F493954
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1437 | 478 | 2874 | 144 |
Family's Representative Sequence
| Representative Sequence | 3300025944|Ga0207661_10042438|Ga0207661_100424384 |
| Length | 137 |
| Sequence | MAANINRVVLVGNLTRDPELRHTPSGMAVCSLRIAVNTRRKDSTSGQWTEKPNYFDITVWGNQGESCAQYLSKGRPVAVDGRLEWREWDAQDGTKRQAVEIIADSVQFLGGRDQFVPAGASSGSDADFQGSDDDIPF |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 2 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 3 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 4 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 5 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 9 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 11 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 12 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 14 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 16 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 17 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 26 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 42 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 43 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 49 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 52 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 54 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 60 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 62 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 63 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 64 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 66 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 67 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 68 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 69 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 70 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 71 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 72 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 73 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 74 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 75 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 76 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 77 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 79 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 80 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 81 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 82 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 83 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 84 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 85 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 87 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 88 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 89 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 90 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 91 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 92 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 93 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 94 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 95 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 97 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300012481 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.1.yng.040610 | Metagenome | Rhizosphere |
| 111 | 3300012488 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.yng.030610 | Metagenome | Rhizosphere |
| 112 | 3300012502 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 | Metagenome | Rhizosphere |
| 113 | 3300012503 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R | Metagenome | Rhizosphere |
| 114 | 3300012505 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 | Metagenome | Rhizosphere |
| 115 | 3300012507 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 | Metagenome | Rhizosphere |
| 116 | 3300012510 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 | Metagenome | Rhizosphere |
| 117 | 3300012512 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 | Metagenome | Rhizosphere |
| 118 | 3300012515 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 | Metagenome | Rhizosphere |
| 119 | 3300013045 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 120 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 131 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 135 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 136 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 138 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 139 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 140 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 141 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 142 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 143 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 144 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 145 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 146 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 147 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 148 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 149 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 211 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 215 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 216 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 217 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 218 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 219 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 220 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 221 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 222 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 223 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 224 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 225 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 226 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 227 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 228 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 229 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 230 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 231 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 232 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 233 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 234 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 235 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 236 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 237 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 238 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 239 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 240 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 241 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 242 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 243 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 244 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 245 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 246 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 247 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 248 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 249 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 250 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 251 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 252 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 253 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 254 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 255 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 256 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 257 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 258 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 259 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 260 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 261 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 262 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 263 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 264 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 265 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 266 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 267 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 268 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 269 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 270 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 271 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 272 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 273 | 3300038699 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot26 | Metagenome | Rhizosphere |
| 274 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 275 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 276 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 277 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 278 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 279 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 280 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 281 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 282 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 283 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 284 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 285 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 286 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 287 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 288 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 289 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 290 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 291 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 292 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 293 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 294 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 295 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 296 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 297 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 298 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 299 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 300 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 301 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 302 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 303 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 304 | 3300042119 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218L_E14_082316_1902 | Metagenome | Rhizosphere |
| 305 | 3300042126 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 | Metagenome | Rhizosphere |
| 306 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 307 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 308 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 309 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 310 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 311 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 312 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 313 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 314 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 315 | 3300042530 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 | Metagenome | Rhizosphere |
| 316 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 317 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 318 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 319 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 320 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 321 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 322 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 323 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 324 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 325 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 326 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 327 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 328 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 329 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 330 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 331 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 332 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 333 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 334 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 399 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 400 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 401 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 402 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 403 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 404 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 405 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 406 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 407 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 408 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 409 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 410 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 411 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 412 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 413 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 414 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 415 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 416 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 417 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 418 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 419 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 420 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 421 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 422 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 423 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 424 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 425 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 426 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 427 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 428 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 429 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 430 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 431 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 432 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 433 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 434 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 435 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 436 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 437 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 438 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 439 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 440 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 441 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 442 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 443 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 444 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 445 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 446 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 447 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 448 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 449 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 450 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 451 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 452 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 453 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 454 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 455 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 456 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 457 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 458 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 459 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 460 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 461 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 462 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 463 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 464 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 465 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 466 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 467 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 468 | 3300059513 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 469 | 3300059622 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 222R_AD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 470 | 3300059623 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 471 | 3300059630 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 472 | 3300059640 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 473 | 3300059655 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 474 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 475 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 476 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 477 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 478 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.08 |
| Metatranscriptomes | 2.92 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.21 |
| Nodule | 0 |
| Rhizoplane | 9.88 |
| Rhizosphere | 89.07 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 9.81 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0207661_10042438 | 3300025944 | Bacteria | 3586 |
| 2 | JGI25407J50210_10003347 | 3300003373 | Bacteria | 3823 |
| 3 | JGI25407J50210_10011863 | 3300003373 | Bacteria | 2231 |
| 4 | JGI25407J50210_10013973 | 3300003373 | Bacteria | 2067 |
| 5 | Ga0058861_10075293 | 3300004800 | Bacteria | 1136 |
| 6 | Ga0058861_11810407 | 3300004800 | Bacteria | 938 |
| 7 | Ga0058862_10046701 | 3300004803 | Bacteria | 1773 |
| 8 | Ga0070658_10105256 | 3300005327 | Bacteria | 2334 |
| 9 | Ga0070658_10646176 | 3300005327 | Bacteria | 918 |
| 10 | Ga0070658_10996356 | 3300005327 | Bacteria | 729 |
| 11 | Ga0070676_10293772 | 3300005328 | Bacteria | 1099 |
| 12 | Ga0070683_100001379 | 3300005329 | Bacteria | 18627 |
| 13 | Ga0070683_100005013 | 3300005329 | Bacteria | 10989 |
| 14 | Ga0070683_100037229 | 3300005329 | Bacteria | 4453 |
| 15 | Ga0070683_100044833 | 3300005329 | Bacteria | 4080 |
| 16 | Ga0070683_100241605 | 3300005329 | Unclassified | 1718 |
| 17 | Ga0070683_100333756 | 3300005329 | Bacteria | 1444 |
| 18 | Ga0070690_100121705 | 3300005330 | Bacteria | 1752 |
| 19 | Ga0070690_100301729 | 3300005330 | Bacteria | 1149 |
| 20 | Ga0070670_100049075 | 3300005331 | Bacteria | 3631 |
| 21 | Ga0068869_100170346 | 3300005334 | Bacteria | 1701 |
| 22 | Ga0068869_100267798 | 3300005334 | Bacteria | 1370 |
| 23 | Ga0070680_100016898 | 3300005336 | Bacteria | 5743 |
| 24 | Ga0070680_100128742 | 3300005336 | Bacteria | 2116 |
| 25 | Ga0070682_100001120 | 3300005337 | Bacteria | 15323 |
| 26 | Ga0070682_100169777 | 3300005337 | Unclassified | 1515 |
| 27 | Ga0068868_100163557 | 3300005338 | Bacteria | 1839 |
| 28 | Ga0068868_100258518 | 3300005338 | Bacteria | 1468 |
| 29 | Ga0068868_100490425 | 3300005338 | Bacteria | 1075 |
| 30 | Ga0070660_100104555 | 3300005339 | Bacteria | 2247 |
| 31 | Ga0070660_100267490 | 3300005339 | Bacteria | 1397 |
| 32 | Ga0070660_100822680 | 3300005339 | Unclassified | 782 |
