662_100111577 3300005457 Bacteria 2084
116 Ga0070681_10086158 3300005458 Bacteria 3094
117 Ga0070681_10112485 3300005458 Bacteria 2662
118 Ga0070681_10113387 3300005458 Bacteria 2650
119 Ga0070681_10354777 3300005458 Bacteria 1377
120 Ga0070681_10467524 3300005458 Bacteria 1174
121 Ga0068867_100004127 3300005459 Bacteria 10203
122 Ga0068867_100074175 3300005459 Bacteria 2550
123 Ga0068867_100852157 3300005459 Bacteria 816
124 Ga0070685_10001503 3300005466 Bacteria 12290
125 Ga0070685_11102103 3300005466 Unclassified 600
126 Ga0070706_100069251 3300005467 Bacteria 3264
127 Ga0070706_100074391 3300005467 Unclassified 3144
128 Ga0070706_100519581 3300005467 Bacteria 1108
129 Ga0070706_100605621 3300005467 Bacteria 1018
130 Ga0070706_100895796 3300005467 Bacteria 820
131 Ga0070707_100064946 3300005468 Bacteria 3505
132 Ga0070707_100080465 3300005468 Bacteria 3145
133 Ga0070707_100088760 3300005468 Bacteria 2991
134 Ga0070707_100158631 3300005468 Bacteria 2204
135 Ga0070707_100263819 3300005468 Bacteria 1675
136 Ga0070707_100510843 3300005468 Bacteria 1163
137 Ga0070698_100011346 3300005471 Bacteria 9462
138 Ga0070698_100046946 3300005471 Bacteria 4415
139 Ga0070698_100100007 3300005471 Bacteria 2873
140 Ga0070698_100140692 3300005471 Bacteria 2364
141 Ga0070698_100252945 3300005471 Bacteria 1694
142 Ga0070698_100734658 3300005471 Unclassified 930
143 Ga0070698_101362834 3300005471 Bacteria 660
144 Ga0070699_100034414 3300005518 Bacteria 4378
145 Ga0070699_100065621 3300005518 Bacteria 3150
146 Ga0070699_100119033 3300005518 Bacteria 2322
147 Ga0070699_100134166 3300005518 Bacteria 2183
148 Ga0070699_100728365 3300005518 Bacteria 907
149 Ga0070679_100012562 3300005530 Bacteria 8099
150 Ga0070679_100045639 3300005530 Bacteria 4366
151 Ga0070679_100126545 3300005530 Bacteria 2537
152 Ga0070679_100339854 3300005530 Bacteria 1449
153 Ga0070679_100438353 3300005530 Bacteria 1251
154 Ga0070684_100000799 3300005535 Bacteria 21882
155 Ga0070684_100011246 3300005535 Bacteria 7126
156 Ga0070684_100662843 3300005535 Bacteria 972
157 Ga0070697_100431839 3300005536 Bacteria 1145
158 Ga0070697_100471372 3300005536 Bacteria 1096
159 Ga0068853_100123750 3300005539 Bacteria 2309
160 Ga0068853_101903701 3300005539 Bacteria 577
161 Ga0070672_100756827 3300005543 Bacteria 853
162 Ga0070672_100858112 3300005543 Unclassified 801
163 Ga0070686_100097025 3300005544 Bacteria 1983
164 Ga0070686_100132575 3300005544 Bacteria 1725
165 Ga0070686_100471996 3300005544 Bacteria 968
166 Ga0070695_100084074 3300005545 Bacteria 2110
167 Ga0070695_100189145 3300005545 Bacteria 1464
168 Ga0070695_100231283 3300005545 Unclassified 1336
169 Ga0070695_100374378 3300005545 Bacteria 1073
170 Ga0070696_100057639 3300005546 Bacteria 2711
171 Ga0070696_100088159 3300005546 Bacteria 2205
172 Ga0070696_100135737 3300005546 Bacteria 1794
173 Ga0070693_100048890 3300005547 Bacteria 2410
174 Ga0070693_100127440 3300005547 Bacteria 1586
175 Ga0070693_100265880 3300005547 Bacteria 1143
176 Ga0070693_100541908 3300005547 Bacteria 832
177 Ga0070665_101122580 3300005548 Bacteria 798
178 Ga0070704_100143365 3300005549 Bacteria 1868
179 Ga0070704_100176953 3300005549 Bacteria 1703
180 Ga0070704_100259472 3300005549 Bacteria 1431
181 Ga0070704_100292602 3300005549 Unclassified 1354
182 Ga0068855_100010923 3300005563 Bacteria 10959
183 Ga0068855_100082705 3300005563 Bacteria 3720
184 Ga0068855_100153338 3300005563 Bacteria 2618
185 Ga0068855_100204561 3300005563 Bacteria 2221
186 Ga0068855_100222731 3300005563 Bacteria 2115
187 Ga0068855_100256458 3300005563 Bacteria 1950
188 Ga0068855_100409880 3300005563 Unclassified 1484
189 Ga0070664_100079756 3300005564 Bacteria 2818
190 Ga0070664_100092804 3300005564 Unclassified 2614
191 Ga0070664_101123134 3300005564 Bacteria 740
192 Ga0068857_100008592 3300005577 Bacteria 8835
193 Ga0068857_100015217 3300005577 Bacteria 6713
194 Ga0068857_100064962 3300005577 Bacteria 3244
195 Ga0068857_100071410 3300005577 Bacteria 3093
196 Ga0068857_100499315 3300005577 Bacteria 1142
197 Ga0068857_101030882 3300005577 Bacteria 793
198 Ga0068854_100065947 3300005578 Bacteria 2633
199 Ga0068854_100596133 3300005578 Unclassified 943
200 Ga0068854_101517773 3300005578 Bacteria 609
201 Ga0068856_100278422 3300005614 Bacteria 1690
202 Ga0068856_100368382 3300005614 Bacteria 1455
203 Ga0070702_100013242 3300005615 Bacteria 4159
204 Ga0070702_100082833 3300005615 Bacteria 1926
205 Ga0070702_100634345 3300005615 Bacteria 806
206 Ga0068852_100408502 3300005616 Bacteria 1337
207 Ga0068852_100596464 3300005616 Unclassified 1108
208 Ga0068859_100170259 3300005617 Bacteria 2259
209 Ga0068859_100291218 3300005617 Unclassified 1726
210 Ga0068866_10011612 3300005718 Bacteria 3816
211 Ga0068866_10160677 3300005718 Unclassified 1310
212 Ga0068861_100011174 3300005719 Bacteria 6234
213 Ga0068861_100020039 3300005719 Bacteria 4784
214 Ga0068863_100507594 3300005841 Bacteria 1188
215 Ga0068858_101343473 3300005842 Bacteria 704
216 Ga0068860_101395787 3300005843 Bacteria 722
217 Ga0068862_100067107 3300005844 Bacteria 3092
218 Ga0068862_100430731 3300005844 Bacteria 1240
219 Ga0081455_10001178 3300005937 Bacteria 32690
220 Ga0081455_10018946 3300005937 Bacteria 6526
221 Ga0081455_10047799 3300005937 Bacteria 3702
222 Ga0081455_10049699 3300005937 Bacteria 3613
223 Ga0081455_10088446 3300005937 Bacteria 2517
224 Ga0081455_10212653 3300005937 Bacteria 1440
225 Ga0081455_10363109 3300005937 Bacteria 1017
226 Ga0081538_10000021 3300005981 Bacteria 138488
227 Ga0081538_10000138 3300005981 Bacteria 75121
228 Ga0081538_10000649 3300005981 Bacteria 38484
229 Ga0081538_10007374 3300005981 Bacteria 9526
230 Ga0081538_10017018 3300005981 Bacteria 5541
231 Ga0081538_10018623 3300005981 Bacteria 5203
232 Ga0081540_1003497 3300005983 Bacteria 12399
233 Ga0081540_1019956 3300005983 Bacteria 4050
234 Ga0081540_1024007 3300005983 Bacteria 3549
235 Ga0081540_1061713 3300005983 Bacteria 1785
236 Ga0081539_10004185 3300005985 Bacteria 16344
237 Ga0070717_10087370 3300006028 Bacteria 2626
238 Ga0070717_10176447 3300006028 Bacteria 1861
239 Ga0075365_10009205 3300006038 Bacteria 5664
240 Ga0075363_100169169 3300006048 Bacteria 1240
241 Ga0075432_10011105 3300006058 Bacteria 3058
242 Ga0075432_10141947 3300006058 Bacteria 917
243 Ga0070715_10019654 3300006163 Unclassified 2594
244 Ga0070715_10050508 3300006163 Bacteria 1786
245 Ga0070715_10457392 3300006163 Bacteria 722
246 Ga0070716_100005213 3300006173 Bacteria 6280
247 Ga0070716_100020081 3300006173 Bacteria 3503
248 Ga0070716_100099369 3300006173 Bacteria 1780
249 Ga0070716_100114929 3300006173 Bacteria 1674
250 Ga0070716_100260874 3300006173 Bacteria 1185
251 Ga0070712_100017483 3300006175 Bacteria 4643
252 Ga0070712_100080695 3300006175 Bacteria 2355
253 Ga0070712_100134940 3300006175 Bacteria 1875
254 Ga0070712_100184214 3300006175 Unclassified 1629
255 Ga0070712_100250739 3300006175 Bacteria 1414
256 Ga0075362_10005326 3300006177 Bacteria 4700
257 Ga0097621_100156276 3300006237 Bacteria 1957
258 Ga0097621_101304370 3300006237 Unclassified 686
259 Ga0068871_100203276 3300006358 Bacteria 1711
260 Ga0068871_101652643 3300006358 Bacteria 607
261 Ga0075428_100057582 3300006844 Bacteria 4254
262 Ga0075428_100140206 3300006844 Bacteria 2629
263 Ga0075428_100347587 3300006844 Bacteria 1592
264 Ga0075428_100474947 3300006844 Bacteria 1338
265 Ga0075428_100497354 3300006844 Bacteria 1305
266 Ga0075428_100525543 3300006844 Bacteria 1265
267 Ga0075428_101313151 3300006844 Unclassified 761
268 Ga0075428_101569851 3300006844 Bacteria 688
269 Ga0075430_100038236 3300006846 Bacteria 4066
270 Ga0075430_100233556 3300006846 Bacteria 1525
271 Ga0075431_100021608 3300006847 Bacteria 6583
272 Ga0075431_100027665 3300006847 Bacteria 5819
273 Ga0075431_100129061 3300006847 Bacteria 2609
274 Ga0075431_100198362 3300006847 Bacteria 2054
275 Ga0075431_100604865 3300006847 Bacteria 1080
276 Ga0075431_101563816 3300006847 Bacteria 617
277 Ga0075433_10052452 3300006852 Bacteria 3554
278 Ga0075433_10073882 3300006852 Bacteria 3000
279 Ga0075433_10139496 3300006852 Bacteria 2155
280 Ga0075433_10946878 3300006852 Bacteria 751
281 Ga0075434_100023038 3300006871 Bacteria 6063
282 Ga0075434_100075447 3300006871 Bacteria 3365
283 Ga0075434_100225890 3300006871 Bacteria 1892
284 Ga0075434_100283745 3300006871 Bacteria 1675
285 Ga0075434_100290291 3300006871 Bacteria 1655
286 Ga0075434_101435524 3300006871 Bacteria 700
287 Ga0075429_100099327 3300006880 Bacteria 2539
288 Ga0075429_100735975 3300006880 Bacteria 864
289 Ga0068865_100003775 3300006881 Bacteria 9094
290 Ga0068865_100136947 3300006881 Unclassified 1841
291 Ga0068865_100420452 3300006881 Bacteria 1099
292 Ga0068865_100714023 3300006881 Unclassified 858
293 Ga0075436_100041620 3300006914 Bacteria 3170
294 Ga0075436_100182574 3300006914 Bacteria 1483
295 Ga0075436_101175364 3300006914 Bacteria 579
296 Ga0097620_100170261 3300006931 Bacteria 2259
297 Ga0097620_100291199 3300006931 Unclassified 1726
298 Ga0097620_102410509 3300006931 Unclassified 580
299 Ga0075435_100007092 3300007076 Bacteria 7959
300 Ga0075435_100022813 3300007076 Bacteria 4831
301 Ga0075435_100071667 3300007076 Bacteria 2830
302 Ga0075435_100114122 3300007076 Bacteria 2249
303 Ga0105240_10019847 3300009093 Bacteria 8977
304 Ga0105240_10476277 3300009093 Bacteria 1392
305 Ga0105240_11110398 3300009093 Bacteria 841
306 Ga0111539_10027300 3300009094 Bacteria 6971
307 Ga0111539_10096592 3300009094 Bacteria 3471
308 Ga0111539_10349612 3300009094 Bacteria 1720
309 Ga0111539_10427459 3300009094 Bacteria 1542
310 Ga0111539_10489365 3300009094 Unclassified 1433
311 Ga0111539_10854121 3300009094 Bacteria 1059
312 Ga0111539_12333355 3300009094 Bacteria 621
313 Ga0105245_10019659 3300009098 Bacteria 5918
314 Ga0105245_10141805 3300009098 Unclassified 2264
315 Ga0105245_10529443 3300009098 Bacteria 1198
316 Ga0105245_11253563 3300009098 Bacteria 790
317 Ga0105247_10039826 3300009101 Bacteria 2871
318 Ga0105247_10244632 3300009101 Bacteria 1224
319 Ga0105247_11042416 3300009101 Unclassified 641
320 Ga0114129_10038479 3300009147 Bacteria 6746
321 Ga0114129_10064757 3300009147 Bacteria 5101
322 Ga0114129_10099426 3300009147 Unclassified 4026
323 Ga0114129_10106794 3300009147 Bacteria 3867
324 Ga0114129_10149545 3300009147 Bacteria 3196
325 Ga0114129_10439523 3300009147 Bacteria 1713
326 Ga0114129_10859167 3300009147 Bacteria 1153
327 Ga0114129_10956171 3300009147 Bacteria 1082
328 Ga0105243_10068824 3300009148 Bacteria 2854
329 Ga0105243_10103799 3300009148 Bacteria 2364
330 Ga0105243_10169896 3300009148 Bacteria 1887
331 Ga0105243_10187215 3300009148 Bacteria 1805
332 Ga0105243_10332675 3300009148 Unclassified 1388
333 Ga0105243_10557355 3300009148 Unclassified 1096
334 Ga0105243_10622177 3300009148 Bacteria 1042
335 Ga0105243_10674002 3300009148 Bacteria 1005
336 Ga0105241_10028797 3300009174 Bacteria 4139
337 Ga0105241_10047092 3300009174 Bacteria 3277
338 Ga0105241_10118663 3300009174 Bacteria 2127
339 Ga0105242_10022608 3300009176 Bacteria 4948
340 Ga0105242_10029025 3300009176 Bacteria 4408
341 Ga0105242_10094391 3300009176 Bacteria 2523
342 Ga0105242_10294092 3300009176 Bacteria 1480
343 Ga0105242_10887844 3300009176 Bacteria 890
344 Ga0105248_10039381 3300009177 Bacteria 5292
345 Ga0105248_10096553 3300009177 Bacteria 3329
346 Ga0105248_10304220 3300009177 Bacteria 1796
347 Ga0105248_12685016 3300009177 Bacteria 568
348 Ga0105238_10411502 3300009551 Bacteria 1346
349 Ga0105238_10457885 3300009551 Bacteria 1273
350 Ga0105249_10036380 3300009553 Bacteria 4465
351 Ga0105249_10217120 3300009553 Bacteria 1880
352 Ga0105249_10999955 3300009553 Bacteria 905
353 Ga0105239_10066176 3300010375 Bacteria 3970
354 Ga0105239_10083931 3300010375 Bacteria 3508
355 Ga0105239_10092694 3300010375 Bacteria 3335
356 Ga0105239_10204769 3300010375 Bacteria 2211
357 Ga0105239_11069792 3300010375 Bacteria 928
358 Ga0105246_10007182 3300011119 Bacteria 6822
359 Ga0157320_1028328 3300012481 Unclassified 552
360 Ga0157343_1009265 3300012488 Bacteria 725
361 Ga0157347_1007249 3300012502 Bacteria 1104
362 Ga0157313_1001914 3300012503 Bacteria 1183
363 Ga0157339_1028723 3300012505 Bacteria 638
364 Ga0157342_1003934 3300012507 Bacteria 1297
365 Ga0157316_1015938 3300012510 Unclassified 766
366 Ga0157327_1030667 3300012512 Bacteria 669
367 Ga0157338_1000279 3300012515 Bacteria 2760
368 Ga0154016_132876 3300013045 Bacteria 780
369 Ga0157371_10071143 3300013102 Bacteria 2462
370 Ga0157371_10183340 3300013102 Unclassified 1497
371 Ga0157371_10698887 3300013102 Bacteria 759
372 Ga0157370_10008089 3300013104 Bacteria 11384
373 Ga0157370_10086066 3300013104 Bacteria 2953
374 Ga0157370_10230176 3300013104 Bacteria 1716
375 Ga0157369_11438057 3300013105 Bacteria 702
376 Ga0157369_12021996 3300013105 Unclassified 585
377 Ga0157374_10050689 3300013296 Bacteria 3860
378 Ga0157374_10540208 3300013296 Bacteria 1173
379 Ga0157378_10197538 3300013297 Bacteria 1901
380 Ga0157378_10548964 3300013297 Bacteria 1160
381 Ga0157378_11904611 3300013297 Bacteria 644
382 Ga0163162_10273823 3300013306 Bacteria 1820
383 Ga0157372_10028322 3300013307 Bacteria 6113
384 Ga0157372_10268198 3300013307 Bacteria 1983
385 Ga0157372_10512605 3300013307 Bacteria 1398
386 Ga0157372_10908629 3300013307 Bacteria 1021
387 Ga0157372_10986794 3300013307 Bacteria 976
388 Ga0157372_11143157 3300013307 Bacteria 900
389 Ga0157375_10080761 3300013308 Bacteria 3290
390 Ga0157375_10193415 3300013308 Bacteria 2189
391 Ga0157375_10247962 3300013308 Unclassified 1941
392 Ga0157375_10843708 3300013308 Unclassified 1063
393 Ga0157375_11624148 3300013308 Bacteria 764
394 Ga0163163_10439583 3300014325 Unclassified 1364
395 Ga0157380_10453549 3300014326 Bacteria 1232
396 Ga0182008_10244503 3300014497 Bacteria 924
397 Ga0157377_10003315 3300014745 Bacteria 7275
398 Ga0157377_10211637 3300014745 Bacteria 1237
399 Ga0157379_10484666 3300014968 Unclassified 1145
400 Ga0157376_10292884 3300014969 Bacteria 1537
401 Ga0157376_10342116 3300014969 Unclassified 1429
402 Ga0157376_10342907 3300014969 Bacteria 1427
403 Ga0157376_11642904 3300014969 Bacteria 677
404 Ga0182006_1070513 3300015261 Bacteria 1297
405 Ga0182005_1073834 3300015265 Bacteria 938
406 Ga0182005_1242909 3300015265 Bacteria 555
407 Ga0163161_10388766 3300017792 Bacteria 1116
408 Ga0163161_10574168 3300017792 Unclassified 927
409 Ga0163161_10972918 3300017792 Bacteria 723
410 Ga0197907_10188215 3300020069 Bacteria 1102
411 Ga0206356_10897941 3300020070 Bacteria 2347
412 Ga0206356_10970350 3300020070 Bacteria 2439
413 Ga0206356_11081930 3300020070 Bacteria 1604
414 Ga0206349_1185021 3300020075 Bacteria 707
415 Ga0206349_1667707 3300020075 Bacteria 1118
416 Ga0206355_1152397 3300020076 Bacteria 1431
417 Ga0206351_10032051 3300020077 Bacteria 1326
418 Ga0206351_10695050 3300020077 Bacteria 990
419 Ga0206352_11232016 3300020078 Bacteria 1280
420 Ga0206350_11574031 3300020080 Bacteria 1039
421 Ga0206354_10190292 3300020081 Bacteria 2809
422 Ga0206354_10337611 3300020081 Unclassified 596
423 Ga0206354_11346914 3300020081 Unclassified 2390
424 Ga0206353_10046952 3300020082 Bacteria 9286
425 Ga0206353_10072795 3300020082 Bacteria 590
426 Ga0206353_10717995 3300020082 Bacteria 2299
427 Ga0206353_11373027 3300020082 Bacteria 3238
428 Ga0154015_1261515 3300020610 Bacteria 734
429 Ga0154015_1543957 3300020610 Unclassified 769
430 Ga0213871_10034944 3300021441 Bacteria 1327
431 Ga0224712_10019853 3300022467 Unclassified 2273
432 Ga0207656_10120689 3300025321 Bacteria 1220
433 Ga0207692_10037924 3300025898 Bacteria 2360
434 Ga0207692_10045495 3300025898 Bacteria 2196
435 Ga0207692_10097640 3300025898 Bacteria 1606
436 Ga0207642_10538637 3300025899 Unclassified 719
437 Ga0207642_11064233 3300025899 Bacteria 522
438 Ga0207710_10030397 3300025900 Bacteria 2356
439 Ga0207688_10033801 3300025901 Bacteria 2829
440 Ga0207688_10098278 3300025901 Bacteria 1687
441 Ga0207688_10133363 3300025901 Unclassified 1457
442 Ga0207688_10190407 3300025901 Bacteria 1227
443 Ga0207688_10610973 3300025901 Bacteria 687
444 Ga0207680_10080065 3300025903 Bacteria 2050
445 Ga0207647_10427341 3300025904 Bacteria 744
446 Ga0207699_10055631 3300025906 Bacteria 2355
447 Ga0207699_10071435 3300025906 Bacteria 2122
448 Ga0207699_10096767 3300025906 Bacteria 1864
449 Ga0207699_10132111 3300025906 Bacteria 1630
450 Ga0207699_10586790 3300025906 Bacteria 811
451 Ga0207699_10710216 3300025906 Bacteria 736
452 Ga0207643_10062453 3300025908 Bacteria 2129
453 Ga0207705_10869412 3300025909 Bacteria 699
454 Ga0207705_11329059 3300025909 Bacteria 548
455 Ga0207684_10036127 3300025910 Bacteria 4194
456 Ga0207684_10121551 3300025910 Bacteria 2239
457 Ga0207684_10249817 3300025910 Bacteria 1530
458 Ga0207684_10324158 3300025910 Bacteria 1327
459 Ga0207684_10357059 3300025910 Bacteria 1258
460 Ga0207684_10861011 3300025910 Bacteria 764
461 Ga0207684_11261494 3300025910 Bacteria 610
462 Ga0207654_10038632 3300025911 Unclassified 2680
463 Ga0207654_10488819 3300025911 Bacteria 868
464 Ga0207707_10039023 3300025912 Bacteria 4151
465 Ga0207707_10041740 3300025912 Bacteria 4006
466 Ga0207707_10043445 3300025912 Bacteria 3921
467 Ga0207695_10077461 3300025913 Bacteria 3377
468 Ga0207695_10703647 3300025913 Bacteria 891
469 Ga0207695_11648716 3300025913 Unclassified 522
470 Ga0207671_10448242 3300025914 Bacteria 1028
471 Ga0207671_10748480 3300025914 Unclassified 776
472 Ga0207693_10000406 3300025915 Bacteria 39259
473 Ga0207693_10001431 3300025915 Bacteria 21143
474 Ga0207693_10006501 3300025915 Bacteria 9675
475 Ga0207693_10079809 3300025915 Bacteria 2562
476 Ga0207693_10110316 3300025915 Bacteria 2157
477 Ga0207663_10008237 3300025916 Bacteria 5441
478 Ga0207663_10013339 3300025916 Bacteria 4464
479 Ga0207663_10118612 3300025916 Bacteria 1807
480 Ga0207663_10136405 3300025916 Bacteria 1703
481 Ga0207660_10023066 3300025917 Bacteria 4199
482 Ga0207660_10098552 3300025917 Unclassified 2180
483 Ga0207660_11173081 3300025917 Bacteria 625
484 Ga0207662_10019934 3300025918 Bacteria 3821
485 Ga0207662_10524967 3300025918 Unclassified 818
486 Ga0207657_10000073 3300025919 Bacteria 93299
487 Ga0207657_10413643 3300025919 Bacteria 1060
488 Ga0207649_10152961 3300025920 Bacteria 1591
489 Ga0207652_10015439 3300025921 Bacteria 6206
490 Ga0207652_10188369 3300025921 Bacteria 1855
491 Ga0207646_10006672 3300025922 Bacteria 11900
492 Ga0207646_10034338 3300025922 Bacteria 4583
493 Ga0207646_10105029 3300025922 Bacteria 2533
494 Ga0207646_10190275 3300025922 Bacteria 1853
495 Ga0207646_11313264 3300025922 Bacteria 631
496 Ga0207681_10872586 3300025923 Bacteria 753
497 Ga0207681_11772699 3300025923 Bacteria 515
498 Ga0207694_10694838 3300025924 Bacteria 858
499 Ga0207650_10382499 3300025925 Unclassified 1162
500 Ga0207650_10389169 3300025925 Unclassified 1152
501 Ga0207659_10340124 3300025926 Bacteria 1243
502 Ga0207687_10012396 3300025927 Bacteria 5571
503 Ga0207687_10044904 3300025927 Bacteria 3052
504 Ga0207687_10060282 3300025927 Bacteria 2676
505 Ga0207687_10090718 3300025927 Bacteria 2228
506 Ga0207687_10250052 3300025927 Unclassified 1409
507 Ga0207687_10423700 3300025927 Bacteria 1099
508 Ga0207687_10841638 3300025927 Bacteria 784
509 Ga0207687_11521695 3300025927 Bacteria 575
510 Ga0207687_11708103 3300025927 Bacteria 539
511 Ga0207700_10416377 3300025928 Bacteria 1180
512 Ga0207700_10791221 3300025928 Unclassified 848
513 Ga0207664_10033314 3300025929 Bacteria 3957
514 Ga0207664_10095633 3300025929 Unclassified 2444
515 Ga0207664_10142050 3300025929 Bacteria 2032
516 Ga0207664_10222265 3300025929 Bacteria 1638
517 Ga0207664_10240069 3300025929 Bacteria 1578
518 Ga0207664_10383061 3300025929 Bacteria 1249
519 Ga0207664_10832798 3300025929 Bacteria 829
520 Ga0207644_11335499 3300025931 Bacteria 602
521 Ga0207690_10571984 3300025932 Bacteria 920
522 Ga0207706_10342978 3300025933 Bacteria 1299
523 Ga0207686_10112002 3300025934 Bacteria 1842
524 Ga0207686_10125432 3300025934 Bacteria 1754
525 Ga0207686_10162485 3300025934 Bacteria 1567
526 Ga0207686_10570264 3300025934 Bacteria 887
527 Ga0207709_10069478 3300025935 Bacteria 2230
528 Ga0207709_10119363 3300025935 Bacteria 1778
529 Ga0207709_10155277 3300025935 Bacteria 1590
530 Ga0207709_10232971 3300025935 Bacteria 1335
531 Ga0207709_10263083 3300025935 Unclassified 1266
532 Ga0207709_10273851 3300025935 Bacteria 1244
533 Ga0207709_10803658 3300025935 Unclassified 759
534 Ga0207670_10014455 3300025936 Bacteria 4686
535 Ga0207670_10823824 3300025936 Unclassified 774
536 Ga0207669_10162245 3300025937 Bacteria 1580
537 Ga0207704_10118772 3300025938 Unclassified 1804
538 Ga0207665_10004586 3300025939 Bacteria 9174
539 Ga0207665_10010758 3300025939 Bacteria 6009
540 Ga0207665_10054526 3300025939 Bacteria 2696
541 Ga0207665_10086520 3300025939 Bacteria 2165
542 Ga0207665_10140452 3300025939 Bacteria 1722
543 Ga0207665_11183908 3300025939 Bacteria 610
544 Ga0207691_10017674 3300025940 Bacteria 6760
545 Ga0207691_10297260 3300025940 Unclassified 1388
546 Ga0207691_10338873 3300025940 Bacteria 1287
547 Ga0207711_10249995 3300025941 Bacteria 1628
548 Ga0207711_10830584 3300025941 Bacteria 860
549 Ga0207689_10127340 3300025942 Bacteria 2095
550 Ga0207661_10000326 3300025944 Bacteria 30199
551 Ga0207661_10040652 3300025944 Bacteria 3656
552 Ga0207661_10055471 3300025944 Bacteria 3178
553 Ga0207661_10068582 3300025944 Bacteria 2888
554 Ga0207661_10831596 3300025944 Bacteria 850
555 Ga0207661_10951577 3300025944 Bacteria 791
556 Ga0207679_10188839 3300025945 Unclassified 1711
557 Ga0207679_11247574 3300025945 Bacteria 682
558 Ga0207679_11357765 3300025945 Bacteria 652
559 Ga0207667_10042798 3300025949 Bacteria 4811
560 Ga0207667_10107678 3300025949 Bacteria 2876
561 Ga0207667_10122160 3300025949 Bacteria 2683
562 Ga0207667_10181302 3300025949 Bacteria 2163
563 Ga0207667_10211870 3300025949 Bacteria 1986
564 Ga0207667_10212183 3300025949 Bacteria 1984
565 Ga0207667_10446039 3300025949 Bacteria 1315
566 Ga0207667_10697762 3300025949 Bacteria 1018
567 Ga0207667_11799391 3300025949 Bacteria 577
568 Ga0207651_10220248 3300025960 Bacteria 1534
569 Ga0207651_10803230 3300025960 Bacteria 834
570 Ga0207712_10074120 3300025961 Bacteria 2457
571 Ga0207712_10491417 3300025961 Bacteria 1048
572 Ga0207640_10053830 3300025981 Bacteria 2628
573 Ga0207640_10182053 3300025981 Unclassified 1576
574 Ga0207640_11549665 3300025981 Bacteria 596
575 Ga0207658_10004832 3300025986 Bacteria 9316
576 Ga0207658_10148116 3300025986 Bacteria 1909
577 Ga0207677_10015265 3300026023 Bacteria 4511
578 Ga0207677_10022503 3300026023 Bacteria 3875
579 Ga0207677_10060395 3300026023 Bacteria 2620
580 Ga0207677_10063219 3300026023 Bacteria 2572
581 Ga0207677_10181778 3300026023 Bacteria 1655
582 Ga0207677_10332586 3300026023 Bacteria 1266
583 Ga0207703_10764948 3300026035 Bacteria 921
584 Ga0207639_10701075 3300026041 Bacteria 939
585 Ga0207639_11409935 3300026041 Bacteria 654
586 Ga0207708_10000563 3300026075 Bacteria 28653
587 Ga0207708_10011914 3300026075 Bacteria 6477
588 Ga0207708_10022231 3300026075 Bacteria 4788
589 Ga0207702_10193158 3300026078 Unclassified 1882
590 Ga0207702_10246673 3300026078 Bacteria 1675
591 Ga0207702_10256646 3300026078 Bacteria 1644
592 Ga0207702_11406172 3300026078 Bacteria 691
593 Ga0207702_11849879 3300026078 Unclassified 595
594 Ga0207641_11029295 3300026088 Bacteria 821
595 Ga0207648_10034191 3300026089 Bacteria 4482
596 Ga0207648_10081001 3300026089 Bacteria 2832
597 Ga0207676_10251224 3300026095 Bacteria 1592
598 Ga0207674_10002539 3300026116 Bacteria 22997
599 Ga0207674_10019424 3300026116 Bacteria 7357
600 Ga0207674_10072841 3300026116 Bacteria 3450
601 Ga0207674_10190650 3300026116 Bacteria 2000
602 Ga0207674_10446731 3300026116 Bacteria 1250
603 Ga0207675_100021594 3300026118 Bacteria 5995
604 Ga0207675_100066350 3300026118 Bacteria 3373
605 Ga0207683_10001199 3300026121 Bacteria 23464
606 Ga0207683_10016391 3300026121 Bacteria 6305
607 Ga0207683_10027770 3300026121 Bacteria 4890
608 Ga0207683_10041472 3300026121 Bacteria 4019
609 Ga0207683_10448683 3300026121 Bacteria 1189
610 Ga0209983_1070447 3300027665 Bacteria 779
611 Ga0209998_10015612 3300027717 Bacteria 1592
612 Ga0207428_10013275 3300027907 Bacteria 7202
613 Ga0207428_10021472 3300027907 Bacteria 5466
614 Ga0207428_10169653 3300027907 Bacteria 1653
615 Ga0207428_10307414 3300027907 Bacteria 1173
616 Ga0207428_10308025 3300027907 Bacteria 1171
617 Ga0207428_10335298 3300027907 Bacteria 1115
618 Ga0207428_10441047 3300027907 Bacteria 950
619 Ga0207428_10550923 3300027907 Bacteria 834
620 Ga0268266_10109253 3300028379 Bacteria 2449
621 Ga0268265_10133985 3300028380 Unclassified 2064
622 Ga0268265_10495479 3300028380 Bacteria 1150
623 Ga0268264_10356041 3300028381 Bacteria 1395
624 Ga0265326_10073939 3300028558 Bacteria 963
625 Ga0265318_10008580 3300028577 Bacteria 4540
626 Ga0265338_10090707 3300028800 Bacteria 2529
627 Ga0265338_10105966 3300028800 Bacteria 2277
628 Ga0265330_10037962 3300031235 Bacteria 2142