| 33 | Ga0070689_100037671 | 3300005340 | Bacteria | 3698 |
| 34 | Ga0070689_100096247 | 3300005340 | Bacteria | 2340 |
| 35 | Ga0070689_100241720 | 3300005340 | Bacteria | 1487 |
| 36 | Ga0070689_100487859 | 3300005340 | Unclassified | 1053 |
| 37 | Ga0070691_10364657 | 3300005341 | Unclassified | 806 |
| 38 | Ga0070687_100140768 | 3300005343 | Bacteria | 1405 |
| 39 | Ga0070687_100248623 | 3300005343 | Bacteria | 1104 |
| 40 | Ga0070661_100016760 | 3300005344 | Bacteria | 5187 |
| 41 | Ga0070661_100210300 | 3300005344 | Bacteria | 1489 |
| 42 | Ga0070661_100255486 | 3300005344 | Bacteria | 1353 |
| 43 | Ga0070661_100577397 | 3300005344 | Unclassified | 907 |
| 44 | Ga0070668_100975774 | 3300005347 | Unclassified | 761 |
| 45 | Ga0070669_100215976 | 3300005353 | Bacteria | 1515 |
| 46 | Ga0070675_100602373 | 3300005354 | Bacteria | 996 |
| 47 | Ga0070671_100137891 | 3300005355 | Bacteria | 2057 |
| 48 | Ga0070671_100201298 | 3300005355 | Bacteria | 1688 |
| 49 | Ga0070671_100418891 | 3300005355 | Bacteria | 1147 |
| 50 | Ga0070674_100514522 | 3300005356 | Bacteria | 999 |
| 51 | Ga0070674_100577638 | 3300005356 | Bacteria | 947 |
| 52 | Ga0070673_100379501 | 3300005364 | Unclassified | 1260 |
| 53 | Ga0070673_100894913 | 3300005364 | Unclassified | 823 |
| 54 | Ga0070673_101445147 | 3300005364 | Bacteria | 648 |
| 55 | Ga0070688_100004502 | 3300005365 | Bacteria | 7264 |
| 56 | Ga0070659_100222305 | 3300005366 | Unclassified | 1559 |
| 57 | Ga0070659_101074117 | 3300005366 | Bacteria | 709 |
| 58 | Ga0070667_100010579 | 3300005367 | Bacteria | 7617 |
| 59 | Ga0070667_100610295 | 3300005367 | Bacteria | 1006 |
| 60 | Ga0070703_10006333 | 3300005406 | Bacteria | 3317 |
| 61 | Ga0070703_10013655 | 3300005406 | Bacteria | 2309 |
| 62 | Ga0070703_10015940 | 3300005406 | Bacteria | 2154 |
| 63 | Ga0070709_10074329 | 3300005434 | Bacteria | 2202 |
| 64 | Ga0070709_10112566 | 3300005434 | Bacteria | 1832 |
| 65 | Ga0070709_10115793 | 3300005434 | Bacteria | 1808 |
| 66 | Ga0070709_10119257 | 3300005434 | Bacteria | 1785 |
| 67 | Ga0070709_10336019 | 3300005434 | Bacteria | 1112 |
| 68 | Ga0070709_10526075 | 3300005434 | Unclassified | 902 |
| 69 | Ga0070714_100098687 | 3300005435 | Bacteria | 2570 |
| 70 | Ga0070714_100131822 | 3300005435 | Bacteria | 2234 |
| 71 | Ga0070714_100135402 | 3300005435 | Bacteria | 2205 |
| 72 | Ga0070714_100185055 | 3300005435 | Bacteria | 1897 |
| 73 | Ga0070714_100554624 | 3300005435 | Bacteria | 1100 |
| 74 | Ga0070714_100794724 | 3300005435 | Bacteria | 916 |
| 75 | Ga0070714_101065556 | 3300005435 | Bacteria | 787 |
| 76 | Ga0070713_100009354 | 3300005436 | Bacteria | 7008 |
| 77 | Ga0070713_100117684 | 3300005436 | Bacteria | 2326 |
| 78 | Ga0070713_100342452 | 3300005436 | Bacteria | 1385 |
| 79 | Ga0070710_10008661 | 3300005437 | Bacteria | 4956 |
| 80 | Ga0070710_10013881 | 3300005437 | Bacteria | 4044 |
| 81 | Ga0070710_10015912 | 3300005437 | Unclassified | 3815 |
| 82 | Ga0070710_10053122 | 3300005437 | Bacteria | 2281 |
| 83 | Ga0070710_10243178 | 3300005437 | Unclassified | 1154 |
| 84 | Ga0070710_10304204 | 3300005437 | Unclassified | 1041 |
| 85 | Ga0070710_10369129 | 3300005437 | Bacteria | 954 |
| 86 | Ga0070710_10391138 | 3300005437 | Bacteria | 930 |
| 87 | Ga0070701_10012076 | 3300005438 | Bacteria | 3882 |
| 88 | Ga0070701_10294474 | 3300005438 | Bacteria | 996 |
| 89 | Ga0070711_100014628 | 3300005439 | Bacteria | 4946 |
| 90 | Ga0070711_100030732 | 3300005439 | Bacteria | 3559 |
| 91 | Ga0070711_100043560 | 3300005439 | Bacteria | 3040 |
| 92 | Ga0070711_100196860 | 3300005439 | Bacteria | 1552 |
| 93 | Ga0070711_100288057 | 3300005439 | Bacteria | 1302 |
| 94 | Ga0070711_100355449 | 3300005439 | Bacteria | 1179 |
| 95 | Ga0070711_100369955 | 3300005439 | Unclassified | 1156 |
| 96 | Ga0070711_100589877 | 3300005439 | Bacteria | 926 |
| 97 | Ga0070705_100010056 | 3300005440 | Bacteria | 4726 |
| 98 | Ga0070705_100256947 | 3300005440 | Bacteria | 1230 |
| 99 | Ga0070705_100271398 | 3300005440 | Bacteria | 1201 |
| 100 | Ga0070705_101172379 | 3300005440 | Bacteria | 632 |
| 101 | Ga0070705_101338758 | 3300005440 | Unclassified | 595 |
| 102 | Ga0070700_100021368 | 3300005441 | Bacteria | 3761 |
| 103 | Ga0070694_100116597 | 3300005444 | Bacteria | 1910 |
| 104 | Ga0070694_100146848 | 3300005444 | Bacteria | 1718 |
| 105 | Ga0070708_100032536 | 3300005445 | Unclassified | 4525 |
| 106 | Ga0070708_100308065 | 3300005445 | Bacteria | 1491 |
| 107 | Ga0070708_100352794 | 3300005445 | Bacteria | 1386 |
| 108 | Ga0070708_100672842 | 3300005445 | Bacteria | 975 |
| 109 | Ga0070708_101551238 | 3300005445 | Bacteria | 617 |
| 110 | Ga0070678_100082013 | 3300005456 | Bacteria | 2447 |
| 111 | Ga0070678_100097624 | 3300005456 | Bacteria | 2269 |
| 112 | Ga0070678_100098306 | 3300005456 | Bacteria | 2263 |
| 113 | Ga0070678_100252065 | 3300005456 | Bacteria | 1480 |
| 114 | Ga0070678_100347824 | 3300005456 | Bacteria | 1274 |
| 115 | Ga0070662_100111577 | 3300005457 | Bacteria | 2084 |
| 116 | Ga0070681_10086158 | 3300005458 | Bacteria | 3094 |
| 117 | Ga0070681_10112485 | 3300005458 | Bacteria | 2662 |
| 118 | Ga0070681_10113387 | 3300005458 | Bacteria | 2650 |
| 119 | Ga0070681_10354777 | 3300005458 | Bacteria | 1377 |
| 120 | Ga0070681_10467524 | 3300005458 | Bacteria | 1174 |
| 121 | Ga0068867_100004127 | 3300005459 | Bacteria | 10203 |
| 122 | Ga0068867_100074175 | 3300005459 | Bacteria | 2550 |
| 123 | Ga0068867_100852157 | 3300005459 | Bacteria | 816 |
| 124 | Ga0070685_10001503 | 3300005466 | Bacteria | 12290 |
| 125 | Ga0070685_11102103 | 3300005466 | Unclassified | 600 |
| 126 | Ga0070706_100069251 | 3300005467 | Bacteria | 3264 |
| 127 | Ga0070706_100074391 | 3300005467 | Unclassified | 3144 |
| 128 | Ga0070706_100519581 | 3300005467 | Bacteria | 1108 |
| 129 | Ga0070706_100605621 | 3300005467 | Bacteria | 1018 |
| 130 | Ga0070706_100895796 | 3300005467 | Bacteria | 820 |
| 131 | Ga0070707_100064946 | 3300005468 | Bacteria | 3505 |
| 132 | Ga0070707_100080465 | 3300005468 | Bacteria | 3145 |
| 133 | Ga0070707_100088760 | 3300005468 | Bacteria | 2991 |
| 134 | Ga0070707_100158631 | 3300005468 | Bacteria | 2204 |
| 135 | Ga0070707_100263819 | 3300005468 | Bacteria | 1675 |
| 136 | Ga0070707_100510843 | 3300005468 | Bacteria | 1163 |
| 137 | Ga0070698_100011346 | 3300005471 | Bacteria | 9462 |
| 138 | Ga0070698_100046946 | 3300005471 | Bacteria | 4415 |
| 139 | Ga0070698_100100007 | 3300005471 | Bacteria | 2873 |
| 140 | Ga0070698_100140692 | 3300005471 | Bacteria | 2364 |
| 141 | Ga0070698_100252945 | 3300005471 | Bacteria | 1694 |
| 142 | Ga0070698_100734658 | 3300005471 | Unclassified | 930 |
| 143 | Ga0070698_101362834 | 3300005471 | Bacteria | 660 |
| 144 | Ga0070699_100034414 | 3300005518 | Bacteria | 4378 |
| 145 | Ga0070699_100065621 | 3300005518 | Bacteria | 3150 |
| 146 | Ga0070699_100119033 | 3300005518 | Bacteria | 2322 |
| 147 | Ga0070699_100134166 | 3300005518 | Bacteria | 2183 |
| 148 | Ga0070699_100728365 | 3300005518 | Bacteria | 907 |
| 149 | Ga0070679_100012562 | 3300005530 | Bacteria | 8099 |
| 150 | Ga0070679_100045639 | 3300005530 | Bacteria | 4366 |
| 151 | Ga0070679_100126545 | 3300005530 | Bacteria | 2537 |
| 152 | Ga0070679_100339854 | 3300005530 | Bacteria | 1449 |
| 153 | Ga0070679_100438353 | 3300005530 | Bacteria | 1251 |
| 154 | Ga0070684_100000799 | 3300005535 | Bacteria | 21882 |
| 155 | Ga0070684_100011246 | 3300005535 | Bacteria | 7126 |
| 156 | Ga0070684_100662843 | 3300005535 | Bacteria | 972 |
| 157 | Ga0070697_100431839 | 3300005536 | Bacteria | 1145 |
| 158 | Ga0070697_100471372 | 3300005536 | Bacteria | 1096 |
| 159 | Ga0068853_100123750 | 3300005539 | Bacteria | 2309 |
| 160 | Ga0068853_101903701 | 3300005539 | Bacteria | 577 |
| 161 | Ga0070672_100756827 | 3300005543 | Bacteria | 853 |
| 162 | Ga0070672_100858112 | 3300005543 | Unclassified | 801 |
| 163 | Ga0070686_100097025 | 3300005544 | Bacteria | 1983 |
| 164 | Ga0070686_100132575 | 3300005544 | Bacteria | 1725 |
| 165 | Ga0070686_100471996 | 3300005544 | Bacteria | 968 |
| 166 | Ga0070695_100084074 | 3300005545 | Bacteria | 2110 |
| 167 | Ga0070695_100189145 | 3300005545 | Bacteria | 1464 |
| 168 | Ga0070695_100231283 | 3300005545 | Unclassified | 1336 |
| 169 | Ga0070695_100374378 | 3300005545 | Bacteria | 1073 |
| 170 | Ga0070696_100057639 | 3300005546 | Bacteria | 2711 |
| 171 | Ga0070696_100088159 | 3300005546 | Bacteria | 2205 |
| 172 | Ga0070696_100135737 | 3300005546 | Bacteria | 1794 |
| 173 | Ga0070693_100048890 | 3300005547 | Bacteria | 2410 |
| 174 | Ga0070693_100127440 | 3300005547 | Bacteria | 1586 |
| 175 | Ga0070693_100265880 | 3300005547 | Bacteria | 1143 |
| 176 | Ga0070693_100541908 | 3300005547 | Bacteria | 832 |
| 177 | Ga0070665_101122580 | 3300005548 | Bacteria | 798 |
| 178 | Ga0070704_100143365 | 3300005549 | Bacteria | 1868 |
| 179 | Ga0070704_100176953 | 3300005549 | Bacteria | 1703 |
| 180 | Ga0070704_100259472 | 3300005549 | Bacteria | 1431 |
| 181 | Ga0070704_100292602 | 3300005549 | Unclassified | 1354 |
| 182 | Ga0068855_100010923 | 3300005563 | Bacteria | 10959 |
| 183 | Ga0068855_100082705 | 3300005563 | Bacteria | 3720 |
| 184 | Ga0068855_100153338 | 3300005563 | Bacteria | 2618 |
| 185 | Ga0068855_100204561 | 3300005563 | Bacteria | 2221 |
| 186 | Ga0068855_100222731 | 3300005563 | Bacteria | 2115 |
| 187 | Ga0068855_100256458 | 3300005563 | Bacteria | 1950 |
| 188 | Ga0068855_100409880 | 3300005563 | Unclassified | 1484 |
| 189 | Ga0070664_100079756 | 3300005564 | Bacteria | 2818 |
| 190 | Ga0070664_100092804 | 3300005564 | Unclassified | 2614 |
| 191 | Ga0070664_101123134 | 3300005564 | Bacteria | 740 |
| 192 | Ga0068857_100008592 | 3300005577 | Bacteria | 8835 |
| 193 | Ga0068857_100015217 | 3300005577 | Bacteria | 6713 |
| 194 | Ga0068857_100064962 | 3300005577 | Bacteria | 3244 |
| 195 | Ga0068857_100071410 | 3300005577 | Bacteria | 3093 |
| 196 | Ga0068857_100499315 | 3300005577 | Bacteria | 1142 |
| 197 | Ga0068857_101030882 | 3300005577 | Bacteria | 793 |
| 198 | Ga0068854_100065947 | 3300005578 | Bacteria | 2633 |
| 199 | Ga0068854_100596133 | 3300005578 | Unclassified | 943 |
| 200 | Ga0068854_101517773 | 3300005578 | Bacteria | 609 |
| 201 | Ga0068856_100278422 | 3300005614 | Bacteria | 1690 |
| 202 | Ga0068856_100368382 | 3300005614 | Bacteria | 1455 |
| 203 | Ga0070702_100013242 | 3300005615 | Bacteria | 4159 |
| 204 | Ga0070702_100082833 | 3300005615 | Bacteria | 1926 |
| 205 | Ga0070702_100634345 | 3300005615 | Bacteria | 806 |
| 206 | Ga0068852_100408502 | 3300005616 | Bacteria | 1337 |
| 207 | Ga0068852_100596464 | 3300005616 | Unclassified | 1108 |
| 208 | Ga0068859_100170259 | 3300005617 | Bacteria | 2259 |
| 209 | Ga0068859_100291218 | 3300005617 | Unclassified | 1726 |
| 210 | Ga0068866_10011612 | 3300005718 | Bacteria | 3816 |
| 211 | Ga0068866_10160677 | 3300005718 | Unclassified | 1310 |
| 212 | Ga0068861_100011174 | 3300005719 | Bacteria | 6234 |
| 213 | Ga0068861_100020039 | 3300005719 | Bacteria | 4784 |
| 214 | Ga0068863_100507594 | 3300005841 | Bacteria | 1188 |
| 215 | Ga0068858_101343473 | 3300005842 | Bacteria | 704 |
| 216 | Ga0068860_101395787 | 3300005843 | Bacteria | 722 |
| 217 | Ga0068862_100067107 | 3300005844 | Bacteria | 3092 |
| 218 | Ga0068862_100430731 | 3300005844 | Bacteria | 1240 |
| 219 | Ga0081455_10001178 | 3300005937 | Bacteria | 32690 |
| 220 | Ga0081455_10018946 | 3300005937 | Bacteria | 6526 |
| 221 | Ga0081455_10047799 | 3300005937 | Bacteria | 3702 |
| 222 | Ga0081455_10049699 | 3300005937 | Bacteria | 3613 |
| 223 | Ga0081455_10088446 | 3300005937 | Bacteria | 2517 |
| 224 | Ga0081455_10212653 | 3300005937 | Bacteria | 1440 |
| 225 | Ga0081455_10363109 | 3300005937 | Bacteria | 1017 |
| 226 | Ga0081538_10000021 | 3300005981 | Bacteria | 138488 |
| 227 | Ga0081538_10000138 | 3300005981 | Bacteria | 75121 |
| 228 | Ga0081538_10000649 | 3300005981 | Bacteria | 38484 |
| 229 | Ga0081538_10007374 | 3300005981 | Bacteria | 9526 |
| 230 | Ga0081538_10017018 | 3300005981 | Bacteria | 5541 |
| 231 | Ga0081538_10018623 | 3300005981 | Bacteria | 5203 |
| 232 | Ga0081540_1003497 | 3300005983 | Bacteria | 12399 |
| 233 | Ga0081540_1019956 | 3300005983 | Bacteria | 4050 |
| 234 | Ga0081540_1024007 | 3300005983 | Bacteria | 3549 |
| 235 | Ga0081540_1061713 | 3300005983 | Bacteria | 1785 |
| 236 | Ga0081539_10004185 | 3300005985 | Bacteria | 16344 |
| 237 | Ga0070717_10087370 | 3300006028 | Bacteria | 2626 |
| 238 | Ga0070717_10176447 | 3300006028 | Bacteria | 1861 |
| 239 | Ga0075365_10009205 | 3300006038 | Bacteria | 5664 |
| 240 | Ga0075363_100169169 | 3300006048 | Bacteria | 1240 |
| 241 | Ga0075432_10011105 | 3300006058 | Bacteria | 3058 |
| 242 | Ga0075432_10141947 | 3300006058 | Bacteria | 917 |
| 243 | Ga0070715_10019654 | 3300006163 | Unclassified | 2594 |
| 244 | Ga0070715_10050508 | 3300006163 | Bacteria | 1786 |
| 245 | Ga0070715_10457392 | 3300006163 | Bacteria | 722 |
| 246 | Ga0070716_100005213 | 3300006173 | Bacteria | 6280 |
| 247 | Ga0070716_100020081 | 3300006173 | Bacteria | 3503 |
| 248 | Ga0070716_100099369 | 3300006173 | Bacteria | 1780 |
| 249 | Ga0070716_100114929 | 3300006173 | Bacteria | 1674 |
| 250 | Ga0070716_100260874 | 3300006173 | Bacteria | 1185 |
| 251 | Ga0070712_100017483 | 3300006175 | Bacteria | 4643 |
| 252 | Ga0070712_100080695 | 3300006175 | Bacteria | 2355 |
| 253 | Ga0070712_100134940 | 3300006175 | Bacteria | 1875 |
| 254 | Ga0070712_100184214 | 3300006175 | Unclassified | 1629 |
| 255 | Ga0070712_100250739 | 3300006175 | Bacteria | 1414 |
| 256 | Ga0075362_10005326 | 3300006177 | Bacteria | 4700 |
| 257 | Ga0097621_100156276 | 3300006237 | Bacteria | 1957 |
| 258 | Ga0097621_101304370 | 3300006237 | Unclassified | 686 |
| 259 | Ga0068871_100203276 | 3300006358 | Bacteria | 1711 |
| 260 | Ga0068871_101652643 | 3300006358 | Bacteria | 607 |
| 261 | Ga0075428_100057582 | 3300006844 | Bacteria | 4254 |
| 262 | Ga0075428_100140206 | 3300006844 | Bacteria | 2629 |
| 263 | Ga0075428_100347587 | 3300006844 | Bacteria | 1592 |
| 264 | Ga0075428_100474947 | 3300006844 | Bacteria | 1338 |
| 265 | Ga0075428_100497354 | 3300006844 | Bacteria | 1305 |
| 266 | Ga0075428_100525543 | 3300006844 | Bacteria | 1265 |
| 267 | Ga0075428_101313151 | 3300006844 | Unclassified | 761 |
| 268 | Ga0075428_101569851 | 3300006844 | Bacteria | 688 |
| 269 | Ga0075430_100038236 | 3300006846 | Bacteria | 4066 |
| 270 | Ga0075430_100233556 | 3300006846 | Bacteria | 1525 |
| 271 | Ga0075431_100021608 | 3300006847 | Bacteria | 6583 |
| 272 | Ga0075431_100027665 | 3300006847 | Bacteria | 5819 |
| 273 | Ga0075431_100129061 | 3300006847 | Bacteria | 2609 |
| 274 | Ga0075431_100198362 | 3300006847 | Bacteria | 2054 |
| 275 | Ga0075431_100604865 | 3300006847 | Bacteria | 1080 |
| 276 | Ga0075431_101563816 | 3300006847 | Bacteria | 617 |
| 277 | Ga0075433_10052452 | 3300006852 | Bacteria | 3554 |
| 278 | Ga0075433_10073882 | 3300006852 | Bacteria | 3000 |
| 279 | Ga0075433_10139496 | 3300006852 | Bacteria | 2155 |
| 280 | Ga0075433_10946878 | 3300006852 | Bacteria | 751 |
| 281 | Ga0075434_100023038 | 3300006871 | Bacteria | 6063 |
| 282 | Ga0075434_100075447 | 3300006871 | Bacteria | 3365 |
| 283 | Ga0075434_100225890 | 3300006871 | Bacteria | 1892 |
| 284 | Ga0075434_100283745 | 3300006871 | Bacteria | 1675 |
| 285 | Ga0075434_100290291 | 3300006871 | Bacteria | 1655 |
| 286 | Ga0075434_101435524 | 3300006871 | Bacteria | 700 |
| 287 | Ga0075429_100099327 | 3300006880 | Bacteria | 2539 |
| 288 | Ga0075429_100735975 | 3300006880 | Bacteria | 864 |
| 289 | Ga0068865_100003775 | 3300006881 | Bacteria | 9094 |
| 290 | Ga0068865_100136947 | 3300006881 | Unclassified | 1841 |
| 291 | Ga0068865_100420452 | 3300006881 | Bacteria | 1099 |
| 292 | Ga0068865_100714023 | 3300006881 | Unclassified | 858 |
| 293 | Ga0075436_100041620 | 3300006914 | Bacteria | 3170 |
| 294 | Ga0075436_100182574 | 3300006914 | Bacteria | 1483 |
| 295 | Ga0075436_101175364 | 3300006914 | Bacteria | 579 |
| 296 | Ga0097620_100170261 | 3300006931 | Bacteria | 2259 |
| 297 | Ga0097620_100291199 | 3300006931 | Unclassified | 1726 |
| 298 | Ga0097620_102410509 | 3300006931 | Unclassified | 580 |
| 299 | Ga0075435_100007092 | 3300007076 | Bacteria | 7959 |
| 300 | Ga0075435_100022813 | 3300007076 | Bacteria | 4831 |
| 301 | Ga0075435_100071667 | 3300007076 | Bacteria | 2830 |
| 302 | Ga0075435_100114122 | 3300007076 | Bacteria | 2249 |
| 303 | Ga0105240_10019847 | 3300009093 | Bacteria | 8977 |
| 304 | Ga0105240_10476277 | 3300009093 | Bacteria | 1392 |
| 305 | Ga0105240_11110398 | 3300009093 | Bacteria | 841 |
| 306 | Ga0111539_10027300 | 3300009094 | Bacteria | 6971 |
| 307 | Ga0111539_10096592 | 3300009094 | Bacteria | 3471 |
| 308 | Ga0111539_10349612 | 3300009094 | Bacteria | 1720 |
| 309 | Ga0111539_10427459 | 3300009094 | Bacteria | 1542 |
| 310 | Ga0111539_10489365 | 3300009094 | Unclassified | 1433 |
| 311 | Ga0111539_10854121 | 3300009094 | Bacteria | 1059 |
| 312 | Ga0111539_12333355 | 3300009094 | Bacteria | 621 |
| 313 | Ga0105245_10019659 | 3300009098 | Bacteria | 5918 |
| 314 | Ga0105245_10141805 | 3300009098 | Unclassified | 2264 |
| 315 | Ga0105245_10529443 | 3300009098 | Bacteria | 1198 |
| 316 | Ga0105245_11253563 | 3300009098 | Bacteria | 790 |
| 317 | Ga0105247_10039826 | 3300009101 | Bacteria | 2871 |
| 318 | Ga0105247_10244632 | 3300009101 | Bacteria | 1224 |
| 319 | Ga0105247_11042416 | 3300009101 | Unclassified | 641 |
| 320 | Ga0114129_10038479 | 3300009147 | Bacteria | 6746 |
| 321 | Ga0114129_10064757 | 3300009147 | Bacteria | 5101 |
| 322 | Ga0114129_10099426 | 3300009147 | Unclassified | 4026 |
| 323 | Ga0114129_10106794 | 3300009147 | Bacteria | 3867 |
| 324 | Ga0114129_10149545 | 3300009147 | Bacteria | 3196 |
| 325 | Ga0114129_10439523 | 3300009147 | Bacteria | 1713 |
| 326 | Ga0114129_10859167 | 3300009147 | Bacteria | 1153 |
| 327 | Ga0114129_10956171 | 3300009147 | Bacteria | 1082 |
| 328 | Ga0105243_10068824 | 3300009148 | Bacteria | 2854 |
| 329 | Ga0105243_10103799 | 3300009148 | Bacteria | 2364 |
| 330 | Ga0105243_10169896 | 3300009148 | Bacteria | 1887 |
| 331 | Ga0105243_10187215 | 3300009148 | Bacteria | 1805 |
| 332 | Ga0105243_10332675 | 3300009148 | Unclassified | 1388 |
| 333 | Ga0105243_10557355 | 3300009148 | Unclassified | 1096 |
| 334 | Ga0105243_10622177 | 3300009148 | Bacteria | 1042 |
| 335 | Ga0105243_10674002 | 3300009148 | Bacteria | 1005 |
| 336 | Ga0105241_10028797 | 3300009174 | Bacteria | 4139 |
| 337 | Ga0105241_10047092 | 3300009174 | Bacteria | 3277 |
| 338 | Ga0105241_10118663 | 3300009174 | Bacteria | 2127 |
| 339 | Ga0105242_10022608 | 3300009176 | Bacteria | 4948 |
| 340 | Ga0105242_10029025 | 3300009176 | Bacteria | 4408 |
| 341 | Ga0105242_10094391 | 3300009176 | Bacteria | 2523 |
| 342 | Ga0105242_10294092 | 3300009176 | Bacteria | 1480 |
| 343 | Ga0105242_10887844 | 3300009176 | Bacteria | 890 |
| 344 | Ga0105248_10039381 | 3300009177 | Bacteria | 5292 |
| 345 | Ga0105248_10096553 | 3300009177 | Bacteria | 3329 |
| 346 | Ga0105248_10304220 | 3300009177 | Bacteria | 1796 |
| 347 | Ga0105248_12685016 | 3300009177 | Bacteria | 568 |
| 348 | Ga0105238_10411502 | 3300009551 | Bacteria | 1346 |
| 349 | Ga0105238_10457885 | 3300009551 | Bacteria | 1273 |