629 Ga0265332_10045862 3300031238 Bacteria 1883
630 Ga0265328_10059321 3300031239 Bacteria 1405
631 Ga0265320_10142303 3300031240 Bacteria 1086
632 Ga0265320_10197892 3300031240 Bacteria 898
633 Ga0265329_10078919 3300031242 Bacteria 1042
634 Ga0265331_10097366 3300031250 Bacteria 1356
635 Ga0265327_10013725 3300031251 Bacteria 5358
636 Ga0265327_10434619 3300031251 Bacteria 568
637 Ga0265316_10351250 3300031344 Bacteria 1067
638 Ga0307408_100266312 3300031548 Unclassified 1421
639 Ga0265313_10002660 3300031595 Bacteria 15177
640 Ga0265313_10106763 3300031595 Bacteria 1236
641 Ga0265314_10003929 3300031711 Bacteria 14127
642 Ga0265342_10021909 3300031712 Bacteria 4071
643 Ga0307405_10231428 3300031731 Unclassified 1363
644 Ga0307405_11920543 3300031731 Bacteria 528
645 Ga0307413_11408303 3300031824 Bacteria 613
646 Ga0307410_10078762 3300031852 Bacteria 2307
647 Ga0307406_10089339 3300031901 Bacteria 2070
648 Ga0307406_10766804 3300031901 Unclassified 811
649 Ga0307407_10319100 3300031903 Bacteria 1090
650 Ga0307412_10161871 3300031911 Bacteria 1664
651 Ga0307412_10814367 3300031911 Bacteria 812
652 Ga0307409_100190963 3300031995 Bacteria 1823
653 Ga0307409_100207612 3300031995 Bacteria 1758
654 Ga0307409_100822478 3300031995 Bacteria 938
655 Ga0307416_100045501 3300032002 Bacteria 3456
656 Ga0307416_100104032 3300032002 Unclassified 2481
657 Ga0307416_100200676 3300032002 Bacteria 1892
658 Ga0307416_100556176 3300032002 Bacteria 1221
659 Ga0307416_100734655 3300032002 Bacteria 1079
660 Ga0307411_10185284 3300032005 Bacteria 1584
661 Ga0307411_11789552 3300032005 Bacteria 570
662 Ga0307415_100098074 3300032126 Bacteria 2141
663 Ga0373948_0007313 3300034817 Bacteria 1853
664 Ga0373950_0000817 3300034818 Bacteria 3909
665 Ga0373958_0000854 3300034819 Bacteria 3920
666 Ga0373958_0071967 3300034819 Unclassified 769
667 Ga0373938_0002204 3300034957 Bacteria 3126
668 Ga0373926_0028415 3300035083 Bacteria 1963
669 Ga0373926_0046649 3300035083 Bacteria 1555
670 Ga0373928_0021966 3300035084 Bacteria 1350
671 Ga0373929_0000828 3300035085 Bacteria 6039
672 Ga0373940_0001455 3300035088 Bacteria 4285
673 Ga0373944_0092162 3300035089 Bacteria 1014
674 Ga0373952_0001596 3300035092 Bacteria 4136
675 Ga0373923_0272686 3300035111 Unclassified 796
676 Ga0373932_0002583 3300035112 Bacteria 4522
677 Ga0373936_0035715 3300035113 Bacteria 1979
678 Ga0373936_0160596 3300035113 Bacteria 979
679 Ga0373939_0000760 3300035114 Bacteria 7951
680 Ga0373939_0519418 3300035114 Bacteria 511
681 Ga0373941_0002021 3300035115 Bacteria 4390
682 Ga0373945_0005021 3300035116 Bacteria 4215
683 Ga0373945_0025445 3300035116 Bacteria 2056
684 Ga0373953_0205213 3300035117 Bacteria 853
685 Ga0373956_0057187 3300035119 Bacteria 1762
686 Ga0373956_0284712 3300035119 Unclassified 787
687 Ga0373960_0085538 3300035121 Unclassified 1000
688 Ga0373943_0019130 3300035170 Bacteria 3149
689 Ga0373943_0026389 3300035170 Bacteria 2721
690 Ga0373943_0236619 3300035170 Bacteria 1022
691 Ga0373946_0063292 3300035171 Bacteria 1580
692 Ga0373946_0106933 3300035171 Bacteria 1261
693 Ga0373946_0164950 3300035171 Bacteria 1042
694 Ga0373942_0151020 3300035207 Bacteria 746
695 Ga0373962_0150607 3300035242 Unclassified 761
696 Ga0373931_0001397 3300035691 Bacteria 10334
697 Ga0373931_0361673 3300035691 Unclassified 911
698 Ga0373931_0864061 3300035691 Unclassified 606
699 Ga0373935_0083863 3300035692 Bacteria 2075
700 Ga0373935_0177103 3300035692 Bacteria 1462
701 Ga0373935_0234191 3300035692 Bacteria 1280
702 Ga0373935_0499371 3300035692 Bacteria 883
703 Ga0373935_0525297 3300035692 Bacteria 861
704 Ga0373935_0629289 3300035692 Bacteria 786
705 Ga0373935_0949816 3300035692 Bacteria 638
706 Ga0373927_0207599 3300035695 Bacteria 1286
707 Ga0373927_0231641 3300035695 Bacteria 1214
708 Ga0373927_0250022 3300035695 Bacteria 1165
709 Ga0373947_0003591 3300035725 Bacteria 9146
710 Ga0373947_0018447 3300035725 Bacteria 4015
711 Ga0373947_0076657 3300035725 Bacteria 2061
712 Ga0373947_0090109 3300035725 Bacteria 1911
713 Ga0373947_0417308 3300035725 Bacteria 907
714 Ga0373937_1167426 3300036401 Unclassified 718
715 Ga0373925_0003351 3300037068 Bacteria 12427
716 Ga0373925_0060908 3300037068 Bacteria 2834
717 Ga0373925_0629143 3300037068 Bacteria 884
718 Ga0373925_1016386 3300037068 Bacteria 683
719 Ga0395899_0001940 3300037312 Bacteria 17023
720 Ga0395899_0005860 3300037312 Bacteria 9539
721 Ga0395899_0019594 3300037312 Bacteria 5136
722 Ga0395899_0031265 3300037312 Bacteria 4001
723 Ga0395899_0039406 3300037312 Bacteria 3536
724 Ga0395899_0059378 3300037312 Bacteria 2819
725 Ga0395899_0069771 3300037312 Bacteria 2573
726 Ga0395899_0174359 3300037312 Bacteria 1513
727 Ga0395899_0199998 3300037312 Bacteria 1394
728 Ga0395899_0200009 3300037312 Bacteria 1394
729 Ga0395899_0242067 3300037312 Bacteria 1241
730 Ga0395899_0350157 3300037312 Bacteria 988
731 Ga0395899_0501994 3300037312 Bacteria 787
732 Ga0395900_0005665 3300037418 Bacteria 13060
733 Ga0395900_0013360 3300037418 Bacteria 8392
734 Ga0395900_0018023 3300037418 Bacteria 7208
735 Ga0395900_0019727 3300037418 Bacteria 6873
736 Ga0395900_0025675 3300037418 Bacteria 6031
737 Ga0395900_0032072 3300037418 Bacteria 5401
738 Ga0395900_0033304 3300037418 Bacteria 5304
739 Ga0395900_0050786 3300037418 Bacteria 4271
740 Ga0395900_0058706 3300037418 Bacteria 3960
741 Ga0395900_0064573 3300037418 Bacteria 3761
742 Ga0395900_0074860 3300037418 Bacteria 3480
743 Ga0395900_0097035 3300037418 Bacteria 3028
744 Ga0395900_0165071 3300037418 Bacteria 2257
745 Ga0395900_0197925 3300037418 Bacteria 2035
746 Ga0395900_0236158 3300037418 Bacteria 1836
747 Ga0395900_0245716 3300037418 Unclassified 1793
748 Ga0395900_0249622 3300037418 Bacteria 1776
749 Ga0395900_0253738 3300037418 Bacteria 1759
750 Ga0395900_0257620 3300037418 Bacteria 1743
751 Ga0395900_0342409 3300037418 Bacteria 1470
752 Ga0395900_0352344 3300037418 Bacteria 1445
753 Ga0395900_0609743 3300037418 Bacteria 1031
754 Ga0395900_0830909 3300037418 Bacteria 850
755 Ga0395900_0836718 3300037418 Bacteria 846
756 Ga0395900_0953943 3300037418 Unclassified 779
757 Ga0395900_1166334 3300037418 Bacteria 686
758 Ga0395898_0003747 3300037466 Bacteria 16858
759 Ga0395898_0004192 3300037466 Bacteria 15800
760 Ga0395898_0006532 3300037466 Bacteria 12448
761 Ga0395898_0008911 3300037466 Bacteria 10568
762 Ga0395898_0012227 3300037466 Bacteria 8874
763 Ga0395898_0014362 3300037466 Bacteria 8139
764 Ga0395898_0016076 3300037466 Bacteria 7667
765 Ga0395898_0016548 3300037466 Bacteria 7541
766 Ga0395898_0017885 3300037466 Bacteria 7231
767 Ga0395898_0026455 3300037466 Bacteria 5837
768 Ga0395898_0030414 3300037466 Bacteria 5403
769 Ga0395898_0087595 3300037466 Bacteria 2999
770 Ga0395898_0184145 3300037466 Bacteria 1996
771 Ga0395898_0186144 3300037466 Bacteria 1984
772 Ga0395898_0317337 3300037466 Bacteria 1487
773 Ga0395898_0442628 3300037466 Bacteria 1238
774 Ga0395898_0457321 3300037466 Bacteria 1215
775 Ga0395898_0506138 3300037466 Bacteria 1148
776 Ga0395898_0563599 3300037466 Bacteria 1081
777 Ga0395898_0585789 3300037466 Bacteria 1058
778 Ga0395905_0009176 3300037471 Bacteria 9684
779 Ga0395905_0011659 3300037471 Bacteria 8489
780 Ga0395905_0012305 3300037471 Bacteria 8236
781 Ga0395905_0015313 3300037471 Bacteria 7288
782 Ga0395905_0016227 3300037471 Bacteria 7075
783 Ga0395905_0017447 3300037471 Bacteria 6815
784 Ga0395905_0020710 3300037471 Bacteria 6227
785 Ga0395905_0045418 3300037471 Bacteria 4120
786 Ga0395905_0074368 3300037471 Bacteria 3184
787 Ga0395905_0080172 3300037471 Bacteria 3059
788 Ga0395905_0090537 3300037471 Bacteria 2868
789 Ga0395905_0095568 3300037471 Bacteria 2789
790 Ga0395905_0105775 3300037471 Bacteria 2642
791 Ga0395905_0173934 3300037471 Bacteria 2022
792 Ga0395905_0198278 3300037471 Bacteria 1882
793 Ga0395905_0246649 3300037471 Bacteria 1668
794 Ga0395905_0250156 3300037471 Bacteria 1656
795 Ga0395905_0250506 3300037471 Bacteria 1654
796 Ga0395905_0369434 3300037471 Bacteria 1328
797 Ga0395905_0370634 3300037471 Bacteria 1325
798 Ga0395905_0797841 3300037471 Unclassified 847
799 Ga0395901_0007305 3300038443 Bacteria 11151
800 Ga0395901_0008381 3300038443 Bacteria 10453
801 Ga0395901_0008807 3300038443 Bacteria 10211
802 Ga0395901_0009124 3300038443 Bacteria 10043
803 Ga0395901_0009722 3300038443 Bacteria 9752
804 Ga0395901_0010594 3300038443 Bacteria 9340
805 Ga0395901_0016666 3300038443 Bacteria 7486
806 Ga0395901_0019727 3300038443 Bacteria 6892
807 Ga0395901_0045672 3300038443 Bacteria 4547
808 Ga0395901_0066263 3300038443 Bacteria 3761
809 Ga0395901_0067281 3300038443 Bacteria 3731
810 Ga0395901_0073121 3300038443 Bacteria 3575
811 Ga0395901_0087756 3300038443 Bacteria 3252
812 Ga0395901_0088981 3300038443 Bacteria 3230
813 Ga0395901_0089871 3300038443 Bacteria 3214
814 Ga0395901_0101528 3300038443 Bacteria 3018
815 Ga0395901_0110460 3300038443 Bacteria 2886
816 Ga0395901_0134887 3300038443 Bacteria 2594
817 Ga0395901_0196847 3300038443 Bacteria 2113
818 Ga0395901_0208057 3300038443 Bacteria 2048
819 Ga0395901_0215078 3300038443 Bacteria 2010
820 Ga0395901_0262698 3300038443 Bacteria 1796
821 Ga0395901_0287639 3300038443 Bacteria 1706
822 Ga0395901_0337203 3300038443 Bacteria 1558
823 Ga0395901_0417104 3300038443 Bacteria 1377
824 Ga0395901_0462974 3300038443 Bacteria 1295
825 Ga0395901_0783748 3300038443 Bacteria 944
826 Ga0395901_0843172 3300038443 Bacteria 902
827 Ga0395901_0988584 3300038443 Bacteria 818
828 Ga0395901_1053107 3300038443 Bacteria 786
829 Ga0242422_03993 3300038699 Bacteria 945
830 Ga0242420_003515 3300038996 Bacteria 2317
831 Ga0436365_1661088 3300039437 Unclassified 854
832 Ga0436360_0869588 3300039438 Bacteria 2726
833 Ga0439438_170111 3300041405 Bacteria 518
834 Ga0439439_0000609 3300041406 Bacteria 6292
835 Ga0451787_504694 3300041441 Bacteria 627
836 Ga0451789_1348595 3300041443 Bacteria 1546
837 Ga0451791_0029882 3300041451 Bacteria 1171
838 Ga0451793_0388457 3300041452 Bacteria 2816
839 Ga0451795_1086781 3300041456 Bacteria 1129
840 Ga0451798_0656323 3300041458 Bacteria 1034
841 Ga0451802_1084932 3300041460 Bacteria 1295
842 Ga0451802_1879636 3300041460 Bacteria 1670
843 Ga0451802_2165544 3300041460 Bacteria 711
844 Ga0451807_0686639 3300041486 Bacteria 1855
845 Ga0451839_0361804 3300041496 Bacteria 1843
846 Ga0451841_0140081 3300041498 Bacteria 1333
847 Ga0451841_1173093 3300041498 Bacteria 681
848 Ga0451845_0813253 3300041501 Bacteria 789
849 Ga0451849_0285293 3300041505 Bacteria 1332
850 Ga0451849_0920216 3300041505 Bacteria 526
851 Ga0451851_1123922 3300041507 Bacteria 709
852 Ga0451855_0770276 3300041511 Bacteria 1395
853 Ga0451853_1078149 3300041512 Bacteria 1099
854 Ga0451853_2987094 3300041512 Bacteria 1620
855 Ga0451853_3160310 3300041512 Bacteria 570
856 Ga0439431_0104213 3300041997 Bacteria 781
857 Ga0439433_0004556 3300041999 Bacteria 2983
858 Ga0439442_001947 3300042002 Bacteria 4060
859 Ga0439443_060296 3300042003 Bacteria 678
860 Ga0439448_0004319 3300042005 Bacteria 4009
861 Ga0439448_0063090 3300042005 Bacteria 1227
862 Ga0439448_0078308 3300042005 Bacteria 1107
863 Ga0439450_026141 3300042008 Bacteria 1285
864 Ga0439450_031340 3300042008 Unclassified 1197
865 Ga0439450_042827 3300042008 Bacteria 1056
866 Ga0439455_0028173 3300042012 Bacteria 1381
867 Ga0439456_112548 3300042013 Bacteria 620
868 Ga0439462_0003467 3300042015 Bacteria 3783
869 Ga0439463_037472 3300042016 Bacteria 1230
870 Ga0450915_005121 3300042119 Bacteria 799
871 Ga0450888_000932 3300042126 Bacteria 2784
872 Ga0439446_0002878 3300042156 Bacteria 4198
873 Ga0439458_0004418 3300042157 Bacteria 3230
874 Ga0439458_0126975 3300042157 Bacteria 674
875 Ga0450908_038111 3300042184 Bacteria 833
876 Ga0439434_0026808 3300042435 Bacteria 1740
877 Ga0439434_0047178 3300042435 Bacteria 1330
878 Ga0439435_0111272 3300042436 Bacteria 850
879 Ga0439444_0086232 3300042437 Unclassified 694
880 Ga0439459_0008081 3300042438 Bacteria 1791
881 Ga0439464_0124129 3300042439 Bacteria 797
882 Ga0439460_0066696 3300042461 Bacteria 1108
883 Ga0439460_0090270 3300042461 Bacteria 973
884 Ga0450916_065751 3300042530 Bacteria 597
885 Ga0450893_0044822 3300042532 Bacteria 818
886 Ga0450893_0122499 3300042532 Bacteria 544
887 Ga0439440_0107552 3300042993 Bacteria 764
888 Ga0439440_0158982 3300042993 Unclassified 651
889 Ga0439440_0171532 3300042993 Bacteria 631
890 Ga0466969_0043984 3300044656 Bacteria 2224
891 Ga0466972_0504106 3300044658 Bacteria 570
892 Ga0466965_0031336 3300044683 Bacteria 2593
893 Ga0466965_0132715 3300044683 Bacteria 1292
894 Ga0466965_0361847 3300044683 Bacteria 796
895 Ga0466966_0023644 3300044684 Bacteria 4023
896 Ga0466961_0022243 3300044693 Bacteria 4079
897 Ga0466961_0094973 3300044693 Bacteria 1881
898 Ga0466961_0126523 3300044693 Bacteria 1603
899 Ga0466963_0010940 3300044694 Bacteria 5513
900 Ga0466963_0027690 3300044694 Bacteria 3632
901 Ga0466963_0033618 3300044694 Bacteria 3331
902 Ga0466963_0084509 3300044694 Bacteria 2153
903 Ga0466963_0113103 3300044694 Bacteria 1864
904 Ga0466963_0126260 3300044694 Bacteria 1764
905 Ga0466963_0194893 3300044694 Bacteria 1416
906 Ga0466963_0429750 3300044694 Bacteria 931
907 Ga0466963_0477065 3300044694 Bacteria 880
908 Ga0466963_0502089 3300044694 Bacteria 856
909 Ga0466963_0527813 3300044694 Bacteria 833
910 Ga0466963_0681302 3300044694 Bacteria 726
911 Ga0466963_1109014 3300044694 Bacteria 556
912 Ga0466964_0000847 3300044706 Bacteria 10025
913 Ga0466964_0017553 3300044706 Bacteria 2738
914 Ga0466964_0041876 3300044706 Bacteria 1854
915 Ga0466964_0072975 3300044706 Bacteria 1456
916 Ga0466964_0075329 3300044706 Bacteria 1436
917 Ga0466964_0157780 3300044706 Bacteria 1058
918 Ga0466964_0329124 3300044706 Bacteria 779
919 Ga0466964_0377108 3300044706 Bacteria 735
920 Ga0466964_0433643 3300044706 Bacteria 693
921 Ga0466964_0817762 3300044706 Bacteria 528
922 Ga0466971_0049704 3300044719 Bacteria 1887
923 Ga0466971_0057526 3300044719 Bacteria 1754
924 Ga0466971_0077519 3300044719 Bacteria 1513
925 Ga0466971_0160388 3300044719 Bacteria 1053
926 Ga0466968_0004269 3300044735 Bacteria 5333
927 Ga0466968_0060350 3300044735 Bacteria 1635
928 Ga0466968_0086909 3300044735 Bacteria 1380
929 Ga0466968_0219622 3300044735 Bacteria 895
930 Ga0466968_0333740 3300044735 Bacteria 734
931 Ga0466970_0105577 3300044765 Bacteria 1536
932 Ga0466970_0140890 3300044765 Bacteria 1328
933 Ga0466957_0097678 3300044842 Bacteria 1847
934 Ga0466957_0137844 3300044842 Bacteria 1569
935 Ga0466957_0510641 3300044842 Bacteria 834
936 Ga0466957_0719304 3300044842 Bacteria 706
937 Ga0466960_0006072 3300044901 Bacteria 4828
938 Ga0466960_0072631 3300044901 Bacteria 1715
939 Ga0466960_0080778 3300044901 Bacteria 1638
940 Ga0466959_0013052 3300045049 Bacteria 6017
941 Ga0466959_0024209 3300045049 Bacteria 4496
942 Ga0466959_0283191 3300045049 Bacteria 1137
943 Ga0451576_0102879 3300045051 Bacteria 2971
944 Ga0466958_0011139 3300045836 Bacteria 5059
945 Ga0466958_0041683 3300045836 Bacteria 2762
946 Ga0466958_0247779 3300045836 Bacteria 1139
947 Ga0466958_0318387 3300045836 Bacteria 1000
948 Ga0466958_0639699 3300045836 Bacteria 692
949 Ga0466958_0668775 3300045836 Bacteria 676
950 Ga0466958_1170482 3300045836 Bacteria 502
951 Ga0466967_0001517 3300045976 Bacteria 13570
952 Ga0466967_0003014 3300045976 Bacteria 10802
953 Ga0466967_0009587 3300045976 Bacteria 7197
954 Ga0466967_0019987 3300045976 Bacteria 5399
955 Ga0466967_0027642 3300045976 Bacteria 4721
956 Ga0466967_0034503 3300045976 Bacteria 4295
957 Ga0466967_0059861 3300045976 Bacteria 3372
958 Ga0466967_0070363 3300045976 Bacteria 3130
959 Ga0466967_0131984 3300045976 Bacteria 2319
960 Ga0466967_0144149 3300045976 Bacteria 2221
961 Ga0466967_0230156 3300045976 Bacteria 1764
962 Ga0466967_0242257 3300045976 Bacteria 1720
963 Ga0466967_0366690 3300045976 Bacteria 1396
964 Ga0466967_0378173 3300045976 Bacteria 1375
965 Ga0466967_0380377 3300045976 Bacteria 1370
966 Ga0466967_0571103 3300045976 Bacteria 1114
967 Ga0466967_0679309 3300045976 Bacteria 1019
968 Ga0495617_129270 3300046452 Bacteria 811
969 Ga0495627_046651 3300046453 Bacteria 1316
970 Ga0495592_0013250 3300046454 Bacteria 6277
971 Ga0495592_0396244 3300046454 Bacteria 875
972 Ga0495603_0230307 3300046455 Bacteria 1068
973 Ga0495591_114714 3300046458 Bacteria 660
974 Ga0495629_0162179 3300046459 Bacteria 1553
975 Ga0495629_0578436 3300046459 Bacteria 752
976 Ga0495629_0601140 3300046459 Bacteria 736
977 Ga0495641_0031218 3300046461 Bacteria 2547
978 Ga0495651_0013235 3300046462 Bacteria 6378
979 Ga0495651_0158078 3300046462 Bacteria 1627
980 Ga0495653_0154665 3300046463 Bacteria 1599
981 Ga0495580_0772573 3300046472 Bacteria 624
982 Ga0495582_0049433 3300046473 Bacteria 2315
983 Ga0495582_0135521 3300046473 Bacteria 1393
984 Ga0495582_0272041 3300046473 Bacteria 972
985 Ga0495582_0363573 3300046473 Bacteria 833
986 Ga0495582_0501241 3300046473 Bacteria 702
987 Ga0495605_0020917 3300046474 Bacteria 3472
988 Ga0495605_0052109 3300046474 Bacteria 1990
989 Ga0495605_0160231 3300046474 Bacteria 999
990 Ga0495662_0040886 3300046476 Bacteria 2239
991 Ga0495662_0216451 3300046476 Bacteria 944
992 Ga0495664_0170434 3300046477 Unclassified 1321
993 Ga0495664_0313245 3300046477 Bacteria 947
994 Ga0495664_0415168 3300046477 Bacteria 808
995 Ga0495584_0323274 3300046491 Bacteria 783
996 Ga0495607_0117537 3300046501 Bacteria 1401
997 Ga0495608_0025716 3300046511 Bacteria 4018
998 Ga0495608_0080762 3300046511 Bacteria 2114
999 Ga0495608_0469645 3300046511 Bacteria 764
1000 Ga0495608_0927343 3300046511 Bacteria 509
1001 Ga0495618_0348671 3300046514 Bacteria 913
1002 Ga0495618_0577752 3300046514 Bacteria 671
1003 Ga0495628_0204430 3300046516 Bacteria 1487
1004 Ga0495630_0035675 3300046517 Bacteria 3716
1005 Ga0495630_0273920 3300046517 Bacteria 1289
1006 Ga0495630_1254182 3300046517 Bacteria 559
1007 Ga0495631_0091583 3300046518 Bacteria 1309
1008 Ga0495631_0208705 3300046518 Bacteria 835
1009 Ga0495637_0291252 3300046520 Bacteria 581
1010 Ga0495644_0081797 3300046523 Bacteria 1218
1011 Ga0495644_0193093 3300046523 Bacteria 784
1012 Ga0495663_0163199 3300046525 Bacteria 765
1013 Ga0495663_0261587 3300046525 Bacteria 616
1014 Ga0495666_0012440 3300046526 Bacteria 4242
1015 Ga0495642_0276926 3300046528 Bacteria 734
1016 Ga0495652_0237119 3300046529 Unclassified 1360
1017 Ga0495652_0279879 3300046529 Bacteria 1222
1018 Ga0495652_0353119 3300046529 Bacteria 1053
1019 Ga0495652_0367160 3300046529 Bacteria 1027
1020 Ga0495652_0687455 3300046529 Bacteria 689
1021 Ga0495665_0018007 3300046531 Bacteria 3797
1022 Ga0495665_0561166 3300046531 Bacteria 572
1023 Ga0495640_0160889 3300046533 Bacteria 1439
1024 Ga0495587_0378938 3300046536 Bacteria 787
1025 Ga0495609_0141382 3300046538 Bacteria 1027
1026 Ga0495609_0374440 3300046538 Bacteria 572
1027 Ga0495645_0105036 3300046543 Bacteria 2005
1028 Ga0495645_0269388 3300046543 Bacteria 1124
1029 Ga0495667_0006310 3300046559 Bacteria 8044
1030 Ga0495667_0073862 3300046559 Bacteria 2221
1031 Ga0495667_0297333 3300046559 Bacteria 1023
1032 Ga0495656_0186484 3300046615 Bacteria 1022
1033 Ga0495656_0298901 3300046615 Bacteria 825
1034 Ga0495656_0323165 3300046615 Bacteria 795
1035 Ga0495668_0591482 3300046616 Bacteria 613
1036 Ga0495634_0098006 3300046642 Bacteria 1897
1037 Ga0495634_0213970 3300046642 Unclassified 1192
1038 Ga0495611_0071162 3300046648 Bacteria 1590
1039 Ga0495611_0214336 3300046648 Bacteria 896
1040 Ga0495635_0083839 3300046663 Bacteria 2181
1041 Ga0495635_0118680 3300046663 Bacteria 1805
1042 Ga0495659_0022681 3300046664 Bacteria 2127
1043 Ga0495588_0135252 3300046674 Bacteria 1301
1044 Ga0495588_0135682 3300046674 Bacteria 1299
1045 Ga0495657_0087951 3300046675 Bacteria 1998
1046 Ga0495657_0257393 3300046675 Unclassified 1049
1047 Ga0495623_0067800 3300046679 Bacteria 2226
1048 Ga0495646_0150962 3300046680 Bacteria 1292
1049 Ga0495647_0118589 3300046681 Bacteria 1111
1050 Ga0495658_0018501 3300046683 Bacteria 3624
1051 Ga0495658_0023792 3300046683 Bacteria 3255
1052 Ga0495658_0058999 3300046683 Bacteria 2196
1053 Ga0495658_0946840 3300046683 Bacteria 550
1054 Ga0495613_0143702 3300046689 Bacteria 1704
1055 Ga0495613_0191297 3300046689 Bacteria 1446
1056 Ga0495624_0151515 3300046690 Bacteria 1418
1057 Ga0495624_0344591 3300046690 Bacteria 896
1058 Ga0495670_0235456 3300046691 Bacteria 974
1059 Ga0495589_0377270 3300046794 Bacteria 652
1060 Ga0495600_0418192 3300046809 Bacteria 832
1061 Ga0495581_0000868 3300047315 Bacteria 16148
1062 Ga0495604_0947874 3300047317 Bacteria 535
1063 Ga0495636_0118234 3300047318 Bacteria 1171
1064 Ga0495636_0324417 3300047318 Bacteria 723
1065 Ga0495674_0081351 3300047319 Bacteria 2778
1066 Ga0495674_0171551 3300047319 Bacteria 1810
1067 Ga0495674_0442190 3300047319 Bacteria 1046
1068 Ga0495676_0018960 3300047321 Bacteria 6060
1069 Ga0495676_0041793 3300047321 Bacteria 3770
1070 Ga0495676_0257510 3300047321 Bacteria 1188
1071 Ga0495676_0298717 3300047321 Bacteria 1086
1072 Ga0495680_0014538 3300047322 Bacteria 6814
1073 Ga0495680_0264282 3300047322 Bacteria 1216
1074 Ga0495680_0492525 3300047322 Bacteria 833
1075 Ga0495680_0522511 3300047322 Bacteria 803
1076 Ga0495675_0784363 3300047444 Bacteria 528
1077 Ga0495677_0248158 3300047445 Bacteria 696
1078 Ga0495679_200978 3300047446 Bacteria 524
1079 Ga0495685_064047 3300047447 Bacteria 1237
1080 Ga0495685_140167 3300047447 Bacteria 788
1081 Ga0495684_0023112 3300047471 Bacteria 4782
1082 Ga0495602_0067084 3300048088 Bacteria 3088
1083 Ga0495614_0059638 3300048089 Bacteria 1639
1084 Ga0495614_0100970 3300048089 Bacteria 1261
1085 Ga0495615_0049389 3300048090 Bacteria 1078
1086 Ga0496100_0007025 3300048903 Bacteria 6176
1087 Ga0496100_0066864 3300048903 Bacteria 2385
1088 Ga0496100_0117670 3300048903 Unclassified 1855
1089 Ga0496100_0148998 3300048903 Bacteria 1666
1090 Ga0496100_0280718 3300048903 Bacteria 1241
1091 Ga0496100_0341681 3300048903 Bacteria 1129
1092 Ga0496100_0407491 3300048903 Bacteria 1036
1093 Ga0496100_0752957 3300048903 Bacteria 762
1094 Ga0496100_1138886 3300048903 Bacteria 615
1095 Ga0496101_0005132 3300048904 Bacteria 8327
1096 Ga0496101_0026950 3300048904 Bacteria 3996
1097 Ga0496101_0082282 3300048904 Bacteria 2382
1098 Ga0496101_0179138 3300048904 Bacteria 1631
1099 Ga0496101_0232909 3300048904 Unclassified 1432
1100 Ga0496101_0313287 3300048904 Bacteria 1230
1101 Ga0496102_0020418 3300048905 Bacteria 5854
1102 Ga0496102_0057361 3300048905 Bacteria 3555
1103 Ga0496102_0084335 3300048905 Bacteria 2932
1104 Ga0496102_0092105 3300048905 Bacteria 2806
1105 Ga0496102_0590586 3300048905 Bacteria 1033
1106 Ga0496102_0666377 3300048905 Bacteria 963
1107 Ga0496102_0940229 3300048905 Bacteria 786
1108 Ga0496102_1098188 3300048905 Unclassified 715
1109 Ga0496103_0008216 3300048906 Bacteria 6195
1110 Ga0496103_0029843 3300048906 Bacteria 3315
1111 Ga0496103_0049030 3300048906 Bacteria 2611
1112 Ga0496103_0113212 3300048906 Bacteria 1724
1113 Ga0496103_0219217 3300048906 Bacteria 1224
1114 Ga0496103_0350328 3300048906 Unclassified 949
1115 Ga0496104_0013997 3300048907 Bacteria 7237
1116 Ga0496104_0026648 3300048907 Bacteria 5340
1117 Ga0496104_0117845 3300048907 Bacteria 2548
1118 Ga0496104_0160532 3300048907 Bacteria 2156
1119 Ga0496104_0325331 3300048907 Unclassified 1450
1120 Ga0496104_0579283 3300048907 Bacteria 1033
1121 Ga0496104_0889899 3300048907 Bacteria 795
1122 Ga0496104_1104840 3300048907 Bacteria 696
1123 Ga0496105_0016517 3300048908 Bacteria 5894
1124 Ga0496105_0023998 3300048908 Bacteria 4953
1125 Ga0496105_0074608 3300048908 Bacteria 2802
1126 Ga0496105_0182990 3300048908 Bacteria 1715
1127 Ga0496106_0136569 3300048909 Bacteria 1926
1128 Ga0496106_0163600 3300048909 Bacteria 1760
1129 Ga0496106_0197991 3300048909 Bacteria 1598
1130 Ga0496106_0198964 3300048909 Bacteria 1594
1131 Ga0496106_0468072 3300048909 Unclassified 1012
1132 Ga0496107_0010371 3300048910 Bacteria 6474
1133 Ga0496107_0011310 3300048910 Bacteria 6211
1134 Ga0496107_0049067 3300048910 Bacteria 3041
1135 Ga0496107_0143457 3300048910 Bacteria 1765
1136 Ga0496107_0191775 3300048910 Bacteria 1518
1137 Ga0496107_0573794 3300048910 Unclassified 835
1138 Ga0496107_0600311 3300048910 Bacteria 814
1139 Ga0496107_0802777 3300048910 Bacteria 689
1140 Ga0496107_0950419 3300048910 Unclassified 625
1141 Ga0496108_0035156 3300048911 Bacteria 4164
1142 Ga0496108_0154131 3300048911 Bacteria 1984
1143 Ga0496108_0278327 3300048911 Bacteria 1457
1144 Ga0496108_0297963 3300048911 Bacteria 1404
1145 Ga0496108_0335462 3300048911 Bacteria 1319
1146 Ga0496108_0353376 3300048911 Bacteria 1282
1147 Ga0496108_0392498 3300048911 Bacteria 1212
1148 Ga0496108_0575434 3300048911 Bacteria 982
1149 Ga0496109_0011051 3300048912 Bacteria 7741
1150 Ga0496109_0040435 3300048912 Bacteria 4224
1151 Ga0496109_0043403 3300048912 Bacteria 4075
1152 Ga0496109_0067879 3300048912 Bacteria 3267
1153 Ga0496109_0115456 3300048912 Unclassified 2498
1154 Ga0496109_0121599 3300048912 Bacteria 2432