| 350 | Ga0105249_10036380 | 3300009553 | Bacteria | 4465 |
| 351 | Ga0105249_10217120 | 3300009553 | Bacteria | 1880 |
| 352 | Ga0105249_10999955 | 3300009553 | Bacteria | 905 |
| 353 | Ga0105239_10066176 | 3300010375 | Bacteria | 3970 |
| 354 | Ga0105239_10083931 | 3300010375 | Bacteria | 3508 |
| 355 | Ga0105239_10092694 | 3300010375 | Bacteria | 3335 |
| 356 | Ga0105239_10204769 | 3300010375 | Bacteria | 2211 |
| 357 | Ga0105239_11069792 | 3300010375 | Bacteria | 928 |
| 358 | Ga0105246_10007182 | 3300011119 | Bacteria | 6822 |
| 359 | Ga0157320_1028328 | 3300012481 | Unclassified | 552 |
| 360 | Ga0157343_1009265 | 3300012488 | Bacteria | 725 |
| 361 | Ga0157347_1007249 | 3300012502 | Bacteria | 1104 |
| 362 | Ga0157313_1001914 | 3300012503 | Bacteria | 1183 |
| 363 | Ga0157339_1028723 | 3300012505 | Bacteria | 638 |
| 364 | Ga0157342_1003934 | 3300012507 | Bacteria | 1297 |
| 365 | Ga0157316_1015938 | 3300012510 | Unclassified | 766 |
| 366 | Ga0157327_1030667 | 3300012512 | Bacteria | 669 |
| 367 | Ga0157338_1000279 | 3300012515 | Bacteria | 2760 |
| 368 | Ga0154016_132876 | 3300013045 | Bacteria | 780 |
| 369 | Ga0157371_10071143 | 3300013102 | Bacteria | 2462 |
| 370 | Ga0157371_10183340 | 3300013102 | Unclassified | 1497 |
| 371 | Ga0157371_10698887 | 3300013102 | Bacteria | 759 |
| 372 | Ga0157370_10008089 | 3300013104 | Bacteria | 11384 |
| 373 | Ga0157370_10086066 | 3300013104 | Bacteria | 2953 |
| 374 | Ga0157370_10230176 | 3300013104 | Bacteria | 1716 |
| 375 | Ga0157369_11438057 | 3300013105 | Bacteria | 702 |
| 376 | Ga0157369_12021996 | 3300013105 | Unclassified | 585 |
| 377 | Ga0157374_10050689 | 3300013296 | Bacteria | 3860 |
| 378 | Ga0157374_10540208 | 3300013296 | Bacteria | 1173 |
| 379 | Ga0157378_10197538 | 3300013297 | Bacteria | 1901 |
| 380 | Ga0157378_10548964 | 3300013297 | Bacteria | 1160 |
| 381 | Ga0157378_11904611 | 3300013297 | Bacteria | 644 |
| 382 | Ga0163162_10273823 | 3300013306 | Bacteria | 1820 |
| 383 | Ga0157372_10028322 | 3300013307 | Bacteria | 6113 |
| 384 | Ga0157372_10268198 | 3300013307 | Bacteria | 1983 |
| 385 | Ga0157372_10512605 | 3300013307 | Bacteria | 1398 |
| 386 | Ga0157372_10908629 | 3300013307 | Bacteria | 1021 |
| 387 | Ga0157372_10986794 | 3300013307 | Bacteria | 976 |
| 388 | Ga0157372_11143157 | 3300013307 | Bacteria | 900 |
| 389 | Ga0157375_10080761 | 3300013308 | Bacteria | 3290 |
| 390 | Ga0157375_10193415 | 3300013308 | Bacteria | 2189 |
| 391 | Ga0157375_10247962 | 3300013308 | Unclassified | 1941 |
| 392 | Ga0157375_10843708 | 3300013308 | Unclassified | 1063 |
| 393 | Ga0157375_11624148 | 3300013308 | Bacteria | 764 |
| 394 | Ga0163163_10439583 | 3300014325 | Unclassified | 1364 |
| 395 | Ga0157380_10453549 | 3300014326 | Bacteria | 1232 |
| 396 | Ga0182008_10244503 | 3300014497 | Bacteria | 924 |
| 397 | Ga0157377_10003315 | 3300014745 | Bacteria | 7275 |
| 398 | Ga0157377_10211637 | 3300014745 | Bacteria | 1237 |
| 399 | Ga0157379_10484666 | 3300014968 | Unclassified | 1145 |
| 400 | Ga0157376_10292884 | 3300014969 | Bacteria | 1537 |
| 401 | Ga0157376_10342116 | 3300014969 | Unclassified | 1429 |
| 402 | Ga0157376_10342907 | 3300014969 | Bacteria | 1427 |
| 403 | Ga0157376_11642904 | 3300014969 | Bacteria | 677 |
| 404 | Ga0182006_1070513 | 3300015261 | Bacteria | 1297 |
| 405 | Ga0182005_1073834 | 3300015265 | Bacteria | 938 |
| 406 | Ga0182005_1242909 | 3300015265 | Bacteria | 555 |
| 407 | Ga0163161_10388766 | 3300017792 | Bacteria | 1116 |
| 408 | Ga0163161_10574168 | 3300017792 | Unclassified | 927 |
| 409 | Ga0163161_10972918 | 3300017792 | Bacteria | 723 |
| 410 | Ga0197907_10188215 | 3300020069 | Bacteria | 1102 |
| 411 | Ga0206356_10897941 | 3300020070 | Bacteria | 2347 |
| 412 | Ga0206356_10970350 | 3300020070 | Bacteria | 2439 |
| 413 | Ga0206356_11081930 | 3300020070 | Bacteria | 1604 |
| 414 | Ga0206349_1185021 | 3300020075 | Bacteria | 707 |
| 415 | Ga0206349_1667707 | 3300020075 | Bacteria | 1118 |
| 416 | Ga0206355_1152397 | 3300020076 | Bacteria | 1431 |
| 417 | Ga0206351_10032051 | 3300020077 | Bacteria | 1326 |
| 418 | Ga0206351_10695050 | 3300020077 | Bacteria | 990 |
| 419 | Ga0206352_11232016 | 3300020078 | Bacteria | 1280 |
| 420 | Ga0206350_11574031 | 3300020080 | Bacteria | 1039 |
| 421 | Ga0206354_10190292 | 3300020081 | Bacteria | 2809 |
| 422 | Ga0206354_10337611 | 3300020081 | Unclassified | 596 |
| 423 | Ga0206354_11346914 | 3300020081 | Unclassified | 2390 |
| 424 | Ga0206353_10046952 | 3300020082 | Bacteria | 9286 |
| 425 | Ga0206353_10072795 | 3300020082 | Bacteria | 590 |
| 426 | Ga0206353_10717995 | 3300020082 | Bacteria | 2299 |
| 427 | Ga0206353_11373027 | 3300020082 | Bacteria | 3238 |
| 428 | Ga0154015_1261515 | 3300020610 | Bacteria | 734 |
| 429 | Ga0154015_1543957 | 3300020610 | Unclassified | 769 |
| 430 | Ga0213871_10034944 | 3300021441 | Bacteria | 1327 |
| 431 | Ga0224712_10019853 | 3300022467 | Unclassified | 2273 |
| 432 | Ga0207656_10120689 | 3300025321 | Bacteria | 1220 |
| 433 | Ga0207692_10037924 | 3300025898 | Bacteria | 2360 |
| 434 | Ga0207692_10045495 | 3300025898 | Bacteria | 2196 |
| 435 | Ga0207692_10097640 | 3300025898 | Bacteria | 1606 |
| 436 | Ga0207642_10538637 | 3300025899 | Unclassified | 719 |
| 437 | Ga0207642_11064233 | 3300025899 | Bacteria | 522 |
| 438 | Ga0207710_10030397 | 3300025900 | Bacteria | 2356 |
| 439 | Ga0207688_10033801 | 3300025901 | Bacteria | 2829 |
| 440 | Ga0207688_10098278 | 3300025901 | Bacteria | 1687 |
| 441 | Ga0207688_10133363 | 3300025901 | Unclassified | 1457 |
| 442 | Ga0207688_10190407 | 3300025901 | Bacteria | 1227 |
| 443 | Ga0207688_10610973 | 3300025901 | Bacteria | 687 |
| 444 | Ga0207680_10080065 | 3300025903 | Bacteria | 2050 |
| 445 | Ga0207647_10427341 | 3300025904 | Bacteria | 744 |
| 446 | Ga0207699_10055631 | 3300025906 | Bacteria | 2355 |
| 447 | Ga0207699_10071435 | 3300025906 | Bacteria | 2122 |
| 448 | Ga0207699_10096767 | 3300025906 | Bacteria | 1864 |
| 449 | Ga0207699_10132111 | 3300025906 | Bacteria | 1630 |
| 450 | Ga0207699_10586790 | 3300025906 | Bacteria | 811 |
| 451 | Ga0207699_10710216 | 3300025906 | Bacteria | 736 |
| 452 | Ga0207643_10062453 | 3300025908 | Bacteria | 2129 |
| 453 | Ga0207705_10869412 | 3300025909 | Bacteria | 699 |
| 454 | Ga0207705_11329059 | 3300025909 | Bacteria | 548 |
| 455 | Ga0207684_10036127 | 3300025910 | Bacteria | 4194 |
| 456 | Ga0207684_10121551 | 3300025910 | Bacteria | 2239 |
| 457 | Ga0207684_10249817 | 3300025910 | Bacteria | 1530 |
| 458 | Ga0207684_10324158 | 3300025910 | Bacteria | 1327 |
| 459 | Ga0207684_10357059 | 3300025910 | Bacteria | 1258 |
| 460 | Ga0207684_10861011 | 3300025910 | Bacteria | 764 |
| 461 | Ga0207684_11261494 | 3300025910 | Bacteria | 610 |
| 462 | Ga0207654_10038632 | 3300025911 | Unclassified | 2680 |
| 463 | Ga0207654_10488819 | 3300025911 | Bacteria | 868 |
| 464 | Ga0207707_10039023 | 3300025912 | Bacteria | 4151 |
| 465 | Ga0207707_10041740 | 3300025912 | Bacteria | 4006 |
| 466 | Ga0207707_10043445 | 3300025912 | Bacteria | 3921 |
| 467 | Ga0207695_10077461 | 3300025913 | Bacteria | 3377 |
| 468 | Ga0207695_10703647 | 3300025913 | Bacteria | 891 |
| 469 | Ga0207695_11648716 | 3300025913 | Unclassified | 522 |
| 470 | Ga0207671_10448242 | 3300025914 | Bacteria | 1028 |
| 471 | Ga0207671_10748480 | 3300025914 | Unclassified | 776 |
| 472 | Ga0207693_10000406 | 3300025915 | Bacteria | 39259 |
| 473 | Ga0207693_10001431 | 3300025915 | Bacteria | 21143 |
| 474 | Ga0207693_10006501 | 3300025915 | Bacteria | 9675 |
| 475 | Ga0207693_10079809 | 3300025915 | Bacteria | 2562 |
| 476 | Ga0207693_10110316 | 3300025915 | Bacteria | 2157 |
| 477 | Ga0207663_10008237 | 3300025916 | Bacteria | 5441 |
| 478 | Ga0207663_10013339 | 3300025916 | Bacteria | 4464 |
| 479 | Ga0207663_10118612 | 3300025916 | Bacteria | 1807 |
| 480 | Ga0207663_10136405 | 3300025916 | Bacteria | 1703 |
| 481 | Ga0207660_10023066 | 3300025917 | Bacteria | 4199 |
| 482 | Ga0207660_10098552 | 3300025917 | Unclassified | 2180 |
| 483 | Ga0207660_11173081 | 3300025917 | Bacteria | 625 |
| 484 | Ga0207662_10019934 | 3300025918 | Bacteria | 3821 |
| 485 | Ga0207662_10524967 | 3300025918 | Unclassified | 818 |
| 486 | Ga0207657_10000073 | 3300025919 | Bacteria | 93299 |
| 487 | Ga0207657_10413643 | 3300025919 | Bacteria | 1060 |
| 488 | Ga0207649_10152961 | 3300025920 | Bacteria | 1591 |
| 489 | Ga0207652_10015439 | 3300025921 | Bacteria | 6206 |
| 490 | Ga0207652_10188369 | 3300025921 | Bacteria | 1855 |
| 491 | Ga0207646_10006672 | 3300025922 | Bacteria | 11900 |
| 492 | Ga0207646_10034338 | 3300025922 | Bacteria | 4583 |
| 493 | Ga0207646_10105029 | 3300025922 | Bacteria | 2533 |
| 494 | Ga0207646_10190275 | 3300025922 | Bacteria | 1853 |
| 495 | Ga0207646_11313264 | 3300025922 | Bacteria | 631 |
| 496 | Ga0207681_10872586 | 3300025923 | Bacteria | 753 |
| 497 | Ga0207681_11772699 | 3300025923 | Bacteria | 515 |
| 498 | Ga0207694_10694838 | 3300025924 | Bacteria | 858 |
| 499 | Ga0207650_10382499 | 3300025925 | Unclassified | 1162 |
| 500 | Ga0207650_10389169 | 3300025925 | Unclassified | 1152 |
| 501 | Ga0207659_10340124 | 3300025926 | Bacteria | 1243 |
| 502 | Ga0207687_10012396 | 3300025927 | Bacteria | 5571 |
| 503 | Ga0207687_10044904 | 3300025927 | Bacteria | 3052 |
| 504 | Ga0207687_10060282 | 3300025927 | Bacteria | 2676 |
| 505 | Ga0207687_10090718 | 3300025927 | Bacteria | 2228 |
| 506 | Ga0207687_10250052 | 3300025927 | Unclassified | 1409 |
| 507 | Ga0207687_10423700 | 3300025927 | Bacteria | 1099 |
| 508 | Ga0207687_10841638 | 3300025927 | Bacteria | 784 |
| 509 | Ga0207687_11521695 | 3300025927 | Bacteria | 575 |
| 510 | Ga0207687_11708103 | 3300025927 | Bacteria | 539 |
| 511 | Ga0207700_10416377 | 3300025928 | Bacteria | 1180 |
| 512 | Ga0207700_10791221 | 3300025928 | Unclassified | 848 |
| 513 | Ga0207664_10033314 | 3300025929 | Bacteria | 3957 |
| 514 | Ga0207664_10095633 | 3300025929 | Unclassified | 2444 |
| 515 | Ga0207664_10142050 | 3300025929 | Bacteria | 2032 |
| 516 | Ga0207664_10222265 | 3300025929 | Bacteria | 1638 |
| 517 | Ga0207664_10240069 | 3300025929 | Bacteria | 1578 |
| 518 | Ga0207664_10383061 | 3300025929 | Bacteria | 1249 |
| 519 | Ga0207664_10832798 | 3300025929 | Bacteria | 829 |
| 520 | Ga0207644_11335499 | 3300025931 | Bacteria | 602 |
| 521 | Ga0207690_10571984 | 3300025932 | Bacteria | 920 |
| 522 | Ga0207706_10342978 | 3300025933 | Bacteria | 1299 |
| 523 | Ga0207686_10112002 | 3300025934 | Bacteria | 1842 |
| 524 | Ga0207686_10125432 | 3300025934 | Bacteria | 1754 |
| 525 | Ga0207686_10162485 | 3300025934 | Bacteria | 1567 |
| 526 | Ga0207686_10570264 | 3300025934 | Bacteria | 887 |
| 527 | Ga0207709_10069478 | 3300025935 | Bacteria | 2230 |
| 528 | Ga0207709_10119363 | 3300025935 | Bacteria | 1778 |
| 529 | Ga0207709_10155277 | 3300025935 | Bacteria | 1590 |
| 530 | Ga0207709_10232971 | 3300025935 | Bacteria | 1335 |
| 531 | Ga0207709_10263083 | 3300025935 | Unclassified | 1266 |
| 532 | Ga0207709_10273851 | 3300025935 | Bacteria | 1244 |
| 533 | Ga0207709_10803658 | 3300025935 | Unclassified | 759 |
| 534 | Ga0207670_10014455 | 3300025936 | Bacteria | 4686 |
| 535 | Ga0207670_10823824 | 3300025936 | Unclassified | 774 |
| 536 | Ga0207669_10162245 | 3300025937 | Bacteria | 1580 |
| 537 | Ga0207704_10118772 | 3300025938 | Unclassified | 1804 |
| 538 | Ga0207665_10004586 | 3300025939 | Bacteria | 9174 |
| 539 | Ga0207665_10010758 | 3300025939 | Bacteria | 6009 |
| 540 | Ga0207665_10054526 | 3300025939 | Bacteria | 2696 |
| 541 | Ga0207665_10086520 | 3300025939 | Bacteria | 2165 |
| 542 | Ga0207665_10140452 | 3300025939 | Bacteria | 1722 |
| 543 | Ga0207665_11183908 | 3300025939 | Bacteria | 610 |
| 544 | Ga0207691_10017674 | 3300025940 | Bacteria | 6760 |
| 545 | Ga0207691_10297260 | 3300025940 | Unclassified | 1388 |
| 546 | Ga0207691_10338873 | 3300025940 | Bacteria | 1287 |
| 547 | Ga0207711_10249995 | 3300025941 | Bacteria | 1628 |
| 548 | Ga0207711_10830584 | 3300025941 | Bacteria | 860 |
| 549 | Ga0207689_10127340 | 3300025942 | Bacteria | 2095 |
| 550 | Ga0207661_10000326 | 3300025944 | Bacteria | 30199 |
| 551 | Ga0207661_10040652 | 3300025944 | Bacteria | 3656 |
| 552 | Ga0207661_10055471 | 3300025944 | Bacteria | 3178 |
| 553 | Ga0207661_10068582 | 3300025944 | Bacteria | 2888 |
| 554 | Ga0207661_10831596 | 3300025944 | Bacteria | 850 |
| 555 | Ga0207661_10951577 | 3300025944 | Bacteria | 791 |
| 556 | Ga0207679_10188839 | 3300025945 | Unclassified | 1711 |
| 557 | Ga0207679_11247574 | 3300025945 | Bacteria | 682 |
| 558 | Ga0207679_11357765 | 3300025945 | Bacteria | 652 |
| 559 | Ga0207667_10042798 | 3300025949 | Bacteria | 4811 |
| 560 | Ga0207667_10107678 | 3300025949 | Bacteria | 2876 |
| 561 | Ga0207667_10122160 | 3300025949 | Bacteria | 2683 |
| 562 | Ga0207667_10181302 | 3300025949 | Bacteria | 2163 |
| 563 | Ga0207667_10211870 | 3300025949 | Bacteria | 1986 |
| 564 | Ga0207667_10212183 | 3300025949 | Bacteria | 1984 |
| 565 | Ga0207667_10446039 | 3300025949 | Bacteria | 1315 |
| 566 | Ga0207667_10697762 | 3300025949 | Bacteria | 1018 |
| 567 | Ga0207667_11799391 | 3300025949 | Bacteria | 577 |
| 568 | Ga0207651_10220248 | 3300025960 | Bacteria | 1534 |
| 569 | Ga0207651_10803230 | 3300025960 | Bacteria | 834 |
| 570 | Ga0207712_10074120 | 3300025961 | Bacteria | 2457 |
| 571 | Ga0207712_10491417 | 3300025961 | Bacteria | 1048 |
| 572 | Ga0207640_10053830 | 3300025981 | Bacteria | 2628 |
| 573 | Ga0207640_10182053 | 3300025981 | Unclassified | 1576 |
| 574 | Ga0207640_11549665 | 3300025981 | Bacteria | 596 |
| 575 | Ga0207658_10004832 | 3300025986 | Bacteria | 9316 |
| 576 | Ga0207658_10148116 | 3300025986 | Bacteria | 1909 |
| 577 | Ga0207677_10015265 | 3300026023 | Bacteria | 4511 |
| 578 | Ga0207677_10022503 | 3300026023 | Bacteria | 3875 |
| 579 | Ga0207677_10060395 | 3300026023 | Bacteria | 2620 |
| 580 | Ga0207677_10063219 | 3300026023 | Bacteria | 2572 |
| 581 | Ga0207677_10181778 | 3300026023 | Bacteria | 1655 |
| 582 | Ga0207677_10332586 | 3300026023 | Bacteria | 1266 |
| 583 | Ga0207703_10764948 | 3300026035 | Bacteria | 921 |
| 584 | Ga0207639_10701075 | 3300026041 | Bacteria | 939 |
| 585 | Ga0207639_11409935 | 3300026041 | Bacteria | 654 |
| 586 | Ga0207708_10000563 | 3300026075 | Bacteria | 28653 |
| 587 | Ga0207708_10011914 | 3300026075 | Bacteria | 6477 |
| 588 | Ga0207708_10022231 | 3300026075 | Bacteria | 4788 |
| 589 | Ga0207702_10193158 | 3300026078 | Unclassified | 1882 |
| 590 | Ga0207702_10246673 | 3300026078 | Bacteria | 1675 |
| 591 | Ga0207702_10256646 | 3300026078 | Bacteria | 1644 |
| 592 | Ga0207702_11406172 | 3300026078 | Bacteria | 691 |
| 593 | Ga0207702_11849879 | 3300026078 | Unclassified | 595 |
| 594 | Ga0207641_11029295 | 3300026088 | Bacteria | 821 |
| 595 | Ga0207648_10034191 | 3300026089 | Bacteria | 4482 |
| 596 | Ga0207648_10081001 | 3300026089 | Bacteria | 2832 |
| 597 | Ga0207676_10251224 | 3300026095 | Bacteria | 1592 |
| 598 | Ga0207674_10002539 | 3300026116 | Bacteria | 22997 |
| 599 | Ga0207674_10019424 | 3300026116 | Bacteria | 7357 |
| 600 | Ga0207674_10072841 | 3300026116 | Bacteria | 3450 |
| 601 | Ga0207674_10190650 | 3300026116 | Bacteria | 2000 |
| 602 | Ga0207674_10446731 | 3300026116 | Bacteria | 1250 |
| 603 | Ga0207675_100021594 | 3300026118 | Bacteria | 5995 |
| 604 | Ga0207675_100066350 | 3300026118 | Bacteria | 3373 |
| 605 | Ga0207683_10001199 | 3300026121 | Bacteria | 23464 |
| 606 | Ga0207683_10016391 | 3300026121 | Bacteria | 6305 |
| 607 | Ga0207683_10027770 | 3300026121 | Bacteria | 4890 |
| 608 | Ga0207683_10041472 | 3300026121 | Bacteria | 4019 |
| 609 | Ga0207683_10448683 | 3300026121 | Bacteria | 1189 |
| 610 | Ga0209983_1070447 | 3300027665 | Bacteria | 779 |
| 611 | Ga0209998_10015612 | 3300027717 | Bacteria | 1592 |
| 612 | Ga0207428_10013275 | 3300027907 | Bacteria | 7202 |
| 613 | Ga0207428_10021472 | 3300027907 | Bacteria | 5466 |
| 614 | Ga0207428_10169653 | 3300027907 | Bacteria | 1653 |
| 615 | Ga0207428_10307414 | 3300027907 | Bacteria | 1173 |
| 616 | Ga0207428_10308025 | 3300027907 | Bacteria | 1171 |
| 617 | Ga0207428_10335298 | 3300027907 | Bacteria | 1115 |
| 618 | Ga0207428_10441047 | 3300027907 | Bacteria | 950 |
| 619 | Ga0207428_10550923 | 3300027907 | Bacteria | 834 |
| 620 | Ga0268266_10109253 | 3300028379 | Bacteria | 2449 |
| 621 | Ga0268265_10133985 | 3300028380 | Unclassified | 2064 |
| 622 | Ga0268265_10495479 | 3300028380 | Bacteria | 1150 |
| 623 | Ga0268264_10356041 | 3300028381 | Bacteria | 1395 |
| 624 | Ga0265326_10073939 | 3300028558 | Bacteria | 963 |
| 625 | Ga0265318_10008580 | 3300028577 | Bacteria | 4540 |
| 626 | Ga0265338_10090707 | 3300028800 | Bacteria | 2529 |
| 627 | Ga0265338_10105966 | 3300028800 | Bacteria | 2277 |
| 628 | Ga0265330_10037962 | 3300031235 | Bacteria | 2142 |
| 629 | Ga0265332_10045862 | 3300031238 | Bacteria | 1883 |
| 630 | Ga0265328_10059321 | 3300031239 | Bacteria | 1405 |
| 631 | Ga0265320_10142303 | 3300031240 | Bacteria | 1086 |
| 632 | Ga0265320_10197892 | 3300031240 | Bacteria | 898 |
| 633 | Ga0265329_10078919 | 3300031242 | Bacteria | 1042 |
| 634 | Ga0265331_10097366 | 3300031250 | Bacteria | 1356 |
| 635 | Ga0265327_10013725 | 3300031251 | Bacteria | 5358 |
| 636 | Ga0265327_10434619 | 3300031251 | Bacteria | 568 |
| 637 | Ga0265316_10351250 | 3300031344 | Bacteria | 1067 |
| 638 | Ga0307408_100266312 | 3300031548 | Unclassified | 1421 |
| 639 | Ga0265313_10002660 | 3300031595 | Bacteria | 15177 |
| 640 | Ga0265313_10106763 | 3300031595 | Bacteria | 1236 |
| 641 | Ga0265314_10003929 | 3300031711 | Bacteria | 14127 |
| 642 | Ga0265342_10021909 | 3300031712 | Bacteria | 4071 |
| 643 | Ga0307405_10231428 | 3300031731 | Unclassified | 1363 |
| 644 | Ga0307405_11920543 | 3300031731 | Bacteria | 528 |
| 645 | Ga0307413_11408303 | 3300031824 | Bacteria | 613 |
| 646 | Ga0307410_10078762 | 3300031852 | Bacteria | 2307 |
| 647 | Ga0307406_10089339 | 3300031901 | Bacteria | 2070 |
| 648 | Ga0307406_10766804 | 3300031901 | Unclassified | 811 |
| 649 | Ga0307407_10319100 | 3300031903 | Bacteria | 1090 |
| 650 | Ga0307412_10161871 | 3300031911 | Bacteria | 1664 |
| 651 | Ga0307412_10814367 | 3300031911 | Bacteria | 812 |
| 652 | Ga0307409_100190963 | 3300031995 | Bacteria | 1823 |
| 653 | Ga0307409_100207612 | 3300031995 | Bacteria | 1758 |
| 654 | Ga0307409_100822478 | 3300031995 | Bacteria | 938 |
| 655 | Ga0307416_100045501 | 3300032002 | Bacteria | 3456 |
| 656 | Ga0307416_100104032 | 3300032002 | Unclassified | 2481 |
| 657 | Ga0307416_100200676 | 3300032002 | Bacteria | 1892 |
| 658 | Ga0307416_100556176 | 3300032002 | Bacteria | 1221 |
| 659 | Ga0307416_100734655 | 3300032002 | Bacteria | 1079 |
| 660 | Ga0307411_10185284 | 3300032005 | Bacteria | 1584 |
| 661 | Ga0307411_11789552 | 3300032005 | Bacteria | 570 |
| 662 | Ga0307415_100098074 | 3300032126 | Bacteria | 2141 |
| 663 | Ga0373948_0007313 | 3300034817 | Bacteria | 1853 |
| 664 | Ga0373950_0000817 | 3300034818 | Bacteria | 3909 |
| 665 | Ga0373958_0000854 | 3300034819 | Bacteria | 3920 |
| 666 | Ga0373958_0071967 | 3300034819 | Unclassified | 769 |
| 667 | Ga0373938_0002204 | 3300034957 | Bacteria | 3126 |
| 668 | Ga0373926_0028415 | 3300035083 | Bacteria | 1963 |
| 669 | Ga0373926_0046649 | 3300035083 | Bacteria | 1555 |
| 670 | Ga0373928_0021966 | 3300035084 | Bacteria | 1350 |
| 671 | Ga0373929_0000828 | 3300035085 | Bacteria | 6039 |
| 672 | Ga0373940_0001455 | 3300035088 | Bacteria | 4285 |
| 673 | Ga0373944_0092162 | 3300035089 | Bacteria | 1014 |
| 674 | Ga0373952_0001596 | 3300035092 | Bacteria | 4136 |
| 675 | Ga0373923_0272686 | 3300035111 | Unclassified | 796 |
| 676 | Ga0373932_0002583 | 3300035112 | Bacteria | 4522 |
| 677 | Ga0373936_0035715 | 3300035113 | Bacteria | 1979 |
| 678 | Ga0373936_0160596 | 3300035113 | Bacteria | 979 |
| 679 | Ga0373939_0000760 | 3300035114 | Bacteria | 7951 |
| 680 | Ga0373939_0519418 | 3300035114 | Bacteria | 511 |
| 681 | Ga0373941_0002021 | 3300035115 | Bacteria | 4390 |
| 682 | Ga0373945_0005021 | 3300035116 | Bacteria | 4215 |
| 683 | Ga0373945_0025445 | 3300035116 | Bacteria | 2056 |
| 684 | Ga0373953_0205213 | 3300035117 | Bacteria | 853 |
| 685 | Ga0373956_0057187 | 3300035119 | Bacteria | 1762 |
| 686 | Ga0373956_0284712 | 3300035119 | Unclassified | 787 |
| 687 | Ga0373960_0085538 | 3300035121 | Unclassified | 1000 |
| 688 | Ga0373943_0019130 | 3300035170 | Bacteria | 3149 |
| 689 | Ga0373943_0026389 | 3300035170 | Bacteria | 2721 |
| 690 | Ga0373943_0236619 | 3300035170 | Bacteria | 1022 |
| 691 | Ga0373946_0063292 | 3300035171 | Bacteria | 1580 |
| 692 | Ga0373946_0106933 | 3300035171 | Bacteria | 1261 |
| 693 | Ga0373946_0164950 | 3300035171 | Bacteria | 1042 |
| 694 | Ga0373942_0151020 | 3300035207 | Bacteria | 746 |
| 695 | Ga0373962_0150607 | 3300035242 | Unclassified | 761 |
| 696 | Ga0373931_0001397 | 3300035691 | Bacteria | 10334 |
| 697 | Ga0373931_0361673 | 3300035691 | Unclassified | 911 |
| 698 | Ga0373931_0864061 | 3300035691 | Unclassified | 606 |
| 699 | Ga0373935_0083863 | 3300035692 | Bacteria | 2075 |
| 700 | Ga0373935_0177103 | 3300035692 | Bacteria | 1462 |
| 701 | Ga0373935_0234191 | 3300035692 | Bacteria | 1280 |
| 702 | Ga0373935_0499371 | 3300035692 | Bacteria | 883 |
| 703 | Ga0373935_0525297 | 3300035692 | Bacteria | 861 |
| 704 | Ga0373935_0629289 | 3300035692 | Bacteria | 786 |
| 705 | Ga0373935_0949816 | 3300035692 | Bacteria | 638 |
| 706 | Ga0373927_0207599 | 3300035695 | Bacteria | 1286 |
| 707 | Ga0373927_0231641 | 3300035695 | Bacteria | 1214 |
| 708 | Ga0373927_0250022 | 3300035695 | Bacteria | 1165 |
| 709 | Ga0373947_0003591 | 3300035725 | Bacteria | 9146 |
| 710 | Ga0373947_0018447 | 3300035725 | Bacteria | 4015 |
| 711 | Ga0373947_0076657 | 3300035725 | Bacteria | 2061 |
| 712 | Ga0373947_0090109 | 3300035725 | Bacteria | 1911 |
| 713 | Ga0373947_0417308 | 3300035725 | Bacteria | 907 |
| 714 | Ga0373937_1167426 | 3300036401 | Unclassified | 718 |
| 715 | Ga0373925_0003351 | 3300037068 | Bacteria | 12427 |
| 716 | Ga0373925_0060908 | 3300037068 | Bacteria | 2834 |
| 717 | Ga0373925_0629143 | 3300037068 | Bacteria | 884 |
| 718 | Ga0373925_1016386 | 3300037068 | Bacteria | 683 |
| 719 | Ga0395899_0001940 | 3300037312 | Bacteria | 17023 |
| 720 | Ga0395899_0005860 | 3300037312 | Bacteria | 9539 |
| 721 | Ga0395899_0019594 | 3300037312 | Bacteria | 5136 |
| 722 | Ga0395899_0031265 | 3300037312 | Bacteria | 4001 |
| 723 | Ga0395899_0039406 | 3300037312 | Bacteria | 3536 |
| 724 | Ga0395899_0059378 | 3300037312 | Bacteria | 2819 |
| 725 | Ga0395899_0069771 | 3300037312 | Bacteria | 2573 |
| 726 | Ga0395899_0174359 | 3300037312 | Bacteria | 1513 |
| 727 | Ga0395899_0199998 | 3300037312 | Bacteria | 1394 |
| 728 | Ga0395899_0200009 | 3300037312 | Bacteria | 1394 |
| 729 | Ga0395899_0242067 | 3300037312 | Bacteria | 1241 |
| 730 | Ga0395899_0350157 | 3300037312 | Bacteria | 988 |
| 731 | Ga0395899_0501994 | 3300037312 | Bacteria | 787 |
| 732 | Ga0395900_0005665 | 3300037418 | Bacteria | 13060 |
| 733 | Ga0395900_0013360 | 3300037418 | Bacteria | 8392 |
| 734 | Ga0395900_0018023 | 3300037418 | Bacteria | 7208 |
| 735 | Ga0395900_0019727 | 3300037418 | Bacteria | 6873 |
| 736 | Ga0395900_0025675 | 3300037418 | Bacteria | 6031 |
| 737 | Ga0395900_0032072 | 3300037418 | Bacteria | 5401 |
| 738 | Ga0395900_0033304 | 3300037418 | Bacteria | 5304 |
| 739 | Ga0395900_0050786 | 3300037418 | Bacteria | 4271 |
| 740 | Ga0395900_0058706 | 3300037418 | Bacteria | 3960 |
| 741 | Ga0395900_0064573 | 3300037418 | Bacteria | 3761 |
| 742 | Ga0395900_0074860 | 3300037418 | Bacteria | 3480 |
| 743 | Ga0395900_0097035 | 3300037418 | Bacteria | 3028 |
| 744 | Ga0395900_0165071 | 3300037418 | Bacteria | 2257 |
| 745 | Ga0395900_0197925 | 3300037418 | Bacteria | 2035 |
| 746 | Ga0395900_0236158 | 3300037418 | Bacteria | 1836 |
| 747 | Ga0395900_0245716 | 3300037418 | Unclassified | 1793 |
| 748 | Ga0395900_0249622 | 3300037418 | Bacteria | 1776 |
| 749 | Ga0395900_0253738 | 3300037418 | Bacteria | 1759 |
| 750 | Ga0395900_0257620 | 3300037418 | Bacteria | 1743 |
| 751 | Ga0395900_0342409 | 3300037418 | Bacteria | 1470 |
| 752 | Ga0395900_0352344 | 3300037418 | Bacteria | 1445 |
| 753 | Ga0395900_0609743 | 3300037418 | Bacteria | 1031 |
| 754 | Ga0395900_0830909 | 3300037418 | Bacteria | 850 |
| 755 | Ga0395900_0836718 | 3300037418 | Bacteria | 846 |
| 756 | Ga0395900_0953943 | 3300037418 | Unclassified | 779 |
| 757 | Ga0395900_1166334 | 3300037418 | Bacteria | 686 |
| 758 | Ga0395898_0003747 | 3300037466 | Bacteria | 16858 |
| 759 | Ga0395898_0004192 | 3300037466 | Bacteria | 15800 |
| 760 | Ga0395898_0006532 | 3300037466 | Bacteria | 12448 |
| 761 | Ga0395898_0008911 | 3300037466 | Bacteria | 10568 |
| 762 | Ga0395898_0012227 | 3300037466 | Bacteria | 8874 |
| 763 | Ga0395898_0014362 | 3300037466 | Bacteria | 8139 |
| 764 | Ga0395898_0016076 | 3300037466 | Bacteria | 7667 |
| 765 | Ga0395898_0016548 | 3300037466 | Bacteria | 7541 |
| 766 | Ga0395898_0017885 | 3300037466 | Bacteria | 7231 |
| 767 | Ga0395898_0026455 | 3300037466 | Bacteria | 5837 |
| 768 | Ga0395898_0030414 | 3300037466 | Bacteria | 5403 |
| 769 | Ga0395898_0087595 | 3300037466 | Bacteria | 2999 |
| 770 | Ga0395898_0184145 | 3300037466 | Bacteria | 1996 |
| 771 | Ga0395898_0186144 | 3300037466 | Bacteria | 1984 |
| 772 | Ga0395898_0317337 | 3300037466 | Bacteria | 1487 |
| 773 | Ga0395898_0442628 | 3300037466 | Bacteria | 1238 |
| 774 | Ga0395898_0457321 | 3300037466 | Bacteria | 1215 |
| 775 | Ga0395898_0506138 | 3300037466 | Bacteria | 1148 |
| 776 | Ga0395898_0563599 | 3300037466 | Bacteria | 1081 |
| 777 | Ga0395898_0585789 | 3300037466 | Bacteria | 1058 |
| 778 | Ga0395905_0009176 | 3300037471 | Bacteria | 9684 |
| 779 | Ga0395905_0011659 | 3300037471 | Bacteria | 8489 |
| 780 | Ga0395905_0012305 | 3300037471 | Bacteria | 8236 |
| 781 | Ga0395905_0015313 | 3300037471 | Bacteria | 7288 |
| 782 | Ga0395905_0016227 | 3300037471 | Bacteria | 7075 |
| 783 | Ga0395905_0017447 | 3300037471 | Bacteria | 6815 |
| 784 | Ga0395905_0020710 | 3300037471 | Bacteria | 6227 |
| 785 | Ga0395905_0045418 | 3300037471 | Bacteria | 4120 |
| 786 | Ga0395905_0074368 | 3300037471 | Bacteria | 3184 |
| 787 | Ga0395905_0080172 | 3300037471 | Bacteria | 3059 |
| 788 | Ga0395905_0090537 | 3300037471 | Bacteria | 2868 |
| 789 | Ga0395905_0095568 | 3300037471 | Bacteria | 2789 |
| 790 | Ga0395905_0105775 | 3300037471 | Bacteria | 2642 |
| 791 | Ga0395905_0173934 | 3300037471 | Bacteria | 2022 |
| 792 | Ga0395905_0198278 | 3300037471 | Bacteria | 1882 |
| 793 | Ga0395905_0246649 | 3300037471 | Bacteria | 1668 |
| 794 | Ga0395905_0250156 | 3300037471 | Bacteria | 1656 |
| 795 | Ga0395905_0250506 | 3300037471 | Bacteria | 1654 |
| 796 | Ga0395905_0369434 | 3300037471 | Bacteria | 1328 |
| 797 | Ga0395905_0370634 | 3300037471 | Bacteria | 1325 |
| 798 | Ga0395905_0797841 | 3300037471 | Unclassified | 847 |
| 799 | Ga0395901_0007305 | 3300038443 | Bacteria | 11151 |
| 800 | Ga0395901_0008381 | 3300038443 | Bacteria | 10453 |
| 801 | Ga0395901_0008807 | 3300038443 | Bacteria | 10211 |
| 802 | Ga0395901_0009124 | 3300038443 | Bacteria | 10043 |
| 803 | Ga0395901_0009722 | 3300038443 | Bacteria | 9752 |
| 804 | Ga0395901_0010594 | 3300038443 | Bacteria | 9340 |
| 805 | Ga0395901_0016666 | 3300038443 | Bacteria | 7486 |
| 806 | Ga0395901_0019727 | 3300038443 | Bacteria | 6892 |
| 807 | Ga0395901_0045672 | 3300038443 | Bacteria | 4547 |
| 808 | Ga0395901_0066263 | 3300038443 | Bacteria | 3761 |
| 809 | Ga0395901_0067281 | 3300038443 | Bacteria | 3731 |
| 810 | Ga0395901_0073121 | 3300038443 | Bacteria | 3575 |
| 811 | Ga0395901_0087756 | 3300038443 | Bacteria | 3252 |
| 812 | Ga0395901_0088981 | 3300038443 | Bacteria | 3230 |
| 813 | Ga0395901_0089871 | 3300038443 | Bacteria | 3214 |
| 814 | Ga0395901_0101528 | 3300038443 | Bacteria | 3018 |
| 815 | Ga0395901_0110460 | 3300038443 | Bacteria | 2886 |
| 816 | Ga0395901_0134887 | 3300038443 | Bacteria | 2594 |
| 817 | Ga0395901_0196847 | 3300038443 | Bacteria | 2113 |
| 818 | Ga0395901_0208057 | 3300038443 | Bacteria | 2048 |
| 819 | Ga0395901_0215078 | 3300038443 | Bacteria | 2010 |
| 820 | Ga0395901_0262698 | 3300038443 | Bacteria | 1796 |
| 821 | Ga0395901_0287639 | 3300038443 | Bacteria | 1706 |
| 822 | Ga0395901_0337203 | 3300038443 | Bacteria | 1558 |
| 823 | Ga0395901_0417104 | 3300038443 | Bacteria | 1377 |
| 824 | Ga0395901_0462974 | 3300038443 | Bacteria | 1295 |
| 825 | Ga0395901_0783748 | 3300038443 | Bacteria | 944 |
| 826 | Ga0395901_0843172 | 3300038443 | Bacteria | 902 |
| 827 | Ga0395901_0988584 | 3300038443 | Bacteria | 818 |
| 828 | Ga0395901_1053107 | 3300038443 | Bacteria | 786 |
| 829 | Ga0242422_03993 | 3300038699 | Bacteria | 945 |
| 830 | Ga0242420_003515 | 3300038996 | Bacteria | 2317 |
| 831 | Ga0436365_1661088 | 3300039437 | Unclassified | 854 |
| 832 | Ga0436360_0869588 | 3300039438 | Bacteria | 2726 |
| 833 | Ga0439438_170111 | 3300041405 | Bacteria | 518 |
| 834 | Ga0439439_0000609 | 3300041406 | Bacteria | 6292 |
| 835 | Ga0451787_504694 | 3300041441 | Bacteria | 627 |
| 836 | Ga0451789_1348595 | 3300041443 | Bacteria | 1546 |
| 837 | Ga0451791_0029882 | 3300041451 | Bacteria | 1171 |
| 838 | Ga0451793_0388457 | 3300041452 | Bacteria | 2816 |
| 839 | Ga0451795_1086781 | 3300041456 | Bacteria | 1129 |
| 840 | Ga0451798_0656323 | 3300041458 | Bacteria | 1034 |
| 841 | Ga0451802_1084932 | 3300041460 | Bacteria | 1295 |
| 842 | Ga0451802_1879636 | 3300041460 | Bacteria | 1670 |
| 843 | Ga0451802_2165544 | 3300041460 | Bacteria | 711 |
| 844 | Ga0451807_0686639 | 3300041486 | Bacteria | 1855 |
| 845 | Ga0451839_0361804 | 3300041496 | Bacteria | 1843 |
| 846 | Ga0451841_0140081 | 3300041498 | Bacteria | 1333 |
| 847 | Ga0451841_1173093 | 3300041498 | Bacteria | 681 |
| 848 | Ga0451845_0813253 | 3300041501 | Bacteria | 789 |
| 849 | Ga0451849_0285293 | 3300041505 | Bacteria | 1332 |
| 850 | Ga0451849_0920216 | 3300041505 | Bacteria | 526 |
| 851 | Ga0451851_1123922 | 3300041507 | Bacteria | 709 |
| 852 | Ga0451855_0770276 | 3300041511 | Bacteria | 1395 |
| 853 | Ga0451853_1078149 | 3300041512 | Bacteria | 1099 |
| 854 | Ga0451853_2987094 | 3300041512 | Bacteria | 1620 |
| 855 | Ga0451853_3160310 | 3300041512 | Bacteria | 570 |
| 856 | Ga0439431_0104213 | 3300041997 | Bacteria | 781 |
| 857 | Ga0439433_0004556 | 3300041999 | Bacteria | 2983 |
| 858 | Ga0439442_001947 | 3300042002 | Bacteria | 4060 |
| 859 | Ga0439443_060296 | 3300042003 | Bacteria | 678 |
| 860 | Ga0439448_0004319 | 3300042005 | Bacteria | 4009 |
| 861 | Ga0439448_0063090 | 3300042005 | Bacteria | 1227 |
| 862 | Ga0439448_0078308 | 3300042005 | Bacteria | 1107 |
| 863 | Ga0439450_026141 | 3300042008 | Bacteria | 1285 |
| 864 | Ga0439450_031340 | 3300042008 | Unclassified | 1197 |
| 865 | Ga0439450_042827 | 3300042008 | Bacteria | 1056 |
| 866 | Ga0439455_0028173 | 3300042012 | Bacteria | 1381 |
| 867 | Ga0439456_112548 | 3300042013 | Bacteria | 620 |
| 868 | Ga0439462_0003467 | 3300042015 | Bacteria | 3783 |
| 869 | Ga0439463_037472 | 3300042016 | Bacteria | 1230 |
| 870 | Ga0450915_005121 | 3300042119 | Bacteria | 799 |
| 871 | Ga0450888_000932 | 3300042126 | Bacteria | 2784 |
| 872 | Ga0439446_0002878 | 3300042156 | Bacteria | 4198 |
| 873 | Ga0439458_0004418 | 3300042157 | Bacteria | 3230 |
| 874 | Ga0439458_0126975 | 3300042157 | Bacteria | 674 |
| 875 | Ga0450908_038111 | 3300042184 | Bacteria | 833 |
| 876 | Ga0439434_0026808 | 3300042435 | Bacteria | 1740 |
| 877 | Ga0439434_0047178 | 3300042435 | Bacteria | 1330 |
| 878 | Ga0439435_0111272 | 3300042436 | Bacteria | 850 |
| 879 | Ga0439444_0086232 | 3300042437 | Unclassified | 694 |
| 880 | Ga0439459_0008081 | 3300042438 | Bacteria | 1791 |
| 881 | Ga0439464_0124129 | 3300042439 | Bacteria | 797 |
| 882 | Ga0439460_0066696 | 3300042461 | Bacteria | 1108 |
| 883 | Ga0439460_0090270 | 3300042461 | Bacteria | 973 |
| 884 | Ga0450916_065751 | 3300042530 | Bacteria | 597 |
| 885 | Ga0450893_0044822 | 3300042532 | Bacteria | 818 |
| 886 | Ga0450893_0122499 | 3300042532 | Bacteria | 544 |
| 887 | Ga0439440_0107552 | 3300042993 | Bacteria | 764 |
| 888 | Ga0439440_0158982 | 3300042993 | Unclassified | 651 |
| 889 | Ga0439440_0171532 | 3300042993 | Bacteria | 631 |
| 890 | Ga0466969_0043984 | 3300044656 | Bacteria | 2224 |
| 891 | Ga0466972_0504106 | 3300044658 | Bacteria | 570 |
| 892 | Ga0466965_0031336 | 3300044683 | Bacteria | 2593 |
| 893 | Ga0466965_0132715 | 3300044683 | Bacteria | 1292 |
| 894 | Ga0466965_0361847 | 3300044683 | Bacteria | 796 |
| 895 | Ga0466966_0023644 | 3300044684 | Bacteria | 4023 |
| 896 | Ga0466961_0022243 | 3300044693 | Bacteria | 4079 |
| 897 | Ga0466961_0094973 | 3300044693 | Bacteria | 1881 |
| 898 | Ga0466961_0126523 | 3300044693 | Bacteria | 1603 |
| 899 | Ga0466963_0010940 | 3300044694 | Bacteria | 5513 |
| 900 | Ga0466963_0027690 | 3300044694 | Bacteria | 3632 |
| 901 | Ga0466963_0033618 | 3300044694 | Bacteria | 3331 |
| 902 | Ga0466963_0084509 | 3300044694 | Bacteria | 2153 |
| 903 | Ga0466963_0113103 | 3300044694 | Bacteria | 1864 |
| 904 | Ga0466963_0126260 | 3300044694 | Bacteria | 1764 |
| 905 | Ga0466963_0194893 | 3300044694 | Bacteria | 1416 |
| 906 | Ga0466963_0429750 | 3300044694 | Bacteria | 931 |
| 907 | Ga0466963_0477065 | 3300044694 | Bacteria | 880 |
| 908 | Ga0466963_0502089 | 3300044694 | Bacteria | 856 |
| 909 | Ga0466963_0527813 | 3300044694 | Bacteria | 833 |
| 910 | Ga0466963_0681302 | 3300044694 | Bacteria | 726 |
| 911 | Ga0466963_1109014 | 3300044694 | Bacteria | 556 |
| 912 | Ga0466964_0000847 | 3300044706 | Bacteria | 10025 |
| 913 | Ga0466964_0017553 | 3300044706 | Bacteria | 2738 |
| 914 | Ga0466964_0041876 | 3300044706 | Bacteria | 1854 |
| 915 | Ga0466964_0072975 | 3300044706 | Bacteria | 1456 |
| 916 | Ga0466964_0075329 | 3300044706 | Bacteria | 1436 |
| 917 | Ga0466964_0157780 | 3300044706 | Bacteria | 1058 |
| 918 | Ga0466964_0329124 | 3300044706 | Bacteria | 779 |
| 919 | Ga0466964_0377108 | 3300044706 | Bacteria | 735 |
| 920 | Ga0466964_0433643 | 3300044706 | Bacteria | 693 |
| 921 | Ga0466964_0817762 | 3300044706 | Bacteria | 528 |
| 922 | Ga0466971_0049704 | 3300044719 | Bacteria | 1887 |
| 923 | Ga0466971_0057526 | 3300044719 | Bacteria | 1754 |
| 924 | Ga0466971_0077519 | 3300044719 | Bacteria | 1513 |
| 925 | Ga0466971_0160388 | 3300044719 | Bacteria | 1053 |
| 926 | Ga0466968_0004269 | 3300044735 | Bacteria | 5333 |
| 927 | Ga0466968_0060350 | 3300044735 | Bacteria | 1635 |
| 928 | Ga0466968_0086909 | 3300044735 | Bacteria | 1380 |
| 929 | Ga0466968_0219622 | 3300044735 | Bacteria | 895 |
| 930 | Ga0466968_0333740 | 3300044735 | Bacteria | 734 |
| 931 | Ga0466970_0105577 | 3300044765 | Bacteria | 1536 |
| 932 | Ga0466970_0140890 | 3300044765 | Bacteria | 1328 |
| 933 | Ga0466957_0097678 | 3300044842 | Bacteria | 1847 |
| 934 | Ga0466957_0137844 | 3300044842 | Bacteria | 1569 |
| 935 | Ga0466957_0510641 | 3300044842 | Bacteria | 834 |
| 936 | Ga0466957_0719304 | 3300044842 | Bacteria | 706 |
| 937 | Ga0466960_0006072 | 3300044901 | Bacteria | 4828 |
| 938 | Ga0466960_0072631 | 3300044901 | Bacteria | 1715 |
| 939 | Ga0466960_0080778 | 3300044901 | Bacteria | 1638 |
| 940 | Ga0466959_0013052 | 3300045049 | Bacteria | 6017 |
| 941 | Ga0466959_0024209 | 3300045049 | Bacteria | 4496 |
| 942 | Ga0466959_0283191 | 3300045049 | Bacteria | 1137 |
| 943 | Ga0451576_0102879 | 3300045051 | Bacteria | 2971 |
| 944 | Ga0466958_0011139 | 3300045836 | Bacteria | 5059 |
| 945 | Ga0466958_0041683 | 3300045836 | Bacteria | 2762 |
| 946 | Ga0466958_0247779 | 3300045836 | Bacteria | 1139 |
| 947 | Ga0466958_0318387 | 3300045836 | Bacteria | 1000 |
| 948 | Ga0466958_0639699 | 3300045836 | Bacteria | 692 |
| 949 | Ga0466958_0668775 | 3300045836 | Bacteria | 676 |
| 950 | Ga0466958_1170482 | 3300045836 | Bacteria | 502 |
| 951 | Ga0466967_0001517 | 3300045976 | Bacteria | 13570 |
| 952 | Ga0466967_0003014 | 3300045976 | Bacteria | 10802 |
| 953 | Ga0466967_0009587 | 3300045976 | Bacteria | 7197 |
| 954 | Ga0466967_0019987 | 3300045976 | Bacteria | 5399 |
| 955 | Ga0466967_0027642 | 3300045976 | Bacteria | 4721 |
| 956 | Ga0466967_0034503 | 3300045976 | Bacteria | 4295 |
| 957 | Ga0466967_0059861 | 3300045976 | Bacteria | 3372 |
| 958 | Ga0466967_0070363 | 3300045976 | Bacteria | 3130 |
| 959 | Ga0466967_0131984 | 3300045976 | Bacteria | 2319 |
| 960 | Ga0466967_0144149 | 3300045976 | Bacteria | 2221 |
| 961 | Ga0466967_0230156 | 3300045976 | Bacteria | 1764 |
| 962 | Ga0466967_0242257 | 3300045976 | Bacteria | 1720 |
| 963 | Ga0466967_0366690 | 3300045976 | Bacteria | 1396 |
| 964 | Ga0466967_0378173 | 3300045976 | Bacteria | 1375 |
| 965 | Ga0466967_0380377 | 3300045976 | Bacteria | 1370 |
| 966 | Ga0466967_0571103 | 3300045976 | Bacteria | 1114 |
| 967 | Ga0466967_0679309 | 3300045976 | Bacteria | 1019 |
| 968 | Ga0495617_129270 | 3300046452 | Bacteria | 811 |
| 969 | Ga0495627_046651 | 3300046453 | Bacteria | 1316 |
| 970 | Ga0495592_0013250 | 3300046454 | Bacteria | 6277 |
| 971 | Ga0495592_0396244 | 3300046454 | Bacteria | 875 |
| 972 | Ga0495603_0230307 | 3300046455 | Bacteria | 1068 |
| 973 | Ga0495591_114714 | 3300046458 | Bacteria | 660 |
| 974 | Ga0495629_0162179 | 3300046459 | Bacteria | 1553 |
| 975 | Ga0495629_0578436 | 3300046459 | Bacteria | 752 |
| 976 | Ga0495629_0601140 | 3300046459 | Bacteria | 736 |
| 977 | Ga0495641_0031218 | 3300046461 | Bacteria | 2547 |
| 978 | Ga0495651_0013235 | 3300046462 | Bacteria | 6378 |
| 979 | Ga0495651_0158078 | 3300046462 | Bacteria | 1627 |
| 980 | Ga0495653_0154665 | 3300046463 | Bacteria | 1599 |
| 981 | Ga0495580_0772573 | 3300046472 | Bacteria | 624 |
| 982 | Ga0495582_0049433 | 3300046473 | Bacteria | 2315 |
| 983 | Ga0495582_0135521 | 3300046473 | Bacteria | 1393 |
| 984 | Ga0495582_0272041 | 3300046473 | Bacteria | 972 |
| 985 | Ga0495582_0363573 | 3300046473 | Bacteria | 833 |
| 986 | Ga0495582_0501241 | 3300046473 | Bacteria | 702 |
| 987 | Ga0495605_0020917 | 3300046474 | Bacteria | 3472 |
| 988 | Ga0495605_0052109 | 3300046474 | Bacteria | 1990 |
| 989 | Ga0495605_0160231 | 3300046474 | Bacteria | 999 |
| 990 | Ga0495662_0040886 | 3300046476 | Bacteria | 2239 |
| 991 | Ga0495662_0216451 | 3300046476 | Bacteria | 944 |
| 992 | Ga0495664_0170434 | 3300046477 | Unclassified | 1321 |
| 993 | Ga0495664_0313245 | 3300046477 | Bacteria | 947 |
| 994 | Ga0495664_0415168 | 3300046477 | Bacteria | 808 |
| 995 | Ga0495584_0323274 | 3300046491 | Bacteria | 783 |
| 996 | Ga0495607_0117537 | 3300046501 | Bacteria | 1401 |
| 997 | Ga0495608_0025716 | 3300046511 | Bacteria | 4018 |