1155 Ga0496109_0147846 3300048912 Unclassified 2199
1156 Ga0496109_0219127 3300048912 Bacteria 1790
1157 Ga0496109_0232003 3300048912 Bacteria 1736
1158 Ga0496109_0236783 3300048912 Bacteria 1717
1159 Ga0496109_0304815 3300048912 Bacteria 1502
1160 Ga0496109_0364995 3300048912 Bacteria 1364
1161 Ga0496109_0490842 3300048912 Bacteria 1159
1162 Ga0496109_0679168 3300048912 Bacteria 967
1163 Ga0496109_0825276 3300048912 Bacteria 865
1164 Ga0496109_0959138 3300048912 Bacteria 793
1165 Ga0496110_0046941 3300048913 Bacteria 3780
1166 Ga0496110_0093561 3300048913 Bacteria 2691
1167 Ga0496110_0120314 3300048913 Bacteria 2365
1168 Ga0496110_0241553 3300048913 Bacteria 1643
1169 Ga0496110_0279442 3300048913 Bacteria 1520
1170 Ga0496110_0386203 3300048913 Bacteria 1276
1171 Ga0496110_0419627 3300048913 Bacteria 1220
1172 Ga0496110_0542167 3300048913 Bacteria 1057
1173 Ga0496110_0547725 3300048913 Unclassified 1051
1174 Ga0496110_1573298 3300048913 Unclassified 567
1175 Ga0496111_0024043 3300048914 Bacteria 4284
1176 Ga0496111_0041866 3300048914 Bacteria 3288
1177 Ga0496111_0043041 3300048914 Bacteria 3245
1178 Ga0496111_0263696 3300048914 Unclassified 1278
1179 Ga0496111_0264101 3300048914 Unclassified 1277
1180 Ga0496111_0298877 3300048914 Bacteria 1193
1181 Ga0496111_0362613 3300048914 Bacteria 1072
1182 Ga0496111_0730041 3300048914 Unclassified 719
1183 Ga0496111_0888781 3300048914 Unclassified 642
1184 Ga0496112_0076547 3300048915 Unclassified 3309
1185 Ga0496112_0082662 3300048915 Bacteria 3176
1186 Ga0496112_0176601 3300048915 Bacteria 2100
1187 Ga0496112_0236011 3300048915 Unclassified 1782
1188 Ga0496112_0316455 3300048915 Bacteria 1505
1189 Ga0496112_0369982 3300048915 Bacteria 1375
1190 Ga0496112_0578579 3300048915 Bacteria 1056
1191 Ga0496113_0016416 3300048916 Bacteria 5115
1192 Ga0496113_0071693 3300048916 Unclassified 2635
1193 Ga0496113_0109054 3300048916 Bacteria 2152
1194 Ga0496113_0188759 3300048916 Unclassified 1635
1195 Ga0496113_0209049 3300048916 Bacteria 1553
1196 Ga0496113_0230149 3300048916 Bacteria 1478
1197 Ga0496113_0257723 3300048916 Bacteria 1393
1198 Ga0496113_0339712 3300048916 Bacteria 1204
1199 Ga0496113_1305121 3300048916 Bacteria 564
1200 Ga0496114_0008715 3300048917 Bacteria 8037
1201 Ga0496114_0010512 3300048917 Bacteria 7365
1202 Ga0496114_0019327 3300048917 Bacteria 5519
1203 Ga0496114_0070400 3300048917 Bacteria 2938
1204 Ga0496114_0076084 3300048917 Bacteria 2828
1205 Ga0496114_0221454 3300048917 Bacteria 1661
1206 Ga0496114_0240604 3300048917 Bacteria 1591
1207 Ga0496114_0311310 3300048917 Bacteria 1391
1208 Ga0496114_0787506 3300048917 Unclassified 829
1209 Ga0496114_0919016 3300048917 Bacteria 757
1210 Ga0496114_0968841 3300048917 Bacteria 733
1211 Ga0496115_0003388 3300048918 Bacteria 11443
1212 Ga0496115_0014734 3300048918 Bacteria 5924
1213 Ga0496115_0076556 3300048918 Bacteria 2719
1214 Ga0496115_0095042 3300048918 Bacteria 2439
1215 Ga0496115_0134589 3300048918 Bacteria 2038
1216 Ga0496115_0239836 3300048918 Bacteria 1494
1217 Ga0496115_0253968 3300048918 Bacteria 1447
1218 Ga0501031_0003798 3300049568 Bacteria 9718
1219 Ga0501031_0015280 3300049568 Bacteria 4985
1220 Ga0501032_0004530 3300049569 Bacteria 10455
1221 Ga0501032_0010424 3300049569 Bacteria 6702
1222 Ga0501032_0835313 3300049569 Bacteria 581
1223 Ga0501033_0015994 3300049570 Bacteria 5683
1224 Ga0501034_0014020 3300049571 Bacteria 8253
1225 Ga0501036_0004028 3300049572 Bacteria 11816
1226 Ga0501036_0034540 3300049572 Bacteria 4277
1227 Ga0501036_0175744 3300049572 Bacteria 1803
1228 Ga0501037_0001346 3300049573 Bacteria 18048
1229 Ga0501037_0010849 3300049573 Bacteria 6695
1230 Ga0501038_0003128 3300049574 Bacteria 15436
1231 Ga0501038_0028881 3300049574 Bacteria 4922
1232 Ga0501039_0069173 3300049575 Bacteria 2741
1233 Ga0501039_0070088 3300049575 Bacteria 2723
1234 Ga0501039_1081270 3300049575 Bacteria 622
1235 Ga0501040_0011794 3300049576 Bacteria 5718
1236 Ga0501040_0031310 3300049576 Bacteria 3594
1237 Ga0501040_0091243 3300049576 Bacteria 2118
1238 Ga0501040_0394173 3300049576 Bacteria 994
1239 Ga0501041_0040776 3300049577 Bacteria 2819
1240 Ga0501041_0129841 3300049577 Bacteria 1569
1241 Ga0501041_0320054 3300049577 Bacteria 978
1242 Ga0501041_0736857 3300049577 Bacteria 631
1243 Ga0501042_0005516 3300049578 Bacteria 8155
1244 Ga0501042_0095228 3300049578 Bacteria 2138
1245 Ga0501042_0388049 3300049578 Bacteria 1011
1246 Ga0501042_0467255 3300049578 Bacteria 915
1247 Ga0501042_0519014 3300049578 Bacteria 865
1248 Ga0501043_0010883 3300049579 Bacteria 7122
1249 Ga0501043_0036692 3300049579 Bacteria 3856
1250 Ga0501043_0192479 3300049579 Bacteria 1586
1251 Ga0501046_0002682 3300049580 Bacteria 16589
1252 Ga0501046_0027463 3300049580 Bacteria 4641
1253 Ga0501046_0343323 3300049580 Bacteria 1085
1254 Ga0501047_0031585 3300049581 Bacteria 5108
1255 Ga0501047_0131362 3300049581 Bacteria 2384
1256 Ga0501048_0011343 3300049582 Bacteria 6645
1257 Ga0501048_0052643 3300049582 Bacteria 2897
1258 Ga0501067_0000018 3300049583 Bacteria 101701
1259 Ga0501067_0000043 3300049583 Bacteria 75533
1260 Ga0501067_0053936 3300049583 Bacteria 2227
1261 Ga0501067_0323688 3300049583 Bacteria 858
1262 Ga0501067_0588167 3300049583 Bacteria 624
1263 Ga0501068_0000161 3300049584 Bacteria 31006
1264 Ga0501068_0002637 3300049584 Bacteria 9504
1265 Ga0501068_0005381 3300049584 Bacteria 6998
1266 Ga0501068_0149947 3300049584 Bacteria 1465
1267 Ga0501068_0236218 3300049584 Unclassified 1163
1268 Ga0501068_0678386 3300049584 Bacteria 673
1269 Ga0501068_1022757 3300049584 Bacteria 545
1270 Ga0501069_0000286 3300049585 Bacteria 22990
1271 Ga0501069_0002442 3300049585 Bacteria 9473
1272 Ga0501069_0003827 3300049585 Bacteria 7751
1273 Ga0501069_0010207 3300049585 Bacteria 4967
1274 Ga0501069_0051697 3300049585 Bacteria 2287
1275 Ga0501069_0260352 3300049585 Bacteria 1013
1276 Ga0501070_0002395 3300049586 Bacteria 16449
1277 Ga0501070_0008310 3300049586 Bacteria 8769
1278 Ga0501070_0074343 3300049586 Bacteria 2813
1279 Ga0501070_0529840 3300049586 Bacteria 944
1280 Ga0501070_0626780 3300049586 Bacteria 855
1281 Ga0501071_0002202 3300049587 Bacteria 11732
1282 Ga0501071_0043650 3300049587 Bacteria 3215
1283 Ga0501071_0054335 3300049587 Bacteria 2890
1284 Ga0501071_0526302 3300049587 Bacteria 907
1285 Ga0501072_0063536 3300049588 Bacteria 2912
1286 Ga0501072_0077783 3300049588 Bacteria 2626
1287 Ga0501072_0302291 3300049588 Bacteria 1272
1288 Ga0501073_0004308 3300049589 Bacteria 10676
1289 Ga0501073_0077338 3300049589 Bacteria 2315
1290 Ga0501073_0665565 3300049589 Bacteria 718
1291 Ga0501074_0067464 3300049590 Bacteria 2572
1292 Ga0501074_0082815 3300049590 Bacteria 2300
1293 Ga0501074_0096410 3300049590 Bacteria 2117
1294 Ga0501074_0173871 3300049590 Unclassified 1537
1295 Ga0501075_0050264 3300049591 Bacteria 3133
1296 Ga0501075_0065557 3300049591 Bacteria 2740
1297 Ga0501075_0302685 3300049591 Bacteria 1218
1298 Ga0501075_0411955 3300049591 Bacteria 1030
1299 Ga0501076_0003583 3300049592 Bacteria 10906
1300 Ga0501076_0013986 3300049592 Bacteria 6030
1301 Ga0501076_0033114 3300049592 Bacteria 4034
1302 Ga0501076_0033754 3300049592 Bacteria 3996
1303 Ga0501076_0275579 3300049592 Bacteria 1378
1304 Ga0501076_0691434 3300049592 Bacteria 842
1305 Ga0501077_0003014 3300049593 Bacteria 10096
1306 Ga0501077_0081550 3300049593 Bacteria 2049
1307 Ga0501077_0124262 3300049593 Unclassified 1636
1308 Ga0501077_0525475 3300049593 Bacteria 759
1309 Ga0501079_0005345 3300049741 Bacteria 9560
1310 Ga0501079_0097510 3300049741 Bacteria 2279
1311 Ga0501079_0228665 3300049741 Bacteria 1453
1312 Ga0501079_0455359 3300049741 Unclassified 1005
1313 Ga0501079_0661662 3300049741 Unclassified 822
1314 Ga0501079_0710330 3300049741 Bacteria 791
1315 Ga0501080_0004462 3300049742 Bacteria 12457
1316 Ga0501080_0014549 3300049742 Bacteria 7247
1317 Ga0501080_0017828 3300049742 Bacteria 6572
1318 Ga0501080_0496176 3300049742 Bacteria 1091
1319 Ga0501081_0007101 3300049743 Bacteria 7278
1320 Ga0501081_0028955 3300049743 Bacteria 3740
1321 Ga0501081_0127918 3300049743 Bacteria 1813
1322 Ga0501081_0302424 3300049743 Bacteria 1173
1323 Ga0501081_0501822 3300049743 Bacteria 904
1324 Ga0501081_0744651 3300049743 Bacteria 736
1325 Ga0501083_0000504 3300049744 Bacteria 24936
1326 Ga0501083_0002288 3300049744 Bacteria 13113
1327 Ga0501035_0001724 3300049822 Bacteria 22093
1328 Ga0501035_0005345 3300049822 Bacteria 12152
1329 Ga0501035_0380752 3300049822 Bacteria 1177
1330 Ga0501044_0119076 3300049823 Bacteria 2643
1331 Ga0501044_0189926 3300049823 Bacteria 2017
1332 Ga0501045_0005671 3300049824 Bacteria 8640
1333 Ga0501045_0019593 3300049824 Bacteria 4826
1334 Ga0501045_0118894 3300049824 Bacteria 1962
1335 Ga0501045_0221787 3300049824 Unclassified 1408
1336 nmdc:mga05p37_221536_c1 3300050507 Bacteria 2283
1337 nmdc:mga05p37_249737_c1 3300050507 Unclassified 2128
1338 nmdc:mga05p37_276752_c1 3300050507 Bacteria 2004
1339 nmdc:mga05p37_304773_c1 3300050507 Bacteria 1891
1340 nmdc:mga05p37_581007_c1 3300050507 Bacteria 1269
1341 nmdc:mga05p37_59343_c1 3300050507 Bacteria 4711
1342 nmdc:mga05p37_61186_c1 3300050507 Bacteria 4636
1343 nmdc:mga05p37_762516_c1 3300050507 Bacteria 1065
1344 nmdc:mga05p37_78557_c1 3300050507 Bacteria 4064
1345 nmdc:mga09592_245893_c1 3300050508 Bacteria 1550
1346 nmdc:mga09592_269491_c1 3300050508 Bacteria 1477
1347 nmdc:mga09592_528256_c1 3300050508 Bacteria 1014
1348 nmdc:mga09592_90669_c1 3300050508 Bacteria 2612
1349 nmdc:mga0qj67_156000_c1 3300050509 Bacteria 1853
1350 nmdc:mga06r32_119803_c1 3300050510 Bacteria 2595
1351 nmdc:mga06r32_19413_c1 3300050510 Bacteria 6238
1352 nmdc:mga06r32_912014_c1 3300050510 Unclassified 835
1353 nmdc:mga08y16_322950_c1 3300050511 Bacteria 1589
1354 nmdc:mga08y16_325918_c1 3300050511 Bacteria 1581
1355 nmdc:mga08y16_34368_c1 3300050511 Bacteria 5325
1356 nmdc:mga08y16_40602_c1 3300050511 Bacteria 4876
1357 nmdc:mga08y16_633725_c1 3300050511 Bacteria 1075
1358 nmdc:mga08y16_823367_c1 3300050511 Unclassified 920
1359 nmdc:mga08y16_973209_c1 3300050511 Unclassified 830
1360 nmdc:mga0n895_1311314_c1 3300050512 Unclassified 695
1361 nmdc:mga0n895_175464_c1 3300050512 Bacteria 2174
1362 nmdc:mga0n895_184995_c1 3300050512 Bacteria 2114
1363 nmdc:mga0n895_355650_c1 3300050512 Bacteria 1483
1364 nmdc:mga0n895_38675_c1 3300050512 Bacteria 4624
1365 nmdc:mga0n895_50477_c1 3300050512 Bacteria 4078
1366 nmdc:mga0n895_657581_c1 3300050512 Bacteria 1046
1367 nmdc:mga0rr50_178493_c1 3300050513 Bacteria 1735
1368 nmdc:mga0rr50_190484_c1 3300050513 Bacteria 1680
1369 nmdc:mga0rr50_191937_c1 3300050513 Bacteria 1675
1370 nmdc:mga0rr50_250762_c1 3300050513 Bacteria 1470
1371 nmdc:mga0rr50_6190_c1 3300050513 Bacteria 7250
1372 nmdc:mga0rr50_63031_c1 3300050513 Bacteria 2799
1373 nmdc:mga0rr50_69825_c1 3300050513 Bacteria 2675
1374 nmdc:mga08x19_12299_c1 3300050514 Bacteria 5153
1375 nmdc:mga08x19_12301_c1 3300050514 Bacteria 5153
1376 nmdc:mga08x19_44327_c1 3300050514 Unclassified 2840
1377 nmdc:mga08x19_452140_c1 3300050514 Bacteria 904
1378 nmdc:mga08x19_660532_c1 3300050514 Bacteria 741
1379 nmdc:mga08x19_75235_c1 3300050514 Bacteria 2208
1380 nmdc:mga0a205_124147_c1 3300050515 Bacteria 2482
1381 nmdc:mga0a205_168641_c1 3300050515 Bacteria 2085
1382 nmdc:mga0a205_221004_c1 3300050515 Bacteria 1780
1383 nmdc:mga0a205_29263_c1 3300050515 Bacteria 5272
1384 nmdc:mga0a205_299559_c1 3300050515 Bacteria 1481
1385 nmdc:mga0a205_62006_c1 3300050515 Bacteria 3613
1386 nmdc:mga0a205_67173_c1 3300050515 Bacteria 3463
1387 nmdc:mga0a205_80998_c1 3300050515 Bacteria 3137
1388 Ga0495601_0016899 3300053077 Bacteria 4426
1389 Ga0495601_0166305 3300053077 Bacteria 1441
1390 Ga0495601_0176904 3300053077 Bacteria 1395
1391 Ga0495601_0180551 3300053077 Bacteria 1380
1392 Ga0495601_0470284 3300053077 Bacteria 812
1393 Ga0495612_0068571 3300053078 Bacteria 1476
1394 Ga0495612_0274688 3300053078 Unclassified 752
1395 Ga0495655_0000869 3300053083 Bacteria 4720
1396 Ga0495595_0009513 3300053084 Bacteria 4023
1397 Ga0495595_0027753 3300053084 Bacteria 2524
1398 Ga0495595_0654230 3300053084 Bacteria 538
1399 Ga0495619_0027019 3300053085 Bacteria 3696
1400 Ga0501084_0009042 3300054114 Bacteria 8242
1401 Ga0501084_0071982 3300054114 Bacteria 2895
1402 Ga0501084_0174171 3300054114 Bacteria 1816
1403 Ga0501084_0216422 3300054114 Bacteria 1616
1404 Ga0501084_0292581 3300054114 Bacteria 1375
1405 Ga0501084_0532896 3300054114 Bacteria 993
1406 Ga0587073_0175252 3300059492 Bacteria 625