| 998 | Ga0495608_0080762 | 3300046511 | Bacteria | 2114 |
| 999 | Ga0495608_0469645 | 3300046511 | Bacteria | 764 |
| 1000 | Ga0495608_0927343 | 3300046511 | Bacteria | 509 |
| 1001 | Ga0495618_0348671 | 3300046514 | Bacteria | 913 |
| 1002 | Ga0495618_0577752 | 3300046514 | Bacteria | 671 |
| 1003 | Ga0495628_0204430 | 3300046516 | Bacteria | 1487 |
| 1004 | Ga0495630_0035675 | 3300046517 | Bacteria | 3716 |
| 1005 | Ga0495630_0273920 | 3300046517 | Bacteria | 1289 |
| 1006 | Ga0495630_1254182 | 3300046517 | Bacteria | 559 |
| 1007 | Ga0495631_0091583 | 3300046518 | Bacteria | 1309 |
| 1008 | Ga0495631_0208705 | 3300046518 | Bacteria | 835 |
| 1009 | Ga0495637_0291252 | 3300046520 | Bacteria | 581 |
| 1010 | Ga0495644_0081797 | 3300046523 | Bacteria | 1218 |
| 1011 | Ga0495644_0193093 | 3300046523 | Bacteria | 784 |
| 1012 | Ga0495663_0163199 | 3300046525 | Bacteria | 765 |
| 1013 | Ga0495663_0261587 | 3300046525 | Bacteria | 616 |
| 1014 | Ga0495666_0012440 | 3300046526 | Bacteria | 4242 |
| 1015 | Ga0495642_0276926 | 3300046528 | Bacteria | 734 |
| 1016 | Ga0495652_0237119 | 3300046529 | Unclassified | 1360 |
| 1017 | Ga0495652_0279879 | 3300046529 | Bacteria | 1222 |
| 1018 | Ga0495652_0353119 | 3300046529 | Bacteria | 1053 |
| 1019 | Ga0495652_0367160 | 3300046529 | Bacteria | 1027 |
| 1020 | Ga0495652_0687455 | 3300046529 | Bacteria | 689 |
| 1021 | Ga0495665_0018007 | 3300046531 | Bacteria | 3797 |
| 1022 | Ga0495665_0561166 | 3300046531 | Bacteria | 572 |
| 1023 | Ga0495640_0160889 | 3300046533 | Bacteria | 1439 |
| 1024 | Ga0495587_0378938 | 3300046536 | Bacteria | 787 |
| 1025 | Ga0495609_0141382 | 3300046538 | Bacteria | 1027 |
| 1026 | Ga0495609_0374440 | 3300046538 | Bacteria | 572 |
| 1027 | Ga0495645_0105036 | 3300046543 | Bacteria | 2005 |
| 1028 | Ga0495645_0269388 | 3300046543 | Bacteria | 1124 |
| 1029 | Ga0495667_0006310 | 3300046559 | Bacteria | 8044 |
| 1030 | Ga0495667_0073862 | 3300046559 | Bacteria | 2221 |
| 1031 | Ga0495667_0297333 | 3300046559 | Bacteria | 1023 |
| 1032 | Ga0495656_0186484 | 3300046615 | Bacteria | 1022 |
| 1033 | Ga0495656_0298901 | 3300046615 | Bacteria | 825 |
| 1034 | Ga0495656_0323165 | 3300046615 | Bacteria | 795 |
| 1035 | Ga0495668_0591482 | 3300046616 | Bacteria | 613 |
| 1036 | Ga0495634_0098006 | 3300046642 | Bacteria | 1897 |
| 1037 | Ga0495634_0213970 | 3300046642 | Unclassified | 1192 |
| 1038 | Ga0495611_0071162 | 3300046648 | Bacteria | 1590 |
| 1039 | Ga0495611_0214336 | 3300046648 | Bacteria | 896 |
| 1040 | Ga0495635_0083839 | 3300046663 | Bacteria | 2181 |
| 1041 | Ga0495635_0118680 | 3300046663 | Bacteria | 1805 |
| 1042 | Ga0495659_0022681 | 3300046664 | Bacteria | 2127 |
| 1043 | Ga0495588_0135252 | 3300046674 | Bacteria | 1301 |
| 1044 | Ga0495588_0135682 | 3300046674 | Bacteria | 1299 |
| 1045 | Ga0495657_0087951 | 3300046675 | Bacteria | 1998 |
| 1046 | Ga0495657_0257393 | 3300046675 | Unclassified | 1049 |
| 1047 | Ga0495623_0067800 | 3300046679 | Bacteria | 2226 |
| 1048 | Ga0495646_0150962 | 3300046680 | Bacteria | 1292 |
| 1049 | Ga0495647_0118589 | 3300046681 | Bacteria | 1111 |
| 1050 | Ga0495658_0018501 | 3300046683 | Bacteria | 3624 |
| 1051 | Ga0495658_0023792 | 3300046683 | Bacteria | 3255 |
| 1052 | Ga0495658_0058999 | 3300046683 | Bacteria | 2196 |
| 1053 | Ga0495658_0946840 | 3300046683 | Bacteria | 550 |
| 1054 | Ga0495613_0143702 | 3300046689 | Bacteria | 1704 |
| 1055 | Ga0495613_0191297 | 3300046689 | Bacteria | 1446 |
| 1056 | Ga0495624_0151515 | 3300046690 | Bacteria | 1418 |
| 1057 | Ga0495624_0344591 | 3300046690 | Bacteria | 896 |
| 1058 | Ga0495670_0235456 | 3300046691 | Bacteria | 974 |
| 1059 | Ga0495589_0377270 | 3300046794 | Bacteria | 652 |
| 1060 | Ga0495600_0418192 | 3300046809 | Bacteria | 832 |
| 1061 | Ga0495581_0000868 | 3300047315 | Bacteria | 16148 |
| 1062 | Ga0495604_0947874 | 3300047317 | Bacteria | 535 |
| 1063 | Ga0495636_0118234 | 3300047318 | Bacteria | 1171 |
| 1064 | Ga0495636_0324417 | 3300047318 | Bacteria | 723 |
| 1065 | Ga0495674_0081351 | 3300047319 | Bacteria | 2778 |
| 1066 | Ga0495674_0171551 | 3300047319 | Bacteria | 1810 |
| 1067 | Ga0495674_0442190 | 3300047319 | Bacteria | 1046 |
| 1068 | Ga0495676_0018960 | 3300047321 | Bacteria | 6060 |
| 1069 | Ga0495676_0041793 | 3300047321 | Bacteria | 3770 |
| 1070 | Ga0495676_0257510 | 3300047321 | Bacteria | 1188 |
| 1071 | Ga0495676_0298717 | 3300047321 | Bacteria | 1086 |
| 1072 | Ga0495680_0014538 | 3300047322 | Bacteria | 6814 |
| 1073 | Ga0495680_0264282 | 3300047322 | Bacteria | 1216 |
| 1074 | Ga0495680_0492525 | 3300047322 | Bacteria | 833 |
| 1075 | Ga0495680_0522511 | 3300047322 | Bacteria | 803 |
| 1076 | Ga0495675_0784363 | 3300047444 | Bacteria | 528 |
| 1077 | Ga0495677_0248158 | 3300047445 | Bacteria | 696 |
| 1078 | Ga0495679_200978 | 3300047446 | Bacteria | 524 |
| 1079 | Ga0495685_064047 | 3300047447 | Bacteria | 1237 |
| 1080 | Ga0495685_140167 | 3300047447 | Bacteria | 788 |
| 1081 | Ga0495684_0023112 | 3300047471 | Bacteria | 4782 |
| 1082 | Ga0495602_0067084 | 3300048088 | Bacteria | 3088 |
| 1083 | Ga0495614_0059638 | 3300048089 | Bacteria | 1639 |
| 1084 | Ga0495614_0100970 | 3300048089 | Bacteria | 1261 |
| 1085 | Ga0495615_0049389 | 3300048090 | Bacteria | 1078 |
| 1086 | Ga0496100_0007025 | 3300048903 | Bacteria | 6176 |
| 1087 | Ga0496100_0066864 | 3300048903 | Bacteria | 2385 |
| 1088 | Ga0496100_0117670 | 3300048903 | Unclassified | 1855 |
| 1089 | Ga0496100_0148998 | 3300048903 | Bacteria | 1666 |
| 1090 | Ga0496100_0280718 | 3300048903 | Bacteria | 1241 |
| 1091 | Ga0496100_0341681 | 3300048903 | Bacteria | 1129 |
| 1092 | Ga0496100_0407491 | 3300048903 | Bacteria | 1036 |
| 1093 | Ga0496100_0752957 | 3300048903 | Bacteria | 762 |
| 1094 | Ga0496100_1138886 | 3300048903 | Bacteria | 615 |
| 1095 | Ga0496101_0005132 | 3300048904 | Bacteria | 8327 |
| 1096 | Ga0496101_0026950 | 3300048904 | Bacteria | 3996 |
| 1097 | Ga0496101_0082282 | 3300048904 | Bacteria | 2382 |
| 1098 | Ga0496101_0179138 | 3300048904 | Bacteria | 1631 |
| 1099 | Ga0496101_0232909 | 3300048904 | Unclassified | 1432 |
| 1100 | Ga0496101_0313287 | 3300048904 | Bacteria | 1230 |
| 1101 | Ga0496102_0020418 | 3300048905 | Bacteria | 5854 |
| 1102 | Ga0496102_0057361 | 3300048905 | Bacteria | 3555 |
| 1103 | Ga0496102_0084335 | 3300048905 | Bacteria | 2932 |
| 1104 | Ga0496102_0092105 | 3300048905 | Bacteria | 2806 |
| 1105 | Ga0496102_0590586 | 3300048905 | Bacteria | 1033 |
| 1106 | Ga0496102_0666377 | 3300048905 | Bacteria | 963 |
| 1107 | Ga0496102_0940229 | 3300048905 | Bacteria | 786 |
| 1108 | Ga0496102_1098188 | 3300048905 | Unclassified | 715 |
| 1109 | Ga0496103_0008216 | 3300048906 | Bacteria | 6195 |
| 1110 | Ga0496103_0029843 | 3300048906 | Bacteria | 3315 |
| 1111 | Ga0496103_0049030 | 3300048906 | Bacteria | 2611 |
| 1112 | Ga0496103_0113212 | 3300048906 | Bacteria | 1724 |
| 1113 | Ga0496103_0219217 | 3300048906 | Bacteria | 1224 |
| 1114 | Ga0496103_0350328 | 3300048906 | Unclassified | 949 |
| 1115 | Ga0496104_0013997 | 3300048907 | Bacteria | 7237 |
| 1116 | Ga0496104_0026648 | 3300048907 | Bacteria | 5340 |
| 1117 | Ga0496104_0117845 | 3300048907 | Bacteria | 2548 |
| 1118 | Ga0496104_0160532 | 3300048907 | Bacteria | 2156 |
| 1119 | Ga0496104_0325331 | 3300048907 | Unclassified | 1450 |
| 1120 | Ga0496104_0579283 | 3300048907 | Bacteria | 1033 |
| 1121 | Ga0496104_0889899 | 3300048907 | Bacteria | 795 |
| 1122 | Ga0496104_1104840 | 3300048907 | Bacteria | 696 |
| 1123 | Ga0496105_0016517 | 3300048908 | Bacteria | 5894 |
| 1124 | Ga0496105_0023998 | 3300048908 | Bacteria | 4953 |
| 1125 | Ga0496105_0074608 | 3300048908 | Bacteria | 2802 |
| 1126 | Ga0496105_0182990 | 3300048908 | Bacteria | 1715 |
| 1127 | Ga0496106_0136569 | 3300048909 | Bacteria | 1926 |
| 1128 | Ga0496106_0163600 | 3300048909 | Bacteria | 1760 |
| 1129 | Ga0496106_0197991 | 3300048909 | Bacteria | 1598 |
| 1130 | Ga0496106_0198964 | 3300048909 | Bacteria | 1594 |
| 1131 | Ga0496106_0468072 | 3300048909 | Unclassified | 1012 |
| 1132 | Ga0496107_0010371 | 3300048910 | Bacteria | 6474 |
| 1133 | Ga0496107_0011310 | 3300048910 | Bacteria | 6211 |
| 1134 | Ga0496107_0049067 | 3300048910 | Bacteria | 3041 |
| 1135 | Ga0496107_0143457 | 3300048910 | Bacteria | 1765 |
| 1136 | Ga0496107_0191775 | 3300048910 | Bacteria | 1518 |
| 1137 | Ga0496107_0573794 | 3300048910 | Unclassified | 835 |
| 1138 | Ga0496107_0600311 | 3300048910 | Bacteria | 814 |
| 1139 | Ga0496107_0802777 | 3300048910 | Bacteria | 689 |
| 1140 | Ga0496107_0950419 | 3300048910 | Unclassified | 625 |
| 1141 | Ga0496108_0035156 | 3300048911 | Bacteria | 4164 |
| 1142 | Ga0496108_0154131 | 3300048911 | Bacteria | 1984 |
| 1143 | Ga0496108_0278327 | 3300048911 | Bacteria | 1457 |
| 1144 | Ga0496108_0297963 | 3300048911 | Bacteria | 1404 |
| 1145 | Ga0496108_0335462 | 3300048911 | Bacteria | 1319 |
| 1146 | Ga0496108_0353376 | 3300048911 | Bacteria | 1282 |
| 1147 | Ga0496108_0392498 | 3300048911 | Bacteria | 1212 |
| 1148 | Ga0496108_0575434 | 3300048911 | Bacteria | 982 |
| 1149 | Ga0496109_0011051 | 3300048912 | Bacteria | 7741 |
| 1150 | Ga0496109_0040435 | 3300048912 | Bacteria | 4224 |
| 1151 | Ga0496109_0043403 | 3300048912 | Bacteria | 4075 |
| 1152 | Ga0496109_0067879 | 3300048912 | Bacteria | 3267 |
| 1153 | Ga0496109_0115456 | 3300048912 | Unclassified | 2498 |
| 1154 | Ga0496109_0121599 | 3300048912 | Bacteria | 2432 |
| 1155 | Ga0496109_0147846 | 3300048912 | Unclassified | 2199 |
| 1156 | Ga0496109_0219127 | 3300048912 | Bacteria | 1790 |
| 1157 | Ga0496109_0232003 | 3300048912 | Bacteria | 1736 |
| 1158 | Ga0496109_0236783 | 3300048912 | Bacteria | 1717 |
| 1159 | Ga0496109_0304815 | 3300048912 | Bacteria | 1502 |
| 1160 | Ga0496109_0364995 | 3300048912 | Bacteria | 1364 |
| 1161 | Ga0496109_0490842 | 3300048912 | Bacteria | 1159 |
| 1162 | Ga0496109_0679168 | 3300048912 | Bacteria | 967 |
| 1163 | Ga0496109_0825276 | 3300048912 | Bacteria | 865 |
| 1164 | Ga0496109_0959138 | 3300048912 | Bacteria | 793 |
| 1165 | Ga0496110_0046941 | 3300048913 | Bacteria | 3780 |
| 1166 | Ga0496110_0093561 | 3300048913 | Bacteria | 2691 |
| 1167 | Ga0496110_0120314 | 3300048913 | Bacteria | 2365 |
| 1168 | Ga0496110_0241553 | 3300048913 | Bacteria | 1643 |
| 1169 | Ga0496110_0279442 | 3300048913 | Bacteria | 1520 |
| 1170 | Ga0496110_0386203 | 3300048913 | Bacteria | 1276 |
| 1171 | Ga0496110_0419627 | 3300048913 | Bacteria | 1220 |
| 1172 | Ga0496110_0542167 | 3300048913 | Bacteria | 1057 |
| 1173 | Ga0496110_0547725 | 3300048913 | Unclassified | 1051 |
| 1174 | Ga0496110_1573298 | 3300048913 | Unclassified | 567 |
| 1175 | Ga0496111_0024043 | 3300048914 | Bacteria | 4284 |
| 1176 | Ga0496111_0041866 | 3300048914 | Bacteria | 3288 |
| 1177 | Ga0496111_0043041 | 3300048914 | Bacteria | 3245 |
| 1178 | Ga0496111_0263696 | 3300048914 | Unclassified | 1278 |
| 1179 | Ga0496111_0264101 | 3300048914 | Unclassified | 1277 |
| 1180 | Ga0496111_0298877 | 3300048914 | Bacteria | 1193 |
| 1181 | Ga0496111_0362613 | 3300048914 | Bacteria | 1072 |
| 1182 | Ga0496111_0730041 | 3300048914 | Unclassified | 719 |
| 1183 | Ga0496111_0888781 | 3300048914 | Unclassified | 642 |
| 1184 | Ga0496112_0076547 | 3300048915 | Unclassified | 3309 |
| 1185 | Ga0496112_0082662 | 3300048915 | Bacteria | 3176 |
| 1186 | Ga0496112_0176601 | 3300048915 | Bacteria | 2100 |
| 1187 | Ga0496112_0236011 | 3300048915 | Unclassified | 1782 |
| 1188 | Ga0496112_0316455 | 3300048915 | Bacteria | 1505 |
| 1189 | Ga0496112_0369982 | 3300048915 | Bacteria | 1375 |
| 1190 | Ga0496112_0578579 | 3300048915 | Bacteria | 1056 |
| 1191 | Ga0496113_0016416 | 3300048916 | Bacteria | 5115 |
| 1192 | Ga0496113_0071693 | 3300048916 | Unclassified | 2635 |
| 1193 | Ga0496113_0109054 | 3300048916 | Bacteria | 2152 |
| 1194 | Ga0496113_0188759 | 3300048916 | Unclassified | 1635 |
| 1195 | Ga0496113_0209049 | 3300048916 | Bacteria | 1553 |
| 1196 | Ga0496113_0230149 | 3300048916 | Bacteria | 1478 |
| 1197 | Ga0496113_0257723 | 3300048916 | Bacteria | 1393 |
| 1198 | Ga0496113_0339712 | 3300048916 | Bacteria | 1204 |
| 1199 | Ga0496113_1305121 | 3300048916 | Bacteria | 564 |
| 1200 | Ga0496114_0008715 | 3300048917 | Bacteria | 8037 |
| 1201 | Ga0496114_0010512 | 3300048917 | Bacteria | 7365 |
| 1202 | Ga0496114_0019327 | 3300048917 | Bacteria | 5519 |
| 1203 | Ga0496114_0070400 | 3300048917 | Bacteria | 2938 |
| 1204 | Ga0496114_0076084 | 3300048917 | Bacteria | 2828 |
| 1205 | Ga0496114_0221454 | 3300048917 | Bacteria | 1661 |
| 1206 | Ga0496114_0240604 | 3300048917 | Bacteria | 1591 |
| 1207 | Ga0496114_0311310 | 3300048917 | Bacteria | 1391 |
| 1208 | Ga0496114_0787506 | 3300048917 | Unclassified | 829 |
| 1209 | Ga0496114_0919016 | 3300048917 | Bacteria | 757 |
| 1210 | Ga0496114_0968841 | 3300048917 | Bacteria | 733 |
| 1211 | Ga0496115_0003388 | 3300048918 | Bacteria | 11443 |
| 1212 | Ga0496115_0014734 | 3300048918 | Bacteria | 5924 |
| 1213 | Ga0496115_0076556 | 3300048918 | Bacteria | 2719 |
| 1214 | Ga0496115_0095042 | 3300048918 | Bacteria | 2439 |
| 1215 | Ga0496115_0134589 | 3300048918 | Bacteria | 2038 |
| 1216 | Ga0496115_0239836 | 3300048918 | Bacteria | 1494 |
| 1217 | Ga0496115_0253968 | 3300048918 | Bacteria | 1447 |
| 1218 | Ga0501031_0003798 | 3300049568 | Bacteria | 9718 |
| 1219 | Ga0501031_0015280 | 3300049568 | Bacteria | 4985 |
| 1220 | Ga0501032_0004530 | 3300049569 | Bacteria | 10455 |
| 1221 | Ga0501032_0010424 | 3300049569 | Bacteria | 6702 |
| 1222 | Ga0501032_0835313 | 3300049569 | Bacteria | 581 |
| 1223 | Ga0501033_0015994 | 3300049570 | Bacteria | 5683 |
| 1224 | Ga0501034_0014020 | 3300049571 | Bacteria | 8253 |
| 1225 | Ga0501036_0004028 | 3300049572 | Bacteria | 11816 |
| 1226 | Ga0501036_0034540 | 3300049572 | Bacteria | 4277 |
| 1227 | Ga0501036_0175744 | 3300049572 | Bacteria | 1803 |
| 1228 | Ga0501037_0001346 | 3300049573 | Bacteria | 18048 |
| 1229 | Ga0501037_0010849 | 3300049573 | Bacteria | 6695 |
| 1230 | Ga0501038_0003128 | 3300049574 | Bacteria | 15436 |
| 1231 | Ga0501038_0028881 | 3300049574 | Bacteria | 4922 |
| 1232 | Ga0501039_0069173 | 3300049575 | Bacteria | 2741 |
| 1233 | Ga0501039_0070088 | 3300049575 | Bacteria | 2723 |
| 1234 | Ga0501039_1081270 | 3300049575 | Bacteria | 622 |
| 1235 | Ga0501040_0011794 | 3300049576 | Bacteria | 5718 |
| 1236 | Ga0501040_0031310 | 3300049576 | Bacteria | 3594 |
| 1237 | Ga0501040_0091243 | 3300049576 | Bacteria | 2118 |
| 1238 | Ga0501040_0394173 | 3300049576 | Bacteria | 994 |
| 1239 | Ga0501041_0040776 | 3300049577 | Bacteria | 2819 |
| 1240 | Ga0501041_0129841 | 3300049577 | Bacteria | 1569 |
| 1241 | Ga0501041_0320054 | 3300049577 | Bacteria | 978 |
| 1242 | Ga0501041_0736857 | 3300049577 | Bacteria | 631 |
| 1243 | Ga0501042_0005516 | 3300049578 | Bacteria | 8155 |
| 1244 | Ga0501042_0095228 | 3300049578 | Bacteria | 2138 |
| 1245 | Ga0501042_0388049 | 3300049578 | Bacteria | 1011 |
| 1246 | Ga0501042_0467255 | 3300049578 | Bacteria | 915 |
| 1247 | Ga0501042_0519014 | 3300049578 | Bacteria | 865 |
| 1248 | Ga0501043_0010883 | 3300049579 | Bacteria | 7122 |
| 1249 | Ga0501043_0036692 | 3300049579 | Bacteria | 3856 |
| 1250 | Ga0501043_0192479 | 3300049579 | Bacteria | 1586 |
| 1251 | Ga0501046_0002682 | 3300049580 | Bacteria | 16589 |
| 1252 | Ga0501046_0027463 | 3300049580 | Bacteria | 4641 |
| 1253 | Ga0501046_0343323 | 3300049580 | Bacteria | 1085 |
| 1254 | Ga0501047_0031585 | 3300049581 | Bacteria | 5108 |
| 1255 | Ga0501047_0131362 | 3300049581 | Bacteria | 2384 |
| 1256 | Ga0501048_0011343 | 3300049582 | Bacteria | 6645 |
| 1257 | Ga0501048_0052643 | 3300049582 | Bacteria | 2897 |
| 1258 | Ga0501067_0000018 | 3300049583 | Bacteria | 101701 |
| 1259 | Ga0501067_0000043 | 3300049583 | Bacteria | 75533 |
| 1260 | Ga0501067_0053936 | 3300049583 | Bacteria | 2227 |
| 1261 | Ga0501067_0323688 | 3300049583 | Bacteria | 858 |
| 1262 | Ga0501067_0588167 | 3300049583 | Bacteria | 624 |
| 1263 | Ga0501068_0000161 | 3300049584 | Bacteria | 31006 |
| 1264 | Ga0501068_0002637 | 3300049584 | Bacteria | 9504 |
| 1265 | Ga0501068_0005381 | 3300049584 | Bacteria | 6998 |
| 1266 | Ga0501068_0149947 | 3300049584 | Bacteria | 1465 |
| 1267 | Ga0501068_0236218 | 3300049584 | Unclassified | 1163 |
| 1268 | Ga0501068_0678386 | 3300049584 | Bacteria | 673 |
| 1269 | Ga0501068_1022757 | 3300049584 | Bacteria | 545 |
| 1270 | Ga0501069_0000286 | 3300049585 | Bacteria | 22990 |
| 1271 | Ga0501069_0002442 | 3300049585 | Bacteria | 9473 |
| 1272 | Ga0501069_0003827 | 3300049585 | Bacteria | 7751 |
| 1273 | Ga0501069_0010207 | 3300049585 | Bacteria | 4967 |
| 1274 | Ga0501069_0051697 | 3300049585 | Bacteria | 2287 |
| 1275 | Ga0501069_0260352 | 3300049585 | Bacteria | 1013 |
| 1276 | Ga0501070_0002395 | 3300049586 | Bacteria | 16449 |
| 1277 | Ga0501070_0008310 | 3300049586 | Bacteria | 8769 |
| 1278 | Ga0501070_0074343 | 3300049586 | Bacteria | 2813 |
| 1279 | Ga0501070_0529840 | 3300049586 | Bacteria | 944 |
| 1280 | Ga0501070_0626780 | 3300049586 | Bacteria | 855 |
| 1281 | Ga0501071_0002202 | 3300049587 | Bacteria | 11732 |
| 1282 | Ga0501071_0043650 | 3300049587 | Bacteria | 3215 |
| 1283 | Ga0501071_0054335 | 3300049587 | Bacteria | 2890 |
| 1284 | Ga0501071_0526302 | 3300049587 | Bacteria | 907 |
| 1285 | Ga0501072_0063536 | 3300049588 | Bacteria | 2912 |
| 1286 | Ga0501072_0077783 | 3300049588 | Bacteria | 2626 |
| 1287 | Ga0501072_0302291 | 3300049588 | Bacteria | 1272 |
| 1288 | Ga0501073_0004308 | 3300049589 | Bacteria | 10676 |
| 1289 | Ga0501073_0077338 | 3300049589 | Bacteria | 2315 |
| 1290 | Ga0501073_0665565 | 3300049589 | Bacteria | 718 |
| 1291 | Ga0501074_0067464 | 3300049590 | Bacteria | 2572 |
| 1292 | Ga0501074_0082815 | 3300049590 | Bacteria | 2300 |
| 1293 | Ga0501074_0096410 | 3300049590 | Bacteria | 2117 |
| 1294 | Ga0501074_0173871 | 3300049590 | Unclassified | 1537 |
| 1295 | Ga0501075_0050264 | 3300049591 | Bacteria | 3133 |
| 1296 | Ga0501075_0065557 | 3300049591 | Bacteria | 2740 |
| 1297 | Ga0501075_0302685 | 3300049591 | Bacteria | 1218 |
| 1298 | Ga0501075_0411955 | 3300049591 | Bacteria | 1030 |
| 1299 | Ga0501076_0003583 | 3300049592 | Bacteria | 10906 |
| 1300 | Ga0501076_0013986 | 3300049592 | Bacteria | 6030 |
| 1301 | Ga0501076_0033114 | 3300049592 | Bacteria | 4034 |
| 1302 | Ga0501076_0033754 | 3300049592 | Bacteria | 3996 |
| 1303 | Ga0501076_0275579 | 3300049592 | Bacteria | 1378 |
| 1304 | Ga0501076_0691434 | 3300049592 | Bacteria | 842 |
| 1305 | Ga0501077_0003014 | 3300049593 | Bacteria | 10096 |
| 1306 | Ga0501077_0081550 | 3300049593 | Bacteria | 2049 |
| 1307 | Ga0501077_0124262 | 3300049593 | Unclassified | 1636 |
| 1308 | Ga0501077_0525475 | 3300049593 | Bacteria | 759 |
| 1309 | Ga0501079_0005345 | 3300049741 | Bacteria | 9560 |
| 1310 | Ga0501079_0097510 | 3300049741 | Bacteria | 2279 |
| 1311 | Ga0501079_0228665 | 3300049741 | Bacteria | 1453 |
| 1312 | Ga0501079_0455359 | 3300049741 | Unclassified | 1005 |
| 1313 | Ga0501079_0661662 | 3300049741 | Unclassified | 822 |
| 1314 | Ga0501079_0710330 | 3300049741 | Bacteria | 791 |
| 1315 | Ga0501080_0004462 | 3300049742 | Bacteria | 12457 |
| 1316 | Ga0501080_0014549 | 3300049742 | Bacteria | 7247 |
| 1317 | Ga0501080_0017828 | 3300049742 | Bacteria | 6572 |
| 1318 | Ga0501080_0496176 | 3300049742 | Bacteria | 1091 |
| 1319 | Ga0501081_0007101 | 3300049743 | Bacteria | 7278 |
| 1320 | Ga0501081_0028955 | 3300049743 | Bacteria | 3740 |
| 1321 | Ga0501081_0127918 | 3300049743 | Bacteria | 1813 |
| 1322 | Ga0501081_0302424 | 3300049743 | Bacteria | 1173 |
| 1323 | Ga0501081_0501822 | 3300049743 | Bacteria | 904 |
| 1324 | Ga0501081_0744651 | 3300049743 | Bacteria | 736 |
| 1325 | Ga0501083_0000504 | 3300049744 | Bacteria | 24936 |
| 1326 | Ga0501083_0002288 | 3300049744 | Bacteria | 13113 |
| 1327 | Ga0501035_0001724 | 3300049822 | Bacteria | 22093 |
| 1328 | Ga0501035_0005345 | 3300049822 | Bacteria | 12152 |
| 1329 | Ga0501035_0380752 | 3300049822 | Bacteria | 1177 |
| 1330 | Ga0501044_0119076 | 3300049823 | Bacteria | 2643 |
| 1331 | Ga0501044_0189926 | 3300049823 | Bacteria | 2017 |
| 1332 | Ga0501045_0005671 | 3300049824 | Bacteria | 8640 |
| 1333 | Ga0501045_0019593 | 3300049824 | Bacteria | 4826 |
| 1334 | Ga0501045_0118894 | 3300049824 | Bacteria | 1962 |
| 1335 | Ga0501045_0221787 | 3300049824 | Unclassified | 1408 |
| 1336 | nmdc:mga05p37_221536_c1 | 3300050507 | Bacteria | 2283 |
| 1337 | nmdc:mga05p37_249737_c1 | 3300050507 | Unclassified | 2128 |
| 1338 | nmdc:mga05p37_276752_c1 | 3300050507 | Bacteria | 2004 |
| 1339 | nmdc:mga05p37_304773_c1 | 3300050507 | Bacteria | 1891 |
| 1340 | nmdc:mga05p37_581007_c1 | 3300050507 | Bacteria | 1269 |
| 1341 | nmdc:mga05p37_59343_c1 | 3300050507 | Bacteria | 4711 |
| 1342 | nmdc:mga05p37_61186_c1 | 3300050507 | Bacteria | 4636 |
| 1343 | nmdc:mga05p37_762516_c1 | 3300050507 | Bacteria | 1065 |
| 1344 | nmdc:mga05p37_78557_c1 | 3300050507 | Bacteria | 4064 |
| 1345 | nmdc:mga09592_245893_c1 | 3300050508 | Bacteria | 1550 |
| 1346 | nmdc:mga09592_269491_c1 | 3300050508 | Bacteria | 1477 |
| 1347 | nmdc:mga09592_528256_c1 | 3300050508 | Bacteria | 1014 |
| 1348 | nmdc:mga09592_90669_c1 | 3300050508 | Bacteria | 2612 |
| 1349 | nmdc:mga0qj67_156000_c1 | 3300050509 | Bacteria | 1853 |
| 1350 | nmdc:mga06r32_119803_c1 | 3300050510 | Bacteria | 2595 |
| 1351 | nmdc:mga06r32_19413_c1 | 3300050510 | Bacteria | 6238 |
| 1352 | nmdc:mga06r32_912014_c1 | 3300050510 | Unclassified | 835 |
| 1353 | nmdc:mga08y16_322950_c1 | 3300050511 | Bacteria | 1589 |
| 1354 | nmdc:mga08y16_325918_c1 | 3300050511 | Bacteria | 1581 |
| 1355 | nmdc:mga08y16_34368_c1 | 3300050511 | Bacteria | 5325 |
| 1356 | nmdc:mga08y16_40602_c1 | 3300050511 | Bacteria | 4876 |
| 1357 | nmdc:mga08y16_633725_c1 | 3300050511 | Bacteria | 1075 |
| 1358 | nmdc:mga08y16_823367_c1 | 3300050511 | Unclassified | 920 |
| 1359 | nmdc:mga08y16_973209_c1 | 3300050511 | Unclassified | 830 |
| 1360 | nmdc:mga0n895_1311314_c1 | 3300050512 | Unclassified | 695 |
| 1361 | nmdc:mga0n895_175464_c1 | 3300050512 | Bacteria | 2174 |
| 1362 | nmdc:mga0n895_184995_c1 | 3300050512 | Bacteria | 2114 |
| 1363 | nmdc:mga0n895_355650_c1 | 3300050512 | Bacteria | 1483 |
| 1364 | nmdc:mga0n895_38675_c1 | 3300050512 | Bacteria | 4624 |
| 1365 | nmdc:mga0n895_50477_c1 | 3300050512 | Bacteria | 4078 |
| 1366 | nmdc:mga0n895_657581_c1 | 3300050512 | Bacteria | 1046 |
| 1367 | nmdc:mga0rr50_178493_c1 | 3300050513 | Bacteria | 1735 |
| 1368 | nmdc:mga0rr50_190484_c1 | 3300050513 | Bacteria | 1680 |
| 1369 | nmdc:mga0rr50_191937_c1 | 3300050513 | Bacteria | 1675 |
| 1370 | nmdc:mga0rr50_250762_c1 | 3300050513 | Bacteria | 1470 |
| 1371 | nmdc:mga0rr50_6190_c1 | 3300050513 | Bacteria | 7250 |
| 1372 | nmdc:mga0rr50_63031_c1 | 3300050513 | Bacteria | 2799 |
| 1373 | nmdc:mga0rr50_69825_c1 | 3300050513 | Bacteria | 2675 |
| 1374 | nmdc:mga08x19_12299_c1 | 3300050514 | Bacteria | 5153 |
| 1375 | nmdc:mga08x19_12301_c1 | 3300050514 | Bacteria | 5153 |
| 1376 | nmdc:mga08x19_44327_c1 | 3300050514 | Unclassified | 2840 |
| 1377 | nmdc:mga08x19_452140_c1 | 3300050514 | Bacteria | 904 |
| 1378 | nmdc:mga08x19_660532_c1 | 3300050514 | Bacteria | 741 |
| 1379 | nmdc:mga08x19_75235_c1 | 3300050514 | Bacteria | 2208 |
| 1380 | nmdc:mga0a205_124147_c1 | 3300050515 | Bacteria | 2482 |
| 1381 | nmdc:mga0a205_168641_c1 | 3300050515 | Bacteria | 2085 |
| 1382 | nmdc:mga0a205_221004_c1 | 3300050515 | Bacteria | 1780 |
| 1383 | nmdc:mga0a205_29263_c1 | 3300050515 | Bacteria | 5272 |
| 1384 | nmdc:mga0a205_299559_c1 | 3300050515 | Bacteria | 1481 |
| 1385 | nmdc:mga0a205_62006_c1 | 3300050515 | Bacteria | 3613 |
| 1386 | nmdc:mga0a205_67173_c1 | 3300050515 | Bacteria | 3463 |
| 1387 | nmdc:mga0a205_80998_c1 | 3300050515 | Bacteria | 3137 |
| 1388 | Ga0495601_0016899 | 3300053077 | Bacteria | 4426 |
| 1389 | Ga0495601_0166305 | 3300053077 | Bacteria | 1441 |
| 1390 | Ga0495601_0176904 | 3300053077 | Bacteria | 1395 |
| 1391 | Ga0495601_0180551 | 3300053077 | Bacteria | 1380 |
| 1392 | Ga0495601_0470284 | 3300053077 | Bacteria | 812 |
| 1393 | Ga0495612_0068571 | 3300053078 | Bacteria | 1476 |
| 1394 | Ga0495612_0274688 | 3300053078 | Unclassified | 752 |
| 1395 | Ga0495655_0000869 | 3300053083 | Bacteria | 4720 |
| 1396 | Ga0495595_0009513 | 3300053084 | Bacteria | 4023 |
| 1397 | Ga0495595_0027753 | 3300053084 | Bacteria | 2524 |
| 1398 | Ga0495595_0654230 | 3300053084 | Bacteria | 538 |
| 1399 | Ga0495619_0027019 | 3300053085 | Bacteria | 3696 |
| 1400 | Ga0501084_0009042 | 3300054114 | Bacteria | 8242 |
| 1401 | Ga0501084_0071982 | 3300054114 | Bacteria | 2895 |
| 1402 | Ga0501084_0174171 | 3300054114 | Bacteria | 1816 |
| 1403 | Ga0501084_0216422 | 3300054114 | Bacteria | 1616 |
| 1404 | Ga0501084_0292581 | 3300054114 | Bacteria | 1375 |
| 1405 | Ga0501084_0532896 | 3300054114 | Bacteria | 993 |
| 1406 | Ga0587073_0175252 | 3300059492 | Bacteria | 625 |
| 1407 | Ga0587077_044317 | 3300059493 | Bacteria | 905 |
| 1408 | Ga0587077_123958 | 3300059493 | Bacteria | 648 |
| 1409 | Ga0587082_016692 | 3300059504 | Bacteria | 1149 |
| 1410 | Ga0587083_0074244 | 3300059505 | Bacteria | 796 |
| 1411 | Ga0587083_0242280 | 3300059505 | Bacteria | 534 |
| 1412 | Ga0587088_036441 | 3300059508 | Unclassified | 906 |
| 1413 | Ga0587088_061728 | 3300059508 | Bacteria | 761 |
| 1414 | Ga0587090_060446 | 3300059510 | Bacteria | 718 |
| 1415 | Ga0587094_093420 | 3300059513 | Bacteria | 572 |
| 1416 | Ga0587099_030972 | 3300059622 | Unclassified | 650 |
| 1417 | Ga0587101_068974 | 3300059623 | Bacteria | 647 |
| 1418 | Ga0587128_091006 | 3300059630 | Bacteria | 626 |
| 1419 | Ga0587067_051046 | 3300059640 | Bacteria | 837 |
| 1420 | Ga0587114_051410 | 3300059655 | Unclassified | 699 |
| 1421 | Ga0587071_044473 | 3300060344 | Unclassified | 900 |
| 1422 | Ga0587111_0251542 | 3300060346 | Bacteria | 523 |
| 1423 | Ga0501082_0014408 | 3300060353 | Bacteria | 6803 |
| 1424 | Ga0501082_0073390 | 3300060353 | Bacteria | 2948 |
| 1425 | Ga0501082_0129571 | 3300060353 | Bacteria | 2188 |
| 1426 | Ga0501082_0144350 | 3300060353 | Bacteria | 2066 |
| 1427 | Ga0501082_0526563 | 3300060353 | Bacteria | 1033 |
| 1428 | Ga0501082_0779018 | 3300060353 | Bacteria | 837 |
| 1429 | Ga0466962_0024344 | 3300061719 | Bacteria | 2908 |
| 1430 | Ga0466962_0240545 | 3300061719 | Bacteria | 888 |
| 1431 | Ga0466962_0412461 | 3300061719 | Bacteria | 677 |
| 1432 | Ga0530510_0003434 | 3300061734 | Bacteria | 10888 |
| 1433 | Ga0530510_0024990 | 3300061734 | Bacteria | 4270 |
| 1434 | Ga0530510_0096661 | 3300061734 | Bacteria | 2158 |
| 1435 | Ga0530510_0292182 | 3300061734 | Bacteria | 1219 |
| 1436 | Ga0530510_0328875 | 3300061734 | Unclassified | 1146 |
| 1437 | Ga0530510_0338454 | 3300061734 | Bacteria | 1129 |
| 1438 | Ga0207661_10042438 | |||
| 1439 | JGI25407J50210_10003347 | |||
| 1440 | JGI25407J50210_10011863 | |||
| 1441 | JGI25407J50210_10013973 | |||
| 1442 | Ga0058861_10075293 | |||
| 1443 | Ga0058861_11810407 | |||
| 1444 | Ga0058862_10046701 | |||
| 1445 | Ga0070658_10105256 | |||
| 1446 | Ga0070658_10646176 | |||
| 1447 | Ga0070658_10996356 | |||
| 1448 | Ga0070676_10293772 | |||
| 1449 | Ga0070683_100001379 | |||
| 1450 | Ga0070683_100005013 | |||
| 1451 | Ga0070683_100037229 | |||
| 1452 | Ga0070683_100044833 | |||
| 1453 | Ga0070683_100241605 | |||
| 1454 | Ga0070683_100333756 | |||
| 1455 | Ga0070690_100121705 | |||
| 1456 | Ga0070690_100301729 | |||
| 1457 | Ga0070670_100049075 | |||
| 1458 | Ga0068869_100170346 | |||
| 1459 | Ga0068869_100267798 | |||
| 1460 | Ga0070680_100016898 | |||
| 1461 | Ga0070680_100128742 | |||
| 1462 | Ga0070682_100001120 | |||
| 1463 | Ga0070682_100169777 | |||
| 1464 | Ga0068868_100163557 | |||
| 1465 | Ga0068868_100258518 | |||
| 1466 | Ga0068868_100490425 | |||
| 1467 | Ga0070660_100104555 | |||
| 1468 | Ga0070660_100267490 | |||
| 1469 | Ga0070660_100822680 | |||
| 1470 | Ga0070689_100037671 | |||
| 1471 | Ga0070689_100096247 | |||
| 1472 | Ga0070689_100241720 | |||
| 1473 | Ga0070689_100487859 | |||
| 1474 | Ga0070691_10364657 | |||
| 1475 | Ga0070687_100140768 | |||
| 1476 | Ga0070687_100248623 | |||
| 1477 | Ga0070661_100016760 | |||
| 1478 | Ga0070661_100210300 | |||
| 1479 | Ga0070661_100255486 | |||
| 1480 | Ga0070661_100577397 | |||
| 1481 | Ga0070668_100975774 | |||
| 1482 | Ga0070669_100215976 | |||
| 1483 | Ga0070675_100602373 | |||
| 1484 | Ga0070671_100137891 | |||
| 1485 | Ga0070671_100201298 | |||
| 1486 | Ga0070671_100418891 | |||
| 1487 | Ga0070674_100514522 | |||
| 1488 | Ga0070674_100577638 | |||
| 1489 | Ga0070673_100379501 | |||
| 1490 | Ga0070673_100894913 | |||
| 1491 | Ga0070673_101445147 | |||
| 1492 | Ga0070688_100004502 | |||
| 1493 | Ga0070659_100222305 | |||
| 1494 | Ga0070659_101074117 | |||
| 1495 | Ga0070667_100010579 | |||
| 1496 | Ga0070667_100610295 | |||
| 1497 | Ga0070703_10006333 | |||
| 1498 | Ga0070703_10013655 | |||
| 1499 | Ga0070703_10015940 | |||
| 1500 | Ga0070709_10074329 | |||
| 1501 | Ga0070709_10112566 | |||
| 1502 | Ga0070709_10115793 | |||
| 1503 | Ga0070709_10119257 | |||
| 1504 | Ga0070709_10336019 | |||
| 1505 | Ga0070709_10526075 | |||
| 1506 | Ga0070714_100098687 | |||
| 1507 | Ga0070714_100131822 | |||
| 1508 | Ga0070714_100135402 | |||
| 1509 | Ga0070714_100185055 | |||
| 1510 | Ga0070714_100554624 | |||
| 1511 | Ga0070714_100794724 | |||
| 1512 | Ga0070714_101065556 | |||
| 1513 | Ga0070713_100009354 | |||
| 1514 | Ga0070713_100117684 | |||
| 1515 | Ga0070713_100342452 | |||
| 1516 | Ga0070710_10008661 | |||
| 1517 | Ga0070710_10013881 | |||
| 1518 | Ga0070710_10015912 | |||
| 1519 | Ga0070710_10053122 | |||
| 1520 | Ga0070710_10243178 | |||
| 1521 | Ga0070710_10304204 | |||
| 1522 | Ga0070710_10369129 | |||
| 1523 | Ga0070710_10391138 | |||
| 1524 | Ga0070701_10012076 | |||
| 1525 | Ga0070701_10294474 | |||
| 1526 | Ga0070711_100014628 | |||
| 1527 | Ga0070711_100030732 | |||
| 1528 | Ga0070711_100043560 | |||
| 1529 | Ga0070711_100196860 | |||
| 1530 | Ga0070711_100288057 | |||
| 1531 | Ga0070711_100355449 | |||
| 1532 | Ga0070711_100369955 | |||
| 1533 | Ga0070711_100589877 | |||
| 1534 | Ga0070705_100010056 | |||
| 1535 | Ga0070705_100256947 | |||
| 1536 | Ga0070705_100271398 | |||
| 1537 | Ga0070705_101172379 | |||
| 1538 | Ga0070705_101338758 | |||
| 1539 | Ga0070700_100021368 | |||
| 1540 | Ga0070694_100116597 | |||
| 1541 | Ga0070694_100146848 | |||
| 1542 | Ga0070708_100032536 | |||
| 1543 | Ga0070708_100308065 | |||
| 1544 | Ga0070708_100352794 | |||
| 1545 | Ga0070708_100672842 | |||
| 1546 | Ga0070708_101551238 | |||
| 1547 | Ga0070678_100082013 | |||
| 1548 | Ga0070678_100097624 | |||
| 1549 | Ga0070678_100098306 | |||
| 1550 | Ga0070678_100252065 | |||
| 1551 | Ga0070678_100347824 | |||
| 1552 | Ga0070662_100111577 | |||
| 1553 | Ga0070681_10086158 | |||
| 1554 | Ga0070681_10112485 | |||
| 1555 | Ga0070681_10113387 | |||
| 1556 | Ga0070681_10354777 | |||
| 1557 | Ga0070681_10467524 | |||
| 1558 | Ga0068867_100004127 | |||
| 1559 | Ga0068867_100074175 | |||
| 1560 | Ga0068867_100852157 | |||
| 1561 | Ga0070685_10001503 | |||
| 1562 | Ga0070685_11102103 | |||
| 1563 | Ga0070706_100069251 | |||
| 1564 | Ga0070706_100074391 | |||
| 1565 | Ga0070706_100519581 | |||
| 1566 | Ga0070706_100605621 | |||
| 1567 | Ga0070706_100895796 | |||
| 1568 | Ga0070707_100064946 | |||
| 1569 | Ga0070707_100080465 | |||
| 1570 | Ga0070707_100088760 | |||
| 1571 | Ga0070707_100158631 | |||
| 1572 | Ga0070707_100263819 | |||
| 1573 | Ga0070707_100510843 | |||
| 1574 | Ga0070698_100011346 | |||
| 1575 | Ga0070698_100046946 | |||
| 1576 | Ga0070698_100100007 | |||
| 1577 | Ga0070698_100140692 | |||
| 1578 | Ga0070698_100252945 | |||
| 1579 | Ga0070698_100734658 | |||
| 1580 | Ga0070698_101362834 | |||
| 1581 | Ga0070699_100034414 | |||
| 1582 | Ga0070699_100065621 | |||
| 1583 | Ga0070699_100119033 | |||
| 1584 | Ga0070699_100134166 | |||
| 1585 | Ga0070699_100728365 | |||
| 1586 | Ga0070679_100012562 | |||
| 1587 | Ga0070679_100045639 | |||
| 1588 | Ga0070679_100126545 | |||
| 1589 | Ga0070679_100339854 | |||
| 1590 | Ga0070679_100438353 | |||
| 1591 | Ga0070684_100000799 | |||
| 1592 | Ga0070684_100011246 | |||
| 1593 | Ga0070684_100662843 | |||
| 1594 | Ga0070697_100431839 | |||
| 1595 | Ga0070697_100471372 | |||
| 1596 | Ga0068853_100123750 | |||
| 1597 | Ga0068853_101903701 | |||
| 1598 | Ga0070672_100756827 | |||
| 1599 | Ga0070672_100858112 | |||
| 1600 | Ga0070686_100097025 | |||
| 1601 | Ga0070686_100132575 | |||
| 1602 | Ga0070686_100471996 | |||
| 1603 | Ga0070695_100084074 | |||
| 1604 | Ga0070695_100189145 | |||
| 1605 | Ga0070695_100231283 | |||
| 1606 | Ga0070695_100374378 | |||
| 1607 | Ga0070696_100057639 | |||
| 1608 | Ga0070696_100088159 | |||
| 1609 | Ga0070696_100135737 | |||
| 1610 | Ga0070693_100048890 | |||
| 1611 | Ga0070693_100127440 | |||
| 1612 | Ga0070693_100265880 | |||
| 1613 | Ga0070693_100541908 | |||
| 1614 | Ga0070665_101122580 | |||
| 1615 | Ga0070704_100143365 | |||
| 1616 | Ga0070704_100176953 | |||
| 1617 | Ga0070704_100259472 | |||
| 1618 | Ga0070704_100292602 | |||
| 1619 | Ga0068855_100010923 | |||
| 1620 | Ga0068855_100082705 | |||
| 1621 | Ga0068855_100153338 | |||
| 1622 | Ga0068855_100204561 | |||
| 1623 | Ga0068855_100222731 | |||
| 1624 | Ga0068855_100256458 | |||
| 1625 | Ga0068855_100409880 | |||
| 1626 | Ga0070664_100079756 | |||
| 1627 | Ga0070664_100092804 | |||
| 1628 | Ga0070664_101123134 | |||
| 1629 | Ga0068857_100008592 | |||
| 1630 | Ga0068857_100015217 | |||
| 1631 | Ga0068857_100064962 | |||
| 1632 | Ga0068857_100071410 | |||
| 1633 | Ga0068857_100499315 | |||
| 1634 | Ga0068857_101030882 | |||
| 1635 | Ga0068854_100065947 | |||
| 1636 | Ga0068854_100596133 | |||
| 1637 | Ga0068854_101517773 | |||
| 1638 | Ga0068856_100278422 | |||
| 1639 | Ga0068856_100368382 | |||
| 1640 | Ga0070702_100013242 | |||
| 1641 | Ga0070702_100082833 | |||
| 1642 | Ga0070702_100634345 | |||
| 1643 | Ga0068852_100408502 | |||
| 1644 | Ga0068852_100596464 | |||
| 1645 | Ga0068859_100170259 | |||
| 1646 | Ga0068859_100291218 | |||
| 1647 | Ga0068866_10011612 | |||
| 1648 | Ga0068866_10160677 | |||
| 1649 | Ga0068861_100011174 | |||
| 1650 | Ga0068861_100020039 | |||
| 1651 | Ga0068863_100507594 | |||
| 1652 | Ga0068858_101343473 | |||
| 1653 | Ga0068860_101395787 | |||
| 1654 | Ga0068862_100067107 | |||
| 1655 | Ga0068862_100430731 | |||
| 1656 | Ga0081455_10001178 | |||
| 1657 | Ga0081455_10018946 | |||
| 1658 | Ga0081455_10047799 | |||
| 1659 | Ga0081455_10049699 | |||
| 1660 | Ga0081455_10088446 | |||
| 1661 | Ga0081455_10212653 | |||
| 1662 | Ga0081455_10363109 | |||
| 1663 | Ga0081538_10000021 | |||
| 1664 | Ga0081538_10000138 | |||
| 1665 | Ga0081538_10000649 | |||
| 1666 | Ga0081538_10007374 | |||
| 1667 | Ga0081538_10017018 | |||
| 1668 | Ga0081538_10018623 | |||
| 1669 | Ga0081540_1003497 | |||
| 1670 | Ga0081540_1019956 | |||
| 1671 | Ga0081540_1024007 | |||
| 1672 | Ga0081540_1061713 | |||
| 1673 | Ga0081539_10004185 | |||
| 1674 | Ga0070717_10087370 | |||
| 1675 | Ga0070717_10176447 | |||
| 1676 | Ga0075365_10009205 | |||
| 1677 | Ga0075363_100169169 | |||
| 1678 | Ga0075432_10011105 | |||
| 1679 | Ga0075432_10141947 | |||
| 1680 | Ga0070715_10019654 | |||
| 1681 | Ga0070715_10050508 | |||
| 1682 | Ga0070715_10457392 | |||
| 1683 | Ga0070716_100005213 | |||
| 1684 | Ga0070716_100020081 | |||
| 1685 | Ga0070716_100099369 | |||
| 1686 | Ga0070716_100114929 | |||
| 1687 | Ga0070716_100260874 | |||
| 1688 | Ga0070712_100017483 | |||
| 1689 | Ga0070712_100080695 | |||
| 1690 | Ga0070712_100134940 | |||
| 1691 | Ga0070712_100184214 | |||
| 1692 | Ga0070712_100250739 | |||
| 1693 | Ga0075362_10005326 | |||
| 1694 | Ga0097621_100156276 | |||
| 1695 | Ga0097621_101304370 | |||
| 1696 | Ga0068871_100203276 | |||
| 1697 | Ga0068871_101652643 | |||
| 1698 | Ga0075428_100057582 | |||
| 1699 | Ga0075428_100140206 | |||
| 1700 | Ga0075428_100347587 | |||
| 1701 | Ga0075428_100474947 | |||
| 1702 | Ga0075428_100497354 | |||
| 1703 | Ga0075428_100525543 | |||
| 1704 | Ga0075428_101313151 | |||
| 1705 | Ga0075428_101569851 | |||
| 1706 | Ga0075430_100038236 | |||
| 1707 | Ga0075430_100233556 | |||
| 1708 | Ga0075431_100021608 | |||
| 1709 | Ga0075431_100027665 | |||
| 1710 | Ga0075431_100129061 | |||
| 1711 | Ga0075431_100198362 | |||
| 1712 | Ga0075431_100604865 | |||
| 1713 | Ga0075431_101563816 | |||
| 1714 | Ga0075433_10052452 | |||
| 1715 | Ga0075433_10073882 | |||
| 1716 | Ga0075433_10139496 | |||
| 1717 | Ga0075433_10946878 | |||
| 1718 | Ga0075434_100023038 | |||
| 1719 | Ga0075434_100075447 | |||
| 1720 | Ga0075434_100225890 | |||
| 1721 | Ga0075434_100283745 | |||
| 1722 | Ga0075434_100290291 | |||
| 1723 | Ga0075434_101435524 | |||
| 1724 | Ga0075429_100099327 | |||
| 1725 | Ga0075429_100735975 | |||
| 1726 | Ga0068865_100003775 | |||
| 1727 | Ga0068865_100136947 | |||
| 1728 | Ga0068865_100420452 | |||
| 1729 | Ga0068865_100714023 | |||
| 1730 | Ga0075436_100041620 | |||
| 1731 | Ga0075436_100182574 | |||
| 1732 | Ga0075436_101175364 | |||
| 1733 | Ga0097620_100170261 | |||
| 1734 | Ga0097620_100291199 | |||
| 1735 | Ga0097620_102410509 | |||
| 1736 | Ga0075435_100007092 | |||
| 1737 | Ga0075435_100022813 | |||
| 1738 | Ga0075435_100071667 | |||
| 1739 | Ga0075435_100114122 | |||
| 1740 | Ga0105240_10019847 | |||
| 1741 | Ga0105240_10476277 | |||
| 1742 | Ga0105240_11110398 | |||
| 1743 | Ga0111539_10027300 | |||
| 1744 | Ga0111539_10096592 | |||
| 1745 | Ga0111539_10349612 | |||
| 1746 | Ga0111539_10427459 | |||
| 1747 | Ga0111539_10489365 | |||
| 1748 | Ga0111539_10854121 | |||
| 1749 | Ga0111539_12333355 | |||
| 1750 | Ga0105245_10019659 | |||
| 1751 | Ga0105245_10141805 | |||
| 1752 | Ga0105245_10529443 | |||
| 1753 | Ga0105245_11253563 | |||
| 1754 | Ga0105247_10039826 | |||
| 1755 | Ga0105247_10244632 | |||
| 1756 | Ga0105247_11042416 | |||
| 1757 | Ga0114129_10038479 | |||
| 1758 | Ga0114129_10064757 | |||
| 1759 | Ga0114129_10099426 | |||
| 1760 | Ga0114129_10106794 | |||
| 1761 | Ga0114129_10149545 | |||
| 1762 | Ga0114129_10439523 | |||
| 1763 | Ga0114129_10859167 | |||
| 1764 | Ga0114129_10956171 | |||
| 1765 | Ga0105243_10068824 | |||
| 1766 | Ga0105243_10103799 | |||
| 1767 | Ga0105243_10169896 | |||
| 1768 | Ga0105243_10187215 | |||
| 1769 | Ga0105243_10332675 | |||
| 1770 | Ga0105243_10557355 | |||
| 1771 | Ga0105243_10622177 | |||
| 1772 | Ga0105243_10674002 | |||
| 1773 | Ga0105241_10028797 | |||
| 1774 | Ga0105241_10047092 | |||
| 1775 | Ga0105241_10118663 | |||
| 1776 | Ga0105242_10022608 | |||
| 1777 | Ga0105242_10029025 | |||