1407 Ga0587077_044317 3300059493 Bacteria 905
1408 Ga0587077_123958 3300059493 Bacteria 648
1409 Ga0587082_016692 3300059504 Bacteria 1149
1410 Ga0587083_0074244 3300059505 Bacteria 796
1411 Ga0587083_0242280 3300059505 Bacteria 534
1412 Ga0587088_036441 3300059508 Unclassified 906
1413 Ga0587088_061728 3300059508 Bacteria 761
1414 Ga0587090_060446 3300059510 Bacteria 718
1415 Ga0587094_093420 3300059513 Bacteria 572
1416 Ga0587099_030972 3300059622 Unclassified 650
1417 Ga0587101_068974 3300059623 Bacteria 647
1418 Ga0587128_091006 3300059630 Bacteria 626
1419 Ga0587067_051046 3300059640 Bacteria 837
1420 Ga0587114_051410 3300059655 Unclassified 699
1421 Ga0587071_044473 3300060344 Unclassified 900
1422 Ga0587111_0251542 3300060346 Bacteria 523
1423 Ga0501082_0014408 3300060353 Bacteria 6803
1424 Ga0501082_0073390 3300060353 Bacteria 2948
1425 Ga0501082_0129571 3300060353 Bacteria 2188
1426 Ga0501082_0144350 3300060353 Bacteria 2066
1427 Ga0501082_0526563 3300060353 Bacteria 1033
1428 Ga0501082_0779018 3300060353 Bacteria 837
1429 Ga0466962_0024344 3300061719 Bacteria 2908
1430 Ga0466962_0240545 3300061719 Bacteria 888
1431 Ga0466962_0412461 3300061719 Bacteria 677
1432 Ga0530510_0003434 3300061734 Bacteria 10888
1433 Ga0530510_0024990 3300061734 Bacteria 4270
1434 Ga0530510_0096661 3300061734 Bacteria 2158
1435 Ga0530510_0292182 3300061734 Bacteria 1219
1436 Ga0530510_0328875 3300061734 Unclassified 1146
1437 Ga0530510_0338454 3300061734 Bacteria 1129
1438 Ga0207661_10042438
1439 JGI25407J50210_10003347
1440 JGI25407J50210_10011863
1441 JGI25407J50210_10013973
1442 Ga0058861_10075293
1443 Ga0058861_11810407
1444 Ga0058862_10046701
1445 Ga0070658_10105256
1446 Ga0070658_10646176
1447 Ga0070658_10996356
1448 Ga0070676_10293772
1449 Ga0070683_100001379
1450 Ga0070683_100005013
1451 Ga0070683_100037229
1452 Ga0070683_100044833
1453 Ga0070683_100241605
1454 Ga0070683_100333756
1455 Ga0070690_100121705
1456 Ga0070690_100301729
1457 Ga0070670_100049075
1458 Ga0068869_100170346
1459 Ga0068869_100267798
1460 Ga0070680_100016898
1461 Ga0070680_100128742
1462 Ga0070682_100001120
1463 Ga0070682_100169777
1464 Ga0068868_100163557
1465 Ga0068868_100258518
1466 Ga0068868_100490425
1467 Ga0070660_100104555
1468 Ga0070660_100267490
1469 Ga0070660_100822680
1470 Ga0070689_100037671
1471 Ga0070689_100096247
1472 Ga0070689_100241720
1473 Ga0070689_100487859
1474 Ga0070691_10364657
1475 Ga0070687_100140768
1476 Ga0070687_100248623
1477 Ga0070661_100016760
1478 Ga0070661_100210300
1479 Ga0070661_100255486
1480 Ga0070661_100577397
1481 Ga0070668_100975774
1482 Ga0070669_100215976
1483 Ga0070675_100602373
1484 Ga0070671_100137891
1485 Ga0070671_100201298
1486 Ga0070671_100418891
1487 Ga0070674_100514522
1488 Ga0070674_100577638
1489 Ga0070673_100379501
1490 Ga0070673_100894913
1491 Ga0070673_101445147
1492 Ga0070688_100004502
1493 Ga0070659_100222305
1494 Ga0070659_101074117
1495 Ga0070667_100010579
1496 Ga0070667_100610295
1497 Ga0070703_10006333
1498 Ga0070703_10013655
1499 Ga0070703_10015940
1500 Ga0070709_10074329
1501 Ga0070709_10112566
1502 Ga0070709_10115793
1503 Ga0070709_10119257
1504 Ga0070709_10336019
1505 Ga0070709_10526075
1506 Ga0070714_100098687
1507 Ga0070714_100131822
1508 Ga0070714_100135402
1509 Ga0070714_100185055
1510 Ga0070714_100554624
1511 Ga0070714_100794724
1512 Ga0070714_101065556
1513 Ga0070713_100009354
1514 Ga0070713_100117684
1515 Ga0070713_100342452
1516 Ga0070710_10008661
1517 Ga0070710_10013881
1518 Ga0070710_10015912
1519 Ga0070710_10053122
1520 Ga0070710_10243178
1521 Ga0070710_10304204
1522 Ga0070710_10369129
1523 Ga0070710_10391138
1524 Ga0070701_10012076
1525 Ga0070701_10294474
1526 Ga0070711_100014628
1527 Ga0070711_100030732
1528 Ga0070711_100043560
1529 Ga0070711_100196860
1530 Ga0070711_100288057
1531 Ga0070711_100355449
1532 Ga0070711_100369955
1533 Ga0070711_100589877
1534 Ga0070705_100010056
1535 Ga0070705_100256947
1536 Ga0070705_100271398
1537 Ga0070705_101172379
1538 Ga0070705_101338758
1539 Ga0070700_100021368
1540 Ga0070694_100116597
1541 Ga0070694_100146848
1542 Ga0070708_100032536
1543 Ga0070708_100308065
1544 Ga0070708_100352794
1545 Ga0070708_100672842
1546 Ga0070708_101551238
1547 Ga0070678_100082013
1548 Ga0070678_100097624
1549 Ga0070678_100098306
1550 Ga0070678_100252065
1551 Ga0070678_100347824
1552 Ga0070662_100111577
1553 Ga0070681_10086158
1554 Ga0070681_10112485
1555 Ga0070681_10113387
1556 Ga0070681_10354777
1557 Ga0070681_10467524
1558 Ga0068867_100004127
1559 Ga0068867_100074175
1560 Ga0068867_100852157
1561 Ga0070685_10001503
1562 Ga0070685_11102103
1563 Ga0070706_100069251
1564 Ga0070706_100074391
1565 Ga0070706_100519581
1566 Ga0070706_100605621
1567 Ga0070706_100895796
1568 Ga0070707_100064946
1569 Ga0070707_100080465
1570 Ga0070707_100088760
1571 Ga0070707_100158631
1572 Ga0070707_100263819
1573 Ga0070707_100510843
1574 Ga0070698_100011346
1575 Ga0070698_100046946
1576 Ga0070698_100100007
1577 Ga0070698_100140692
1578 Ga0070698_100252945
1579 Ga0070698_100734658
1580 Ga0070698_101362834
1581 Ga0070699_100034414
1582 Ga0070699_100065621
1583 Ga0070699_100119033
1584 Ga0070699_100134166
1585 Ga0070699_100728365
1586 Ga0070679_100012562
1587 Ga0070679_100045639
1588 Ga0070679_100126545
1589 Ga0070679_100339854
1590 Ga0070679_100438353
1591 Ga0070684_100000799
1592 Ga0070684_100011246
1593 Ga0070684_100662843
1594 Ga0070697_100431839
1595 Ga0070697_100471372
1596 Ga0068853_100123750
1597 Ga0068853_101903701
1598 Ga0070672_100756827
1599 Ga0070672_100858112
1600 Ga0070686_100097025
1601 Ga0070686_100132575
1602 Ga0070686_100471996
1603 Ga0070695_100084074
1604 Ga0070695_100189145
1605 Ga0070695_100231283
1606 Ga0070695_100374378
1607 Ga0070696_100057639
1608 Ga0070696_100088159
1609 Ga0070696_100135737
1610 Ga0070693_100048890
1611 Ga0070693_100127440
1612 Ga0070693_100265880
1613 Ga0070693_100541908
1614 Ga0070665_101122580
1615 Ga0070704_100143365
1616 Ga0070704_100176953
1617 Ga0070704_100259472
1618 Ga0070704_100292602
1619 Ga0068855_100010923
1620 Ga0068855_100082705
1621 Ga0068855_100153338
1622 Ga0068855_100204561
1623 Ga0068855_100222731
1624 Ga0068855_100256458
1625 Ga0068855_100409880
1626 Ga0070664_100079756
1627 Ga0070664_100092804
1628 Ga0070664_101123134
1629 Ga0068857_100008592
1630 Ga0068857_100015217
1631 Ga0068857_100064962
1632 Ga0068857_100071410
1633 Ga0068857_100499315
1634 Ga0068857_101030882
1635 Ga0068854_100065947
1636 Ga0068854_100596133
1637 Ga0068854_101517773
1638 Ga0068856_100278422
1639 Ga0068856_100368382
1640 Ga0070702_100013242
1641 Ga0070702_100082833
1642 Ga0070702_100634345
1643 Ga0068852_100408502
1644 Ga0068852_100596464
1645 Ga0068859_100170259
1646 Ga0068859_100291218
1647 Ga0068866_10011612
1648 Ga0068866_10160677
1649 Ga0068861_100011174
1650 Ga0068861_100020039
1651 Ga0068863_100507594
1652 Ga0068858_101343473
1653 Ga0068860_101395787
1654 Ga0068862_100067107
1655 Ga0068862_100430731
1656 Ga0081455_10001178
1657 Ga0081455_10018946
1658 Ga0081455_10047799
1659 Ga0081455_10049699
1660 Ga0081455_10088446
1661 Ga0081455_10212653
1662 Ga0081455_10363109
1663 Ga0081538_10000021
1664 Ga0081538_10000138
1665 Ga0081538_10000649
1666 Ga0081538_10007374
1667 Ga0081538_10017018
1668 Ga0081538_10018623
1669 Ga0081540_1003497
1670 Ga0081540_1019956
1671 Ga0081540_1024007
1672 Ga0081540_1061713
1673 Ga0081539_10004185
1674 Ga0070717_10087370
1675 Ga0070717_10176447
1676 Ga0075365_10009205
1677 Ga0075363_100169169
1678 Ga0075432_10011105
1679 Ga0075432_10141947
1680 Ga0070715_10019654
1681 Ga0070715_10050508
1682 Ga0070715_10457392
1683 Ga0070716_100005213
1684 Ga0070716_100020081
1685 Ga0070716_100099369
1686 Ga0070716_100114929
1687 Ga0070716_100260874
1688 Ga0070712_100017483
1689 Ga0070712_100080695
1690 Ga0070712_100134940
1691 Ga0070712_100184214
1692 Ga0070712_100250739
1693 Ga0075362_10005326
1694 Ga0097621_100156276
1695 Ga0097621_101304370
1696 Ga0068871_100203276
1697 Ga0068871_101652643
1698 Ga0075428_100057582
1699 Ga0075428_100140206
1700 Ga0075428_100347587
1701 Ga0075428_100474947
1702 Ga0075428_100497354
1703 Ga0075428_100525543
1704 Ga0075428_101313151
1705 Ga0075428_101569851
1706 Ga0075430_100038236
1707 Ga0075430_100233556
1708 Ga0075431_100021608
1709 Ga0075431_100027665
1710 Ga0075431_100129061
1711 Ga0075431_100198362
1712 Ga0075431_100604865
1713 Ga0075431_101563816
1714 Ga0075433_10052452
1715 Ga0075433_10073882
1716 Ga0075433_10139496
1717 Ga0075433_10946878
1718 Ga0075434_100023038
1719 Ga0075434_100075447
1720 Ga0075434_100225890
1721 Ga0075434_100283745
1722 Ga0075434_100290291
1723 Ga0075434_101435524
1724 Ga0075429_100099327
1725 Ga0075429_100735975
1726 Ga0068865_100003775
1727 Ga0068865_100136947
1728 Ga0068865_100420452
1729 Ga0068865_100714023
1730 Ga0075436_100041620
1731 Ga0075436_100182574
1732 Ga0075436_101175364
1733 Ga0097620_100170261
1734 Ga0097620_100291199
1735 Ga0097620_102410509
1736 Ga0075435_100007092
1737 Ga0075435_100022813
1738 Ga0075435_100071667
1739 Ga0075435_100114122
1740 Ga0105240_10019847
1741 Ga0105240_10476277
1742 Ga0105240_11110398
1743 Ga0111539_10027300
1744 Ga0111539_10096592
1745 Ga0111539_10349612
1746 Ga0111539_10427459
1747 Ga0111539_10489365
1748 Ga0111539_10854121
1749 Ga0111539_12333355
1750 Ga0105245_10019659
1751 Ga0105245_10141805
1752 Ga0105245_10529443
1753 Ga0105245_11253563
1754 Ga0105247_10039826
1755 Ga0105247_10244632
1756 Ga0105247_11042416
1757 Ga0114129_10038479
1758 Ga0114129_10064757
1759 Ga0114129_10099426
1760 Ga0114129_10106794
1761 Ga0114129_10149545
1762 Ga0114129_10439523
1763 Ga0114129_10859167
1764 Ga0114129_10956171
1765 Ga0105243_10068824
1766 Ga0105243_10103799
1767 Ga0105243_10169896
1768 Ga0105243_10187215
1769 Ga0105243_10332675
1770 Ga0105243_10557355
1771 Ga0105243_10622177
1772 Ga0105243_10674002
1773 Ga0105241_10028797
1774 Ga0105241_10047092
1775 Ga0105241_10118663
1776 Ga0105242_10022608
1777 Ga0105242_10029025
1778 Ga0105242_10094391
1779 Ga0105242_10294092
1780 Ga0105242_10887844
1781 Ga0105248_10039381
1782 Ga0105248_10096553
1783 Ga0105248_10304220
1784 Ga0105248_12685016
1785 Ga0105238_10411502
1786 Ga0105238_10457885
1787 Ga0105249_10036380
1788 Ga0105249_10217120
1789 Ga0105249_10999955
1790 Ga0105239_10066176
1791 Ga0105239_10083931
1792 Ga0105239_10092694
1793 Ga0105239_10204769
1794 Ga0105239_11069792
1795 Ga0105246_10007182
1796 Ga0157320_1028328
1797 Ga0157343_1009265
1798 Ga0157347_1007249
1799 Ga0157313_1001914
1800 Ga0157339_1028723
1801 Ga0157342_1003934
1802 Ga0157316_1015938
1803 Ga0157327_1030667
1804 Ga0157338_1000279
1805 Ga0154016_132876
1806 Ga0157371_10071143
1807 Ga0157371_10183340
1808 Ga0157371_10698887
1809 Ga0157370_10008089
1810 Ga0157370_10086066
1811 Ga0157370_10230176
1812 Ga0157369_11438057
1813 Ga0157369_12021996
1814 Ga0157374_10050689
1815 Ga0157374_10540208
1816 Ga0157378_10197538
1817 Ga0157378_10548964
1818 Ga0157378_11904611
1819 Ga0163162_10273823
1820 Ga0157372_10028322
1821 Ga0157372_10268198
1822 Ga0157372_10512605
1823 Ga0157372_10908629
1824 Ga0157372_10986794
1825 Ga0157372_11143157
1826 Ga0157375_10080761
1827 Ga0157375_10193415
1828 Ga0157375_10247962
1829 Ga0157375_10843708
1830 Ga0157375_11624148
1831 Ga0163163_10439583
1832 Ga0157380_10453549
1833 Ga0182008_10244503
1834 Ga0157377_10003315
1835 Ga0157377_10211637
1836 Ga0157379_10484666
1837 Ga0157376_10292884
1838 Ga0157376_10342116
1839 Ga0157376_10342907
1840 Ga0157376_11642904
1841 Ga0182006_1070513
1842 Ga0182005_1073834
1843 Ga0182005_1242909
1844 Ga0163161_10388766
1845 Ga0163161_10574168
1846 Ga0163161_10972918
1847 Ga0197907_10188215
1848 Ga0206356_10897941
1849 Ga0206356_10970350
1850 Ga0206356_11081930
1851 Ga0206349_1185021
1852 Ga0206349_1667707
1853 Ga0206355_1152397
1854 Ga0206351_10032051
1855 Ga0206351_10695050
1856 Ga0206352_11232016
1857 Ga0206350_11574031
1858 Ga0206354_10190292
1859 Ga0206354_10337611
1860 Ga0206354_11346914
1861 Ga0206353_10046952
1862 Ga0206353_10072795
1863 Ga0206353_10717995
1864 Ga0206353_11373027
1865 Ga0154015_1261515
1866 Ga0154015_1543957
1867 Ga0213871_10034944
1868 Ga0224712_10019853
1869 Ga0207656_10120689
1870 Ga0207692_10037924
1871 Ga0207692_10045495
1872 Ga0207692_10097640
1873 Ga0207642_10538637
1874 Ga0207642_11064233
1875 Ga0207710_10030397
1876 Ga0207688_10033801
1877 Ga0207688_10098278
1878 Ga0207688_10133363
1879 Ga0207688_10190407
1880 Ga0207688_10610973
1881 Ga0207680_10080065
1882 Ga0207647_10427341
1883 Ga0207699_10055631
1884 Ga0207699_10071435
1885 Ga0207699_10096767
1886 Ga0207699_10132111