| 1778 | Ga0105242_10094391 | |||
| 1779 | Ga0105242_10294092 | |||
| 1780 | Ga0105242_10887844 | |||
| 1781 | Ga0105248_10039381 | |||
| 1782 | Ga0105248_10096553 | |||
| 1783 | Ga0105248_10304220 | |||
| 1784 | Ga0105248_12685016 | |||
| 1785 | Ga0105238_10411502 | |||
| 1786 | Ga0105238_10457885 | |||
| 1787 | Ga0105249_10036380 | |||
| 1788 | Ga0105249_10217120 | |||
| 1789 | Ga0105249_10999955 | |||
| 1790 | Ga0105239_10066176 | |||
| 1791 | Ga0105239_10083931 | |||
| 1792 | Ga0105239_10092694 | |||
| 1793 | Ga0105239_10204769 | |||
| 1794 | Ga0105239_11069792 | |||
| 1795 | Ga0105246_10007182 | |||
| 1796 | Ga0157320_1028328 | |||
| 1797 | Ga0157343_1009265 | |||
| 1798 | Ga0157347_1007249 | |||
| 1799 | Ga0157313_1001914 | |||
| 1800 | Ga0157339_1028723 | |||
| 1801 | Ga0157342_1003934 | |||
| 1802 | Ga0157316_1015938 | |||
| 1803 | Ga0157327_1030667 | |||
| 1804 | Ga0157338_1000279 | |||
| 1805 | Ga0154016_132876 | |||
| 1806 | Ga0157371_10071143 | |||
| 1807 | Ga0157371_10183340 | |||
| 1808 | Ga0157371_10698887 | |||
| 1809 | Ga0157370_10008089 | |||
| 1810 | Ga0157370_10086066 | |||
| 1811 | Ga0157370_10230176 | |||
| 1812 | Ga0157369_11438057 | |||
| 1813 | Ga0157369_12021996 | |||
| 1814 | Ga0157374_10050689 | |||
| 1815 | Ga0157374_10540208 | |||
| 1816 | Ga0157378_10197538 | |||
| 1817 | Ga0157378_10548964 | |||
| 1818 | Ga0157378_11904611 | |||
| 1819 | Ga0163162_10273823 | |||
| 1820 | Ga0157372_10028322 | |||
| 1821 | Ga0157372_10268198 | |||
| 1822 | Ga0157372_10512605 | |||
| 1823 | Ga0157372_10908629 | |||
| 1824 | Ga0157372_10986794 | |||
| 1825 | Ga0157372_11143157 | |||
| 1826 | Ga0157375_10080761 | |||
| 1827 | Ga0157375_10193415 | |||
| 1828 | Ga0157375_10247962 | |||
| 1829 | Ga0157375_10843708 | |||
| 1830 | Ga0157375_11624148 | |||
| 1831 | Ga0163163_10439583 | |||
| 1832 | Ga0157380_10453549 | |||
| 1833 | Ga0182008_10244503 | |||
| 1834 | Ga0157377_10003315 | |||
| 1835 | Ga0157377_10211637 | |||
| 1836 | Ga0157379_10484666 | |||
| 1837 | Ga0157376_10292884 | |||
| 1838 | Ga0157376_10342116 | |||
| 1839 | Ga0157376_10342907 | |||
| 1840 | Ga0157376_11642904 | |||
| 1841 | Ga0182006_1070513 | |||
| 1842 | Ga0182005_1073834 | |||
| 1843 | Ga0182005_1242909 | |||
| 1844 | Ga0163161_10388766 | |||
| 1845 | Ga0163161_10574168 | |||
| 1846 | Ga0163161_10972918 | |||
| 1847 | Ga0197907_10188215 | |||
| 1848 | Ga0206356_10897941 | |||
| 1849 | Ga0206356_10970350 | |||
| 1850 | Ga0206356_11081930 | |||
| 1851 | Ga0206349_1185021 | |||
| 1852 | Ga0206349_1667707 | |||
| 1853 | Ga0206355_1152397 | |||
| 1854 | Ga0206351_10032051 | |||
| 1855 | Ga0206351_10695050 | |||
| 1856 | Ga0206352_11232016 | |||
| 1857 | Ga0206350_11574031 | |||
| 1858 | Ga0206354_10190292 | |||
| 1859 | Ga0206354_10337611 | |||
| 1860 | Ga0206354_11346914 | |||
| 1861 | Ga0206353_10046952 | |||
| 1862 | Ga0206353_10072795 | |||
| 1863 | Ga0206353_10717995 | |||
| 1864 | Ga0206353_11373027 | |||
| 1865 | Ga0154015_1261515 | |||
| 1866 | Ga0154015_1543957 | |||
| 1867 | Ga0213871_10034944 | |||
| 1868 | Ga0224712_10019853 | |||
| 1869 | Ga0207656_10120689 | |||
| 1870 | Ga0207692_10037924 | |||
| 1871 | Ga0207692_10045495 | |||
| 1872 | Ga0207692_10097640 | |||
| 1873 | Ga0207642_10538637 | |||
| 1874 | Ga0207642_11064233 | |||
| 1875 | Ga0207710_10030397 | |||
| 1876 | Ga0207688_10033801 | |||
| 1877 | Ga0207688_10098278 | |||
| 1878 | Ga0207688_10133363 | |||
| 1879 | Ga0207688_10190407 | |||
| 1880 | Ga0207688_10610973 | |||
| 1881 | Ga0207680_10080065 | |||
| 1882 | Ga0207647_10427341 | |||
| 1883 | Ga0207699_10055631 | |||
| 1884 | Ga0207699_10071435 | |||
| 1885 | Ga0207699_10096767 | |||
| 1886 | Ga0207699_10132111 | |||
| 1887 | Ga0207699_10586790 | |||
| 1888 | Ga0207699_10710216 | |||
| 1889 | Ga0207643_10062453 | |||
| 1890 | Ga0207705_10869412 | |||
| 1891 | Ga0207705_11329059 | |||
| 1892 | Ga0207684_10036127 | |||
| 1893 | Ga0207684_10121551 | |||
| 1894 | Ga0207684_10249817 | |||
| 1895 | Ga0207684_10324158 | |||
| 1896 | Ga0207684_10357059 | |||
| 1897 | Ga0207684_10861011 | |||
| 1898 | Ga0207684_11261494 | |||
| 1899 | Ga0207654_10038632 | |||
| 1900 | Ga0207654_10488819 | |||
| 1901 | Ga0207707_10039023 | |||
| 1902 | Ga0207707_10041740 | |||
| 1903 | Ga0207707_10043445 | |||
| 1904 | Ga0207695_10077461 | |||
| 1905 | Ga0207695_10703647 | |||
| 1906 | Ga0207695_11648716 | |||
| 1907 | Ga0207671_10448242 | |||
| 1908 | Ga0207671_10748480 | |||
| 1909 | Ga0207693_10000406 | |||
| 1910 | Ga0207693_10001431 | |||
| 1911 | Ga0207693_10006501 | |||
| 1912 | Ga0207693_10079809 | |||
| 1913 | Ga0207693_10110316 | |||
| 1914 | Ga0207663_10008237 | |||
| 1915 | Ga0207663_10013339 | |||
| 1916 | Ga0207663_10118612 | |||
| 1917 | Ga0207663_10136405 | |||
| 1918 | Ga0207660_10023066 | |||
| 1919 | Ga0207660_10098552 | |||
| 1920 | Ga0207660_11173081 | |||
| 1921 | Ga0207662_10019934 | |||
| 1922 | Ga0207662_10524967 | |||
| 1923 | Ga0207657_10000073 | |||
| 1924 | Ga0207657_10413643 | |||
| 1925 | Ga0207649_10152961 | |||
| 1926 | Ga0207652_10015439 | |||
| 1927 | Ga0207652_10188369 | |||
| 1928 | Ga0207646_10006672 | |||
| 1929 | Ga0207646_10034338 | |||
| 1930 | Ga0207646_10105029 | |||
| 1931 | Ga0207646_10190275 | |||
| 1932 | Ga0207646_11313264 | |||
| 1933 | Ga0207681_10872586 | |||
| 1934 | Ga0207681_11772699 | |||
| 1935 | Ga0207694_10694838 | |||
| 1936 | Ga0207650_10382499 | |||
| 1937 | Ga0207650_10389169 | |||
| 1938 | Ga0207659_10340124 | |||
| 1939 | Ga0207687_10012396 | |||
| 1940 | Ga0207687_10044904 | |||
| 1941 | Ga0207687_10060282 | |||
| 1942 | Ga0207687_10090718 | |||
| 1943 | Ga0207687_10250052 | |||
| 1944 | Ga0207687_10423700 | |||
| 1945 | Ga0207687_10841638 | |||
| 1946 | Ga0207687_11521695 | |||
| 1947 | Ga0207687_11708103 | |||
| 1948 | Ga0207700_10416377 | |||
| 1949 | Ga0207700_10791221 | |||
| 1950 | Ga0207664_10033314 | |||
| 1951 | Ga0207664_10095633 | |||
| 1952 | Ga0207664_10142050 | |||
| 1953 | Ga0207664_10222265 | |||
| 1954 | Ga0207664_10240069 | |||
| 1955 | Ga0207664_10383061 | |||
| 1956 | Ga0207664_10832798 | |||
| 1957 | Ga0207644_11335499 | |||
| 1958 | Ga0207690_10571984 | |||
| 1959 | Ga0207706_10342978 | |||
| 1960 | Ga0207686_10112002 | |||
| 1961 | Ga0207686_10125432 | |||
| 1962 | Ga0207686_10162485 | |||
| 1963 | Ga0207686_10570264 | |||
| 1964 | Ga0207709_10069478 | |||
| 1965 | Ga0207709_10119363 | |||
| 1966 | Ga0207709_10155277 | |||
| 1967 | Ga0207709_10232971 | |||
| 1968 | Ga0207709_10263083 | |||
| 1969 | Ga0207709_10273851 | |||
| 1970 | Ga0207709_10803658 | |||
| 1971 | Ga0207670_10014455 | |||
| 1972 | Ga0207670_10823824 | |||
| 1973 | Ga0207669_10162245 | |||
| 1974 | Ga0207704_10118772 | |||
| 1975 | Ga0207665_10004586 | |||
| 1976 | Ga0207665_10010758 | |||
| 1977 | Ga0207665_10054526 | |||
| 1978 | Ga0207665_10086520 | |||
| 1979 | Ga0207665_10140452 | |||
| 1980 | Ga0207665_11183908 | |||
| 1981 | Ga0207691_10017674 | |||
| 1982 | Ga0207691_10297260 | |||
| 1983 | Ga0207691_10338873 | |||
| 1984 | Ga0207711_10249995 | |||
| 1985 | Ga0207711_10830584 | |||
| 1986 | Ga0207689_10127340 | |||
| 1987 | Ga0207661_10000326 | |||
| 1988 | Ga0207661_10040652 | |||
| 1989 | Ga0207661_10055471 | |||
| 1990 | Ga0207661_10068582 | |||
| 1991 | Ga0207661_10831596 | |||
| 1992 | Ga0207661_10951577 | |||
| 1993 | Ga0207679_10188839 | |||
| 1994 | Ga0207679_11247574 | |||
| 1995 | Ga0207679_11357765 | |||
| 1996 | Ga0207667_10042798 | |||
| 1997 | Ga0207667_10107678 | |||
| 1998 | Ga0207667_10122160 | |||
| 1999 | Ga0207667_10181302 | |||
| 2000 | Ga0207667_10211870 | |||
| 2001 | Ga0207667_10212183 | |||
| 2002 | Ga0207667_10446039 | |||
| 2003 | Ga0207667_10697762 | |||
| 2004 | Ga0207667_11799391 | |||
| 2005 | Ga0207651_10220248 | |||
| 2006 | Ga0207651_10803230 | |||
| 2007 | Ga0207712_10074120 | |||
| 2008 | Ga0207712_10491417 | |||
| 2009 | Ga0207640_10053830 | |||
| 2010 | Ga0207640_10182053 | |||
| 2011 | Ga0207640_11549665 | |||
| 2012 | Ga0207658_10004832 | |||
| 2013 | Ga0207658_10148116 | |||
| 2014 | Ga0207677_10015265 | |||
| 2015 | Ga0207677_10022503 | |||
| 2016 | Ga0207677_10060395 | |||
| 2017 | Ga0207677_10063219 | |||
| 2018 | Ga0207677_10181778 | |||
| 2019 | Ga0207677_10332586 | |||
| 2020 | Ga0207703_10764948 | |||
| 2021 | Ga0207639_10701075 | |||
| 2022 | Ga0207639_11409935 | |||
| 2023 | Ga0207708_10000563 | |||
| 2024 | Ga0207708_10011914 | |||
| 2025 | Ga0207708_10022231 | |||
| 2026 | Ga0207702_10193158 | |||
| 2027 | Ga0207702_10246673 | |||
| 2028 | Ga0207702_10256646 | |||
| 2029 | Ga0207702_11406172 | |||
| 2030 | Ga0207702_11849879 | |||
| 2031 | Ga0207641_11029295 | |||
| 2032 | Ga0207648_10034191 | |||
| 2033 | Ga0207648_10081001 | |||
| 2034 | Ga0207676_10251224 | |||
| 2035 | Ga0207674_10002539 | |||
| 2036 | Ga0207674_10019424 | |||
| 2037 | Ga0207674_10072841 | |||
| 2038 | Ga0207674_10190650 | |||
| 2039 | Ga0207674_10446731 | |||
| 2040 | Ga0207675_100021594 | |||
| 2041 | Ga0207675_100066350 | |||
| 2042 | Ga0207683_10001199 | |||
| 2043 | Ga0207683_10016391 | |||
| 2044 | Ga0207683_10027770 | |||
| 2045 | Ga0207683_10041472 | |||
| 2046 | Ga0207683_10448683 | |||
| 2047 | Ga0209983_1070447 | |||
| 2048 | Ga0209998_10015612 | |||
| 2049 | Ga0207428_10013275 | |||
| 2050 | Ga0207428_10021472 | |||
| 2051 | Ga0207428_10169653 | |||
| 2052 | Ga0207428_10307414 | |||
| 2053 | Ga0207428_10308025 | |||
| 2054 | Ga0207428_10335298 | |||
| 2055 | Ga0207428_10441047 | |||
| 2056 | Ga0207428_10550923 | |||
| 2057 | Ga0268266_10109253 | |||
| 2058 | Ga0268265_10133985 | |||
| 2059 | Ga0268265_10495479 | |||
| 2060 | Ga0268264_10356041 | |||
| 2061 | Ga0265326_10073939 | |||
| 2062 | Ga0265318_10008580 | |||
| 2063 | Ga0265338_10090707 | |||
| 2064 | Ga0265338_10105966 | |||
| 2065 | Ga0265330_10037962 | |||
| 2066 | Ga0265332_10045862 | |||
| 2067 | Ga0265328_10059321 | |||
| 2068 | Ga0265320_10142303 | |||
| 2069 | Ga0265320_10197892 | |||
| 2070 | Ga0265329_10078919 | |||
| 2071 | Ga0265331_10097366 | |||
| 2072 | Ga0265327_10013725 | |||
| 2073 | Ga0265327_10434619 | |||
| 2074 | Ga0265316_10351250 | |||
| 2075 | Ga0307408_100266312 | |||
| 2076 | Ga0265313_10002660 | |||
| 2077 | Ga0265313_10106763 | |||
| 2078 | Ga0265314_10003929 | |||
| 2079 | Ga0265342_10021909 | |||
| 2080 | Ga0307405_10231428 | |||
| 2081 | Ga0307405_11920543 | |||
| 2082 | Ga0307413_11408303 | |||
| 2083 | Ga0307410_10078762 | |||
| 2084 | Ga0307406_10089339 | |||
| 2085 | Ga0307406_10766804 | |||
| 2086 | Ga0307407_10319100 | |||
| 2087 | Ga0307412_10161871 | |||
| 2088 | Ga0307412_10814367 | |||
| 2089 | Ga0307409_100190963 | |||
| 2090 | Ga0307409_100207612 | |||
| 2091 | Ga0307409_100822478 | |||
| 2092 | Ga0307416_100045501 | |||
| 2093 | Ga0307416_100104032 | |||
| 2094 | Ga0307416_100200676 | |||
| 2095 | Ga0307416_100556176 | |||
| 2096 | Ga0307416_100734655 | |||
| 2097 | Ga0307411_10185284 | |||
| 2098 | Ga0307411_11789552 | |||
| 2099 | Ga0307415_100098074 | |||
| 2100 | Ga0373948_0007313 | |||
| 2101 | Ga0373950_0000817 | |||
| 2102 | Ga0373958_0000854 | |||
| 2103 | Ga0373958_0071967 | |||
| 2104 | Ga0373938_0002204 | |||
| 2105 | Ga0373926_0028415 | |||
| 2106 | Ga0373926_0046649 | |||
| 2107 | Ga0373928_0021966 | |||
| 2108 | Ga0373929_0000828 | |||
| 2109 | Ga0373940_0001455 | |||
| 2110 | Ga0373944_0092162 | |||
| 2111 | Ga0373952_0001596 | |||
| 2112 | Ga0373923_0272686 | |||
| 2113 | Ga0373932_0002583 | |||
| 2114 | Ga0373936_0035715 | |||
| 2115 | Ga0373936_0160596 | |||
| 2116 | Ga0373939_0000760 | |||
| 2117 | Ga0373939_0519418 | |||
| 2118 | Ga0373941_0002021 | |||
| 2119 | Ga0373945_0005021 | |||
| 2120 | Ga0373945_0025445 | |||
| 2121 | Ga0373953_0205213 | |||
| 2122 | Ga0373956_0057187 | |||
| 2123 | Ga0373956_0284712 | |||
| 2124 | Ga0373960_0085538 | |||
| 2125 | Ga0373943_0019130 | |||
| 2126 | Ga0373943_0026389 | |||
| 2127 | Ga0373943_0236619 | |||
| 2128 | Ga0373946_0063292 | |||
| 2129 | Ga0373946_0106933 | |||
| 2130 | Ga0373946_0164950 | |||
| 2131 | Ga0373942_0151020 | |||
| 2132 | Ga0373962_0150607 | |||
| 2133 | Ga0373931_0001397 | |||
| 2134 | Ga0373931_0361673 | |||
| 2135 | Ga0373931_0864061 | |||
| 2136 | Ga0373935_0083863 | |||
| 2137 | Ga0373935_0177103 | |||
| 2138 | Ga0373935_0234191 | |||
| 2139 | Ga0373935_0499371 | |||
| 2140 | Ga0373935_0525297 | |||
| 2141 | Ga0373935_0629289 | |||
| 2142 | Ga0373935_0949816 | |||
| 2143 | Ga0373927_0207599 | |||
| 2144 | Ga0373927_0231641 | |||
| 2145 | Ga0373927_0250022 | |||
| 2146 | Ga0373947_0003591 | |||
| 2147 | Ga0373947_0018447 | |||
| 2148 | Ga0373947_0076657 | |||
| 2149 | Ga0373947_0090109 | |||
| 2150 | Ga0373947_0417308 | |||
| 2151 | Ga0373937_1167426 | |||
| 2152 | Ga0373925_0003351 | |||
| 2153 | Ga0373925_0060908 | |||
| 2154 | Ga0373925_0629143 | |||
| 2155 | Ga0373925_1016386 | |||
| 2156 | Ga0395899_0001940 | |||
| 2157 | Ga0395899_0005860 | |||
| 2158 | Ga0395899_0019594 | |||
| 2159 | Ga0395899_0031265 | |||
| 2160 | Ga0395899_0039406 | |||
| 2161 | Ga0395899_0059378 | |||
| 2162 | Ga0395899_0069771 | |||
| 2163 | Ga0395899_0174359 | |||
| 2164 | Ga0395899_0199998 | |||
| 2165 | Ga0395899_0200009 | |||
| 2166 | Ga0395899_0242067 | |||
| 2167 | Ga0395899_0350157 | |||
| 2168 | Ga0395899_0501994 | |||
| 2169 | Ga0395900_0005665 | |||
| 2170 | Ga0395900_0013360 | |||
| 2171 | Ga0395900_0018023 | |||
| 2172 | Ga0395900_0019727 | |||
| 2173 | Ga0395900_0025675 | |||
| 2174 | Ga0395900_0032072 | |||
| 2175 | Ga0395900_0033304 | |||
| 2176 | Ga0395900_0050786 | |||
| 2177 | Ga0395900_0058706 | |||
| 2178 | Ga0395900_0064573 | |||
| 2179 | Ga0395900_0074860 | |||
| 2180 | Ga0395900_0097035 | |||
| 2181 | Ga0395900_0165071 | |||
| 2182 | Ga0395900_0197925 | |||
| 2183 | Ga0395900_0236158 | |||
| 2184 | Ga0395900_0245716 | |||
| 2185 | Ga0395900_0249622 | |||
| 2186 | Ga0395900_0253738 | |||
| 2187 | Ga0395900_0257620 | |||
| 2188 | Ga0395900_0342409 | |||
| 2189 | Ga0395900_0352344 | |||
| 2190 | Ga0395900_0609743 | |||
| 2191 | Ga0395900_0830909 | |||
| 2192 | Ga0395900_0836718 | |||
| 2193 | Ga0395900_0953943 | |||
| 2194 | Ga0395900_1166334 | |||
| 2195 | Ga0395898_0003747 | |||
| 2196 | Ga0395898_0004192 | |||
| 2197 | Ga0395898_0006532 | |||
| 2198 | Ga0395898_0008911 | |||
| 2199 | Ga0395898_0012227 | |||
| 2200 | Ga0395898_0014362 | |||
| 2201 | Ga0395898_0016076 | |||
| 2202 | Ga0395898_0016548 | |||
| 2203 | Ga0395898_0017885 | |||
| 2204 | Ga0395898_0026455 | |||
| 2205 | Ga0395898_0030414 | |||
| 2206 | Ga0395898_0087595 | |||
| 2207 | Ga0395898_0184145 | |||
| 2208 | Ga0395898_0186144 | |||
| 2209 | Ga0395898_0317337 | |||
| 2210 | Ga0395898_0442628 | |||
| 2211 | Ga0395898_0457321 | |||
| 2212 | Ga0395898_0506138 | |||
| 2213 | Ga0395898_0563599 | |||
| 2214 | Ga0395898_0585789 | |||
| 2215 | Ga0395905_0009176 | |||
| 2216 | Ga0395905_0011659 | |||
| 2217 | Ga0395905_0012305 | |||
| 2218 | Ga0395905_0015313 | |||
| 2219 | Ga0395905_0016227 | |||
| 2220 | Ga0395905_0017447 | |||
| 2221 | Ga0395905_0020710 | |||
| 2222 | Ga0395905_0045418 | |||
| 2223 | Ga0395905_0074368 | |||
| 2224 | Ga0395905_0080172 | |||
| 2225 | Ga0395905_0090537 | |||
| 2226 | Ga0395905_0095568 | |||
| 2227 | Ga0395905_0105775 | |||
| 2228 | Ga0395905_0173934 | |||
| 2229 | Ga0395905_0198278 | |||
| 2230 | Ga0395905_0246649 | |||
| 2231 | Ga0395905_0250156 | |||
| 2232 | Ga0395905_0250506 | |||
| 2233 | Ga0395905_0369434 | |||
| 2234 | Ga0395905_0370634 | |||
| 2235 | Ga0395905_0797841 | |||
| 2236 | Ga0395901_0007305 | |||
| 2237 | Ga0395901_0008381 | |||
| 2238 | Ga0395901_0008807 | |||
| 2239 | Ga0395901_0009124 | |||
| 2240 | Ga0395901_0009722 | |||
| 2241 | Ga0395901_0010594 | |||
| 2242 | Ga0395901_0016666 | |||
| 2243 | Ga0395901_0019727 | |||
| 2244 | Ga0395901_0045672 | |||
| 2245 | Ga0395901_0066263 | |||
| 2246 | Ga0395901_0067281 | |||
| 2247 | Ga0395901_0073121 | |||
| 2248 | Ga0395901_0087756 | |||
| 2249 | Ga0395901_0088981 | |||
| 2250 | Ga0395901_0089871 | |||
| 2251 | Ga0395901_0101528 | |||
| 2252 | Ga0395901_0110460 | |||
| 2253 | Ga0395901_0134887 | |||
| 2254 | Ga0395901_0196847 | |||
| 2255 | Ga0395901_0208057 | |||
| 2256 | Ga0395901_0215078 | |||
| 2257 | Ga0395901_0262698 | |||
| 2258 | Ga0395901_0287639 | |||
| 2259 | Ga0395901_0337203 | |||
| 2260 | Ga0395901_0417104 | |||
| 2261 | Ga0395901_0462974 | |||
| 2262 | Ga0395901_0783748 | |||
| 2263 | Ga0395901_0843172 | |||
| 2264 | Ga0395901_0988584 | |||
| 2265 | Ga0395901_1053107 | |||
| 2266 | Ga0242422_03993 | |||
| 2267 | Ga0242420_003515 | |||
| 2268 | Ga0436365_1661088 | |||
| 2269 | Ga0436360_0869588 | |||
| 2270 | Ga0439438_170111 | |||
| 2271 | Ga0439439_0000609 | |||
| 2272 | Ga0451787_504694 | |||
| 2273 | Ga0451789_1348595 | |||
| 2274 | Ga0451791_0029882 | |||
| 2275 | Ga0451793_0388457 | |||
| 2276 | Ga0451795_1086781 | |||
| 2277 | Ga0451798_0656323 | |||
| 2278 | Ga0451802_1084932 | |||
| 2279 | Ga0451802_1879636 | |||
| 2280 | Ga0451802_2165544 | |||
| 2281 | Ga0451807_0686639 | |||
| 2282 | Ga0451839_0361804 | |||
| 2283 | Ga0451841_0140081 | |||
| 2284 | Ga0451841_1173093 | |||
| 2285 | Ga0451845_0813253 | |||
| 2286 | Ga0451849_0285293 | |||
| 2287 | Ga0451849_0920216 | |||
| 2288 | Ga0451851_1123922 | |||
| 2289 | Ga0451855_0770276 | |||
| 2290 | Ga0451853_1078149 | |||
| 2291 | Ga0451853_2987094 | |||
| 2292 | Ga0451853_3160310 | |||
| 2293 | Ga0439431_0104213 | |||
| 2294 | Ga0439433_0004556 | |||
| 2295 | Ga0439442_001947 | |||
| 2296 | Ga0439443_060296 | |||
| 2297 | Ga0439448_0004319 | |||
| 2298 | Ga0439448_0063090 | |||
| 2299 | Ga0439448_0078308 | |||
| 2300 | Ga0439450_026141 | |||
| 2301 | Ga0439450_031340 | |||
| 2302 | Ga0439450_042827 | |||
| 2303 | Ga0439455_0028173 | |||
| 2304 | Ga0439456_112548 | |||
| 2305 | Ga0439462_0003467 | |||
| 2306 | Ga0439463_037472 | |||
| 2307 | Ga0450915_005121 | |||
| 2308 | Ga0450888_000932 | |||
| 2309 | Ga0439446_0002878 | |||
| 2310 | Ga0439458_0004418 | |||
| 2311 | Ga0439458_0126975 | |||
| 2312 | Ga0450908_038111 | |||
| 2313 | Ga0439434_0026808 | |||
| 2314 | Ga0439434_0047178 | |||
| 2315 | Ga0439435_0111272 | |||
| 2316 | Ga0439444_0086232 | |||
| 2317 | Ga0439459_0008081 | |||
| 2318 | Ga0439464_0124129 | |||
| 2319 | Ga0439460_0066696 | |||
| 2320 | Ga0439460_0090270 | |||
| 2321 | Ga0450916_065751 | |||
| 2322 | Ga0450893_0044822 | |||
| 2323 | Ga0450893_0122499 | |||
| 2324 | Ga0439440_0107552 | |||
| 2325 | Ga0439440_0158982 | |||
| 2326 | Ga0439440_0171532 | |||
| 2327 | Ga0466969_0043984 | |||
| 2328 | Ga0466972_0504106 | |||
| 2329 | Ga0466965_0031336 | |||
| 2330 | Ga0466965_0132715 | |||
| 2331 | Ga0466965_0361847 | |||
| 2332 | Ga0466966_0023644 | |||
| 2333 | Ga0466961_0022243 | |||
| 2334 | Ga0466961_0094973 | |||
| 2335 | Ga0466961_0126523 | |||
| 2336 | Ga0466963_0010940 | |||
| 2337 | Ga0466963_0027690 | |||
| 2338 | Ga0466963_0033618 | |||
| 2339 | Ga0466963_0084509 | |||
| 2340 | Ga0466963_0113103 | |||
| 2341 | Ga0466963_0126260 | |||
| 2342 | Ga0466963_0194893 | |||
| 2343 | Ga0466963_0429750 | |||
| 2344 | Ga0466963_0477065 | |||
| 2345 | Ga0466963_0502089 | |||
| 2346 | Ga0466963_0527813 | |||
| 2347 | Ga0466963_0681302 | |||
| 2348 | Ga0466963_1109014 | |||
| 2349 | Ga0466964_0000847 | |||
| 2350 | Ga0466964_0017553 | |||
| 2351 | Ga0466964_0041876 | |||
| 2352 | Ga0466964_0072975 | |||
| 2353 | Ga0466964_0075329 | |||
| 2354 | Ga0466964_0157780 | |||
| 2355 | Ga0466964_0329124 | |||
| 2356 | Ga0466964_0377108 | |||
| 2357 | Ga0466964_0433643 | |||
| 2358 | Ga0466964_0817762 | |||
| 2359 | Ga0466971_0049704 | |||
| 2360 | Ga0466971_0057526 | |||
| 2361 | Ga0466971_0077519 | |||
| 2362 | Ga0466971_0160388 | |||
| 2363 | Ga0466968_0004269 | |||
| 2364 | Ga0466968_0060350 | |||
| 2365 | Ga0466968_0086909 | |||
| 2366 | Ga0466968_0219622 | |||
| 2367 | Ga0466968_0333740 | |||
| 2368 | Ga0466970_0105577 | |||
| 2369 | Ga0466970_0140890 | |||
| 2370 | Ga0466957_0097678 | |||
| 2371 | Ga0466957_0137844 | |||
| 2372 | Ga0466957_0510641 | |||
| 2373 | Ga0466957_0719304 | |||
| 2374 | Ga0466960_0006072 | |||
| 2375 | Ga0466960_0072631 | |||
| 2376 | Ga0466960_0080778 | |||
| 2377 | Ga0466959_0013052 | |||
| 2378 | Ga0466959_0024209 | |||
| 2379 | Ga0466959_0283191 | |||
| 2380 | Ga0451576_0102879 | |||
| 2381 | Ga0466958_0011139 | |||
| 2382 | Ga0466958_0041683 | |||
| 2383 | Ga0466958_0247779 | |||
| 2384 | Ga0466958_0318387 | |||
| 2385 | Ga0466958_0639699 | |||
| 2386 | Ga0466958_0668775 | |||
| 2387 | Ga0466958_1170482 | |||
| 2388 | Ga0466967_0001517 | |||
| 2389 | Ga0466967_0003014 | |||
| 2390 | Ga0466967_0009587 | |||
| 2391 | Ga0466967_0019987 | |||
| 2392 | Ga0466967_0027642 | |||
| 2393 | Ga0466967_0034503 | |||
| 2394 | Ga0466967_0059861 | |||
| 2395 | Ga0466967_0070363 | |||
| 2396 | Ga0466967_0131984 | |||
| 2397 | Ga0466967_0144149 | |||
| 2398 | Ga0466967_0230156 | |||
| 2399 | Ga0466967_0242257 | |||
| 2400 | Ga0466967_0366690 | |||
| 2401 | Ga0466967_0378173 | |||
| 2402 | Ga0466967_0380377 | |||
| 2403 | Ga0466967_0571103 | |||
| 2404 | Ga0466967_0679309 | |||
| 2405 | Ga0495617_129270 | |||
| 2406 | Ga0495627_046651 | |||
| 2407 | Ga0495592_0013250 | |||
| 2408 | Ga0495592_0396244 | |||
| 2409 | Ga0495603_0230307 | |||
| 2410 | Ga0495591_114714 | |||
| 2411 | Ga0495629_0162179 | |||
| 2412 | Ga0495629_0578436 | |||
| 2413 | Ga0495629_0601140 | |||
| 2414 | Ga0495641_0031218 | |||
| 2415 | Ga0495651_0013235 | |||
| 2416 | Ga0495651_0158078 | |||
| 2417 | Ga0495653_0154665 | |||
| 2418 | Ga0495580_0772573 | |||
| 2419 | Ga0495582_0049433 | |||
| 2420 | Ga0495582_0135521 | |||
| 2421 | Ga0495582_0272041 | |||
| 2422 | Ga0495582_0363573 | |||
| 2423 | Ga0495582_0501241 | |||
| 2424 | Ga0495605_0020917 | |||
| 2425 | Ga0495605_0052109 | |||
| 2426 | Ga0495605_0160231 | |||
| 2427 | Ga0495662_0040886 | |||
| 2428 | Ga0495662_0216451 | |||
| 2429 | Ga0495664_0170434 | |||
| 2430 | Ga0495664_0313245 | |||
| 2431 | Ga0495664_0415168 | |||
| 2432 | Ga0495584_0323274 | |||
| 2433 | Ga0495607_0117537 | |||
| 2434 | Ga0495608_0025716 | |||
| 2435 | Ga0495608_0080762 | |||
| 2436 | Ga0495608_0469645 | |||
| 2437 | Ga0495608_0927343 | |||
| 2438 | Ga0495618_0348671 | |||
| 2439 | Ga0495618_0577752 | |||
| 2440 | Ga0495628_0204430 | |||
| 2441 | Ga0495630_0035675 | |||
| 2442 | Ga0495630_0273920 | |||
| 2443 | Ga0495630_1254182 | |||
| 2444 | Ga0495631_0091583 | |||
| 2445 | Ga0495631_0208705 | |||
| 2446 | Ga0495637_0291252 | |||
| 2447 | Ga0495644_0081797 | |||
| 2448 | Ga0495644_0193093 | |||
| 2449 | Ga0495663_0163199 | |||
| 2450 | Ga0495663_0261587 | |||
| 2451 | Ga0495666_0012440 | |||
| 2452 | Ga0495642_0276926 | |||
| 2453 | Ga0495652_0237119 | |||
| 2454 | Ga0495652_0279879 | |||
| 2455 | Ga0495652_0353119 | |||
| 2456 | Ga0495652_0367160 | |||
| 2457 | Ga0495652_0687455 | |||
| 2458 | Ga0495665_0018007 | |||
| 2459 | Ga0495665_0561166 | |||
| 2460 | Ga0495640_0160889 | |||
| 2461 | Ga0495587_0378938 | |||
| 2462 | Ga0495609_0141382 | |||
| 2463 | Ga0495609_0374440 | |||
| 2464 | Ga0495645_0105036 | |||
| 2465 | Ga0495645_0269388 | |||
| 2466 | Ga0495667_0006310 | |||
| 2467 | Ga0495667_0073862 | |||
| 2468 | Ga0495667_0297333 | |||
| 2469 | Ga0495656_0186484 | |||
| 2470 | Ga0495656_0298901 | |||
| 2471 | Ga0495656_0323165 | |||
| 2472 | Ga0495668_0591482 | |||
| 2473 | Ga0495634_0098006 | |||
| 2474 | Ga0495634_0213970 | |||
| 2475 | Ga0495611_0071162 | |||
| 2476 | Ga0495611_0214336 | |||
| 2477 | Ga0495635_0083839 | |||
| 2478 | Ga0495635_0118680 | |||
| 2479 | Ga0495659_0022681 | |||
| 2480 | Ga0495588_0135252 | |||
| 2481 | Ga0495588_0135682 | |||
| 2482 | Ga0495657_0087951 | |||
| 2483 | Ga0495657_0257393 | |||
| 2484 | Ga0495623_0067800 | |||
| 2485 | Ga0495646_0150962 | |||
| 2486 | Ga0495647_0118589 | |||
| 2487 | Ga0495658_0018501 | |||
| 2488 | Ga0495658_0023792 | |||
| 2489 | Ga0495658_0058999 | |||
| 2490 | Ga0495658_0946840 | |||
| 2491 | Ga0495613_0143702 | |||
| 2492 | Ga0495613_0191297 | |||
| 2493 | Ga0495624_0151515 | |||
| 2494 | Ga0495624_0344591 | |||
| 2495 | Ga0495670_0235456 | |||
| 2496 | Ga0495589_0377270 | |||
| 2497 | Ga0495600_0418192 | |||
| 2498 | Ga0495581_0000868 | |||
| 2499 | Ga0495604_0947874 | |||
| 2500 | Ga0495636_0118234 | |||
| 2501 | Ga0495636_0324417 | |||
| 2502 | Ga0495674_0081351 | |||
| 2503 | Ga0495674_0171551 | |||
| 2504 | Ga0495674_0442190 | |||
| 2505 | Ga0495676_0018960 | |||
| 2506 | Ga0495676_0041793 | |||
| 2507 | Ga0495676_0257510 | |||
| 2508 | Ga0495676_0298717 | |||
| 2509 | Ga0495680_0014538 | |||
| 2510 | Ga0495680_0264282 | |||
| 2511 | Ga0495680_0492525 | |||
| 2512 | Ga0495680_0522511 | |||
| 2513 | Ga0495675_0784363 | |||
| 2514 | Ga0495677_0248158 | |||
| 2515 | Ga0495679_200978 | |||
| 2516 | Ga0495685_064047 | |||
| 2517 | Ga0495685_140167 | |||
| 2518 | Ga0495684_0023112 | |||
| 2519 | Ga0495602_0067084 | |||
| 2520 | Ga0495614_0059638 | |||
| 2521 | Ga0495614_0100970 | |||
| 2522 | Ga0495615_0049389 | |||
| 2523 | Ga0496100_0007025 | |||
| 2524 | Ga0496100_0066864 | |||
| 2525 | Ga0496100_0117670 | |||
| 2526 | Ga0496100_0148998 | |||
| 2527 | Ga0496100_0280718 | |||
| 2528 | Ga0496100_0341681 | |||
| 2529 | Ga0496100_0407491 | |||
| 2530 | Ga0496100_0752957 | |||
| 2531 | Ga0496100_1138886 | |||
| 2532 | Ga0496101_0005132 | |||
| 2533 | Ga0496101_0026950 | |||
| 2534 | Ga0496101_0082282 | |||
| 2535 | Ga0496101_0179138 | |||
| 2536 | Ga0496101_0232909 | |||
| 2537 | Ga0496101_0313287 | |||
| 2538 | Ga0496102_0020418 | |||
| 2539 | Ga0496102_0057361 | |||
| 2540 | Ga0496102_0084335 | |||
| 2541 | Ga0496102_0092105 | |||
| 2542 | Ga0496102_0590586 | |||
| 2543 | Ga0496102_0666377 | |||
| 2544 | Ga0496102_0940229 | |||
| 2545 | Ga0496102_1098188 | |||
| 2546 | Ga0496103_0008216 | |||
| 2547 | Ga0496103_0029843 | |||
| 2548 | Ga0496103_0049030 | |||
| 2549 | Ga0496103_0113212 | |||
| 2550 | Ga0496103_0219217 | |||
| 2551 | Ga0496103_0350328 | |||
| 2552 | Ga0496104_0013997 | |||
| 2553 | Ga0496104_0026648 | |||
| 2554 | Ga0496104_0117845 | |||
| 2555 | Ga0496104_0160532 | |||
| 2556 | Ga0496104_0325331 | |||
| 2557 | Ga0496104_0579283 | |||
| 2558 | Ga0496104_0889899 | |||
| 2559 | Ga0496104_1104840 | |||
| 2560 | Ga0496105_0016517 | |||
| 2561 | Ga0496105_0023998 | |||
| 2562 | Ga0496105_0074608 | |||
| 2563 | Ga0496105_0182990 | |||
| 2564 | Ga0496106_0136569 | |||
| 2565 | Ga0496106_0163600 | |||
| 2566 | Ga0496106_0197991 | |||
| 2567 | Ga0496106_0198964 | |||
| 2568 | Ga0496106_0468072 | |||
| 2569 | Ga0496107_0010371 | |||
| 2570 | Ga0496107_0011310 | |||
| 2571 | Ga0496107_0049067 | |||
| 2572 | Ga0496107_0143457 | |||
| 2573 | Ga0496107_0191775 | |||
| 2574 | Ga0496107_0573794 | |||
| 2575 | Ga0496107_0600311 | |||
| 2576 | Ga0496107_0802777 | |||
| 2577 | Ga0496107_0950419 | |||
| 2578 | Ga0496108_0035156 | |||
| 2579 | Ga0496108_0154131 | |||
| 2580 | Ga0496108_0278327 | |||
| 2581 | Ga0496108_0297963 | |||
| 2582 | Ga0496108_0335462 | |||
| 2583 | Ga0496108_0353376 | |||
| 2584 | Ga0496108_0392498 | |||
| 2585 | Ga0496108_0575434 | |||
| 2586 | Ga0496109_0011051 | |||
| 2587 | Ga0496109_0040435 | |||
| 2588 | Ga0496109_0043403 | |||
| 2589 | Ga0496109_0067879 | |||
| 2590 | Ga0496109_0115456 | |||
| 2591 | Ga0496109_0121599 | |||
| 2592 | Ga0496109_0147846 | |||
| 2593 | Ga0496109_0219127 | |||
| 2594 | Ga0496109_0232003 | |||
| 2595 | Ga0496109_0236783 | |||
| 2596 | Ga0496109_0304815 | |||
| 2597 | Ga0496109_0364995 | |||
| 2598 | Ga0496109_0490842 | |||
| 2599 | Ga0496109_0679168 | |||
| 2600 | Ga0496109_0825276 | |||
| 2601 | Ga0496109_0959138 | |||
| 2602 | Ga0496110_0046941 | |||
| 2603 | Ga0496110_0093561 | |||
| 2604 | Ga0496110_0120314 | |||
| 2605 | Ga0496110_0241553 | |||
| 2606 | Ga0496110_0279442 | |||
| 2607 | Ga0496110_0386203 | |||
| 2608 | Ga0496110_0419627 | |||
| 2609 | Ga0496110_0542167 | |||
| 2610 | Ga0496110_0547725 | |||
| 2611 | Ga0496110_1573298 | |||
| 2612 | Ga0496111_0024043 | |||
| 2613 | Ga0496111_0041866 | |||
| 2614 | Ga0496111_0043041 | |||
| 2615 | Ga0496111_0263696 | |||
| 2616 | Ga0496111_0264101 | |||
| 2617 | Ga0496111_0298877 | |||
| 2618 | Ga0496111_0362613 | |||
| 2619 | Ga0496111_0730041 | |||
| 2620 | Ga0496111_0888781 | |||
| 2621 | Ga0496112_0076547 | |||
| 2622 | Ga0496112_0082662 | |||
| 2623 | Ga0496112_0176601 | |||
| 2624 | Ga0496112_0236011 | |||
| 2625 | Ga0496112_0316455 | |||
| 2626 | Ga0496112_0369982 | |||
| 2627 | Ga0496112_0578579 | |||
| 2628 | Ga0496113_0016416 | |||
| 2629 | Ga0496113_0071693 | |||
| 2630 | Ga0496113_0109054 | |||
| 2631 | Ga0496113_0188759 | |||
| 2632 | Ga0496113_0209049 | |||
| 2633 | Ga0496113_0230149 | |||
| 2634 | Ga0496113_0257723 | |||
| 2635 | Ga0496113_0339712 | |||
| 2636 | Ga0496113_1305121 | |||
| 2637 | Ga0496114_0008715 | |||
| 2638 | Ga0496114_0010512 | |||
| 2639 | Ga0496114_0019327 | |||
| 2640 | Ga0496114_0070400 | |||
| 2641 | Ga0496114_0076084 | |||
| 2642 | Ga0496114_0221454 | |||
| 2643 | Ga0496114_0240604 | |||
| 2644 | Ga0496114_0311310 | |||
| 2645 | Ga0496114_0787506 | |||
| 2646 | Ga0496114_0919016 | |||
| 2647 | Ga0496114_0968841 | |||
| 2648 | Ga0496115_0003388 | |||
| 2649 | Ga0496115_0014734 | |||
| 2650 | Ga0496115_0076556 | |||
| 2651 | Ga0496115_0095042 | |||
| 2652 | Ga0496115_0134589 | |||
| 2653 | Ga0496115_0239836 | |||
| 2654 | Ga0496115_0253968 | |||
| 2655 | Ga0501031_0003798 | |||
| 2656 | Ga0501031_0015280 | |||
| 2657 | Ga0501032_0004530 | |||
| 2658 | Ga0501032_0010424 | |||
| 2659 | Ga0501032_0835313 | |||
| 2660 | Ga0501033_0015994 | |||
| 2661 | Ga0501034_0014020 | |||
| 2662 | Ga0501036_0004028 | |||
| 2663 | Ga0501036_0034540 | |||
| 2664 | Ga0501036_0175744 | |||
| 2665 | Ga0501037_0001346 | |||
| 2666 | Ga0501037_0010849 | |||
| 2667 | Ga0501038_0003128 | |||
| 2668 | Ga0501038_0028881 | |||
| 2669 | Ga0501039_0069173 | |||
| 2670 | Ga0501039_0070088 | |||
| 2671 | Ga0501039_1081270 | |||
| 2672 | Ga0501040_0011794 | |||
| 2673 | Ga0501040_0031310 | |||
| 2674 | Ga0501040_0091243 | |||
| 2675 | Ga0501040_0394173 | |||
| 2676 | Ga0501041_0040776 | |||
| 2677 | Ga0501041_0129841 | |||
| 2678 | Ga0501041_0320054 | |||
| 2679 | Ga0501041_0736857 | |||
| 2680 | Ga0501042_0005516 | |||
| 2681 | Ga0501042_0095228 | |||
| 2682 | Ga0501042_0388049 | |||
| 2683 | Ga0501042_0467255 | |||
| 2684 | Ga0501042_0519014 | |||
| 2685 | Ga0501043_0010883 | |||
| 2686 | Ga0501043_0036692 | |||
| 2687 | Ga0501043_0192479 | |||
| 2688 | Ga0501046_0002682 | |||
| 2689 | Ga0501046_0027463 | |||
| 2690 | Ga0501046_0343323 | |||
| 2691 | Ga0501047_0031585 | |||
| 2692 | Ga0501047_0131362 | |||
| 2693 | Ga0501048_0011343 | |||
| 2694 | Ga0501048_0052643 | |||
| 2695 | Ga0501067_0000018 | |||
| 2696 | Ga0501067_0000043 | |||
| 2697 | Ga0501067_0053936 | |||
| 2698 | Ga0501067_0323688 | |||
| 2699 | Ga0501067_0588167 | |||
| 2700 | Ga0501068_0000161 | |||
| 2701 | Ga0501068_0002637 | |||
| 2702 | Ga0501068_0005381 | |||
| 2703 | Ga0501068_0149947 | |||
| 2704 | Ga0501068_0236218 | |||
| 2705 | Ga0501068_0678386 | |||
| 2706 | Ga0501068_1022757 | |||
| 2707 | Ga0501069_0000286 | |||
| 2708 | Ga0501069_0002442 | |||
| 2709 | Ga0501069_0003827 | |||
| 2710 | Ga0501069_0010207 | |||
| 2711 | Ga0501069_0051697 | |||
| 2712 | Ga0501069_0260352 | |||
| 2713 | Ga0501070_0002395 | |||
| 2714 | Ga0501070_0008310 | |||
| 2715 | Ga0501070_0074343 | |||
| 2716 | Ga0501070_0529840 | |||
| 2717 | Ga0501070_0626780 | |||
| 2718 | Ga0501071_0002202 | |||
| 2719 | Ga0501071_0043650 | |||
| 2720 | Ga0501071_0054335 | |||
| 2721 | Ga0501071_0526302 | |||
| 2722 | Ga0501072_0063536 | |||
| 2723 | Ga0501072_0077783 | |||
| 2724 | Ga0501072_0302291 | |||
| 2725 | Ga0501073_0004308 | |||
| 2726 | Ga0501073_0077338 | |||
| 2727 | Ga0501073_0665565 | |||
| 2728 | Ga0501074_0067464 | |||
| 2729 | Ga0501074_0082815 | |||
| 2730 | Ga0501074_0096410 | |||
| 2731 | Ga0501074_0173871 | |||
| 2732 | Ga0501075_0050264 | |||
| 2733 | Ga0501075_0065557 | |||
| 2734 | Ga0501075_0302685 | |||
| 2735 | Ga0501075_0411955 | |||
| 2736 | Ga0501076_0003583 | |||
| 2737 | Ga0501076_0013986 | |||
| 2738 | Ga0501076_0033114 | |||
| 2739 | Ga0501076_0033754 | |||
| 2740 | Ga0501076_0275579 | |||
| 2741 | Ga0501076_0691434 | |||
| 2742 | Ga0501077_0003014 | |||
| 2743 | Ga0501077_0081550 | |||
| 2744 | Ga0501077_0124262 | |||
| 2745 | Ga0501077_0525475 | |||
| 2746 | Ga0501079_0005345 | |||
| 2747 | Ga0501079_0097510 | |||
| 2748 | Ga0501079_0228665 | |||
| 2749 | Ga0501079_0455359 | |||
| 2750 | Ga0501079_0661662 | |||
| 2751 | Ga0501079_0710330 | |||
| 2752 | Ga0501080_0004462 | |||
| 2753 | Ga0501080_0014549 | |||
| 2754 | Ga0501080_0017828 | |||
| 2755 | Ga0501080_0496176 | |||
| 2756 | Ga0501081_0007101 | |||
| 2757 | Ga0501081_0028955 | |||
| 2758 | Ga0501081_0127918 | |||
| 2759 | Ga0501081_0302424 | |||
| 2760 | Ga0501081_0501822 | |||
| 2761 | Ga0501081_0744651 | |||
| 2762 | Ga0501083_0000504 | |||
| 2763 | Ga0501083_0002288 | |||
| 2764 | Ga0501035_0001724 | |||
| 2765 | Ga0501035_0005345 | |||
| 2766 | Ga0501035_0380752 | |||
| 2767 | Ga0501044_0119076 | |||
| 2768 | Ga0501044_0189926 | |||
| 2769 | Ga0501045_0005671 | |||
| 2770 | Ga0501045_0019593 | |||
| 2771 | Ga0501045_0118894 | |||
| 2772 | Ga0501045_0221787 | |||
| 2773 | nmdc:mga05p37_221536_c1 | |||
| 2774 | nmdc:mga05p37_249737_c1 | |||
| 2775 | nmdc:mga05p37_276752_c1 | |||
| 2776 | nmdc:mga05p37_304773_c1 | |||
| 2777 | nmdc:mga05p37_581007_c1 | |||
| 2778 | nmdc:mga05p37_59343_c1 | |||
| 2779 | nmdc:mga05p37_61186_c1 | |||
| 2780 | nmdc:mga05p37_762516_c1 | |||
| 2781 | nmdc:mga05p37_78557_c1 | |||
| 2782 | nmdc:mga09592_245893_c1 | |||
| 2783 | nmdc:mga09592_269491_c1 | |||
| 2784 | nmdc:mga09592_528256_c1 | |||
| 2785 | nmdc:mga09592_90669_c1 | |||
| 2786 | nmdc:mga0qj67_156000_c1 | |||
| 2787 | nmdc:mga06r32_119803_c1 | |||
| 2788 | nmdc:mga06r32_19413_c1 | |||
| 2789 | nmdc:mga06r32_912014_c1 | |||
| 2790 | nmdc:mga08y16_322950_c1 | |||
| 2791 | nmdc:mga08y16_325918_c1 | |||
| 2792 | nmdc:mga08y16_34368_c1 | |||
| 2793 | nmdc:mga08y16_40602_c1 | |||
| 2794 | nmdc:mga08y16_633725_c1 | |||
| 2795 | nmdc:mga08y16_823367_c1 | |||
| 2796 | nmdc:mga08y16_973209_c1 | |||
| 2797 | nmdc:mga0n895_1311314_c1 | |||
| 2798 | nmdc:mga0n895_175464_c1 | |||
| 2799 | nmdc:mga0n895_184995_c1 | |||
| 2800 | nmdc:mga0n895_355650_c1 | |||
| 2801 | nmdc:mga0n895_38675_c1 | |||
| 2802 | nmdc:mga0n895_50477_c1 | |||
| 2803 | nmdc:mga0n895_657581_c1 | |||
| 2804 | nmdc:mga0rr50_178493_c1 | |||
| 2805 | nmdc:mga0rr50_190484_c1 | |||
| 2806 | nmdc:mga0rr50_191937_c1 | |||
| 2807 | nmdc:mga0rr50_250762_c1 | |||
| 2808 | nmdc:mga0rr50_6190_c1 | |||
| 2809 | nmdc:mga0rr50_63031_c1 | |||
| 2810 | nmdc:mga0rr50_69825_c1 | |||
| 2811 | nmdc:mga08x19_12299_c1 | |||
| 2812 | nmdc:mga08x19_12301_c1 | |||
| 2813 | nmdc:mga08x19_44327_c1 | |||
| 2814 | nmdc:mga08x19_452140_c1 | |||
| 2815 | nmdc:mga08x19_660532_c1 | |||
| 2816 | nmdc:mga08x19_75235_c1 | |||
| 2817 | nmdc:mga0a205_124147_c1 | |||
| 2818 | nmdc:mga0a205_168641_c1 | |||
| 2819 | nmdc:mga0a205_221004_c1 | |||
| 2820 | nmdc:mga0a205_29263_c1 | |||
| 2821 | nmdc:mga0a205_299559_c1 | |||
| 2822 | nmdc:mga0a205_62006_c1 | |||
| 2823 | nmdc:mga0a205_67173_c1 | |||
| 2824 | nmdc:mga0a205_80998_c1 | |||
| 2825 | Ga0495601_0016899 | |||
| 2826 | Ga0495601_0166305 | |||
| 2827 | Ga0495601_0176904 | |||
| 2828 | Ga0495601_0180551 | |||
| 2829 | Ga0495601_0470284 | |||
| 2830 | Ga0495612_0068571 | |||
| 2831 | Ga0495612_0274688 | |||
| 2832 | Ga0495655_0000869 | |||
| 2833 | Ga0495595_0009513 | |||
| 2834 | Ga0495595_0027753 | |||
| 2835 | Ga0495595_0654230 | |||
| 2836 | Ga0495619_0027019 | |||
| 2837 | Ga0501084_0009042 | |||
| 2838 | Ga0501084_0071982 | |||
| 2839 | Ga0501084_0174171 | |||
| 2840 | Ga0501084_0216422 | |||
| 2841 | Ga0501084_0292581 | |||
| 2842 | Ga0501084_0532896 | |||
| 2843 | Ga0587073_0175252 | |||
| 2844 | Ga0587077_044317 | |||
| 2845 | Ga0587077_123958 | |||
| 2846 | Ga0587082_016692 | |||
| 2847 | Ga0587083_0074244 | |||
| 2848 | Ga0587083_0242280 | |||
| 2849 | Ga0587088_036441 | |||
| 2850 | Ga0587088_061728 | |||
| 2851 | Ga0587090_060446 | |||
| 2852 | Ga0587094_093420 | |||
| 2853 | Ga0587099_030972 | |||
| 2854 | Ga0587101_068974 | |||
| 2855 | Ga0587128_091006 | |||
| 2856 | Ga0587067_051046 | |||
| 2857 | Ga0587114_051410 | |||
| 2858 | Ga0587071_044473 | |||
| 2859 | Ga0587111_0251542 | |||
| 2860 | Ga0501082_0014408 | |||
| 2861 | Ga0501082_0073390 | |||
| 2862 | Ga0501082_0129571 | |||
| 2863 | Ga0501082_0144350 | |||
| 2864 | Ga0501082_0526563 | |||
| 2865 | Ga0501082_0779018 | |||
| 2866 | Ga0466962_0024344 | |||
| 2867 | Ga0466962_0240545 | |||
| 2868 | Ga0466962_0412461 | |||
| 2869 | Ga0530510_0003434 | |||
| 2870 | Ga0530510_0024990 | |||
| 2871 | Ga0530510_0096661 | |||
| 2872 | Ga0530510_0292182 | |||
| 2873 | Ga0530510_0328875 | |||
| 2874 | Ga0530510_0338454 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2cwa-assembly1.cif.gz_A | crystal structure of the single-stranded dna binding protein from thermus thermophilus hb8 | 0.9603 | 4 | 108 |
| 6bhw-assembly2.cif.gz_E | b. subtilis ssba | 0.9508 | 4 | 108 |
| 3tqy-assembly1.cif.gz_D | structure of a single-stranded dna-binding protein (ssb), from coxiella burnetii | 0.9461 | 3 | 109 |
| 6bhw-assembly1.cif.gz_A | b. subtilis ssba | 0.9415 | 4 | 110 |
| 5odn-assembly1.cif.gz_D | salinibacter ruber single-strand binding protein | 0.9403 | 1 | 108 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2G112_1_115_2.40.50.140 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.9126 | 4 | 111 | 2.40.50.140 |
| 5odnH00 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.8994 | 1 | 108 | 2.40.50.140 |
| 6bhwF00 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.8925 | 4 | 107 | 2.40.50.140 |
| af_F1QB63_52_370_1.25.40.20 | Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Ankyrin repeat-containing domain | 0.8866 | 32 | 55 | 1.25.40.20 |
| af_C4J9S9_72_176_2.40.50.140 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.8865 | 1 | 111 | 2.40.50.140 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7V4AAE6-F1-model_v4 | Single-stranded DNA-binding protein (SSB) | 0.9301 | 4 | 109 |
GO:0003697
GO:0006260 GO:0009295 |
| AF-A0A0G1IEC5-F1-model_v4 | Single-stranded DNA-binding protein (SSB) | 0.9254 | 4 | 115 |
GO:0003697
GO:0006260 GO:0009295 |
| AF-A0A2V9H5Y2-F1-model_v4 | Single-stranded DNA-binding protein | 0.9252 | 3 | 112 |
GO:0003697
GO:0006260 GO:0009295 |
| AF-A0A1Y4R849-F1-model_v4 | Single-stranded DNA-binding protein | 0.9213 | 4 | 108 |
GO:0003697
GO:0006260 |
| AF-A0A7C5RVI8-F1-model_v4 | Single-stranded DNA-binding protein (SSB) | 0.9194 | 4 | 111 |
GO:0003697
GO:0006260 GO:0009295 |