1887 Ga0207699_10586790
1888 Ga0207699_10710216
1889 Ga0207643_10062453
1890 Ga0207705_10869412
1891 Ga0207705_11329059
1892 Ga0207684_10036127
1893 Ga0207684_10121551
1894 Ga0207684_10249817
1895 Ga0207684_10324158
1896 Ga0207684_10357059
1897 Ga0207684_10861011
1898 Ga0207684_11261494
1899 Ga0207654_10038632
1900 Ga0207654_10488819
1901 Ga0207707_10039023
1902 Ga0207707_10041740
1903 Ga0207707_10043445
1904 Ga0207695_10077461
1905 Ga0207695_10703647
1906 Ga0207695_11648716
1907 Ga0207671_10448242
1908 Ga0207671_10748480
1909 Ga0207693_10000406
1910 Ga0207693_10001431
1911 Ga0207693_10006501
1912 Ga0207693_10079809
1913 Ga0207693_10110316
1914 Ga0207663_10008237
1915 Ga0207663_10013339
1916 Ga0207663_10118612
1917 Ga0207663_10136405
1918 Ga0207660_10023066
1919 Ga0207660_10098552
1920 Ga0207660_11173081
1921 Ga0207662_10019934
1922 Ga0207662_10524967
1923 Ga0207657_10000073
1924 Ga0207657_10413643
1925 Ga0207649_10152961
1926 Ga0207652_10015439
1927 Ga0207652_10188369
1928 Ga0207646_10006672
1929 Ga0207646_10034338
1930 Ga0207646_10105029
1931 Ga0207646_10190275
1932 Ga0207646_11313264
1933 Ga0207681_10872586
1934 Ga0207681_11772699
1935 Ga0207694_10694838
1936 Ga0207650_10382499
1937 Ga0207650_10389169
1938 Ga0207659_10340124
1939 Ga0207687_10012396
1940 Ga0207687_10044904
1941 Ga0207687_10060282
1942 Ga0207687_10090718
1943 Ga0207687_10250052
1944 Ga0207687_10423700
1945 Ga0207687_10841638
1946 Ga0207687_11521695
1947 Ga0207687_11708103
1948 Ga0207700_10416377
1949 Ga0207700_10791221
1950 Ga0207664_10033314
1951 Ga0207664_10095633
1952 Ga0207664_10142050
1953 Ga0207664_10222265
1954 Ga0207664_10240069
1955 Ga0207664_10383061
1956 Ga0207664_10832798
1957 Ga0207644_11335499
1958 Ga0207690_10571984
1959 Ga0207706_10342978
1960 Ga0207686_10112002
1961 Ga0207686_10125432
1962 Ga0207686_10162485
1963 Ga0207686_10570264
1964 Ga0207709_10069478
1965 Ga0207709_10119363
1966 Ga0207709_10155277
1967 Ga0207709_10232971
1968 Ga0207709_10263083
1969 Ga0207709_10273851
1970 Ga0207709_10803658
1971 Ga0207670_10014455
1972 Ga0207670_10823824
1973 Ga0207669_10162245
1974 Ga0207704_10118772
1975 Ga0207665_10004586
1976 Ga0207665_10010758
1977 Ga0207665_10054526
1978 Ga0207665_10086520
1979 Ga0207665_10140452
1980 Ga0207665_11183908
1981 Ga0207691_10017674
1982 Ga0207691_10297260
1983 Ga0207691_10338873
1984 Ga0207711_10249995
1985 Ga0207711_10830584
1986 Ga0207689_10127340
1987 Ga0207661_10000326
1988 Ga0207661_10040652
1989 Ga0207661_10055471
1990 Ga0207661_10068582
1991 Ga0207661_10831596
1992 Ga0207661_10951577
1993 Ga0207679_10188839
1994 Ga0207679_11247574
1995 Ga0207679_11357765
1996 Ga0207667_10042798
1997 Ga0207667_10107678
1998 Ga0207667_10122160
1999 Ga0207667_10181302
2000 Ga0207667_10211870
2001 Ga0207667_10212183
2002 Ga0207667_10446039
2003 Ga0207667_10697762
2004 Ga0207667_11799391
2005 Ga0207651_10220248
2006 Ga0207651_10803230
2007 Ga0207712_10074120
2008 Ga0207712_10491417
2009 Ga0207640_10053830
2010 Ga0207640_10182053
2011 Ga0207640_11549665
2012 Ga0207658_10004832
2013 Ga0207658_10148116
2014 Ga0207677_10015265
2015 Ga0207677_10022503
2016 Ga0207677_10060395
2017 Ga0207677_10063219
2018 Ga0207677_10181778
2019 Ga0207677_10332586
2020 Ga0207703_10764948
2021 Ga0207639_10701075
2022 Ga0207639_11409935
2023 Ga0207708_10000563
2024 Ga0207708_10011914
2025 Ga0207708_10022231
2026 Ga0207702_10193158
2027 Ga0207702_10246673
2028 Ga0207702_10256646
2029 Ga0207702_11406172
2030 Ga0207702_11849879
2031 Ga0207641_11029295
2032 Ga0207648_10034191
2033 Ga0207648_10081001
2034 Ga0207676_10251224
2035 Ga0207674_10002539
2036 Ga0207674_10019424
2037 Ga0207674_10072841
2038 Ga0207674_10190650
2039 Ga0207674_10446731
2040 Ga0207675_100021594
2041 Ga0207675_100066350
2042 Ga0207683_10001199
2043 Ga0207683_10016391
2044 Ga0207683_10027770
2045 Ga0207683_10041472
2046 Ga0207683_10448683
2047 Ga0209983_1070447
2048 Ga0209998_10015612
2049 Ga0207428_10013275
2050 Ga0207428_10021472
2051 Ga0207428_10169653
2052 Ga0207428_10307414
2053 Ga0207428_10308025
2054 Ga0207428_10335298
2055 Ga0207428_10441047
2056 Ga0207428_10550923
2057 Ga0268266_10109253
2058 Ga0268265_10133985
2059 Ga0268265_10495479
2060 Ga0268264_10356041
2061 Ga0265326_10073939
2062 Ga0265318_10008580
2063 Ga0265338_10090707
2064 Ga0265338_10105966
2065 Ga0265330_10037962
2066 Ga0265332_10045862
2067 Ga0265328_10059321
2068 Ga0265320_10142303
2069 Ga0265320_10197892
2070 Ga0265329_10078919
2071 Ga0265331_10097366
2072 Ga0265327_10013725
2073 Ga0265327_10434619
2074 Ga0265316_10351250
2075 Ga0307408_100266312
2076 Ga0265313_10002660
2077 Ga0265313_10106763
2078 Ga0265314_10003929
2079 Ga0265342_10021909
2080 Ga0307405_10231428
2081 Ga0307405_11920543
2082 Ga0307413_11408303
2083 Ga0307410_10078762
2084 Ga0307406_10089339
2085 Ga0307406_10766804
2086 Ga0307407_10319100
2087 Ga0307412_10161871
2088 Ga0307412_10814367
2089 Ga0307409_100190963
2090 Ga0307409_100207612
2091 Ga0307409_100822478
2092 Ga0307416_100045501
2093 Ga0307416_100104032
2094 Ga0307416_100200676
2095 Ga0307416_100556176
2096 Ga0307416_100734655
2097 Ga0307411_10185284
2098 Ga0307411_11789552
2099 Ga0307415_100098074
2100 Ga0373948_0007313
2101 Ga0373950_0000817
2102 Ga0373958_0000854
2103 Ga0373958_0071967
2104 Ga0373938_0002204
2105 Ga0373926_0028415
2106 Ga0373926_0046649
2107 Ga0373928_0021966
2108 Ga0373929_0000828
2109 Ga0373940_0001455
2110 Ga0373944_0092162
2111 Ga0373952_0001596
2112 Ga0373923_0272686
2113 Ga0373932_0002583
2114 Ga0373936_0035715
2115 Ga0373936_0160596
2116 Ga0373939_0000760
2117 Ga0373939_0519418
2118 Ga0373941_0002021
2119 Ga0373945_0005021
2120 Ga0373945_0025445
2121 Ga0373953_0205213
2122 Ga0373956_0057187
2123 Ga0373956_0284712
2124 Ga0373960_0085538
2125 Ga0373943_0019130
2126 Ga0373943_0026389
2127 Ga0373943_0236619
2128 Ga0373946_0063292
2129 Ga0373946_0106933
2130 Ga0373946_0164950
2131 Ga0373942_0151020
2132 Ga0373962_0150607
2133 Ga0373931_0001397
2134 Ga0373931_0361673
2135 Ga0373931_0864061
2136 Ga0373935_0083863
2137 Ga0373935_0177103
2138 Ga0373935_0234191
2139 Ga0373935_0499371
2140 Ga0373935_0525297
2141 Ga0373935_0629289
2142 Ga0373935_0949816
2143 Ga0373927_0207599
2144 Ga0373927_0231641
2145 Ga0373927_0250022
2146 Ga0373947_0003591
2147 Ga0373947_0018447
2148 Ga0373947_0076657
2149 Ga0373947_0090109
2150 Ga0373947_0417308
2151 Ga0373937_1167426
2152 Ga0373925_0003351
2153 Ga0373925_0060908
2154 Ga0373925_0629143
2155 Ga0373925_1016386
2156 Ga0395899_0001940
2157 Ga0395899_0005860
2158 Ga0395899_0019594
2159 Ga0395899_0031265
2160 Ga0395899_0039406
2161 Ga0395899_0059378
2162 Ga0395899_0069771
2163 Ga0395899_0174359
2164 Ga0395899_0199998
2165 Ga0395899_0200009
2166 Ga0395899_0242067
2167 Ga0395899_0350157
2168 Ga0395899_0501994
2169 Ga0395900_0005665
2170 Ga0395900_0013360
2171 Ga0395900_0018023
2172 Ga0395900_0019727
2173 Ga0395900_0025675
2174 Ga0395900_0032072
2175 Ga0395900_0033304
2176 Ga0395900_0050786
2177 Ga0395900_0058706
2178 Ga0395900_0064573
2179 Ga0395900_0074860
2180 Ga0395900_0097035
2181 Ga0395900_0165071
2182 Ga0395900_0197925
2183 Ga0395900_0236158
2184 Ga0395900_0245716
2185 Ga0395900_0249622
2186 Ga0395900_0253738
2187 Ga0395900_0257620
2188 Ga0395900_0342409
2189 Ga0395900_0352344
2190 Ga0395900_0609743
2191 Ga0395900_0830909
2192 Ga0395900_0836718
2193 Ga0395900_0953943
2194 Ga0395900_1166334
2195 Ga0395898_0003747
2196 Ga0395898_0004192
2197 Ga0395898_0006532
2198 Ga0395898_0008911
2199 Ga0395898_0012227
2200 Ga0395898_0014362
2201 Ga0395898_0016076
2202 Ga0395898_0016548
2203 Ga0395898_0017885
2204 Ga0395898_0026455
2205 Ga0395898_0030414
2206 Ga0395898_0087595
2207 Ga0395898_0184145
2208 Ga0395898_0186144
2209 Ga0395898_0317337
2210 Ga0395898_0442628
2211 Ga0395898_0457321
2212 Ga0395898_0506138
2213 Ga0395898_0563599
2214 Ga0395898_0585789
2215 Ga0395905_0009176
2216 Ga0395905_0011659
2217 Ga0395905_0012305
2218 Ga0395905_0015313
2219 Ga0395905_0016227
2220 Ga0395905_0017447
2221 Ga0395905_0020710
2222 Ga0395905_0045418
2223 Ga0395905_0074368
2224 Ga0395905_0080172
2225 Ga0395905_0090537
2226 Ga0395905_0095568
2227 Ga0395905_0105775
2228 Ga0395905_0173934
2229 Ga0395905_0198278
2230 Ga0395905_0246649
2231 Ga0395905_0250156
2232 Ga0395905_0250506
2233 Ga0395905_0369434
2234 Ga0395905_0370634
2235 Ga0395905_0797841
2236 Ga0395901_0007305
2237 Ga0395901_0008381
2238 Ga0395901_0008807
2239 Ga0395901_0009124
2240 Ga0395901_0009722
2241 Ga0395901_0010594
2242 Ga0395901_0016666
2243 Ga0395901_0019727
2244 Ga0395901_0045672
2245 Ga0395901_0066263
2246 Ga0395901_0067281
2247 Ga0395901_0073121
2248 Ga0395901_0087756
2249 Ga0395901_0088981
2250 Ga0395901_0089871
2251 Ga0395901_0101528
2252 Ga0395901_0110460
2253 Ga0395901_0134887
2254 Ga0395901_0196847
2255 Ga0395901_0208057
2256 Ga0395901_0215078
2257 Ga0395901_0262698
2258 Ga0395901_0287639
2259 Ga0395901_0337203
2260 Ga0395901_0417104
2261 Ga0395901_0462974
2262 Ga0395901_0783748
2263 Ga0395901_0843172
2264 Ga0395901_0988584
2265 Ga0395901_1053107
2266 Ga0242422_03993
2267 Ga0242420_003515
2268 Ga0436365_1661088
2269 Ga0436360_0869588
2270 Ga0439438_170111
2271 Ga0439439_0000609
2272 Ga0451787_504694
2273 Ga0451789_1348595
2274 Ga0451791_0029882
2275 Ga0451793_0388457
2276 Ga0451795_1086781
2277 Ga0451798_0656323
2278 Ga0451802_1084932
2279 Ga0451802_1879636
2280 Ga0451802_2165544
2281 Ga0451807_0686639
2282 Ga0451839_0361804
2283 Ga0451841_0140081
2284 Ga0451841_1173093
2285 Ga0451845_0813253
2286 Ga0451849_0285293
2287 Ga0451849_0920216
2288 Ga0451851_1123922
2289 Ga0451855_0770276
2290 Ga0451853_1078149
2291 Ga0451853_2987094
2292 Ga0451853_3160310
2293 Ga0439431_0104213
2294 Ga0439433_0004556
2295 Ga0439442_001947
2296 Ga0439443_060296
2297 Ga0439448_0004319
2298 Ga0439448_0063090
2299 Ga0439448_0078308
2300 Ga0439450_026141
2301 Ga0439450_031340
2302 Ga0439450_042827
2303 Ga0439455_0028173
2304 Ga0439456_112548
2305 Ga0439462_0003467
2306 Ga0439463_037472
2307 Ga0450915_005121
2308 Ga0450888_000932
2309 Ga0439446_0002878
2310 Ga0439458_0004418
2311 Ga0439458_0126975
2312 Ga0450908_038111
2313 Ga0439434_0026808
2314 Ga0439434_0047178
2315 Ga0439435_0111272
2316 Ga0439444_0086232
2317 Ga0439459_0008081
2318 Ga0439464_0124129
2319 Ga0439460_0066696
2320 Ga0439460_0090270
2321 Ga0450916_065751
2322 Ga0450893_0044822
2323 Ga0450893_0122499
2324 Ga0439440_0107552
2325 Ga0439440_0158982
2326 Ga0439440_0171532
2327 Ga0466969_0043984
2328 Ga0466972_0504106
2329 Ga0466965_0031336
2330 Ga0466965_0132715
2331 Ga0466965_0361847
2332 Ga0466966_0023644
2333 Ga0466961_0022243
2334 Ga0466961_0094973
2335 Ga0466961_0126523
2336 Ga0466963_0010940
2337 Ga0466963_0027690
2338 Ga0466963_0033618
2339 Ga0466963_0084509
2340 Ga0466963_0113103
2341 Ga0466963_0126260
2342 Ga0466963_0194893
2343 Ga0466963_0429750
2344 Ga0466963_0477065
2345 Ga0466963_0502089
2346 Ga0466963_0527813
2347 Ga0466963_0681302
2348 Ga0466963_1109014
2349 Ga0466964_0000847
2350 Ga0466964_0017553
2351 Ga0466964_0041876
2352 Ga0466964_0072975
2353 Ga0466964_0075329
2354 Ga0466964_0157780
2355 Ga0466964_0329124
2356 Ga0466964_0377108
2357 Ga0466964_0433643
2358 Ga0466964_0817762
2359 Ga0466971_0049704
2360 Ga0466971_0057526
2361 Ga0466971_0077519
2362 Ga0466971_0160388
2363 Ga0466968_0004269
2364 Ga0466968_0060350
2365 Ga0466968_0086909
2366 Ga0466968_0219622
2367 Ga0466968_0333740
2368 Ga0466970_0105577
2369 Ga0466970_0140890
2370 Ga0466957_0097678
2371 Ga0466957_0137844
2372 Ga0466957_0510641
2373 Ga0466957_0719304
2374 Ga0466960_0006072
2375 Ga0466960_0072631
2376 Ga0466960_0080778
2377 Ga0466959_0013052
2378 Ga0466959_0024209
2379 Ga0466959_0283191
2380 Ga0451576_0102879
2381 Ga0466958_0011139
2382 Ga0466958_0041683
2383 Ga0466958_0247779
2384 Ga0466958_0318387
2385 Ga0466958_0639699
2386 Ga0466958_0668775
2387 Ga0466958_1170482
2388 Ga0466967_0001517
2389 Ga0466967_0003014
2390 Ga0466967_0009587
2391 Ga0466967_0019987
2392 Ga0466967_0027642
2393 Ga0466967_0034503
2394 Ga0466967_0059861
2395 Ga0466967_0070363
2396 Ga0466967_0131984
2397 Ga0466967_0144149
2398 Ga0466967_0230156
2399 Ga0466967_0242257
2400 Ga0466967_0366690
2401 Ga0466967_0378173
2402 Ga0466967_0380377
2403 Ga0466967_0571103
2404 Ga0466967_0679309
2405 Ga0495617_129270
2406 Ga0495627_046651
2407 Ga0495592_0013250
2408 Ga0495592_0396244
2409 Ga0495603_0230307
2410 Ga0495591_114714
2411 Ga0495629_0162179
2412 Ga0495629_0578436
2413 Ga0495629_0601140
2414 Ga0495641_0031218
2415 Ga0495651_0013235
2416 Ga0495651_0158078
2417 Ga0495653_0154665
2418 Ga0495580_0772573
2419 Ga0495582_0049433
2420 Ga0495582_0135521
2421 Ga0495582_0272041
2422 Ga0495582_0363573
2423 Ga0495582_0501241
2424 Ga0495605_0020917
2425 Ga0495605_0052109
2426 Ga0495605_0160231
2427 Ga0495662_0040886
2428 Ga0495662_0216451
2429 Ga0495664_0170434
2430 Ga0495664_0313245
2431 Ga0495664_0415168
2432 Ga0495584_0323274
2433 Ga0495607_0117537
2434 Ga0495608_0025716
2435 Ga0495608_0080762
2436 Ga0495608_0469645
2437 Ga0495608_0927343
2438 Ga0495618_0348671
2439 Ga0495618_0577752
2440 Ga0495628_0204430
2441 Ga0495630_0035675
2442 Ga0495630_0273920
2443 Ga0495630_1254182
2444 Ga0495631_0091583
2445 Ga0495631_0208705
2446 Ga0495637_0291252
2447 Ga0495644_0081797
2448 Ga0495644_0193093
2449 Ga0495663_0163199
2450 Ga0495663_0261587
2451 Ga0495666_0012440
2452 Ga0495642_0276926
2453 Ga0495652_0237119
2454 Ga0495652_0279879
2455 Ga0495652_0353119
2456 Ga0495652_0367160
2457 Ga0495652_0687455
2458 Ga0495665_0018007
2459 Ga0495665_0561166
2460 Ga0495640_0160889
2461 Ga0495587_0378938
2462 Ga0495609_0141382
2463 Ga0495609_0374440
2464 Ga0495645_0105036
2465 Ga0495645_0269388
2466 Ga0495667_0006310
2467 Ga0495667_0073862
2468 Ga0495667_0297333
2469 Ga0495656_0186484
2470 Ga0495656_0298901
2471 Ga0495656_0323165
2472 Ga0495668_0591482
2473 Ga0495634_0098006
2474 Ga0495634_0213970
2475 Ga0495611_0071162
2476 Ga0495611_0214336
2477 Ga0495635_0083839
2478 Ga0495635_0118680
2479 Ga0495659_0022681
2480 Ga0495588_0135252
2481 Ga0495588_0135682
2482 Ga0495657_0087951
2483 Ga0495657_0257393
2484 Ga0495623_0067800
2485 Ga0495646_0150962
2486 Ga0495647_0118589
2487 Ga0495658_0018501
2488 Ga0495658_0023792
2489 Ga0495658_0058999
2490 Ga0495658_0946840
2491 Ga0495613_0143702
2492 Ga0495613_0191297
2493 Ga0495624_0151515
2494 Ga0495624_0344591
2495 Ga0495670_0235456
2496 Ga0495589_0377270
2497 Ga0495600_0418192
2498 Ga0495581_0000868
2499 Ga0495604_0947874
2500 Ga0495636_0118234
2501 Ga0495636_0324417
2502 Ga0495674_0081351
2503 Ga0495674_0171551
2504 Ga0495674_0442190
2505 Ga0495676_0018960
2506 Ga0495676_0041793
2507 Ga0495676_0257510
2508 Ga0495676_0298717
2509 Ga0495680_0014538
2510 Ga0495680_0264282
2511 Ga0495680_0492525
2512 Ga0495680_0522511
2513 Ga0495675_0784363
2514 Ga0495677_0248158
2515 Ga0495679_200978
2516 Ga0495685_064047
2517 Ga0495685_140167
2518 Ga0495684_0023112
2519 Ga0495602_0067084
2520 Ga0495614_0059638
2521 Ga0495614_0100970
2522 Ga0495615_0049389
2523 Ga0496100_0007025
2524 Ga0496100_0066864
2525 Ga0496100_0117670
2526 Ga0496100_0148998
2527 Ga0496100_0280718
2528 Ga0496100_0341681
2529 Ga0496100_0407491
2530 Ga0496100_0752957
2531 Ga0496100_1138886
2532 Ga0496101_0005132
2533 Ga0496101_0026950
2534 Ga0496101_0082282
2535 Ga0496101_0179138
2536 Ga0496101_0232909
2537 Ga0496101_0313287
2538 Ga0496102_0020418
2539 Ga0496102_0057361
2540 Ga0496102_0084335
2541 Ga0496102_0092105
2542 Ga0496102_0590586
2543 Ga0496102_0666377
2544 Ga0496102_0940229
2545 Ga0496102_1098188
2546 Ga0496103_0008216
2547 Ga0496103_0029843
2548 Ga0496103_0049030
2549 Ga0496103_0113212
2550 Ga0496103_0219217
2551 Ga0496103_0350328
2552 Ga0496104_0013997
2553 Ga0496104_0026648
2554 Ga0496104_0117845
2555 Ga0496104_0160532
2556 Ga0496104_0325331
2557 Ga0496104_0579283
2558 Ga0496104_0889899
2559 Ga0496104_1104840
2560 Ga0496105_0016517
2561 Ga0496105_0023998
2562 Ga0496105_0074608
2563 Ga0496105_0182990
2564 Ga0496106_0136569
2565 Ga0496106_0163600
2566 Ga0496106_0197991
2567 Ga0496106_0198964
2568 Ga0496106_0468072
2569 Ga0496107_0010371
2570 Ga0496107_0011310
2571 Ga0496107_0049067
2572 Ga0496107_0143457
2573 Ga0496107_0191775
2574 Ga0496107_0573794
2575 Ga0496107_0600311
2576 Ga0496107_0802777
2577 Ga0496107_0950419
2578 Ga0496108_0035156
2579 Ga0496108_0154131
2580 Ga0496108_0278327
2581 Ga0496108_0297963
2582 Ga0496108_0335462
2583 Ga0496108_0353376
2584 Ga0496108_0392498
2585 Ga0496108_0575434
2586 Ga0496109_0011051
2587 Ga0496109_0040435
2588 Ga0496109_0043403
2589 Ga0496109_0067879
2590 Ga0496109_0115456
2591 Ga0496109_0121599
2592 Ga0496109_0147846
2593 Ga0496109_0219127
2594 Ga0496109_0232003
2595 Ga0496109_0236783
2596 Ga0496109_0304815
2597 Ga0496109_0364995
2598 Ga0496109_0490842
2599 Ga0496109_0679168
2600 Ga0496109_0825276
2601 Ga0496109_0959138
2602 Ga0496110_0046941
2603 Ga0496110_0093561
2604 Ga0496110_0120314
2605 Ga0496110_0241553
2606 Ga0496110_0279442
2607 Ga0496110_0386203
2608 Ga0496110_0419627
2609 Ga0496110_0542167
2610 Ga0496110_0547725
2611 Ga0496110_1573298
2612 Ga0496111_0024043
2613 Ga0496111_0041866
2614 Ga0496111_0043041
2615 Ga0496111_0263696
2616 Ga0496111_0264101
2617 Ga0496111_0298877
2618 Ga0496111_0362613
2619 Ga0496111_0730041
2620 Ga0496111_0888781
2621 Ga0496112_0076547
2622 Ga0496112_0082662
2623 Ga0496112_0176601
2624 Ga0496112_0236011
2625 Ga0496112_0316455
2626 Ga0496112_0369982
2627 Ga0496112_0578579
2628 Ga0496113_0016416
2629 Ga0496113_0071693
2630 Ga0496113_0109054
2631 Ga0496113_0188759
2632 Ga0496113_0209049
2633 Ga0496113_0230149
2634 Ga0496113_0257723
2635 Ga0496113_0339712
2636 Ga0496113_1305121
2637 Ga0496114_0008715
2638 Ga0496114_0010512
2639 Ga0496114_0019327
2640 Ga0496114_0070400
2641 Ga0496114_0076084
2642 Ga0496114_0221454
2643 Ga0496114_0240604
2644 Ga0496114_0311310
2645 Ga0496114_0787506
2646 Ga0496114_0919016
2647 Ga0496114_0968841
2648 Ga0496115_0003388
2649 Ga0496115_0014734
2650 Ga0496115_0076556
2651 Ga0496115_0095042
2652 Ga0496115_0134589
2653 Ga0496115_0239836
2654 Ga0496115_0253968
2655 Ga0501031_0003798
2656 Ga0501031_0015280
2657 Ga0501032_0004530
2658 Ga0501032_0010424
2659 Ga0501032_0835313
2660 Ga0501033_0015994
2661 Ga0501034_0014020
2662 Ga0501036_0004028
2663 Ga0501036_0034540
2664 Ga0501036_0175744
2665 Ga0501037_0001346
2666 Ga0501037_0010849
2667 Ga0501038_0003128
2668 Ga0501038_0028881
2669 Ga0501039_0069173
2670 Ga0501039_0070088
2671 Ga0501039_1081270
2672 Ga0501040_0011794
2673 Ga0501040_0031310
2674 Ga0501040_0091243
2675 Ga0501040_0394173
2676 Ga0501041_0040776
2677 Ga0501041_0129841
2678 Ga0501041_0320054
2679 Ga0501041_0736857
2680 Ga0501042_0005516
2681 Ga0501042_0095228
2682 Ga0501042_0388049
2683 Ga0501042_0467255
2684 Ga0501042_0519014
2685 Ga0501043_0010883
2686 Ga0501043_0036692
2687 Ga0501043_0192479
2688 Ga0501046_0002682
2689 Ga0501046_0027463
2690 Ga0501046_0343323
2691 Ga0501047_0031585
2692 Ga0501047_0131362
2693 Ga0501048_0011343
2694 Ga0501048_0052643
2695 Ga0501067_0000018
2696 Ga0501067_0000043
2697 Ga0501067_0053936
2698 Ga0501067_0323688
2699 Ga0501067_0588167
2700 Ga0501068_0000161
2701 Ga0501068_0002637
2702 Ga0501068_0005381
2703 Ga0501068_0149947
2704 Ga0501068_0236218
2705 Ga0501068_0678386
2706 Ga0501068_1022757
2707 Ga0501069_0000286
2708 Ga0501069_0002442
2709 Ga0501069_0003827
2710 Ga0501069_0010207
2711 Ga0501069_0051697
2712 Ga0501069_0260352
2713 Ga0501070_0002395
2714 Ga0501070_0008310
2715 Ga0501070_0074343
2716 Ga0501070_0529840
2717 Ga0501070_0626780
2718 Ga0501071_0002202
2719 Ga0501071_0043650
2720 Ga0501071_0054335
2721 Ga0501071_0526302
2722 Ga0501072_0063536
2723 Ga0501072_0077783
2724 Ga0501072_0302291
2725 Ga0501073_0004308
2726 Ga0501073_0077338
2727 Ga0501073_0665565
2728 Ga0501074_0067464
2729 Ga0501074_0082815
2730 Ga0501074_0096410
2731 Ga0501074_0173871
2732 Ga0501075_0050264
2733 Ga0501075_0065557
2734 Ga0501075_0302685
2735 Ga0501075_0411955
2736 Ga0501076_0003583
2737 Ga0501076_0013986
2738 Ga0501076_0033114
2739 Ga0501076_0033754
2740 Ga0501076_0275579
2741 Ga0501076_0691434
2742 Ga0501077_0003014
2743 Ga0501077_0081550
2744 Ga0501077_0124262
2745 Ga0501077_0525475
2746 Ga0501079_0005345
2747 Ga0501079_0097510
2748 Ga0501079_0228665
2749 Ga0501079_0455359
2750 Ga0501079_0661662
2751 Ga0501079_0710330
2752 Ga0501080_0004462
2753 Ga0501080_0014549
2754 Ga0501080_0017828
2755 Ga0501080_0496176
2756 Ga0501081_0007101
2757 Ga0501081_0028955
2758 Ga0501081_0127918
2759 Ga0501081_0302424
2760 Ga0501081_0501822
2761 Ga0501081_0744651
2762 Ga0501083_0000504
2763 Ga0501083_0002288
2764 Ga0501035_0001724
2765 Ga0501035_0005345
2766 Ga0501035_0380752
2767 Ga0501044_0119076
2768 Ga0501044_0189926
2769 Ga0501045_0005671
2770 Ga0501045_0019593
2771 Ga0501045_0118894
2772 Ga0501045_0221787
2773 nmdc:mga05p37_221536_c1
2774 nmdc:mga05p37_249737_c1
2775 nmdc:mga05p37_276752_c1
2776 nmdc:mga05p37_304773_c1
2777 nmdc:mga05p37_581007_c1
2778 nmdc:mga05p37_59343_c1
2779 nmdc:mga05p37_61186_c1
2780 nmdc:mga05p37_762516_c1
2781 nmdc:mga05p37_78557_c1
2782 nmdc:mga09592_245893_c1
2783 nmdc:mga09592_269491_c1
2784 nmdc:mga09592_528256_c1
2785 nmdc:mga09592_90669_c1
2786 nmdc:mga0qj67_156000_c1
2787 nmdc:mga06r32_119803_c1
2788 nmdc:mga06r32_19413_c1
2789 nmdc:mga06r32_912014_c1
2790 nmdc:mga08y16_322950_c1
2791 nmdc:mga08y16_325918_c1
2792 nmdc:mga08y16_34368_c1
2793 nmdc:mga08y16_40602_c1
2794 nmdc:mga08y16_633725_c1
2795 nmdc:mga08y16_823367_c1
2796 nmdc:mga08y16_973209_c1
2797 nmdc:mga0n895_1311314_c1
2798 nmdc:mga0n895_175464_c1
2799 nmdc:mga0n895_184995_c1
2800 nmdc:mga0n895_355650_c1
2801 nmdc:mga0n895_38675_c1
2802 nmdc:mga0n895_50477_c1
2803 nmdc:mga0n895_657581_c1
2804 nmdc:mga0rr50_178493_c1
2805 nmdc:mga0rr50_190484_c1
2806 nmdc:mga0rr50_191937_c1
2807 nmdc:mga0rr50_250762_c1
2808 nmdc:mga0rr50_6190_c1
2809 nmdc:mga0rr50_63031_c1
2810 nmdc:mga0rr50_69825_c1
2811 nmdc:mga08x19_12299_c1
2812 nmdc:mga08x19_12301_c1
2813 nmdc:mga08x19_44327_c1
2814 nmdc:mga08x19_452140_c1
2815 nmdc:mga08x19_660532_c1
2816 nmdc:mga08x19_75235_c1
2817 nmdc:mga0a205_124147_c1
2818 nmdc:mga0a205_168641_c1
2819 nmdc:mga0a205_221004_c1
2820 nmdc:mga0a205_29263_c1
2821 nmdc:mga0a205_299559_c1
2822 nmdc:mga0a205_62006_c1
2823 nmdc:mga0a205_67173_c1
2824 nmdc:mga0a205_80998_c1
2825 Ga0495601_0016899
2826 Ga0495601_0166305
2827 Ga0495601_0176904
2828 Ga0495601_0180551
2829 Ga0495601_0470284
2830 Ga0495612_0068571
2831 Ga0495612_0274688
2832 Ga0495655_0000869
2833 Ga0495595_0009513
2834 Ga0495595_0027753
2835 Ga0495595_0654230
2836 Ga0495619_0027019
2837 Ga0501084_0009042
2838 Ga0501084_0071982
2839 Ga0501084_0174171
2840 Ga0501084_0216422
2841 Ga0501084_0292581
2842 Ga0501084_0532896
2843 Ga0587073_0175252
2844 Ga0587077_044317
2845 Ga0587077_123958
2846 Ga0587082_016692
2847 Ga0587083_0074244
2848 Ga0587083_0242280
2849 Ga0587088_036441
2850 Ga0587088_061728
2851 Ga0587090_060446
2852 Ga0587094_093420
2853 Ga0587099_030972
2854 Ga0587101_068974
2855 Ga0587128_091006
2856 Ga0587067_051046
2857 Ga0587114_051410
2858 Ga0587071_044473
2859 Ga0587111_0251542
2860 Ga0501082_0014408
2861 Ga0501082_0073390
2862 Ga0501082_0129571
2863 Ga0501082_0144350
2864 Ga0501082_0526563
2865 Ga0501082_0779018
2866 Ga0466962_0024344
2867 Ga0466962_0240545
2868 Ga0466962_0412461
2869 Ga0530510_0003434
2870 Ga0530510_0024990
2871 Ga0530510_0096661
2872 Ga0530510_0292182
2873 Ga0530510_0328875
2874 Ga0530510_0338454

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00436

SSB

Single-strand binding protein family

5

109

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
2cwa-assembly1.cif.gz_A crystal structure of the single-stranded dna binding protein from thermus thermophilus hb8 0.9603 4 108
6bhw-assembly2.cif.gz_E b. subtilis ssba 0.9508 4 108
3tqy-assembly1.cif.gz_D structure of a single-stranded dna-binding protein (ssb), from coxiella burnetii 0.9461 3 109
6bhw-assembly1.cif.gz_A b. subtilis ssba 0.9415 4 110
5odn-assembly1.cif.gz_D salinibacter ruber single-strand binding protein 0.9403 1 108
ID Description Score Start End Superfamily
af_Q2G112_1_115_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9126 4 111 2.40.50.140
5odnH00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8994 1 108 2.40.50.140
6bhwF00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8925 4 107 2.40.50.140
af_F1QB63_52_370_1.25.40.20 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Ankyrin repeat-containing domain 0.8866 32 55 1.25.40.20
af_C4J9S9_72_176_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8865 1 111 2.40.50.140
ID Description Score Start End GO Terms
AF-A0A7V4AAE6-F1-model_v4 Single-stranded DNA-binding protein (SSB) 0.9301 4 109 GO:0003697
GO:0006260
GO:0009295
AF-A0A0G1IEC5-F1-model_v4 Single-stranded DNA-binding protein (SSB) 0.9254 4 115 GO:0003697
GO:0006260
GO:0009295
AF-A0A2V9H5Y2-F1-model_v4 Single-stranded DNA-binding protein 0.9252 3 112 GO:0003697
GO:0006260
GO:0009295
AF-A0A1Y4R849-F1-model_v4 Single-stranded DNA-binding protein 0.9213 4 108 GO:0003697
GO:0006260
AF-A0A7C5RVI8-F1-model_v4 Single-stranded DNA-binding protein (SSB) 0.9194 4 111 GO:0003697
GO:0006260
GO:0009295

Map